4CO3A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
104
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and thermodynamics of effector molecule binding to the nitrogen signal transduction PII protein GlnZ from Azospirillum brasilense.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
total genus 18
structure length 104
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co3A00
4RLEA 4Y65A 1GNKA 4USHA 4CO1A 3M05A 4RWXA 5DS7A 1QY7A 3NCPA 1NAQA 4CO4A 3TA2A 1V3SA 2Z0GA 3AHPA 2E66A 3NCQA 2NS1B 1HWUA 3O5TB 4CNYA 1NH7A 4ZK7M 2XULA 1UMJA 4RX6A 2VD3A 3NCRA 4AFFA 3HLUA 4Y6IA 1Q1KA 1XK8A 1VFJA 1UL3A 1O5JA 2J9EA 5D4NA 3T9ZA 3TA0A 3AH6A 1OSCA 4USJC 5D4OA 4USIA 2ZFHA 4C3KA 1O51A 4RWWA 4YB7A 1NH8A 2PIIA 2ZOMA 1P1LA 5D4LA 4R25A 2GW8A 3X3UA 4OZNA 4C3MA 4WK1A 2NUHA 3CE8A 2DCLA 4C3LA 2CZ4A 3AA8A 1NZAA 2NUUG 1V9OA 5DRKA 2EG2A 2JJ4D 4YB6A 4CO5A 4IYQA 1VHFA 4CNZA 4NYOA 4D3GA 2J9DA 2XBPA 2O66A 4OZLA 4E98A 4WK3A 1V6HA 2GNKA 1J2VA 3TA1A 3MHYA 4YB5A 1UFLA 4NYPA 5D4PA 3GSDA 3BZQA 4CO3A 3L7PA 2GX8A 2J9DE 3O8WA 2RD5C 3DFEA 3AA9A 1PILA 4CO0A 3N5BA 4CO2A 1V3RA 4D3HA 1KR4A 3OPKA 2XZWA 1UKUA 2J9CA 1H3DA 3LF0A 2XG8A 2V5HG 2O67A 5L9NA 2EG1A 4OZJA
chains in the Genus database with same CATH superfamily
1RAEB 3EGNA 1S1XB 5HO4A 1TKDA 2F4VF 3HVTB 2UXCJ 4QIFA 4ZJLA 4IQXA 1NM2A 1X5SA 2PMHA 5F3ZA 4OJHA 1YLXA 5DDOC 1VBZA 1LKZA 3ZZUA 2IDEA 1WG4A 7FD1A 2MKIA 3KG0A 1VK8A 2MDAA 3T5KA 1FKAF 4OI1A 3HDSA 3TX0A 4XK8C 1TELA 2KFYA 4LFCF 2ZH6A 1VR6A 2UUBF 2VF3A 4J7CA 3BGUA 4ZPTR 3C6UB 3OHBA 2WOMB 3S1TA 2P9CA 2LLZA 2PD1A 1YX2A 3R5AA 2IRXA 2BQUA 3DLLQ 4HT5A 2HHUA 4ZK7M 1RWPB 4K5SA 2G0IA 3CJ4A 3POTB 2R9LA 1IBKF 3W64A 2PI4A 4U96A 2DGWA 3RW7A 2V2VA 4NLXA 5B09A 1HW8A 2OPSB 4UOHA 2J9EA 4DG1A 3CC4S 2AP6A 2R2RA 2H1YA 4K50A 2F40A 3QQCD 2L9NA 3LP0A 3HT0A 1HNXJ 1QSSA 4M63A 4LR9A 3TZYA 1FHTA 5EN1A 3DLEB 3MMAB 2DNMA 5HJXA 4DV1J 4QYZK 4A8SA 1KDNA 1VYAA 3SV4A 4PUOB 1JLFB 2DJWA 5LSOA 2COLA 1JKHB 3BF4A 3IS9B 1P1LA 5GAEU 1NK5A 1WI8A 3O1LA 1MWYA 2B9YA 3W61A 1QE1A 1UW4A 5FLXY 3MR7A 1T94A 5DDPC 4C8NA 2HNDB 2U2FA 4O0IA 2Z58B 4XAKA 1M90T 3NWGA 2DNKA 1UJ6A 4WFZA 1HMVA 3M6WA 3M8PB 3MMCA 2HHHJ 4UY8T 1TKXA 1E6VB 4IR9A 1ZPWX 2ZNYA 3TJ9A 2AEMA 2XO6A 3M32B 4KHRA 3EZUA 2R7SA 2Q1LA 5KFZA 5A8WB 1FXDA 4KGKA 1L3VA 1SI9A 3CTRA 4QR2A 4U67Q 2YWKA 3Q8YA 1IR1A 3H98A 4JI8F 4XPCA 4ILRA 2LEPA 4NA2A 4NYZA 4NXNF 1ZM9A 1HYSB 4OJGA 2W7OA 1AFIA 1JJHA 2VKRA 4LF4F 2E5GA 3PM9A 1FWPA 1XEZA 2IVFB 4PUOA 2B9EA 4HL9A 4ED4A 1RAGB 5KFKA 1VK3A 4MFBA 1EZZB 4MMOA 2KM8C 3MFIA 5CAAA 4R0EA 2V0NA 2G1DA 2M0GB 1BGXT 4E0DA 2A6MA 2DHSA 2O3DA 5KG1A 4OX8A 4PWWA 1X4EA 2ZWOA 1IBMJ 1S79A 3Q8PB 2VB6A 2I5JA 2XSJB 4YS2A 3CCJS 1IBLF 2HHHF 5C25B 3MECA 1U6BA 3GSDA 1IM6A 3FFIB 2DNPA 2OSRA 1D8ZA 3R5BA 4DL0C 2XLIA 1UW9A 3K0JA 3NXZA 1F5AA 4A8YA 3L7PA 2CXEA 2F7VA 2BKNA 2C3MA 4BDPA 2HNYA 2XMAA 5HLFA 5D0GA 3R2CJ 2IVYA 3NS6A 2WB1D 3DFEA 3AA9A 1D1UA 3DGVA 2B3TB 1EIYB 1IJFB 1KVKA 1CULB 1U09A 1WKLA 3HJVA 4IDKA 2W4DA 1T02A 1UKUA 4WE1B 1JXLA 1H3DA 1BY9A 3U02A 2RQCA 1FKOB 4OYOA 1IBMF 1FD8A 2HQGA 2EI5A 1S9EA 2YQ1A 4NLRA 2W2PP 1NNDA 2PEHA 3H4DA 2GGPA 3RBZA 2MLZA 4CH1A 2CDQA 2JZ5A 3TI0A 1FT8A 4F2RA 3T6BA 1S0VA 2EFPA 2GVDB 3CCZA 1KN6A 1S9GB 3NNHA 3P49B 3JSYA 1VQKS 4JI0F 3ZXWA 3IM9A 4OQJA 4RWXA 3PZPA 1Z1ZA 2F8MA 3PW5A 1CQNA 4F4XA 4USVA 3BSCA 1IKXB 3QLHB 5B0CA 2ZNZA 4MYUA 3W9JA 1IQTA 1TKZB 4P6QA 4GC7A 1SH2A 4H4OB 2MQOA 3QGGA 1C0TB 3OTEA 5D15A 3KTQA 1NPPA 1RHUB 2X7IA 3UQSA 1T05B 1I94J 4NLDA 4DU7A 4YN3B 4ECUA 2OPQA 1W25A 4PG7A 2MQPA 4NEYA 2KJVA 1T9XA 1PC5A 1WHYA 2AX1A 2VFSA 3DRPB 1S1VA 4LJMA 2ZWPA 4O3SA 2HRUA 4Q44A 1KVJA 1HA1A 2CQHA 3GJQB 4M5DA 3AQOA 3CCVS 2IAJA 3DLGB 4DSFA 2AYGA 2D3UA 3AY0A 4RBUA 3MR3A 1LK7A 3R5GA 4HHHA 5J1EB 2KH9A 3IN5A 3AD7C 1OSDA 1SJ4P 4ZJQA 2E1PA 2GO8A 4X4RA 4RW9A 4M1KA 2DGOA 4QR1A 3HFZB 2C3PA 4ZCKA 2R7XA 3OTDA 1OSCA 2G2OA 5D4OA 2MQLA 2V63A 2V2KA 2CQPA 4M8LA 4F4WA 4JI0J 4FPRA 4QPTA 3J80U 1JWWA 2EWHA 4J37A 4L6V3 3GE9A 1X4CA 1U0SA 4Y34A 1GT8A 1FNOA 3QATA 2ZVSA 2NLWA 2QLBB 2A6OA 4DSIA 2UXDF 1BUXA 3C15B 3H59A 3BO2A 4DV6F 3FEXB 1YVFA 4NI2A 2DXDA 3BH6B 3IR7B 3MCOA 2NPFA 1T7PA 1KTVA 1LW2A 1S6PB 2VKZG 4I2QA 3HFKA 3UVJB 1VQ5S 1IXKA 1RK8A 3T5JA 4ZVTB 2ZJRQ 3N6LA 1Z2LA 2HQCA 4J9VA 3ZFVA 4CZCA 3QAEA 2DRBA 1GXUA 2YTCA 2KVQE 1T8EA 2YXLA 1FDDA 4FDFA 4AYBD 2C28A 2MZSA 2LXUA 1HBUA 3F41A 1OS5A 4DZDA 1T95A 3LP1B 1SV5A 1M0SA 2M2BA 1VCTA 3OTOF 4KGVB 1CULA 1HWLA 4R0JA 5CZVA 4N41A 4AQYF 1CJVA 1YJRA 5SZTA 5DGBA 1CPZA 2IM1A 2KM8B 4LF7J 1D3WA 2D9OA 5KFXA 4PAAA 1S6QA 1YK9A 2HFOA 4ICLA 1VHFA 1BWVA 1KFDA 2DNLA 3HSZA 2ATLA 4K4ZA 2Z8QA 3HM9A 2DR6A 3CIZA 3MM9A 5GADI 4DS4A 3CCWA 2XSFA 4QBUA 1U45A 3B78A 3D7SB 4ZLJA 1B7FA 2OTJS 5DZ7A 1OQ6A 4X4TA 3PEJA 3FSIA 1M5PC 2W01A 2BJEA 3N0VA 3UD5A 4NRUA 2UXDJ 2I6WA 4LF6J 2LU2A 4PWDB 2DGVA 1J2VA 3MHYA 3AXMA 2YX7A 3D1QA 4XDCA 4JB8B 3CJKB 3L9ZA 4DR4J 1S1XA 4WYLA 3MXHP 2HQ3A 5KFSA 4WKRA 4OHXA 3VAJA 2BACA 4C8LA 1TKZA 4DPUA 1TL4A 4QW8A 4J9LA 1FCAA 5KFTA 5CA5A 4Y28C 1JJ4A 1MSWD 5J2NA 2RRNA 1HBUB 2CZVC 2OJ3A 5J1PA 1VS3A 3GTYX 3QRQA 1EX8A 