4CO3A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
104
Chain Sequence
b'MKLVMAIIKPFKLDEVREALTSLGIGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
molecule tags Signaling protein
publication title Structure and thermodynamics of effector molecule binding to the nitrogen signal transduction PII protein GlnZ from Azospirillum brasilense.
pubmed doi rcsb
total genus 18
structure length 104
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co3A00
4CO4A 2J9CA 5DS7A 3TA1A 3O5TB 4C3LA 4CO2A 1QY7A 2J9EA 3GSDA 2XBPA 4C3MA 3OPKA 1NH8A 3M05A 2ZOMA 2J9DA 4NYOA 4USJC 4E98A 4ZK7M 2PIIA 1J2VA 1OSCA 1Q1KA 3MHYA 2NUUG 1UMJA 4RX6A 4OZNA 5L9NA 1XK8A 4D3HA 4RLEA 4C3KA 3NCRA 3CE8A 1NAQA 2XZWA 1O51A 3AH6A 2GX8A 1VHFA 2GW8A 5D4OA 4WK3A 4NYPA 4R25A 4YB6A 4IYQA 3BZQA 4YB5A 5DRKA 2O66A 2V5HG 1H3DA 2CZ4A 4Y6IA 5D4NA 1V9OA 1UKUA 4WK1A 4CO0A 4D3GA 4YB7A 4CNYA 1GNKA 1V3RA 4CNZA 1HWUA 1KR4A 1V6HA 2O67A 3AA8A 3TA0A 3AA9A 2JJ4D 3AHPA 2EG2A 3TA2A 3NCPA 3N5BA 4AFFA 2GNKA 1NZAA 2XG8A 4CO1A 2DCLA 3NCQA 1UL3A 3O8WA 3T9ZA 4CO5A 4CO3A 2NS1B 2Z0GA 2EG1A 1V3SA 2XULA 1PILA 3HLUA 2ZFHA 4OZJA 5D4PA 1UFLA 4RWWA 1NH7A 3LF0A 5D4LA 3X3UA 4USHA 1VFJA 4RWXA 4USIA 3DFEA 2VD3A 1P1LA 4OZLA 4Y65A 2RD5C 2J9DE 3L7PA 2E66A 2NUHA 1O5JA
chains in the Genus database with same CATH superfamily
5ETQA 3CD7A 5FIIA 3ENAA 4ZLPA 3DLHA 1P27B 3HD2A 2CQIA 4ZCLA 3SDEB 3Q23A 4KH1B 2ZC4A 1QAJA 2LQ9A 3AD8C 4P52A 3T5KA 4RU9A 4CO2A 3K58A 3V81B 1TZ0A 2MKJA 3BPDA 3FBFA 4I6WA 5BYQA 5ETVA 5J2PB 4Q45A 4F4YA 3DLLQ 3SDEA 4DL7A 5H9EK 2AQ4A 4JYAJ 3OPKA 2AJQA 3UR0A 5IT9U 2YKOA 3ILIA 4YDDB 2YPZA 1HQ2A 3DRYA 3GU0A 4Y2KA 4WE1A 4XAKA 3PIPQ 2HFZA 2L41A 4FF2A 2Z2LA 2APOA 4PXBA 3HI9A 2UUTA 4X84A 3M2VB 1RT7A 2KHCA 1Q1KA 3SCJE 1N6QA 3MM7A 2CPXA 4Q0BB 5CH7B 4LT6A 1NDKA 2V4JB 1U47A 3NL0A 5KFOA 4OI0A 1NU4A 1Q0NA 2XMVA 4FPIA 4KC5A 3KHRA 4C3KA 4FYDA 4CYUB 4QCLA 2J5AA 1S9EB 3DXBA 1FKOB 2V9KA 3HSDA 3THTA 1AFJA 4RBVA 1Q8LA 1X4EA 5D4OA 4A8KA 4URQU 1Q4RA 4R25A 1XR7A 4BBYA 4WWSA 2AEFA 3C8YA 1N0UA 4OHYA 3EGWB 5THWA 1ZPVA 1XMQJ 1U2CA 1KONA 4CIOA 2JSXA 4LF6J 1FO1A 4OX7A 4C2MA 3PHTA 3GJSB 3KMSA 5AXLA 5DQGA 3HFKA 2DR6A 1LV5A 2XLJA 2V2VA 1F9EB 1VBXA 4BDPA 3AJ1A 4O4GA 1K73T 1REGX 2DHSA 3CC7S 2VB6A 2ZD1B 2DITA 1W26A 2VIHA 3W9IA 3CDAA 1F5AA 4PG4A 1CJUA 2QFJA 1SJQA 3QRRA 1G2EA 2JOQA 4OLOA 1T03B 5MLCV 1KQFB 3R5JB 3AJDA 3BO2A 2YWWA 3GFXA 4OIXA 4IRDA 1RWXB 3G86A 4RW7B 3H4DA 1U7LA 3FZ2A 1SH0A 1NB7A 2R7RA 2LFVA 2BRKA 2MQLA 1P8GA 2PMHA 3D9BA 3UVJB 5EWEA 1FA0A 2HAFA 4JI2F 2O1PA 4C8OA 1N5TA 1S1XA 4ZP7A 1TAQA 3FRZA 1X4HA 3VQTA 3DYAA 1KVKA 2YVSA 2CFXA 1Q7YT 3HMJG 4ED6A 2CA9A 4JI7J 3ET6A 1LWXA 3NWGA 4QWAA 2HHWA 3QIPA 1V3SA 3E2EA 5DM6Q 3PTWA 4JBCA 3K5OA 4DN9A 3GPAA 4X4UA 1S1VA 5IWAJ 5J2MA 1NSKL 1P9QC 2DNLA 2IM0A 5IQQA 5CAAA 3N01A 4Y34A 4BC9A 1HQUB 5A8RA 4OJHA 1TL1A 2E5IA 1YSJA 4I67A 3LF0A 4ZVEA 2MZQA 3GQCA 1HNWJ 1S6QB 5D0RA 4C97A 3TQ1A 3H5SA 1CC7A 2P5VA 2BZ2A 1MMNA 2I5JB 3MAHA 1RYSA 1IWAA 2R7QA 5CA5A 1NKBA 4Z2XA 1HBOB 2UU9J 3P5BP 2XB2D 3VVUA 3NNHA 2CJBA 3VGSA 3KMQA 4CH0S 2HW3A 3T6JA 1C1BA 4K2XA 4MAKA 1MN9A 1TKZA 1TL3A 3HULA 1CEZA 4R0JA 3DGVA 1IBLF 4WTYA 3UO0A 5HO4A 1RHKB 4JV5F 1PYOB 1Q5YA 2CNLB 4IH7A 3IFEA 1KFSA 3OR1A 3EZ5A 3HHKA 1VQ4S 3GZ7A 1PJ6A 4P2SA 1TVRA 1S97A 1NKEA 2JRSA 5IS2A 2XI2A 1U1PA 4JOUA 2VQEJ 1FERA 2ZEJA 3FBCA 1HBMB 4HHUA 1VYAA 3ZZZA 2XY6A 2DR5A 1UVNA 2AD9A 3TA1A 1Y3KA 4UT4A 4USVA 3IN5A 3J80Y 1SIZA 1DHMA 1KKHA 1S79A 1OY9A 1T7PA 2IVYA 1UEKA 4F67A 1HBMA 2J0XA 3MR3A 4ZPCA 5JXSA 5F8MA 3KUGA 4TY8A 1VQ9S 4DSJA 1E6YB 1GX5A 1PCAA 2Q79A 1D8YA 2AKWB 2QGFB 3I5CA 4ER8A 3OR1B 2R42A 3PFEA 1U4BA 4ZVUB 4ZCIA 3DXSX 1LKZA 4I1TA 1VRTB 3MHYA 2OSRA 5HI7A 2GAGC 4PQAA 1XEZA 1SL2A 4OL8A 3CO0P 2CG8A 3NEKA 3D6FB 1S4EA 1B3TA 2DGUA 4K7QA 3W62A 5B0BA 5L9NA 2KT5A 4K8RA 4X62F 2ZHAA 2CJKA 1JLEA 1PYSB 3FCWA 2KDOA 4QIGA 3UE2A 2Y9HA 1GX6A 3KLIB 5IWAF 1GMWD 1YHQS 3W8GA 4E8UA 3TARA 2DB1A 2VG6A 2CNOB 5D0HA 3ZTQA 1VC6A 4DX6A 1ZZNA 4MT1A 4GKJJ 1MROB 1QJHA 3DU5A 3BZQA 4J91A 4NLXA 4DCOB 4GKKF 1TL1B 2YPYA 3BYRA 2KTQA 1GMUA 4WZMA 5LXYA 1SQEA 1VJWA 5BXIA 3NKYA 3JQMA 4DV2F 3BGOP 1NCLA 2V8HA 1KWMA 3CULA 3C15B 1JQGA 3DRSB 1H7WA 3M1VA 2RB7A 4EUVA 4Y2MA 4A8SA 2HHVA 1IKYB 2MLXA 1DBDA 5KFTA 1IKWB 3G6VA 3TAPA 1HR0J 1S1TB 3BGRA 4WZQA 1NLKL 1GNKA 2CG4A 3HJFA 2LLZA 4UOHA 3S8SA 1IN0A 4JB8B 3PG9A 3TYTA 4DOZA 4FDFA 2FY8A 3VZIA 1YK9A 2B7CB 3CWJA 4C48A 3CIZA 2F8HA 3BKTA 1WJ9A 3DDNA 3FBBA 