2HK2A 1EP4A 5E3CA 1ZAXA 4A8OA 3N01A 4IG3A 1RAOA 2J0WA 3V2UC 3IWXA 2MSSA 2BOAA 1KR4A 3TQ1A 2VFTA 3EPGA 3GV7B 2HFZA 3RYLA 2Z30B 1XNRF 1RWMB 3CO0P 1S1TB 5I42B 3EM1A 3P8BB 1PYSB 2MKYA 4QCLA 2EBEA 4LT6A 1PGZA 1JMTA 4KC5A 2ZZMA 2ATCB 1RI7A 3D5MA 3BQ0A 5A6PA 3DXBA 4DR3F 4IOBA 3UPFA 1SKUB 4DSKA 3CIMA 4R5PA 4ZIVA 5F9LA 4B9TA 4BHQA 2JHEA 1DQAA 2K1RB 4ZMMA 4K4TA 1NK9A 3HZGA 2AGPA 3D3CJ 1PAUB 1WSVA 4RL1A 5I3UB 4I0WA 2B0GA 1H72C 1VISA 3UE2A 4IOAQ 2WVDA 4Z7CA 3VHQA 1S1UA 2HVZA 3K2YA 2F3JA 2UVWA 3PG9A 1SIZA 3EVMA 1Q53A 1N5QA 3LGNA 4MFBB 5E0OA 1ZM3A 3ET6B 1JLFA 1PAEX 1T9UA 2WCXA 4BC7A 3I55S 4DV2J 2HBYB 4DPWA 1RISA 2BRLA 2B6AB 4TLQA 4DU8A 3K57A 2EK1A 2OMLA 4B9NA 1QE1B 1TKTA 4JOUA 2XY5A 1W2BR 1RB0A 3OUYB 1O8BA 2WVBA 2YH0A 4NE9C 4TVAB 2XY7A 2HQFA 2ACYA 2MJUA 2G0JA 3G87A 4ID5B 3B8HA 4ZCIA 1FA0A 5D4NA 3WBZA 1QTMA 2IY5B 1DARA 3M32A 3K5OA 4LRCA 2GJFA 1X4DA 2XGQA 4QWAA 1KD1T 1DQ9A 3VAHA 1KP6A 2KYZA 3M8ZA 4UTGA 4OL8A 1CS4A 2CNLB 3SQOP 3R7NB 4BS2A 1EB0A 2Y3YA 4AL6A 4ILLA 3VV2B 2RF2A 3NAHA 4HI1A 2CA9A 3QT6A 1FEHA 3MM8B 3CCMS 1FI4A 1H98A 1SKRA 5DG7A 3TUPA 3D9BA 3CJKA 3K7RA 1NU4A 3TVKA 3QRRA 2RQKA 1L3UA 1RP5A 4F67A 3LP2B 1N34F 2P9EA 3EDQB 3V81B 3LP0B 2R7QA 5CCMA 1X9MA 2FJWA 3DXSX 1A0OB 1F5CA 4C7QA 2Q3PA 3D2WA 2HS4A 1CJTA 5AE1A 2R8JA 2MHEA 2W24A 4QU7A 3QIDA 5HP1A 3DDKA 3I9ZA 2CPZA 2HSEB 4Z37A 1C1BA 1X60A 3K59A 4A8WA 3G6ES 2NZ4A 1IBLJ 4F8RA 3P45B 4USUA 7FDRA 3B4MA 4GKJF 2XYGB 5EX3A 2ZVIA 2ASJA 2V8HA 4ZN1A 1R8AA 4QYZJ 2ALZA 5K8NA 1XMQJ 2UUCF 4ZDNA 1R7IA 2WW8A 2OD6A 4ITSA 4P9SA 3ENQA 4LRFA 1H38A 4KAIA 4B3RJ 2OKQA 5AT1B 1XTZA 3KLIB 3MD3A 3OL6A 3DGPA 4DV7J 4NCBA 4TYBA 3VZHA 3A8IA 5KG2A 5GAGI 4NLYA 4JI3F 2J0SD 3CD0A 5JMNA 2UXBF 5JXSA 1RE1B 3RAMA 2HVIA 1RA6A 4V19X 2K2PA 3R6GB 3MM7A 2QL7B 2DR7A 1VLYA 1ZZFA 3NNAA 4L3NA 4M5NA 3R9LA 4F2SA 1P9QC 4HKQA 4WP3A 4F02A 4RO0A 4NZ6A 2BJDA 3THPA 4PQUA 4JV5F 1SCJB 2VJUA 2GX8A 1FKPB 1LXJA 1NO8A 1RT3A 2NXJA 3ZO7A 1G7CB 3NAIA 2DXEA 2GV1A 2MKSA 2Z2ZA 2ZC3A 3CCTA 3DU6A 3GU0A 1PILA 3R27A 4DUTA 2ZD1B 5J1NA 3IAM9 4K59A 3HK2A 4FF1A 4URSA 4D3HA 2MLXA 3MDFA 1W26A 1KQGB 2IJNA 3DNCA 1FVQA 4UOFA 1TR0A 2G4BA 2JVOA 2O67A 3CWJA 3QWUA 3JQMA 2WBRA 3HD1A 1FK9A 4DLGA 1HNVB 3O44A 5AE2A 2YKAA 3DOLB 3KJQB 3SFUA 2HGLA 2J0XA 2DNNA 3Q8UA 2UXBJ 3W2VB 3JB9k 4I68A 3B6BA 5KFHA 4EBEA 2HHWA 2HFVA 4AE5A 2PMZD 1MU2A 2JVRA 3K8WA 3IMQJ 4WIIA 4CI0B 4DF4A 3ISZA 1HHSA 1R89A 1T9VA 1LQ9A 4LF9J 1TTHB 4RPFA 3QJLA 2B9XA 4LF4J 1AW0A 4F4KA 2OELA 3PEHA 4OHVA 3OW2R 2DR8A 4O4GA 2GQCA 4DR6J 1RT7A 2MQ8A 4CO4A 5HBMB 4CYUB 4OYXA 4S0MA 4YB1P 2CWXA 4J9UE 4X64F 2KG1A 1UVJA 2DNQA 3Q8SB 4EK2A 2LXIA 1WC4A 4MK9A 2YKNA 4HH0A 3M7VA 3SDEB 4DV1F 2DCUB 4DLEA 4C8OA 3OT9A 3UNGC 1Q1KA 2VDIA 3PHEA 4GRSA 4PXCA 2Q79A 3LGMA 1N5TA 1UTAA 2BJ8A 4P52A 2WONB 4Q43A 3D28A 5FDLA 3ENWA 4CH0S 4DJBA 1RWXB 4OLOA 5CCLA 3PR4A 4Q0BA 2VBWA 2OEKA 1IM4A 5HANA 2UP1A 2J7KA 5HL7Q 3VWSA 2C2KB 5KT3A 1U48A 3UNYA 2XWXA 4UUWA 2D41A 1UJ4A 3NNCA 3IM8A 1CLFA 2FHKA 1IJEB 3GCXP 3W1YC 3ZZOA 2K06A 4ANCA 3T5LA 4USJC 3CXCR 2OLWA 2QMUB 1PG5B 2DNRA 1NRKA 1Q7LB 2QN6B 1X4GA 4AL5A 1Q8KA 1YJ7A 4LR7A 1U1PA 4WU3A 4QZVB 2RT3A 2J6SA 2RNEA 1TFYA 1BWEA 2CIMA 4O4RA 1I5OB 1RTDB 3HSJA 2CG8A 3VCDA 1NSPA 3CVKA 4OZNA 3MM9B 2IBKA 3SDEA 1HNWF 2Y8YA 3MZIA 2F65A 2IYGA 5GADU 1IBCB 2JSXA 3GYNA 1DURA 4CDIA 1FNXH 3BSAA 2PFDA 4O23A 1TL1B 4AXJA 2RDIA 1YQHA 2A3JA 2YQ0A 1YRXA 2H54B 5JVHQ 4C8ZA 1ICEB 3HHLA 1BQMA 3MEKA 5AE3A 1XMOJ 4RW8B 1SH0A 2RHSB 5T7LA 2ZHAA 3OL9A 1RBLA 2ASLA 2VDHA 1SQGA 2J8SA 4ER8A 4X66J 3DMJA 4OZ5A 3SXLA 2ZH7A 2DKOB 5J2MA 3IP0A 1W7WA 1ZYQA 1CEZA 3DRYA 3EMTA 1RGVA 3BPSP 5F8MA 2V94A 5I3PA 3CPWR 1NK0A 3FBCA 5ETRA 4YY3J 2XMMA 2GA7A 4WK3A 1SC4B 3DI6A 5IWAF 4ZITA 3CCLS 1KSPA 2R2TA 1J5EF 2HVEA 1MMLA 4RU9A 3HT3A 4YB5A 5KFOA 3KK1B 3R1LA 1AZSB 1IKYA 2J76E 2MSTA 4NYPA 2ZHBA 2RS2A 1N34J 3NMRA 3W8PA 5LXRA 2XNRA 5HBMA 2WTFA 4DV4F 2G0CA 2OSQA 3B54A 1T9TA 2K1RA 2CADA 3QT8A 2JEGA 1WHXA 4ANDA 2C2EA 3I4HX 2CPYA 1IWAA 1H2TZ 1R0BG 2PE8A 1NMEB 3RBEA 4HVZA 2F9JA 1X4HA 2ROPA 4KIAA 3C16A 1Y5LB 2KN4A 5HSPA 2L3MA 2NPIA 4ENOA 2IM3A 3OFGA 1FX4A 1H7WA 1VGYA 1RAFB 2DHAA 1HBMA 3R97A 1U1OA 2OEJA 1I1GA 2CVEA 5KFGA 2V4JB 2HS3A 3LAMA 3HULA 3LTOA 3O6QA 3SCKE 3RB6A 2EG1A 2ZZTA 1EKRA 3HVAA 4OZJA 2LP4A 4ZLNA 1UEKA 4OHWA 2HBRB 1IKWB 1S4FA 3OTOJ 3PTWA 5IT9Y 2WOMA 4IG3B 1NSQA 1IKYB 1PJ6A 4IUFA 2HK3A 2RQ4A 5DS7A 5AXKA 3V6JA 3F56A 2DGUA 5C2GA 3QSYB 1OPZA 2KRRA 3HHEA 2DNZA 3PV8A 2YH1A 5KG7A 3KXDA 3NGSA 2W9CA 4PRFA 3M9MB 4Y0FA 4ZVPB 4ZHRA 3QT7A 3AHPA 1RTJB 2KL8A 4DL6A 4TNOA 4JI5J 4LF8F 4LR8A 5DQIA 3BBBA 4WYWA 2B43A 3ZTSA 3ZNUA 4WFXA 5LMNF 5F8JA 3HLUA 2GIRA 3CDWA 2ERRA 1FE0A 1KRPA 2RAQA 1HI8A 4H54A 5KOXA 3MUMP 1JLEB 2FLNA 3D0GE 2R8GA 3JQJA 4YOEA 3PACA 1HNIB 1HNZF 3A3NB 3AODA 2FHJA 2HNDA 1S1UB 4OX6A 5KG6A 3M1VB 2DT9A 4UQTA 4L76A 3BEGB 3UR0A 1GQEA 2YNGA 3OD2A 4QOTA 2VH7A 2UV8A 3ET6A 3JXOA 3AH6A 4ZVUB 3G6YA 2R7UA 2VG5A 2E9RX 1KNZA 2IM2A 1PBAA 2W25A 3GIRA 4DPXA 3A12A 4RWWA 5EDWA 1VQNS 1NDPA 3MCNA 3PYFA 2XC9A 1CJUA 4DUYJ 1T3NA 1YWXA 1UWBA 5DZ6A 3IO1A 1HNVA 4W4MA 1R3NA 2BEFA 3QPIA 3BSNA 