4QW9A 3Q8SB 4K4XA 2OTJS 4WFXA 1X4CA 1IUJA 4M63A 3W8PA 2M2BA 4AFFA 3OXFA 4LF9F 5DG7A 1TUVA 3IBCB 3ONQA 2NZCA 1QE1A 3NGTA 5JUMA 4LFAF 3CJKB 4JI1J 4KHPJ 4YUDA 2H3EB 1VDHA 1PC4A 2F63A 1LNQA 2Z8QA 1RTHA 1JXEA 2CQ1A 3OTCA 2B5JA 7FDRA 2IAJB 4A47A 2Z0GA 3ILJA 3O44A 2R7SA 4EI2A 1U1QA 3R1HA 4ZJLA 2ZBRA 2JC0A 1JX4A 4DWIA 1EB0A 3HXMA 4XO0A 1QSYA 2D74B 2ZBIA 1DRZA 1QLNA 1QTMA 3Q8PB 4ZVOB 4B3SF 4DV5F 2A2CA 4HLBA 1L3UA 2UXDJ 3DCAA 2L9NA 2YWEA 3EVWA 2I2YA 2NZ4A 3HZEA 3F0NA 4KR0B 2VPZB 1S1UB 2BKNA 5K5MA 5D3GA 1XR6A 2YQ1A 5K8NA 4F2SA 1H74A 4U7UD 1ZZFA 2K3KA 2RKIA 2WHOA 3BDEA 1UCNA 2KJVA 2CJ9A 3AOCA 4YR2A 4PQUB 2DGXA 3BGLA 4F4XA 3JYTB 3TOQA 1VQ7S 4GC7A 4H4MB 1N56A 2Z30B 4QYZJ 2VICA 5LJ3Y 4X4QA 1HR0F 1RXOB 1Y11A 3FBEA 2ACYA 2H4WB 2E7WA 1ACMB 4WE1B 2KVQE 1C1CB 1UVLA 1DARA 2J9CA 3BN4A 2OUGA 4G65A 3CCZA 1N36F 1SUQB 1ROFA 2A6MA 2IMOA 1X5PA 3VTIA 3D2WA 1T0TV 3JSYA 1BE4A 4QBUA 4I7FB 4L72B 4DL0C 3CJQA 1KTVA 5LSRA 3QGIA 4QWCA 3TEGA 1FFWB 1SKWA 3G9CA 1XNQJ 2PN6A 4DR5F 4WBFA 2PMZD 4B3RF 2ZOMA 4YP3A 5LMUF 5H9FK 2PFFB 1SCJB 1FK9B 2OPSB 1HWIA 2OEMA 5LXRA 4ECUA 2NSBA 4O44A 3CSKA 5KT7A 1N0VC 2MQQA 2PIIA 3JAMU 2IFXA 1M5OC 3HT0A 1RAOA 2GAHC 2MJNA 1OY6A 2CPIA 1R0BG 1I94J 3W3SA 2YX1A 2V63A 4N41A 1CJTA 1C1BB 4NCGA 1RU2A 1FNMA 1RT5A 4CLSA 2AJ0A 2ASDA 2DR9A 3WX4A 2VODA 3NGKA 2V67A 1RWPB 3LPYA 2HPUA 3EJMA 3KUEA 5DM7Q 3SBMA 4U7UK 3BKUA 4B3TF 1LW2A 3P4UB 1IJFB 2MQOA 1H38A 2CQ0A 1N5YA 4YB5A 4X4SA 1NDCA 3HSZA 4DV2J 3VALA 3BSAA 1C0UA 3LW5C 3UI3A 4WTOB 1X5SA 3F73A 4IDKB 4AXJA 2WW8A 4P75A 2GIQA 5CYJA 2HNDB 4UQGA 4YY3J 2FZCB 4DSIA 3CD6S 5J2MB 4J9QA 1R7IA 2AZ3A 4DUTA 5HL7Q 1D3WA 2BQRA 1OMSA 3TR5A 4DQRA 2K3IA 2J7WA 1EARA 5EUHA 2XHWA 3R97A 1S10A 4JI3J 2QN6B 1YTYA 3OHBA 1UAWA 1NHKL 2OP5A 3Q8QB 1ZS6A 3HHEA 4DR2J 4NCAA 3PKMA 2GVDA 3DRRB 4DCJB 5A76A 3CCQS 2FJVA 4EBCA 2R8KA 3DOMA 2NXEA 2W9BA 1B70B 1DJ0A 1RT6A 2KM8C 2R7TA 3MM9A 1HNIA 1S1WB 1VIXA 2GVZA 3I6PA 2VU5A 4HTJA 3QLHB 4LQ9A 4ECXA 3DGPA 2OGUA 3B4DA 3MM9B 1RWOB 3OL8A 3C6TB 1R43A 2VFVA 4KHMA 1H98A 1NZAA 5KT2A 2V8DA 3VCDA 3GV8B 1XIQA 2CPJA 1M1GA 4JI1F 3KLFA 1PBUA 1R6VA 5KFVA 3MDFA 2DCLA 2E1CA 4WIIA 1XBWA 1CULA 4C8NA 4BLGA 4U8YA 5GAEU 4J9OA 2M88A 4M5HA 1J5OA 4AL6A 4IG0A 