3MMBA 2DRDA 3ETOA 3KUEA 2P9GA 2XMKA 1KS2A 3N5FA 3T41A 5KTQA 4FS1A 1YBTA 1VQ7S 5KAKA 3Q2TC 3PYGA 1Q86T 1MU2B 1KQFB 4FF2A 1GEHA 3EXYA 4AUKA 5KT2A 1Q5VA 5AJ3F 3R3TA 2J8AA 1KEKA 1Q79A 1LW0A 2QE5A 4Y2AA 2I38A 2R42A 4XTTA 3VAGA 3ZC4A 4DR1J 2CZ9A 4X4PA 1U49A 1V9OA 3ONQA 2CJKA 1MMNA 1R8BA 4HACA 1S0MA 1U2CA 1RHRB 3LOUA 2HHVA 3N79A 1LXNA 1YDLA 5C42B 1D8YA 1RKIA 2VOPA 5HMWA 4DV5F 3A8EA 1WF0A 2OMOA 1YJ9S 2VIHA 3FDSA 3VAIA 1DFDA 2JEIA 3KLEA 4KV8B 2APOA 4A48A 5KT7A 3D1OA 2MMYA 3IG1A 3MECB 1RA7A 1YZ6A 2FQQB 2B4PA 2K7JA 4J9SA 1YJWS 4DS5A 4Z7YA 2QRRA 1P27B 2WSCC 1QTNB 4X4OA 2BZ2A 2RILA 1LV5A 3PKYA 4ZVQB 1VBYA 1O6XA 1RT5B 3Q24A 3UDLA 3W62A 1NSKL 1WTFA 3G82B 4J91A 3BPDA 1WHVA 5E3RA 5K5MA 3BREA 3R2DJ 4HH1A 1Y9OA 1BLUA 1U1KA 4J9QA 2HAIA 3MPYA 2W4CA 4DG1B 4DN9A 2LQ8A 1R8CA 5C42A 2XQCA 2IC3B 1KC8T 2XS7A 2R3VA 4CO2A 1PKUA 2Z57B 4LSLB 4RNNA 4P72A 4EFAC 4DUZF 5BYRA 3OPKA 2J9CA 3AAWB 1FNMA 3CMQA 3D3BJ 2QO3A 3MM5A 3GR1A 3VAMA 4DL3A 2FZGB 2UVUA 2QA1A 4RW6A 2HURA 4ES3A 3DLJA 1RLCL 2RJZA 4ILMA 1MW7A 1S7HA 4U95A 1X9WA 5E3QA 2HS0A 3T19A 1ZA1B 1UZHA 2LA6A 3BN7A 4LBHA 4JI8J 3KDNA 2X1FA 1T0TV 1S1WB 2ZE2A 1JK9B 4QWDA 3T3FA 1Y3JA 3FQLA 3G9CA 2H48B 3DOKB 4CWBA 1UVNA 2W1BA 1CJUB 3S6EA 3J81j 1RXOB 3CF5Q 1R0AA 5HAOA 1QAJA 4L74A 3MPVA 3NG8A 3GB0A 4YR0A 2JEJA 4M5IA 3FSXA 3PCOB 3BSOA 2CJBA 3UWTA 3FEZA 4F25A 2FGOA 4OI4A 4J9NA 2V9WA 2WK4A 5CYMB 2E66A 2FGCA 2NS1B 3FCVA 1TKTB 4U7CA 1GTEA 3V5RA 3OVSA 3BJYA 3OQ2A 3P96A 4YHHJ 3H40A 4F4ZA 3OL8A 3GFYA 1J27A 1T9YA 2OHDA 2XM3A 1DTQB 1XNRJ 1K1QA 1S7IA 3M2UB 1QVFR 5ETTA 1HQ2A 4USWA 3H25A 4OZ0A 1KLMA 2LXFA 4NEZA 1FFWB 5KFBA 3KJVB 5DDRC 4QWBA 1HI0P 1S6PA 4I2QB 4M5LA 3UVJA 4C98A 1VIOA 3CEDA 1C2PA 4ECXA 4B9MA 2Y1RI 3TA0A 3CW2C 4LBIA 2X1BA 3C66A 4RZRA 3NGUA 4KO0B 4Y2IA 5A6WA 3M30A 5KFVA 1OO0B 3WQPA 3KLGB 3E3XA 2QEXS 1U25A 2O1PA 4I64A 3G86A 4NMLA 3PYDA 4EI2A 1S99A 2VG6A 2H4WB 2Q6CA 5D6GA 2JX2A 1UCNA 3U1NA 2CQIA 4PCQA 1Q5YA 3TQEA 2F4FA 3LUYA 3SSQA 2ZITA 2DR5A 2AJ0A 3TAMA 3RRHA 4OJ3A 3R5JB 5I3QA 3KMQA 2PEBA 4WXOA 2EKYA 4CLWA 4ZP7A 4BCAA 2P6TA 1EARA 1QDUB 1BQNB 1TAQA 4PEOA 4L75A 1FRMA 1BC6A 4AXIA 1RQ0A 3FCHA 1K8AT 2HNZB 4ZHRB 2VOOA 5F41A 4DFMA 2RSQA 1VJQA 4H4KA 4TU9A 4ECRA 3I0SB 2H9ZA 2XZDB 4RW4A 1S9GA 4JYAF 2KU7A 5B0EA 3TAQA 4J5OA 4C8KA 3B82A 2C22A 5IZHA 2ZZNA 4WZMA 4OX9J 3DHWC 1OYDA 1FFSB 5KFRA 4L3KA 2HFNA 4FYWB 4NA1A 2B9WA 4ATNA 1NK8A 2VBYA 4ECSA 4CT8A 3TR5A 3JTPA 3GWCA 6FDRA 1HIYA 2ILYA 3TA1A 4Q2MA 3SBMA 1HNXF 2DBBA 4PQUB 4B3OB 3CUNA 4IH6A 1BMQB 1YJVA 2C2NA 2RUGA 3MOZA 1HQUB 2XMJA 4LBPA 4UOCA 5IFMA 3EYZA 1KLNA 2HBZB 1HL6A 4CM2A 1BQNA 1YBAA 4MKBA 2KXNB 4OJ1A 5F0WA 1WC0A 2HQDA 5E41A 4NX9A 1NK6A 4B9SA 2HNZA 2M7SA 1WC5A 3K58A 2KYXA 2ZHOA 4QIVA 4LFAF 1JLQB 2IPOB 3P3DA 4OHYA 3M8PA 3DRXA 1ZOTA 3K5NA 4RW4B 2XYPB 5KFNA 5F0UA 2OPPA 3HF5A 3DYAB 2XZTB 3AD8C 1FESA 2AIRB 1AZSA 2CPJA 3CJRA 4EBDA 3KNAA 1SUQA 1FTCA 1Y0HA 2D9PA 3W5ZA 2KT5A 1RWUA 5D78A 4LRDA 3W9IA 4FYXB 3BO4A 1SL0A 2ZJQQ 4P73A 4CTAB 4EU0A 1QAYA 4NPOA 4TN2A 5H9FJ 2UUAF 3NBPA 5L1IA 2YKOA 5HMYA 2R2SA 4WFNQ 3GG1A 2LKZA 4Z2XA 5EWEA 2HMIB 2E1MC 4ZIWA 5E5NA 4KH0B 4LF6F 1B4SA 1ZH5A 2FLPA 1LW2B 2AKWB 1YGYA 3EVWA 4PG8A 5KFJA 1HWJA 2OFGX 1OJ4A 2RDJA 4ALZA 4ANEA 3MFHA 3IBFB 4ZP9A 2AJFE 3GZ7A 2MKCA 1YBUA 2EFVA 2NSBA 2DNYA 2HRTA 2Z2MA 3W7BA 2FHOB 3ZNJ1 1U47A 2EC2A 3TA2A 2C42A 5D0HA 5ETPA 4NASA 5ETSA 4OI3A 2ZBIA 5LSLA 2I8EA 3M8QB 5HMZA 2DY9A 3LALA 2BANB 2XULA 2JLFA 2XMWA 3TUJC 4M5JA 1I3OB 4EO8A 1WORA 4OLPA 4R8UB 3GV8B 1T03B 3JQKA 4ZVGA 4GC6A 2E5LF 5ETKA 4JI2F 5KT4A 1U2FA 2VC1A 4IFYB 4XPEA 2XCPA 5DM7Q 1ZM4A 2FB0A 2E5HA 5A0YA 2XGPA 4MKVA 3ZZZA 2BBEA 4GVBB 3QBCA 4Y00A 3W63A 3DDIA 4ED0A 1FKOA 4OHZA 3E01A 2GVDA 4UQGA 4USIA 1HKAA 4CQ1A 4M5HA 2V4QA 4AT1B 3TANA 2A10A 3D0IE 3UR3C 1SJ1A 2M8DB 3AFGA 3JAMY 4DR7F 2FVQA 5FD1A 1VRQC 2HQIA 1Y3KA 1JJ2R 2NREA 4PXBA 3IRWP 3ELHA 2MB0B 3QLHA 3DLEA 2IFXA 1RWKB 3QGPA 2BOPA 2FPHX 3WX8A 4KGZB 2GC8A 1RAAB 1WDDA 4C3LA 2YWFA 3DDNA 2CQ0A 3CCES 2GS8A 1XJWB 1NDKA 5D0RA 4XO0A 1U1LA 3CMAS 1O0PA 2XEXA 1RUSA 2ZUGA 2OPSA 2CJQA 3DOKA 3KG1A 2NXUA 3AA8A 4P2MA 5KFYA 2NZCA 1SC6A 4YY3F 2DR9A 1JLBA 4MKAA 4OV1A 3TUIC 5C5JA 4F3OA 2F8HA 1PSDA 2NUUG 4WTYA 1B70B 3TO8A 4IKAA 3VGSA 5GAHI 4RUAA 3DLKB 2EXUA 2DYAA 1HQEA 1P8GA 2JH3A 2UUTA 2YKQA 2QMXA 3CDEA 3C6TB 3DM2B 1HARA 3PJWA 4ZPAA 2CPEA 1VQ6S 1VDHA 4C11A 4IYQA 3CMES 2YWHA 2W9BA 2QJ3A 3JAMU 2D3OR 2BA9A 1KQSR 1P9YA 2HLUA 3BYRA 2B8QA 3C19A 3WHIA 1TP7A 2CQ3A 3RBXA 3Q8QB 1PJ7A 3IWLA 4DCOB 1B0VA 2XMUA 5EWFA 4ED3A 2KI2A 3EE3A 2EK6A 5J2PA 4ZVOB 1HPZB 3DOMB 3D54A 4F36A 2DIUA 2HLTA 2Z2LA 3BGRA 5LOQA 3MUTP 2X3DA 4RUCA 5K8MA 3Q23A 3TZZA 2C2RA 3M9OB 2IRUA 5K8OA 1S0OA 3KLGA 2LQ9A 4N8NA 3THTA 1TMJA 1NK7A 2J9DE 4JUZA 1C0UA 2HGNA 5K14B 3QJPA 3ITHB 5BR8J 5DGAA 4ED5A 2M9KA 3ILOA 2NYHA 3LP1A 2YNFB 1N5YB 3OXFA 1MN7A 1VOMA 5KG0A 5GMKa 2L9WA 5D3GB 2OIHA 2B51A 2WB4A 2XG8A 2MY7A 3FK4A 1WTBA 3RR8A 3HXMA 4KB7A 1NDLA 4C6AA 4CLKA 5GMEA 3WC0A 3EWGA 3SMZA 1RT2B 4DQSA 2QGFB 2EVZA 4K2XA 4DHVA 2AYMA 4I6AA 3PJ9A 3B4DA 4IQMA 4PG6A 5J2PB 4LRAA 2BR0A 2JRSA 1UPPA 4N56A 2PGCA 2XY6A 