3ITHB 4ED1A 5J2QA 4PXDA 5CZVA 4DF8A 1UZDA 4C8ZA 4GC6A 1BXNA 4LFCF 3B54A 4AQYJ 5A8WB 4LMZA 3OR2B 5KFQA 2V34A 1U09A 5IT4A 2LYVA 1W2IA 3KFWX 2FC8A 3W63A 2DNOA 3EZOA 2QX0A 2FJEB 3CJ8A 1QTNB 2B51A 3H42A 3QWPA 2VC0A 5MAOA 3FSIA 2MKSA 5GVQA 1OSDA 2FDNA 3D67A 1LXNA 1RE1B 2I6WA 4ZKAA 3PZPA 3RJMB 3T1YJ 2DGOA 2QE5A 2LQ8A 4PWDA 3DDIA 3M8QB 3NG8A 4KKOB 1RHUB 3OVSA 8ATCB 3Q22A 1SBRA 2MKHA 3MM6B 4NZ7A 1TUGB 4OI4A 4R8UA 4RPFA 5J2NA 2QL5B 3QT7A 1UP1A 1T9XA 1LWFA 4WIQA 2YKQA 3BO3A 1QVGR 1UFKA 2OKQA 4KKOA 2ZH3A 3MGJA 5KG5A 3LP1A 3I4PA 1XWLA 2NYIA 2OEKA 1KVJA 4M5NA 2MKCA 3TW0A 5C24B 4FF1A 2M4MA 5B0EA 4F4KA 4XDDA 5HMZA 1HFEL 4NXNJ 1S77D 2JLEA 4CM0A 1SUQA 2PGCA 1LWFB 5DGAA 1MN7A 1RT3A 5KT4A 1XNRF 1QSLA 1KOHA 2E5HA 3GYXB 2GS8A 3V4MA 4AD6A 3H2LA 4E98A 3VAMA 1WHWA 3LP2B 1J2VA 1OSCA 2JDJA 2R3VA 3IO1A 4J9VA 3M8QA 4RR5A 1T02A 3TZXA 4BCAA 2XLIA 1GTHA 4OV1A 5HROA 4KGKA 4JI0J 5FD1A 2AJFE 4WP8A 4OZNA 1F2GA 3HVRA 3Q83A 4ZN1A 4BHQA 4OHVA 1JB0C 2I1RA 5SUHA 3BQ1A 1S6OA 4ECSA 1KBRA 2DD8S 2WVEA 2YNFB 2HBZB 3U02A 4WFBQ 3K5NA 3FVYA 3TUJC 2ERRA 2MJUA 2XZWA 4JUZA 4EU0A 2HWIA 3PIOQ 4CCHA 3IM8A 3B78A 4IFYA 5I4MA 2R2UA 4ED3A 5HMYA 1X4BA 4YR3A 5E2QA 2Z2MA 2H5JB 2AMCB 5DDPC 4LVNP 4NLSA 3U7JA 1RT6B 1DTQB 4GO7X 5A8WA 2ZE2A 2CRLA 5F3TA 5FDLB 1UW9A 3ZZOA 4K2JA 4KPCA 4NLUA 4NRTA 1B0VA 4WFYA 3TJ8A 4KSEB 3TJ9A 3OTDA 4N8NA 2M52A 4OYOA 3OUYA 3OXGA 3UDEA 2EKNA 1P1TA 2BW2A 5AE3A 4YR0A 1K9MT 2UUBF 2F4VJ 1U2FA 4CNYA 1HI0P 2B8PA 2WB4A 2Z57B 1NBEB 4FXDA 1HKAA 1YRUA 3AA9A 2BJ7A 5KG7A 4YOEA 3BSCA 1SI9A 2B3TB 3C6TA 4MKBA 2KVIA 3RTVA 2RH3A 1HYSB 2WCXA 3W1YC 1MWYA 2KXNB 3N5FA 3W60A 1S76D 2MQ8A 4IRKA 1C0UB 2MKYA 3EUNA 4JI2J 3AT1B 5K8OA 4RUHA 4B3OB 3I31A 1HI8A 4OLPA 1UFWA 1RABB 2ZNZA 4ZVTB 3KJQB 1M1KT 7AT1B 3ISND 4UY85 2DGTA 1OWXA 4KJIA 1MMLA 4E0DA 3E51A 4C6AA 4NLTA 3SSSA 4RW6A 2IAJA 4R0EA 4TN2A 2M8DB 2C3YA 2YX7A 4ENOA 1ICEB 1W7WA 1H6KX 1RT5B 3DM2B 3NAIA 3KK1B 3BGUA 2EG1A 2C3OA 4FXVA 5L1LA 3OV7A 3D6HB 1XN9A 2MZJA 4GMKA 4B3MJ 3GIIA 2JEIA 1Q16B 3FGVA 4GVBB 2QT7A 1DQAA 2GV1A 2VDHA 2QYGA 1AROP 1HNWF 4I64A 2FIUA 2NYHA 3EXCX 3NAHA 2VFUA 4N8OA 2OI2A 2IYGA 1NEEA 3GCWP 3W66A 1Q8BA 2WRMA 5C5JA 4RNHA 3CJ0A 1MROA 1TL5A 2E9ZA 2EPIA 3RW6A 2KI2A 2N82B 