2PT0A 4DL2A 1JLAB 3T1YJ 3MTKA 4HYKA 4PKDB 4ZP8A 4HHJA 1TUGB 2C1EB 3CB4A 4JV1A 1RT6A 2R4FA 3NCPA 1BXNA 2GQ2A 5B0AA 3NKYA 2P6SA 2W4PA 5DJBA 2XI3A 5IQ6A 3OV7A 5IQQA 3W2WA 5CABA 4DL5A 4QJVA 5DQHA 4B3SJ 2OEMA 1Y7PA 2NXCA 3QWPA 4NRTA 2DISA 4ECTA 4IRCA 4A8XA 3O5TB 4ELTA 1U0HA 2BE2B 5FIIA 3AJ1A 1S97A 1RAJA 1RHKB 4LFAJ 2FC8A 2GCFA 4Y6IA 4GO5X 1YG0A 1JLBB 1WOSA 4LRBA 4QIWD 4F26A 5KT6A 4DMZA 1S9EB 1CC7A 3AJDA 5M2RA 1U1RA 1UL3A 4B3MF 2B7BB 5BYSA 4FF4A 1SQFA 3AQPA 2VV5A 2YX4A 3RZAA 2DH9A 4WIQA 5KG4A 4EWTA 3THVA 2R8KA 4OFZA 1FVSA 3OHAA 2V34A 4C11B 1RKJA 2ZH5A 3L4BC 3GG0A 2LEBA 2WBMA 4C0BA 2ADCA 2IIHA 1GXTA 3OTBA 2FJEB 2LCWA 5AXNA 4ZA1A 2C3YA 1CC8A 4KHMA 1XN9A 2YKPA 4ZVSB 2CUYA 4C3KA 1FJGF 4I6WA 3A3PB 4IRKA 5HVHA 4WFAQ 2QLXA 2PIIA 3M8WA 3MMBB 4ZPVR 4ETXA 1D9DA 1N33J 1J5OB 3W2WB 4L72B 5L9XA 2GO9A 5E3PA 4K0KJ 1ZA2B 2YWWA 3FUYA 3SZ2A 2WVCA 3KLHB 1JKHA 1JX4A 1WC1A 3ETMA 3I9V9 3KJVA 3MEGA 4NMXA 3CE8A 3NBPB 5B0GA 3M9NB 2VICA 4IO9Q 1XC9A 1WC6A 2KT3A 3TEGA 2QL5B 4ZLLA 4DR2F 1RT1A 3NL0A 4G1PA 3MURP 3IA0A 1K0TA 3ZTOA 1YITS 5ITHA 2YNIB 4ZVFA 3QAUA 2YBVA 1B7YB 4DFJA 4FZVA 1PYTA 2DNHA 2DHHA 4PYDA 5ETMA 4WKYA 2AQ4A 2XLJA 1K0VA 1OY6A 2VG6B 3P5TL 1F9FA 1SBRA 1ZBTA 2QMWA 5BJRA 4IR1A 1VJWA 3A3OB 4PR6A 4G1QB 2LEAA 1RTIA 3S7RA 1TZ0A 1H6KX 3D67A 2FYXA 3H7HB 4TLRA 2LVWA 4XIUA 4DX8H 4UZCA 3C3LA 1N33F 1WEXA 1T9WA 4MJKA 3C16B 4TU8A 4C4WA 2MEWA 1RT7B 4I67A 3CJ5A 1ZM2A 4TY8A 4DV5J 1LK5A 4ED2A 3SQGB 5GVQA 3MM6A 3GIKA 2E29A 1UFLA 2ZBPA 4ZPBA 3ZZTA 3ISNC 2CPXA 4G6VB 2FVRA 2DGTA 1HBOA 4KPYA 2AWZA 4RU2A 1FXLA 1BHNA 1NHUA 2HMIA 1R8PA 2LFVA 2QL9B 3PW4A 4ZCMA 3C2PA 2E9TA 4NLOA 1T11A 2FY1A 4NCAA 4ZKAA 2N82B 4ZPCA 2VL1A 3UN5A 3PIOQ 2VQEJ 3T1HF 1K47A 1N54B 1Q4RA 3C14A 2M5YA 1WKKA 3EVOA 3Q8VA 3BYPA 4G1QA 1ZAVA 4RW6B 3IBCB 2VG7B 4DFKA 3FC9A 3UD4P 4MK8A 1TKXB 3BKFA 4IDKB 3K17A 3HO1A 2GJ2A 3QNWB 1RU1A 1RSCA 3VZIA 1WNEA 1IR2A 2KVIA 3CD5A 4B17A 4IH7A 3HSGA 4UW2A 3MCMA 4OYZA 1EHWA 1Z2ZA 2M4MA 2RB7A 3G4SS 1RTDA 1WWHA 4USHA 1HQEB 4YR3A 3G6XA 2ZKUA 1QUVA 4X2BA 3AJ2A 1KHVA 3R8YA 4B08A 1QY7A 2CJ9A 3W9HA 4J9RA 2CQBA 1GTHA 5J2NB 1JLCA 4ZJOA 3CJ8A 1Y5IB 4WP9A 4ES2A 2CFXA 3M2RA 2VA3A 1HWIA 3E01B 1OY9A 5CHCB 1L5UA 2BM1A 2YNGB 4JI1J 2HVHA 2AF6A 1RWVB 2EW9A 5K8PA 3PW2A 4NCGB 3ADAC 5BR8F 4O3OA 2UZAA 1TVRA 1V5IB 4WJBA 1KLMB 1KHWA 1Y5NB 1R8HA 1Y10A 4FNIA 5CH7B 2GHWA 1FRKA 3BH7B 3MTJA 5C25A 5CYJA 4O3RA 3AB4B 3I0RA 1HNWJ 2QLFB 2DHGA 4KH1B 4QU6A 3BR9A 2NYIA 2B6AA 1RTHB 3D6FB 4JI7F 4ZOSA 2ZEJA 2KDOA 3OR1A 1U26A 1S49A 1LWFA 4Q45A 1Q8IA 3MOJB 3MUVP 2N7CA 2E1AA 2RE1A 1YJTA 2J5AA 2CNKB 2VBZA 1Q8BA 2D7SA 4AD6A 4YDDB 3H4BA 4DV3J 1VQPS 1APSA 1B99A 1NH8A 5ETQA 1G2EA 3TZWA 1TK0A 2H51B 3NGKA 2ADBA 2B5JB 5DLFA 2MQQA 2HHXA 3X3UA 4O4GB 4C48A 4PPDA 1CBKA 3BKTA 3H42A 5KFWA 4QWEA 1RT2A 3F44A 4CLUA 2JFDA 1Q0NA 4WK1A 2NUHA 4MIBA 2ZH9A 4LFBJ 5GAGU 3GFHA 1XBWA 5A0YB 2DEIA 3I96A 3KJNB 3V4IB 4B9UA 2G2ZA 4YUDA 1NZ8A 5A8KB 3IG1B 2YX1A 4DR1F 3QSIA 3JYTB 3FSYA 3DOMA 2ALYB 2FD2A 1LWEA 2DIVA 2F5GA 3GSIA 2YVSA 3N6NA 3KHGA 3BQ1A 3I5CA 3V6DA 2FJVA 4DSLA 4LF5J 4HDGA 4NLGA 2N4DA 3M8YA 4H4OA 1UAWA 2ACMA 4UZBA 4JI7J 3PYEA 3D6TB 3PW7A 1VC0A 3FQKA 1CSJA 3DKDA 3PX4A 2D1CA 3DRPA 5HQLA 4FS2A 2ZH8A 3NOCA 1LOUA 2RS8A 3OR2B 4M5DB 3G8SA 4B9VA 4F0KA 5H1SV 4NL5A 4DQIA 2MKKA 3ILIA 1HMVB 4CLLA 4J9KA 2G13A 3UW1A 2HWIA 4LMZA 1N6QB 3E51A 2GNKA 1OIAA 1IUJA 3CT9A 3GPAA 4P71A 1YI2S 2N7YA 3DGPB 2W8LA 2FY8A 3D66A 3LWLA 5M2PA 1S10A 3H2LA 3MCSA 3W65A 1VC5A 5FJ4A 2Y1LB 3GMGA 1QSLA 4KFBB 5CYQA 1S5ZA 1FXRA 1UZDA 2Z56B 1U2RA 5E3AA 5EWGA 4LUBA 5K20B 4PWUA 3CCQS 1N36J 2VJVA 2IMOA 1TK5A 2A2DA 2CKWA 1S48A 1XNQJ 3R7SB 4MYTA 2BKOA 3CJ2A 4FKXA 3HZEA 3RRGA 2J0QD 4IO1A 2N3LA 3AXKA 3HKZD 3LANA 1GMWD 3BV8A 2LMIA 3CDAA 3KJFB 2V5HG 3HHNB 1RT1B 3MEEB 2V69A 4DCPB 3TAPA 3ZZPA 5IV3A 1JXVA 2ZDPA 4YDXA 2A1BA 2VHGA 1KFSA 4K4VA 2I5JB 4HEA9 1SL1A 5F8NA 4Y65A 3DLBA 2ZDOA 2UUBJ 2LYVA 1N32J 2GMHA 2OPRA 5F9NA 1KTQA 1DTTB 3M4XA 4IG0B 3CD7A 2UXCF 5KOWA 3QO9A 2V8GA 3H5XA 4U7UK 2W2OP 6FD1A 4HR2A 1RTIB 4X65J 2JC1A 5KG3A 1VRTA 2HGMA 2RMLA 1REVB 1QUPA 2QA2A 1XWLA 3DI6B 2IM0A 3ICLA 4LREA 4RR5A 3H2VE 4OIXA 2UU9F 4ZVEA 5EHHA 1URRA 3V4IA 1HYSA 2CG4A 5KFQA 1Q78A 5KFDA 3HSDA 4PWDA 2D3ZA 2VD3A 4AFFA 2IVMA 3S8SA 4DUYF 1VFJA 3N6MA 4G65A 3W60A 2DH7A 2W8KA 2LECA 1NJWA 2IA6A 1JLAA 4DV0F 3UCZP 1G1XA 5HK4A 1MROB 1F1BB 5T41A 1HBMB 4KV8A 1Y4ZB 4URGA 4C0HA 2FHMA 1UVKA 3PX6A 1XR7A 3F0NA 3W2VA 1N0VC 1MN9A 5CD4A 1VQSA 2WRMA 1DRZA 3GCWP 3F73A 3DRSB 2YNIA 4O44A 1Q81T 1RBAA 1DTTA 1CVJA 3IS9A 3WX4A 4I7FA 4Q0BB 1DZ5A 2FHJD 1PJ5A 2MLYA 3T6JA 2Y1IA 1K1SA 1PIEA 4P7TA 1ROFA 1AT1B 2KT2A 3D6MB 3TZXA 5FLXU 3RJMB 3GJRB 3TP2A 3GFZA 1N5SA 4IOCQ 3MWBA 3U1LA 3MPWA 4M94A 3J7A1 3MMCB 3KMSA 1NKEA 1DLOB 1AROP 1GMVA 1RHQB 2BYCA 2PC6A 3BBFA 4NLVA 4YP3A 3Q0AA 3FBEA 2LQ5A 1RTJA 2MZQA 3W5YA 1NKCA 1ZAWA 3ILJA 2D74B 1H73A 5J1EA 3T5HA 3GQCA 2HZVA 2CDRB 4ECVA 2AGOA 2CZ4A 4ID8A 4WP8A 1WJ9A 4KE5A 4JI6J 1MROA 4DI6A 4RW9B 3DLKA 3MM5B 3FMBA 1VQMS 4JI2J 2Y8WA 1SL2A 4F0MA 3PR5B 4QR0A 2AT1B 3CSKA 3PIPQ 1RCOB 2Q43A 2DEJA 2DGQA 5DDQC 2QSFA 2ZC4A 4O44B 3QZ8A 1VBXA 4K8RA 1FRJA 3D0HE 5E7OB 4LF8J 4KHPF 4C8YA 1JLEA 2Y0BB 3KUHA 4NYOA 4D3GA 5F3TA 3GLJA 1TVRB 2KXFA 2L48A 5SUHA 1HNIA 5KFAA 5IM0B 2O66A 1RYRA 3KLVA 2PMWA 3K8VA 1R27B 3HMJG 1WOPA 2OPRB 4CIOA 2X3GA 1V6HA 3FFIA 1JB0C 2HPUA 2OPPB 3Q8RB 2HYIB 4F50A 1URNA 5H9FK 2C3OA 4LFBF 1G4CA 2KTQA 2IJFA 3RW6A 4JI6F 2E44A 2YY3A 3BQ2A 1NB7A 1KWMA 1WSRA 5DG9A 2Y0SD 2QC3A 3OFHA 4O3QA 2M8HA 4YR2A 3PO4A 3KK1A 2EBGA 1SC3B 4DR5J 3HHLD 1VC6A 4ED1A 4JI4J 1FKPA 3IAS9 2DPJA 4HACB 3LO3A 3OVAA 2BE7D 3HVTA 3NS7B 2AV5A 2V8DA 3H5SA 4GVLA 5F8HA 1HWKA 2GGPB 1WI6A 1MNEA 3C8YA 4PG5A 4MIWA 1HLWA 1NHVA 4FVCA 4MKYA 1PBUA 4JYAJ 1FEEA 4EEYA 2UUAJ 2HBQB 4Y3CA 5LJ5Y 4NXMJ 3IC1A 1RT4A 3KK2A 3FRYA 4K4UA 2BABA 3HCXA 3UO0A 4PQAA 1RADB 2EFOA 4WFYA 4EZ6A 1TL5A 2A2CA 1N52B 2DHXA 3LQVA 4DOZA 4J90A 3RB3A 1SB6A 3GIMA 1VQOS 1WD6A 5F8LA 3TJAA 4ELUA 4F04B 2FTRA 2DH8A 1RAHB 4JI5F 3TAMB 3Q2SC 1Y00A 3VR1A 3ZZYA 2V9KA 1ZS6A 3FGVA 1YTYA 1T05A 3G82A 3K5LA 1UEVA 2DNOA 3TYTA 1X7VA 4I4BA 1GX5A 1V3SA 2FC9A 4KYZA 3M8SA 2CVIA 2RKIB 3ZTRA 1V3ZA 1VIXA 1DY3A 3PKMA 3G8TA 4KT0C 1CJKB 1A7GE 1UMJA 4UT4A 1N6QA 2M88A 5HMXA 2HWHA 3GV5B 1K73T 3I0SA 3UCUP 1LWCA 4NLWA 1F3FA 1KONA 1RWWB 1DHMA 4LVOP 4RJVA 3OL7A 1AXQA 2D3O1 4JV5J 2CJYB 1WELA 2UVRA 3FJ2A 1FWKA 2JOQA 1JLCB 2AEFA 1X31C 2F63A 5GMDA 2OAUA 2R7TA 2Q66A 5B08A 1KQKA 4ZLPA 3PRVA 1QVGR 3QIPB 5L38A 1C1BB 4QQBA 3TWZA 3SYZA 1LWXA 3NGRA 2AZ3A 1TU0B 3CJTA 3KDOA 5ETNA 1N88A 2CQDA 3VVTA 4DUZJ 2E7WA 4YB7A 4WWSA 2MZRA 5THWA 3M1VA 1Q7YT 1NPRA 4Y2CA 1VQ4S 1OYEA 2NR0A 4DEZA 2YQ3A 2QYCA 3MEGB 1IQZA 4PABA 1EQMA 1IKVB 1FJCA 3BGLA 3I0RB 3NRBA 3CCRS 1N56A 4CLFA 3RB4A 1QM9A 3KLIA 3HI9A 4K4WA 1S9FA 1GMUA 3PRDA 5C2CA 2DCLA 2IHR1 2W9BB 2XYHB 1QJHA 2QV6A 1L3SA 1SJ3P 1XR5A 3TEHB 2LA4A 2XTJP 1FX2A 1QD1A 2HWTA 3C6TA 3QO9B 4GKKF 3KHLA 3MI7X 3G96A 4A8KA 2DO4A 3VGTA 4EUVA 2BJ7A 1REVA 3OLBA 1E6YB 3UDEA 2ZH4A 2IA0A 3HHLC 1H0HB 2JJ4D 3FZBA 4LQ9A 2VPXB 2X51A 1F3VA 2QIFA 2VUGA 3H0PA 3TOQA 4CTAA 5LMUF 3NMAA 4UF4A 2JL9A 3RBDA 4FXVA 1FJEB 4A8FA 1Z4UA 3RRKA 2XMVA 4P10A 2DGXA 2CPIA 1RABB 4KGXB 4DX5A 2MGZB 1XMOF 3H2UB 1TK8A 4HT7A 3VALA 1HR0F 4DCJB 4DR7J 1IKVA 1R43A 5IC6B 3AB2B 1X4AA 4F4AA 1Q8LA 3EGWB 2XS2A 3MEEA 3R1HA 1SIWB 1UEUA 1TL3A 4OI0A 4V1Ak 4CLYA 1FDBA 5K14A 1H7XA 2OD4A 2HZAA 2B8PA 5D4PA 4ECYA 2WHOA 3I32A 2BQ3A 1T03A 2V2ZA 5J2QB 1N5YA 5EGYA 2DGSA 1JIHA 2RU3A 1XR6A 2AX0A 1YIJS 2YPZA 3CCSS 1FTRA 3IR6B 2HFUA 1HBNA 2V50A 4HI2A 4IFYA 4ZP6A 1Q82T 3UDCA 1M5SA 4X65F 4CP5A 1QLNA 4PYAA 2OO4A 2BXJA 2E7XA 1N8RT 3CULA 2OPQB 3EDRB 3LF0A 1ZETA 2AHOB 2ZUAA 2VODA 4JBCA 2W7AA 3MMAA 2KRBA 5T14A 2FJXA 1T3OA 1TL7A 2JC0A 2XI2A 1K44A 2YNHA 2YWEA 3C46A 2MKHA 1U7LA 2RQMA 3GILA 1IKXA 1SKSA 3V6HA 1TL3B 4X4SA 4LF5F 4O3PA 4K4XA 4ZVRB 4F3QA 4NZ7A 3RR7A 4RW8A 1F6TA 5IT4A 1C0TA 4M5GA 3KK3A 2XCAA 1UA1A 5D77A 4HDHA 1AYEA 1F9HA 3NLCA 4KTQA 5IT9U 1VQYA 4YMEA 5DLGA 1B64A 5C24B 4X62J 1YHQS 2EFGA 1NK4A 4B3OA 2VZ9A 4USTA 5BXIA 5J2MB 3GIJA 1NKBA 3AOBA 1TV6B 3RTVA 4BWJA 1H2VZ 1NSAA 5A8WA 2UUWA 2XNQA 3Q89A 4RUBA 5LMNJ 2BDPA 3C15A 1WC3A 2HHTA 1U02A 2QFIA 4P2SA 4Y2KA 3WIUA 4CNYA 1FRHA 3UN2A 2VQEF 4A8MP 4RX6A 4LF1A 3T1HJ 2BQRA 5ETOA 3US5A 5LJ3Y 3HPOA 1QSYA 5E2QA 4IG0A 2HEKA 2QFJA 1VMBA 1LFPA 4A4JA 1LWFB 2P2CB 2W2QP 3AT1B 3I5BA 4FPIA 2DTJA 5G4DA 5H9EJ 4JI3J 3D6HB 4NXMF 1B3TA 3VTIA 1IWGA 1N36F 2FDNA 2U1AA 2MZ1A 2AJ4A 3W5XA 2W2NP 3KK3B 3V6DB 1HNZJ 1FJGJ 2XS5A 2H65B 2R7VA 4EYIB 4J9OA 1A9NB 5G0RA 3MM8A 2F9DA 1HHTP 2AJQA 2MYFA 1O51A 3OSNA 1UA0A 3NS5A 1G6BA 1BQXA 5KFCA 2C2OB 3CC7S 2FLLA 1S76D 1WF1A 2H3EB 3QT5A 4WXWA 2V4JA 3SI8A 5CYMA 3MAAA 4C3MA 2F8EX 2AMCB 5IM0A 1C4CA 3L09A 1RHMB 4F0HA 3QMQA 5ADZA 2VFVA 1X0PA 4U6PA 2CPDA 2XB2D 3NEKA 4X84A 3MAHA 3MMJA 4UOGA 2QLWA 3MD1A 2M52A 1HBNB 3H90A 3TVZA 1NZAA 2KFZA 3CC2S 4DSEA 4JV2A 4B3SF 4EGLA 2BKPA 3H5YA 5CD4H 8AT1B 5HROA 5LM7E 2BANA 3IXQA 4YB6A 5LXYA 1OY8A 3R5DA 5KT5A 1NJZA 5M2UA 4CO5A 5U47A 1YJNS 4KHPJ 3DRRA 3FBFA 4ZS6A 4ECZA 1JQGA 5CXTA 3W66A 2YNHB 2ZKTA 2OI2A 1MMDA 3PDNA 4M5KA 4AQYJ 4X4UA 1H74A 3WIVA 2AYBA 3QZ7A 2POKA 2BX6A 2LQBA 4E8UA 4DQQA 4E98A 2GJIA 3LWMA 2HIQA 4ERDA 2V6AA 3OXLA 2ZH1A 1RAIB 1DJ0A 3LH2S 3J81Y 4U9RA 4CLSA 1EAYC 1YSJA 2VG7A 4KFBA 1EP4B 4P2XA 3JSRA 5CYQB 1IBKJ 2GVZB 4CLZA 5F8IA 2O5DA 7AT1B 5I3UA 1TMMA 3EGZA 4CRJA 3EX7B 3BZQA 2HRYA 4DR4F 1S1TA 2DNGA 4K4SA 4K0KF 4TYAA 4RNMA 2B4UA 2GQQA 2ZBCA 3CJ0A 2PFFB 2MY8A 1S6OA 3N5BA 4X4QA 4DWIA 1S1VB 4GO7X 1V3RA 9RUBA 3FVYA 3SV3A 3RAXA 2EFNA 2V4RA 1PO6A 2XZWA 2WW4A 3KG4A 3TX8A 5I4MA 1NJYA 1R6YA 2ZBRA 3DM2A 4OI6A 3MR5A 1U4BA 2RH3A 2CWKA 3DU5A 4WTOB 3OTCA 4NLPA 3KOAA 1TFWA 1VRUB 4MTPA 1JLQA 1AFJA 1Q16B 1GFWB 2HFSA 4LSNA 5LL6d 3SSRA 3CGIA 5EX0A 2RRBA 4OYMA 4RLEA 2UV8G 1WOOA 4NLTA 4U8YA 3L3CA 1JLGA 2WSEC 2FZCB 3AOAA 4LIWA 2J7WA 2VC0A 3L95X 1SUQB 3QFWA 3TJ8A 2FJBB 1TL1A 2VFRA 1GK8A 2PO4A 2WVFA 3M05A 1HPZA 3O2IA 4NLUA 4BWMA 3BO3A 1N48A 4B3MJ 4B3TJ 2RF2B 4KJIA 1NAQA 4ZCLA 1U24A 2MGZA 3HHLB 2VQFF 2RRAA 1AUSL 3GR0A 2DD8S 3OUYA 4DBQA 3NY0A 3BM7A 3NCQA 4MIAA 1SV5B 3AD9C 2ZH3A 1HWUA 4W90B 2OUGA 2J7UA 1SJRA 2QA4S 4X64J 3MPUB 3GJSB 3T1AA 