3G96A 4C8YA 1JLGA 3I87A 3M9OB 1FXLA 2MHNA 2HVIA 2ZZTA 1UA1A 4G1QA 1B99A 2HKEA 2MTLA 1N52B 4U7CA 3NBPB 3UCGA 5KOXA 3A3NB 1UWAA 4ZVHA 2WTFA 3K59A 3EZUA 1JXVA 1NJYA 1JLFA 1SV5A 3MAAA 1JKHB 3DOKA 5LL6d 1RP5A 3JTPA 4LR8A 2A18A 4CM2A 2AJ2A 2H9ZA 1NZ8A 4LSNB 2IPOB 2RU9A 4QZVB 4YDXA 4PQUA 2QA1A 5CCLA 3H90A 4A8OA 4LF2A 4HH0A 2LXUA 1EQ0A 3CD0A 3RB0A 3KJFB 1JJ4A 4W92B 4PPDA 3ZO7A 4E2FB 4OI1A 1VC0A 1KOOA 3PEHA 3IS9A 1Q79A 5L9XA 3WZ0A 1X5OA 3LP0B 3KLIA 4DZ6A 5L46A 2XHCA 2WVBA 1NH8A 4NPOA 2GIRA 2X1AA 3B8HA 4KGZB 4DFKA 1URNA 1LFPA 2GJIA 1FJCA 2ZITA 4KFBA 2BKPA 3I5AA 2RS8A 3PHEA 3FCHA 4I6YA 1CPZA 5F8LA 4QJVA 2QV6A 2HWTA 4NRUA 2XMWA 4H4OB 2EK6A 4O23A 3U27A 4DUZF 2RKIB 3P3DA 4LFBF 4QU7A 4NXMF 2OPRB 4D3HA 3SI8A 5F9NA 3MR2A 2J0SD 2Y8YA 1HNXJ 2R7VA 3IC1A 3UCZP 4DL2A 3FZBA 5D15A 2LU2A 1NAQA 2RQ4A 2LDIA 4L76A 2ALZA 1OYDA 2XI3A 1UPMB 5DG9A 2HQDA 3OFGA 2XQCA 4F02A 3ZZYA 4CLKA 4ILMA 4DPXA 1S6QA 4B08A 1F60B 4LJMA 5ETPA 3T3FA 1OQ3A 3A4TA 4WKRA 3DI6B 3QPIA 2NCKL 4PPZA 4F4ZA 2ZOFA 2UUBJ 4J9LA 1S1VB 2C2OB 1G4CA 1XJWB 3MXHP 4QR2A 1GAOA 1T9YA 4UY8T 1EKSA 1RTJA 3MM5B 1V3RA 4UOGA 4A48A 3K8WA 3RBXA 2ATCB 1K1SA 4TYAA 1S1TA 3G82B 2CPZA 4L3KA 2HLUA 3ZZUA 3HT3A 2YNGB 2JJ4D 3OSNA 2DEIA 3J7YI 4WCEQ 4K4WA 2DKOB 1EHWA 3L4BC 1RTDA 1X4FA 2HVZA 3AD7C 3NCPA 2OIHA 4NEZA 1U2RA 8AT1B 1LK5A 2CDQA 1GXLA 4FXWA 4M1KA 3IR7B 2W9CA 4DL3A 1U45A 2HIQA 2DT9A 4ZS6A 1RTDB 2HRTA 4RW4B 3MR6A 3M8YA 4JV2A 1NXIA 1UEVA 5F9LA 1YJWS 5DQHA 1RCXB 2GHPA 2C2NA 2YNGA 1KD1T 3OL6A 4AL5A 4PKDB 5CXTA 3QAEA 4JI0F 4JV1A 4I68A 4DUYJ 2GHWA 5KG6A 2BJ8A 4DF4A 4CO3A 2W1BA 1WD6A 2XSJB 5A0YB 5ETTA 1D0EA 4WXOA 3UQSA 2SXLA 2XC9A 1M5PC 2BJDA 3KNGA 4QR1A 2W9CB 3NS6A 3CC2S 3FRYA 4RW7A 3OTOJ 1VQPS 1B7FA 2VPXB 3R3TA 5F0UA 4DR6J 3U1LA 2V68A 2ZKUA 4ID5B 5T14A 1D9DA 2PI4A 4GRSA 1VJQA 4B9NA 4RBUA 3SQOP 4DX8H 5HSPA 4DV4F 1RT1A 2Q1LA 3L7UA 3TANA 3FDSA 2EC0A 1FJ7A 3HKZD 3KLEA 1TUWA 3Q86A 3UDVA 1B0TA 1P1LA 1PBAA 1U1MA 2W24A 3I0RA 2FVPA 5M2UA 2D69A 2XYPB 3ISZA 5E3QA 1HHSA 4U96A 2V8VA 4WYWA 4KGVB 1D1UA 1RQ0A 3HO1A 2A0FB 1CC8A 2FB0A 3DMJB 5HMWA 3CCMS 4ZCKA 4QIFA 1FDAA 4H4OA 3SCLE 2J8SA 4WFZA 1MLAA 2QLXA 1RGVA 3M6XA 5IZHA 1M5VC 4P72A 3VAJA 3HDSA 3PJXA 2QLJB 4CH1A 2Y0BB 1N88A 