2B56A 4AL7A 3H5UA 5HI7A 3WZ0A 2QSWA 1VHIA 3A13A 3LW5C 5HATA 3MR2A 1FD2A 3QGIA 3FKBA 3VQTA 3CJQA 4TXSA 3DCAA 5HROB 2HNYB 3NOGA 3OVBA 1DTQA 4OZ2A 3RGIA 3UI3A 3QJJA 1UETA 4NXNJ 1ZTTA 5IS2A 2AZ1A 4I7FB 2G1HA 1EETB 5KFFA 1S6QB 2H5JB 1UJ5A 4DR2J 3HJFA 3C6UA 2OP5A 3GJTB 4F7VA 4K2JA 5DM6Q 3LPYA 4OYBA 3JYTA 1MWZA 1X5OA 3MM6B 3OBIA 2QLJB 3V81A 1N4LA 2MPUA 2QX0A 3JS9A 2YPYA 4J9MA 3KLFA 2ZM6J 1FRLA 1TL7B 1SPBP 2GW8A 1N0UA 1L3KA 5JJBA 4TQSA 1M5VC 1TUWA 2K7KA 2NCKL 5DG8A 1S77D 3A8KA 1I51B 4N8OA 3CD6S 4FXDA 3N9UC 4K5RA 3EZOA 4LIRA 4FP9A 3M6XA 2XO7A 2JLEA 2BE9B 2JLGA 2A18A 2BE2A 5HVFA 4BBYA 3LA0A 3OR2A 3GIIA 1D0EA 2V8VA 3I87A 4FBTA 4CLPA 3J7YI 3BDEA 4Q7AA 9ATCB 3A8JA 1S72S 1SJFA 2R2UA 4DPOA 4KPCA 2DVIA 1FE4A 1KBRA 1TAUA 4JV0A 1TQLA 1W2IA 3A4TA 3BGOP 1RZMA 3KNGA 5I42A 1V5VA 2HAFA 4TQRA 4LF2A 2VPWB 4HTJA 3I4PA 4NLQA 2LDIA 2MZTA 3TNVA 4PXEA 2RUSA 2R7OA 4J9PA 5L8RC 2P8IA 2GIFA 1F9EB 1HW9A 3DOLA 1RBOB 3RUBL 2PN6A 1GH8A 3SEOA 3HD2A 1RT3B 2ABYA 2CJAA 2BRKA 2K3IA 1VLOA 1R31A 2B4VA 2K8GA 2MZJA 2NSCA 1XQIA 4PPZA 4OI2A 3IWNC 2F1FA 3RG6A 2V8PA 3HVWA 4LFCJ 3M6VA 4NLSA 5B7WA 1R0CB 3CDBA 4KQZA 1F2HA 4LF7F 3PVXA 1UWAA 1BE4A 1RU2A 2ZBQA 2ZE2B 3RU0A 4CO3A 1XNQF 4DL4A 2ZOGA 1WEYA 1HQUA 1YJUA 4WZQA 3ISND 2XMTA 2J6TA 4ZN3A 4DXLA 1B0PA 2RD5C 4FVMA 4PXDA 5L1LA 3BR8A 4X62F 4A8QA 2GIQA 4DPYA 4X4NA 1ZZNA 4UUXA 5C7PA 5HQ8A 2VA2A 1M5KC 4DZ6A 4K4YA 3U27A 1JJCB 4RW7A 4MH8A 1RT4B 2KXHA 3KK2B 1U1QA 4ZVHA 3KYLA 4DQPA 2XSJA 1S12A 3KFWX 3L7UA 5FDLB 1NJXA 1M1KT 3EPIA 5HQMA 1RWNB 4RKUC 3W8GA 4IRDA 2I9SA 1SVDA 4Q5VA 1F60B 1SXLA 2EPIA 1FO1A 3QGHA 4WE1A 2EFQA 3MAQA 4DQRA 2AYEA 2QT7A 1GNKA 4HHUA 1L3TA 3NP5A 2P5VA 2FJDB 2RIJA 2KFNA 4QYRA 2V2QA 2YKMB 3KLFB 3D1HA 4A46A 5AJ3J 3NGTA 2QTWA 3LPEA 1LW0B 3OJUA 1SQEA 4LVNP 2FUG9 2AJ2A 3MEDA 4C0OC 1HI1A 4GMKA 4LSLA 2OTLS 4GKJJ 2CQGA 1YKWA 2RVJA 4UY85 3TRGA 2E5JA 2E7VA 2Z0GA 2JDJA 2Y1JA 4RNHA 3IGNA 1XMQF 2AEJA 2GAHC 5CQGA 5DETA 4JI4F 2CAJA 4DV0J 3HKWA 3LGHA 3MR6A 2M3DA 1WG5A 2KKHA 1PYOB 3KLEB 3M8QA 4A47A 3DRSA 3OXGA 3UN3A 3Q86A 2CPHA 2GZOA 1AB8A 1C1CA 3I5AA 2B7CB 1Y11A 3QIPA 5KFEA 2OH2A 1U0HB 4ECQA 4KKOB 2FIUA 3PHTA 3ZZRA 2GMLA 1IN0A 3MGJA 4KY3A 3VVUA 1P6TA 1R0AB 2XHCA 4C9DA 2UVVA 2IBOA 1QAIA 3ENVA 1D09B 3IR5B 1K9MT 3E8OA 4Y2MA 3BS9A 2AW0A 3ILLA 2IYIA 4FNHA 2ZOMA 4MT1A 1FRXA 3DRRB 4ZPWR 4R25A 3SSSA 4QIEA 3TW0A 2QZ8A 4RNFA 2HKEA 2HG4A 1WEZA 5HJYA 3T9NA 2LU1A 2EEYA 1U8WA 1D9AA 2R8IA 3IBWA 1HFEL 2Q6BA 3TARA 1VQLS 2CJXB 1B0TA 1LFWA 3R5CA 5IOLA 1RHJB 2VPYB 4M5MA 3OJSA 2BJ1A 2CNOB 2N3OA 3QRPA 4IFVB 2ZD1A 2EKNA 2NXNA 3BGFA 4OYPA 2KZZA 5DRKA 2BVZA 4USKA 4WU2A 1S1WA 1KOOA 4URQU 4RW7B 3G6VA 4FBUA 1GX6A 5LT5A 2HW3A 3VGVA 3FZ2A 1BD6A 1U6ZA 3OR1B 3S01A 2KZMA 1X0FA 1WUUA 4I56A 2ROEA 2LQJA 2XBPA 3SCJE 2CYYA 2HHQA 1U6FA 3KHHA 3AOCA 3D4JA 2SXLA 1CJVB 1DBDA 3U1MA 4I6YA 5MLCV 4X66F 3OLAA 1SKWA 3M2VB 3ZTQA 4DDFA 1EJ7L 2VFUA 2IRYA 3G8QA 4NOHA 2CQ1A 4CYUA 4FXWA 1RYSA 1DAXA 2OGUA 3PY8A 2CQCA 3FCWA 5J2QA 2BW7A 1NDCA 4QWCA 1MG7A 2D69A 4YEAA 2E1CA 3UFCX 3M8RA 4PG4A 3BGRB 5KFPA 1JLGB 1NCLA 4IFVA 3GONA 1NLKL 3VQSA 1N32F 3L7OA 2YKNB 3IRXB 4U7UD 1UP1A 2MXYA 1FERA 4CO0A 5ETVA 4CCHA 4W98A 4OZ3A 3G2XA 4F3MA 1ULRA 1RACB 2H4YB 4OYIA 2QYGA 4U8VA 5HLFB 3QFHA 3M30B 3CDUA 5HP1B 1WDTA 2FJAB 1WHWA 3EGVA 3ENAA 4MK7A 2IMWP 2UU9J 3GYGA 5RUBA 1R6VA 2BJ9A 1WF2A 4P74A 5BYQA 3J7Z5 3OFEA 2KHDA 2VPZB 2ILZA 3P4UB 4O0NA 2O01C 4R8UA 3V6KA 2ASDA 3DC2A 1UFWA 2JWNA 4TKTA 1HD1A 1CJKA 5B0BA 3T1YF 1P1TA 2LDYA 1SH3A 5L46A 5KFLA 2GHVC 5AXLA 2CNNB 4I2PB 4DR3J 3EICA 1CG2A 1JNRB 4BLGA 4CO1A 4N5SA 4F4YA 4HLBA 4XDDA 5HN0A 1HBOB 1TV6A 1X4FA 5A76A 3TUZC 1U1NA 3J81U 2B4OA 2XLKA 2CQ2A 2BM0A 2FZKB 3KKFA 1S6UA 2JEFA 4ED8A 4FYDA 2R7WA 1UWBB 1XERA 1ZTWA 2PSZA 3VGUA 2DRAA 4EZ9A 4C97A 1FF2A 3R6LB 3JSMB 4KGMA 1BQMB 1MWQA 4NA3A 5B0DA 1IVZA 2BMBA 4TU7A 2QA4G 4CH7A 4DR5F 3KHRA 2FVPA 3K5MA 1XK8A 1CQMA 2WZ1A 5B0FA 1IR0A 5KFMA 2CQ4A 1C4AA 4H4MB 2X1AA 1VQ8S 4B3RF 1QAXA 2FVSA 2N4CA 3JTNA 5K9FA 3Q22A 1I94F 1VI7A 4G3IA 3KUGA 5T7LB 3ULHA 4RNOA 4PZVA 3EUNA 8ATCB 4P2FA 5D0EA 1M5OC 2IAJB 3DLGA 1J5EJ 2J6UA 1UVIA 3T9ZA 6AT1B 3W3SA 4ES1A 1RDRA 3ITHA 2Z4PA 1E6VA 3QYYA 4C2MA 3HHDA 3PW0A 3J7ZT 4NWBA 4OZ1A 1M1GA 1WG1A 3WDOA 3J7YU 4DV4J 3BB5A 1KKHA 2ZFHA 3IFEA 1UFKA 1YRTA 2IJRA 4C8MA 4DX7A 4BC9A 1RTHA 2NQPA 2WSFC 4O3NA 1NHKL 1OQ3A 3BKUA 4TY9A 3HHKA 1NB2A 2AJ1A 3POTA 3JSMA 1VRTB 3I31A 1SJQA 3K89A 5MAOA 4WCEQ 2KG0A 4FYVB 4ID5A 3HVRA 4NCGA 3PFOA 1H2UX 2Z2YB 5ETLA 2KJWA 1X8DA 2RU9A 3EXCX 1EETA 1J5OA 3E2EA 4KRWA 1VQ9S 3KLHA 3I82A 3N28A 3HFVA 4N77A 3V4MA 4H4MA 2MKJA 1RT5A 1S59A 2B5JA 2M70A 3P5BP 2NXEA 1U1MA 2A0FB 4B3TF 4P75A 1RT6B 4GVBA 2MHNA 2GFFA 4KSEB 3TVYA 5JUMA 3LP2A 3MEDB 2DXFA 5IXUA 5A2QY 5L1KA 5AXMA 2EG2A 4DL7A 4WPAA 1NJIT 2HHSA 3IGVA 4H4KC 2GHPA 4E2FB 2BV3A 4EBCA 2E1RA 3ZTPA 1IKWA 2DPIA 2GAGC 2L08A 1VBKA 1RCXB 2WONA 4CNZA 4LF9F 2J9DA 1S57A 1WACA 1JXEA 4LQ3A 2E9ZA 4W92B 3O3LA 4CM0A 4HTIA 5F8GA 2Y9HA 4DR6F 1CJTB 5LSRA 2W9AA 3SCLE 3EZ5A 2QG9B 4OZLA 2DK2A 3CCUS 5D3GA 8RUCA 4RUHA 3OFFA 4DFPA 1SC1B 2KB2A 2HZCA 3GFXA 4OX9F 3K5PA 3SFGA 