1WG4A 3B82A 3Q0AA 2IBOA 2HG4A 2WSEC 2XEXA 5CD4A 1Q82T 3WBZA 1FRHA 2DY1A 2OHDA 2ASLA 2YWGA 1ZTWA 2PC6A 1F3FA 3GR1A 1CG2A 4OZ5A 1ZM2A 3H98A 3H5UA 3JQKA 5D0EA 5KFSA 3UW1A 5JVGQ 4CT8A 3TJAA 3W7BA 2MDAA 4DCPB 1GK8A 2HGLA 2JVRA 4RKUC 2ZJQQ 2RU3A 3EPGA 2DNKA 2W4CA 2YNIA 3MM7B 2HZVA 3S7RA 5KFDA 1EX8A 4DQPA 3OJUA 1AUSL 2DJWA 2E1MC 1TKXA 4DUZJ 1D9FA 3KUHA 4OX6A 4LFBJ 3ETMA 3MAQA 5B09A 2J6SA 2PMWA 2WK4A 4CLTA 5KFKA 2OO4A 2XS5A 1JJHA 3TRGA 4CWBA 4PUOB 4FF4A 4J5OA 2DH9A 1HBOA 1I51B 3NNCA 3UNGC 2ROEA 4M94A 2MYFA 2JL9A 2R2RA 5J2PA 3IS9B 1HD1A 4FNIA 4QIVA 2BXJA 4ES3A 6FDRA 4FYYB 3FSXA 3MMJA 1RAGB 1Y5IB 4MFBA 1K47A 1UJ5A 2VFRA 1IQZA 5GMKa 2FLLA 3TVKA 3BS9A 4KY3A 5F8GA 4LSNA 2CWXA 2Y0SD 2V69A 3BPSP 4PG7A 3MM6A 3N6MA 1JIHA 5E7OB 1T11A 2O66A 4NEYA 2VBYA 2WAQD 3W9JA 5SZTA 2CZ4A 3RYLA 2KG0A 6AT1B 3C6UA 4XDCA 3KK2B 1Y9OA 1XR5A 3GONA 5GAGI 3M9MB 4WK1A 2ZD1A 4WJBA 2D41A 3KDNA 4DV6J 3F56A 4NZ0A 3HHNB 1U25A 3DRPB 4JI6J 5KFEA 2HURA 2JWNA 1WELA 3SCIE 3TA0A 4RNNA 1FEEA 2YXLA 2Z4PA 2EG2A 3CW2C 3CJSA 3MURP 2QMXA 4F3OA 2ROGA 4LF7F 2RNEA 3DI6A 3W5XA 5LJ5Y 3DLGA 3VAGA 3IR6B 1NUEA 1YG0A 3PO5A 1MU2A 2BV3A 3G2XA 1ZAWA 1IKVB 2OH2A 3LA0A 4M5KA 4HEA9 3PXGa 2IM1A 4KGMA 5HQLA 1T03A 1LW0A 1UWBB 1C4AA 1DQ8A 3QQCD 2YQ3A 4GVBA 5B0GA 4J9NA 1HYSA 2CQ4A 1O6XA 4LQ3A 1RCOB 2R7WA 3MOZA 4NLVA 1FKOA 1S0MA 1HLWA 1R89A 1ZPWX 1RACB 2KU7A 3K2YA 4IR1A 4NXMJ 3C14B 2DHXA 2DNHA 4QU6A 2V4JA 4W90B 5ETKA 2CQDA 2IVMA 2HHUA 2CIMA 4RUBA 3R7NB 3H2VE 3KWMA 1XQIA 5IXUA 2LDYA 2WSFC 1LW0B 3OTOF 2BQ3A 4J9SA 4OYIA 4OZJA 3VV2B 4LFCJ 2W8KA 1FFGB 1FRJA 1HW9A 3NXZA 1TKTA 4IFVB 2FGOA 4Y3CA 3SQGB 2E5LF 5C25A 3GIMA 4LSZB 2LEAA 4OX9F 4YN3B 4DS4A 1U02A 1WDDA 2LCWA 2UP1A 2FJDB 1S9FA 2XSFA 3LP0A 3MPYA 2RVJA 4LR9A 4K0KJ 2UXCJ 1FFSB 2IJFA 1JLCA 1BQMB 1Q5VA 1UPPA 2AJ1A 1PYTA 4P6QA 5T7LB 3KLGB 2CYYA 1NK6A 1FTRA 2C2DA 4QWDA 1Z2LA 3AXMA 1AA1B 1GMVA 2FZKB 2QEXS 1PC5A 1X0PA 3KK3B 1YKWA 2NUHA 2PSZA 1N33F 3PYFA 3G8TA 2XY5A 2CZVC 1JLBB 4OI2A 5A6PA 3CCWA 3QT8A 3KK3A 1C0TA 3MEGA 4EBDA 2XY7A 4DSLA 2DHHA 4JI6F 3S01A 4H54A 1ZBTA 4U9RA 4IFYB 2QLWA 3VWSA 1TV6B 3QZ7A 1VLOA 3BDPA 4B3RJ 4X65J 5AJ3J 4QOTA 4B9VA 2VASA 1NDLA 2KHDA 1PGZA 4ZIWA 2HVEA 3OFEA 2ZBQA 4AT1B 1NPRA 1YX2A 2JZ5A 4LIWA 3MFIA 1RAFB 4IO1A 1L3KA 2HFSA 2OAUA 1NHUA 2C42A 1Y10A 4OHXA 1HMVA 2M3DA 1RDRA 2VOOA 2EWHA 1JMTA 3MTJA 4MYUA 1S7IA 1A7GE 3Q2SC 3OLBA 3MI7X 4CI0B 4PG5A 4WP3A 5D77A 1SH2A 3JS9A 2R7XA 1Y5NB 1H2VZ 3CVKA 4DPWA 1H7XA 3D0HE 5DZ7A 4N5SA 2JH3A 4TLRA 2GMHA 4X62J 3CEDA 4EO8A 3V5RA 4DL6A 4IG3B 1YGYA 3D3BJ 2RSQA 5C24A 2OMOA 4DV4J 4LREA 4X2BA 2VQFJ 2YKMA 3UFCX 4LRFA 1VHFA 2GW8A 4L73A 5ETLA 2ZH9A 3GG1A 3KTQA 3K89A 4AE5A 2ZUAA 3JAMY 5CCMA 4FP9A 1RHRB 4F0HA 3CDBA 1RT4B 3M30B 2AU0A 3JSRA 1TKDA 2F40A 2VPYB 4ELVA 4PYAA 2CQ3A 5KTQA 5J2QB 2NQPA 1JLAB 1N5SA 1RTZA 1SKUB 3C66A 3MR7A 1X9MA 1HBNA 4OI6A 4UOFA 4MKVA 3P45B 4DV7F 3AQOA 2MXYA 3PCOB 4CNZA 4PYDA 2L9WA 2CVEA 2WSCC 4XIUA 1IBKF 2DRAA 5ETRA 2EBGA 4W98A 3OVAA 4I2QB 3CDWA 4PXCA 5KG1A 4C0BA 3OUYB 2IMWP 2B43A 4AUKA 5KG2A 4FN5A 1WDTA 4G6VB 4LBHA 1UWBA 2P9GA 3N6LA 3SCKE 4ANDA 4F36A 1SL1A 5HBMB 3Q8YA 5HMXA 2DISA 2HNYB 3ZNJ1 2M70A 3R27A 3RU0A 1XMOF 4FF3A 2CJAA 3DLGB 2MKKA 3BSOA 2V4QA 4X66J 2ZWPA 2FVQA 4DV3J 1HWLA 4ED5A 1IM6A 1WC1A 2E5JA 2CKWA 1IKXB 2XYGB 1G7CB 2AGQA 1NJZA 2VDIA 3PYDA 4MFBB 4IO9Q 1F6TA 5FLXY 2KT3A 3G6XA 2AEMA 3JSBA 2E7XA 3G6ES 1C2PA 4ZPTR 1WOPA 3O8WA 4OYZA 2ZH7A 3T9ZA 5EHHA 2V9WA 3QSIA 1AT1B 3S6EA 5CABA 4WFAQ 2FLNA 2H5EA 4A46A 2BYCA 1F3VA 3M2RA 3R5BA 2OELA 2C2ZB 2XM3A 5JVHQ 3M7VA 1Y00A 2V2QA 5KT5A 2KH9A 5GAGU 1TKXB 3SV3A 2H4YB 2J0QD 2ZFHA 4Z37A 2DEJA 2J8AA 2VFTA 2W7OA 1L3VA 2IDEA 4IDKA 2XMTA 3PRVA 2VF3A 2ZC3A 2B9WA 1R8HA 5H9EJ 1DQ9A 5D4LA 2GA7A 1LXJA 3SSRA 1S9GA 1RKJA 1AXQA 4KT0C 2CJXB 1YJRA 3DRRA 3HX9A 3NP5A 4RL1A 4USIA 1SC3B 1U0HB 3DFEA 5E5NA 8RUCA 1R3NA 2X51A 1IBMJ 5DJBA 2ZVIA 3A3PB 4RO0A 4PR6A 4K50A 1X9SA 2VBXA 5HATA 1P9YA 5B0FA 4ZP8A 5IFMA 3O6QA 2QMWA 2DNZA 3K17A 5A8KA 1BQNA 5J1EB 1VRUB 2G0JA 2H48B 2JLGA 1FKPA 2L3MA 3KJNB 3MF5A 4KAIA 3TX8A 2K1RA 3SYZA 2WBRA 5DGBA 5KG3A 4DDFA 2RRAA 2DHGA 3EXYA 4CO4A 3DMJA 1KLNA 4P7TA 3ICLA 5CYQA 2YTCA 1FESA 4DQQA 2HQ3A 5AJ3F 3EGZA 4KHRA 1IBCB 1BLUA 2PEBA 3I0RB 4F0KA 5I42A 3AFGA 2EC2A 4DBQA 4ES1A 3EWGA 4C8LA 2HK2A 1ITPA 2E44A 4UW2A 2KYXA 2GO9A 1R8PA 3IWXA 1MWQA 4K4ZA 1ZM9A 1V5VA 3I4HX 4DR5J 1TMMA 2DVIA 2P8IA 2Y1LB 4OJ3A 5LT5A 3KLVA 3HFVA 4OYWA 5FLXU 1X4GA 1NK8A 2HFVA 1TU0B 2LU1A 