1NXIA 2OFHX 3G71S 1ITPA 5CZXA 2K3KA 2MQMA 2R8HA 3X1LB 4WF9Q 2ROGA 3PFEA 5A8KA 2ZH2A 2FVCA 2VASA 4N7TA 2FLOA 2W9CB 3RAQA 4IH5A 2JFKA 5KFIA 5DQGA 1LWEB 2IDLA 2ZJPQ 1UVLA 2YWGA 4DX6A 4GKKJ 4JP8A 1DLOA 3PO5A 2ZM6F 2PA8D 3NWRA 2ZOFA 1LEOA 2H5IB 3Q83A 4NZ0A 1RWOB 3H20A 2L9DA 2VBXA 1REGX 4WBFA 1RTZA 2GMJA 2PDAA 3PXGa 4EO6A 1MLAA 5L39A 3I6PA 1Q95G 1F0XA 1GMWA 1M1HA 2VG5B 3C14B 4FKYA 3SIPB 5L9NA 3M2UA 5IWAJ 4OYWA 4ECWA 1X5PA 1S0NA 2BUNA 2CRLA 3WC2A 1HHQA 2PI5A 2PA3A 3CO9A 1FRIA 2MTLA 3J80Y 2EC0A 1NUEA 1C1CB 1XMBA 3DMJB 5A8RA 3JSBA 3UD3P 1FK9B 5E33A 2X1GA 4OYAA 3DHXA 4KO0A 5KG5A 1X5TA 2XHWA 3J7AN 5A2QU 4KBIA 4QPXA 2YNFA 3KWMA 3MPDA 3CNQP 2L41A 1AUDA 3PNIA 2RHQB 1S4EA 4P7VA 4G1IA 3M2RB 3DLHA 4ED7A 1NH7A 5G0RB 3SQGA 5IT0A 3NGDA 1OWXA 2CPFA 3LAKA 3NCRA 3HP6A 4K7QA 4RBVA 1D9FA 4JI1F 4I1TA 3FMWA 3DN9A 2MQNA 5DO2A 4CT9A 4ELVA 4Q8EA 2YKMA 2C2DA 4Q8FA 3FRZA 1O5JA 4YHHF 3A1YG 4DPTA 4X4VA 2V68A 1ELOA 2I1RA 4NI2B 3I56S 1UPMB 3D68A 4MAKA 3GYXB 3U7JA 4B02A 2W7PA 1KOHA 3VAKA 2E5LJ 2WVEA 1YRUA 2HHPA 2WAQD 3R7BB 1PC4A 3H8YA 2DY1A 1UVMA 1KVIA 1N5VA 2HIYA 4DV3F 3MAAB 5KFUA 4WFBQ 1GAOA 2C2MB 1I6JA 1TUVA 3UCGA 1NPKA 3ZZ0A 2H5EA 2ASYA 4DV2F 2DO0A 1RJJA 3P6YC 2C2ZB 1U8SA 3VF0B 4DV7F 1HD0A 5LMUJ 1CS4B 3FBBA 5GAEI 1M5HA 5D4LA 2DB1A 3CJ3A 2VQFJ 2JNJA 1PCAA 1EKSA 2AU0A 4RBTA 2DITA 2AGQA 4FF3A 4KKOA 3VAFA 2VU5A 2MJNA 2XWYA 2RKIA 1HR0J 1FDAA 1RLDA 3M2VA 3MF5A 3OSPA 1XIQA 2R7RA 1A6LA 4OX7A 1AA1B 1OMSA 3CJSA 2HVDA 2W2MP 4I69A 4YQWA 1LWCB 3SCIE 1FJ7A 5HVGA 2IC3A 4EYHB 5GAHU 1JNZB 2KHCA 2KO1A 3RB0A 2C3UA 5EUHA 3UDVA 2GVZA 3M6UA 4B9LA 4EMDA 4YFUA 4N76A 1YZ7A 3IRXA 2G9OA 1G3OA 4DV6J 4N47A 5L1JA 4CLTA 3PRBA 1F5BA 5IC4B 5C24A 4M95A 5IV4A 1NEEA 4L73A 3N4WA 5D8HB 1GXLA 3PJXA 2F4VJ 3HX9A 4KR0B 4Q2LA 1WKJA 2I0XA 5A8RB 4LSZB 2VONA 3GP9A 1F2GA 3PX0A 2V67A 1FFGB 4DN0A 4FYYB 4QIGA 1EQ0A 5H9EK 2RDDA 2BJ3A 3MM7B 1NBEB 4OMFG 2I2YA 2UUCJ 3FNNA 1C0UB 4DSJA 4I2PA 4LSNB 1FDNA 3DYAA 3BDPA 4QW9A 3JTOA 4R5PB 1ZPVA 4ICLB 3BN4A 1VRUA 3O8WA 1DQ8A 4FN5A 4ETZA 1ACMB 3FEYB 1X9SA 1FWLA 1LNQA 4OV6A 4V19J 3BBCA 2AD9A 3EJMA 2E5IA 1OPIA 1X4BA 4TY8B 4ZPDA 5JVGQ 4ED6A 4USMA 1E6YA 2BW2A 2G2YA 4DF8A
chains in the Genus database with same CATH topology
3EGNA 5HO4A 1S1XB 1TKDA 2F4VF 3HVTB 4QIFA 4IQXA 1X5SA 2PMHA 5F3ZA 4OJHA 1VBZA 5DDOC 1LKZA 3ZZUA 7FD1A 1WG4A 2MKIA 3KG0A 1VK8A 2MDAA 3T5KA 1FKAF 4OI1A 3HDSA 4LFCF 4XK8C 2KFYA 2ZH6A 2UUBF 3BGUA 4ZPTR 3C6UB 3OHBA 2WOMB 3S1TA 2P9CA 2LLZA 2PD1A 3R5AA 2BQUA 2IRXA 3DLLQ 4HT5A 2HHUA 4ZK7M 4K5SA 3CJ4A 1IBKF 3POTB 2R9LA 2PI4A 3RW7A 2DGWA 5B09A 4NLXA 1HW8A 2OPSB 2J9EA 4DG1A 3CC4S 2AP6A 2R2RA 4K50A 2F40A 2L9NA 3LP0A 1QSSA 4M63A 1FHTA 5EN1A 3DLEB 3MMAB 2DNMA 4A8SA 3SV4A 4PUOB 1JLFB 2DJWA 5LSOA 2COLA 1JKHB 3BF4A 3IS9B 1P1LA 5GAEU 1NK5A 1WI8A 3O1LA 1MWYA 2B9YA 1QE1A 1UW4A 5FLXY 1T94A 5DDPC 2HNDB 2U2FA 4O0IA 4XAKA 1M90T 3NWGA 2DNKA 1UJ6A 4WFZA 1HMVA 3M6WA 3M8PB 3MMCA 4UY8T 1TKXA 1E6VB 4IR9A 1ZPWX 2ZNYA 3M32B 4KHRA 3EZUA 2R7SA 2Q1LA 5KFZA 5A8WB 1FXDA 4KGKA 1L3VA 1SI9A 3CTRA 4QR2A 4U67Q 2YWKA 3H98A 4JI8F 4XPCA 4ILRA 2LEPA 4NA2A 4NYZA 4NXNF 1ZM9A 1HYSB 4OJGA 2W7OA 1AFIA 1JJHA 2VKRA 4LF4F 2E5GA 3PM9A 1XEZA 2IVFB 4PUOA 4HL9A 5KFKA 1VK3A 4MFBA 4MMOA 2KM8C 3MFIA 4R0EA 2V0NA 2G1DA 2M0GB 1BGXT 4E0DA 2DHSA 5KG1A 2O3DA 4OX8A 1X4EA 1S79A 3Q8PB 2VB6A 2I5JA 2XSJB 3CCJS 1IBLF 2HHHF 1U6BA 5C25B 3MECA 3GSDA 3FFIB 3R5BA 2DNPA 2OSRA 1D8ZA 4DL0C 2XLIA 3K0JA 4A8YA 1F5AA 3L7PA 2F7VA 2C3MA 4BDPA 2HNYA 5HLFA 2IVYA 3NS6A 2WB1D 3DFEA 3AA9A 1D1UA 2B3TB 1IJFB 1U09A 4IDKA 1JXLA 2W4DA 1T02A 1UKUA 4WE1B 1H3DA 1BY9A 3U02A 2RQCA 1FKOB 1IBMF 1FD8A 2EI5A 1S9EA 4NLRA 1NNDA 2PEHA 3H4DA 2GGPA 4CH1A 2CDQA 2JZ5A 3TI0A 1FT8A 4F2RA 3T6BA 1S0VA 2EFPA 3CCZA 1S9GB 3P49B 3JSYA 1VQKS 4JI0F 3PZPA 4OQJA 4RWXA 1Z1ZA 2F8MA 3PW5A 1CQNA 4F4XA 3BSCA 1IKXB 3QLHB 5B0CA 2ZNZA 4MYUA 1IQTA 1TKZB 4P6QA 4GC7A 1SH2A 4H4OB 2MQOA 3QGGA 1C0TB 3OTEA 3KTQA 3UQSA 1T05B 4NLDA 4ECUA 2OPQA 1W25A 4PG7A 2MQPA 2KJVA 1WHYA 1PC5A 2AX1A 2VFSA 3DRPB 4LJMA 1S1VA 1KVJA 2HRUA 4Q44A 1HA1A 2CQHA 3CCVS 4M5DA 3AQOA 2IAJA 3DLGB 2AYGA 2D3UA 3AY0A 4RBUA 3MR3A 1LK7A 5J1EB 2KH9A 3IN5A 1SJ4P 1OSDA 2GO8A 4X4RA 4RW9A 4M1KA 2DGOA 4QR1A 2C3PA 4ZCKA 2R7XA 3OTDA 1OSCA 5D4OA 2MQLA 2V2KA 2CQPA 4M8LA 4F4WA 1JWWA 4FPRA 4QPTA 2EWHA 4J37A 4L6V3 3GE9A 1X4CA 4Y34A 1FNOA 1GT8A 4DSIA 2ZVSA 2NLWA 2UXDF 3BO2A 3H59A 4DV6F 3FEXB 1YVFA 3IR7B 1T7PA 2NPFA 1KTVA 1LW2A 1S6PB 2VKZG 4I2QA 3HFKA 1VQ5S 1IXKA 1RK8A 3T5JA 2ZJRQ 3N6LA 1Z2LA 3ZFVA 4CZCA 3QAEA 2DRBA 1GXUA 2YTCA 1T8EA 1LV5A 2C28A 1FDDA 4AYBD 1QTMA 4FF4A 2MZSA 2LXUA 1HBUA 3F41A 1OS5A 1T95A 3LP1B 1SV5A 1M0SA 2M2BA 3OTOF 1HWLA 4R0JA 4N41A 5CZVA 4AQYF 1YJRA 5SZTA 5DGBA 1CPZA 2IM1A 2KM8B 1D3WA 2D9OA 5KFXA 1S6QA 4ICLA 2HFOA 4K4ZA 1VHFA 2DNLA 1KFDA 2ATLA 2Z8QA 3HM9A 5GADI 3CIZA 3MM9A 4DS4A 3CCWA 2XSFA 4QBUA 1U45A 3B78A 1B7FA 2OTJS 1OQ6A 4X4TA 3PEJA 3FSIA 1M5PC 2BJEA 3N0VA 4NRUA 2LU2A 4PWDB 2DGVA 1J2VA 3MHYA 4XDCA 2YX7A 3D1QA 3CJKB 1S1XA 4WYLA 3MXHP 2HQ3A 5KFSA 4WKRA 4OHXA 3VAJA 2BACA 4C8LA 1TKZA 4J9LA 1TL4A 4QW8A 1JJ4A 1FCAA 5KFTA 5CA5A 4Y28C 1MSWD 5J2NA 2RRNA 1HBUB 2CZVC 2OJ3A 5J1PA 1VS3A 5E3CA 1EP4A 1ZAXA 4A8OA 3N01A 4IG3A 2J0WA 3V2UC 3IWXA 2MSSA 3TQ1A 1KR4A 2VFTA 3EPGA 3GV7B 2HFZA 3RYLA 1XNRF 5I42B 1S1TB 4QCLA 2EBEA 4LT6A 1PGZA 1JMTA 4KC5A 2ZZMA 1RI7A 3D5MA 3BQ0A 5A6PA 3DXBA 4DR3F 4IOBA 3UPFA 4DSKA 3CIMA 4R5PA 5F9LA 4B9TA 4BHQA 2JHEA 1DQAA 2K1RB 4ZMMA 4K4TA 1NK9A 3HZGA 2AGPA 5I3UB 4I0WA 2B0GA 3UE2A 4IOAQ 1S1UA 2HVZA 3K2YA 2F3JA 2UVWA 1SIZA 1Q53A 1N5QA 3LGNA 4MFBB 5E0OA 1ZM3A 1JLFA 3I55S 2WCXA 4BC7A 1RISA 2BRLA 2B6AB 4TLQA 3K57A 2EK1A 2OMLA 4B9NA 1QE1B 1TKTA 4JOUA 2XY5A 1W2BR 3OUYB 1O8BA 2YH0A 2XY7A 2ACYA 2MJUA 4ID5B 4ZCIA 3B8HA 1FA0A 5D4NA 3WBZA 1DARA 3M32A 3K5OA 2XGQA 1X4DA 4QWAA 1KD1T 1DQ9A 3VAHA 4OL8A 2KYZA 4BS2A 4ILLA 4AL6A 2RF2A 3NAHA 4HI1A 1FEHA 3MM8B 3CCMS 1H98A 1SKRA 5DG7A 3CJKA 3K7RA 1NU4A 3TVKA 2RQKA 1L3UA 1RP5A 4F67A 3LP2B 1N34F 2P9EA 3V81B 3LP0B 2R7QA 5CCMA 1X9MA 2FJWA 3DXSX 1F5CA 4C7QA 2Q3PA 3D2WA 2HS4A 5AE1A 2R8JA 2MHEA 2W24A 4QU7A 3QIDA 5HP1A 3DDKA 3I9ZA 2CPZA 4Z37A 1C1BA 3K59A 4A8WA 3G6ES 2NZ4A 4F8RA 7FDRA 3B4MA 4GKJF 5EX3A 2ASJA 2V8HA 1R8AA 4QYZJ 2ALZA 5K8NA 2UUCF 4ZDNA 1R7IA 2WW8A 2OD6A 4ITSA 3ENQA 1H38A 4KAIA 2OKQA 1XTZA 3KLIB 3MD3A 3OL6A 3DGPA 4NCBA 4TYBA 3VZHA 2J0SD 5KG2A 5GAGI 4NLYA 4JI3F 2UXBF 3CD0A 5JXSA 3RAMA 2HVIA 1RA6A 2K2PA 3MM7A 2DR7A 1VLYA 1ZZFA 3NNAA 4L3NA 4F2SA 1P9QC 4HKQA 4F02A 4NZ6A 2BJDA 3THPA 4PQUA 4JV5F 2GX8A 1FKPB 1LXJA 1NO8A 1RT3A 1G7CB 3NAIA 2ZC3A 2GV1A 2MKSA 4C8NA 3CCTA 3DU6A 1PILA 3R27A 2ZD1B 5J1NA 3IAM9 4K59A 3HK2A 4FF1A 4URSA 4D3HA 3MDFA 1KQGB 2IJNA 3DNCA 1FVQA 2G4BA 1TR0A 2JVOA 2O67A 3CWJA 3QWUA 2WBRA 1FK9A 4DLGA 1HNVB 3O44A 5AE2A 2YKAA 3DOLB 3SFUA 2HGLA 2J0XA 2DNNA 3W2VB 3JB9k 4I68A 4EBEA 2HHWA 4AE5A 2PMZD 1MU2A 2JVRA 3K8WA 4CI0B 4WIIA 4DF4A 3ISZA 1HHSA 1R89A 1LQ9A 3QJLA 2B9XA 1AW0A 4F4KA 3PEHA 4OHVA 3OW2R 2DR8A 4O4GA 2GQCA 1RT7A 4CO4A 5HBMB 4YB1P 4X64F 2KG1A 1UVJA 2DNQA 3Q8SB 2LXIA 4MK9A 2YKNA 4HH0A 4DV1F 3SDEB 2DCUB 4DLEA 4C8OA 3UNGC 1Q1KA 3PHEA 4PXCA 2Q79A 3LGMA 1N5TA 4Q43A 4DSFA 4O3SA 2WONB 3PR4A 3D28A 5FDLA 3ENWA 4CH0S 4DJBA 5CCLA 4OLOA 1S10A 4Q0BA 2VBWA 1IM4A 2UP1A 2J7KA 5HL7Q 3VWSA 5KT3A 1U48A 2XWXA 4UUWA 2D41A 1UJ4A 3NNCA 1CLFA 2FHKA 1IJEB 3ZZOA 3T5LA 4USJC 3CXCR 2OLWA 2DNRA 1NRKA 1Q7LB 1X4GA 1U1PA 4WU3A 4QZVB 2RT3A 2J6SA 2RNEA 1TFYA 1BWEA 2CIMA 4O4RA 1RTDB 3VCDA 4OZNA 3CVKA 2IBKA 3MM9B 3SDEA 1HNWF 3MZIA 2IYGA 5GADU 2JSXA 3GYNA 1DURA 1FNXH 3BSAA 4O23A 1TL1B 4AXJA 2RDIA 1YQHA 2A3JA 1YRXA 5JVHQ 4C8ZA 3HHLA 1BQMA 3MEKA 5AE3A 4RW8B 1SH0A 5T7LA 2ZHAA 3OL9A 2ASLA 3DMJA 4OZ5A 3SXLA 2ZH7A 5J2MA 1ZYQA 1CEZA 3DRYA 1RGVA 1NK0A 5F8MA 2V94A 5I3PA 3CPWR 2XMMA 2GA7A 4WK3A 3DI6A 5IWAF 3CCLS 2R2TA 1J5EF 1MMLA 4RU9A 3HT3A 4YB5A 5KFOA 3KK1B 3R1LA 2J76E 1IKYA 4NYPA 2MSTA 2RS2A 2ZHBA 3NMRA 5LXRA 2XNRA 5HBMA 2WTFA 4DV4F 2G0CA 2OSQA 2K1RA 2JEGA 1WHXA 2C2EA 3I4HX 2CPYA 1H2TZ 2PE8A 3RBEA 4HVZA 2F9JA 1X4HA 2ROPA 4KIAA 1Y5LB 2KN4A 2L3MA 2NPIA 2IM3A 3OFGA 1H7WA 1VGYA 2DHAA 1HBMA 1U1OA 1I1GA 2CVEA 5KFGA 2V4JB 2HS3A 3LAMA 3O6QA 3SCKE 3RB6A 2EG1A 3HVAA 4OZJA 4OHWA 1IKWB 1S4FA 5IT9Y 2WOMA 4IG3B 4IUFA 1IKYB 2RQ4A 5DS7A 5AXKA 3V6JA 3F56A 2DGUA 3PV8A 1OPZA 2KRRA 3HHEA 2DNZA 2YH1A 5KG7A 2W9CA 4PRFA 3M9MB 4Y0FA 4ZHRA 3AHPA 1RTJB 4DL6A 4TNOA 4LF8F 5DQIA 4WYWA 2B43A 5LMNF 5F8JA 4WFXA 3HLUA 2GIRA 3CDWA 2ERRA 1FE0A 1KRPA 1HI8A 4H54A 5KOXA 3MUMP 1JLEB 2FLNA 3D0GE 2R8GA 4YOEA 3PACA 1HNIB 1HNZF 2FHJA 2HNDA 1S1UB 4OX6A 5KG6A 3M1VB 2DT9A 4UQTA 3BEGB 3UR0A 1GQEA 2YNGA 4QOTA 2VH7A 2UV8A 2R7UA 3G6YA 3AH6A 2VG5A 2E9RX 1KNZA 2IM2A 2W25A 4RWWA 5EDWA 1VQNS 2XC9A 1T3NA 1YWXA 1UWBA 3IO1A 1HNVA 1R3NA 3BSNA 3QPIA 3MMBA 3ETOA 4FS1A 2P9GA 2XMKA 1KS2A 3N5FA 5KTQA 1VQ7S 2BOPA 5KAKA 1Q86T 1MU2B 1KQFB 4FF2A 3EXYA 4AUKA 5KT2A 5AJ3F 3R3TA 2J8AA 1KEKA 1Q79A 1LW0A 2QE5A 4Y2AA 2I38A 1U49A 3VAGA 3ZC4A 2CJKA 4X4PA 1V9OA 3ONQA 2EC0A 1MMNA 1R8BA 1S0MA 2HHVA 1KN6A 3LOUA 3N79A 1LXNA 5C42B 1D8YA 1RKIA 2VOPA 5HMWA 4DV5F 3A8EA 1WF0A 2OMOA 1YJ9S 3FDSA 3VAIA 1DFDA 2JEIA 3KLEA 4KV8B 2APOA 4A48A 5KT7A 3D1OA 2MMYA 3IG1A 3MECB 1RA7A 2K7JA 4J9SA 2B4PA 1YJWS 4DS5A 2QRRA 1P27B 2WSCC 4X4OA 2BZ2A 2RILA 3PKYA 1VBYA 1RT5B 3Q24A 3UDLA 1WTFA 5K5MA 1WHVA 5E3RA 3BREA 4HH1A 1Y9OA 1BLUA 1U1KA 4J9QA 2HAIA 3MPYA 2W4CA 4DG1B 4DN9A 5C42A 1R8CA 2IC3B 1KC8T 2XS7A 4CO2A 4RNNA 4LSLB 4DUZF 4EFAC 5BYRA 3OPKA 2J9CA 3AAWB 1FNMA 2QO3A 3MM5A 3GR1A 3VAMA 4DL3A 2UVUA 2QA1A 4RW6A 4ES3A 3DLJA 2RJZA 4ILMA 1MW7A 1S7HA 1X9WA 5E3QA 2HS0A 3T19A 2LA6A 3BN7A 2X1FA 1S1WB 2ZE2A 1JK9B 4QWDA 3T3FA 1Y3JA 3FQLA 3G9CA 3DOKB 1UVNA 3S6EA 1R0AA 3CF5Q 1QAJA 3MPVA 3NG8A 3GB0A 4YR0A 2JEJA 3FSXA 3BSOA 2CJBA 3UWTA 3FEZA 4F25A 2FGOA 4OI4A 4J9NA 2V9WA 2WK4A 5CYMB 2E66A 2FGCA 2NS1B 4U7CA 1TKTB 3OVSA 1GTEA 3V5RA 3BJYA 4F4ZA 3OQ2A 3P96A 3H40A 3OL8A 3GFYA 1DTQB 1K1QA 3M2UB 1QVFR 3H25A 4OZ0A 1KLMA 2LXFA 5KFBA 3KJVB 5DDRC 4QWBA 1HI0P 1S6PA 4I2QB 4ECXA 4C98A 4B9MA 1VIOA 3CEDA 1C2PA 2Y1RI 3TA0A 2X1BA 3C66A 4RZRA 4KO0B 4Y2IA 5A6WA 3M30A 5KFVA 1OO0B 3KLGB 3E3XA 2QEXS 1U25A 2O1PA 4I64A 3G86A 4NMLA 1S99A 2VG6A 2Q6CA 5D6GA 2JX2A 3U1NA