2GJ2A 3D1QA 2CQBA 1XK8A 2BE2B 5ITHA 1N4LA 5CHCB 1SC6A 5D78A 1JLQA 1EP4A 2WONA 3V6KA 3JB9k 5KFHA 3HP6A 3AB2B 3KNAA 2AYEA 3WX8A 2W2QP 3MR5A 1VBYA 2CQ2A 3W5YA 3DOLA 3T5LA 3IG1A 1GMWA 2QO3A 4MTPA 4K0KF 2XCPA 2D3ZA 1RBLA 1LWEB 2F5GA 2P6SA 2V2ZA 5I3UB 4QIWD 5AXMA 5C42B 5K9FA 4QYRA 4LRBA 2XSJA 1L3TA 1UKUA 2FJWA 2R2TA 2MQMA 1RAHB 3PVXA 2R7UA 1FVSA 3C19A 2VG7B 1JLGB 3CJ2A 1YITS 3RGIA 3TVZA 4X64J 3R2DJ 5GMDA 1Q8IA 2E5GA 3SFUA 1XERA 1IQTA 3OVBA 2V4RA 1IR2A 1QE1B 1FJEB 1YJTA 3THVA 2KG1A 4RJVA 2RILA 1R8AA 2DNMA 1MWZA 2JVOA 3P6YC 4URGA 2QA4S 1U1OA 4ERDA 3M6UA 2DR8A 3N5BA 3NS5A 1ELOA 1OS5A 2BMBA 4Q2MA 4KBIA 1YBUA 4NL5A 5DDQC 3P5TL 2DNRA 4RW9B 1GXUA 1EKRA 4ZVPB 3OSPA 1FKAF 2GIFA 5K14A 1BMQB 4IOCQ 3I9ZA 3N0VA 3CD5A 2FQQB 3UN2A 4R5PB 2V2KA 3CJ3A 1S6PA 4RW9A 3G8SA 2DPJA 3C16B 5LSLA 1QSSA 2UUAF 2D9PA 1XTZA 1O8BA 4N47A 4LF1A 1UVJA 2P2CB 2DBBA 1TL7B 1B7YB 2K7KA 3TWZA 1IVZA 1X7VA 2NSCA 4O3NA 3QO9A 1EETB 2VQFF 5IOLA 5DLGA 2BJ3A 2EI5A 2FHJA 5HVFA 2N7YA 2VH7A 5C2GA 3TAMA 4USHA 4MH8A 4RWXA 2RRBA 3OHAA 5ADZA 3DLEA 5DDRC 1F1BB 1T95A 2CWKA 2UUWA 3DOLB 3QIDA 2C3UA 2C1EB 4I7FA 4KQZA 4JV0A 2DRBA 4B9LA 2BACA 4LR7A 2YNHB 1IKWA 2HS3A 1OYEA 1R8CA 2IM3A 2W9AA 2E66A 3K5LA 2D1CA 4DV7J 3T1YF 2DHAA 1M5HA 2IBKA 4LF4F 1RHQB 4DQSA 1YRXA 2FHJD 2MLZA 5I3UA 1LWEA 2K7JA 1JLFB 6FD1A 3T1AA 2PEHA 3RZAA 4TU9A 5LMNJ 2OSQA 2ZWOA 4P2FA 4ECRA 1NK5A 2VOPA 1Y7PA 1GQEA 4OZ1A 1XMBA 2BE9B 1N34J 1S4FA 3GYNA 1RK8A 3QT6A 2PI5A 1EAYC 1UETA 2ZBPA 5GAEI 1WC3A 3H59A 1ZYQA 2ZBCA 3FC9A 1VQ6S 1QY7A 4HKQA 2H5IB 1FJGJ 1T05B 2B9EA 2OFHX 3D54A 1Q95G 2CQHA 2QLFB 2RUSA 3WC0A 2ZH5A 4V19J 2WW4A 3M32B 1NKCA 5EGYA 2LECA 1RWVB 4JI7F 1QD1A 1SVDA 1SV5B 3TO8A 1VRTA 1FD8A 4FNHA 4F4WA 3SV4A 4ZK7M 2OLWA 4AXIA 2EBEA 3QBCA 4LF5J 5KAKA 2D9OA 1WI6A 1RT3B 2C2MB 2PD1A 2RJZA 3DRXA 3GYGA 3H8YA 3HKWA 3GJRB 3NGUA 4Y00A 4CDIA 3OXLA 4MKYA 2ZM6J 1RHMB 5A8KB 2E1RA 3GILA 2X1BA 2G1DA 4F04B 3OL7A 3CXCR 4PAAA 3A8IA 3V4IA 1WNEA 1BWEA 3RRKA 4CLFA 5B0AA 3EVMA 1VQ5S 2L48A 1TK8A 2AX1A 4MJKA 3AH6A 4ZVRB 4DV0F 3HZGA 1NSAA 1WF1A 3AOBA 2YH0A 5CYQB 3CMAS 1EETA 1I1GA 1S9GB 1YIJS 2GQQA 1R6YA 2HZCA 4NA3A 1GEHA 4HL9A 2A1BA 2FPHX 3HPOA 3C16A 2M0GB 3M4XA 2UVUA 2DK2A 2WVDA 3KK1A 4P2XA 1LEOA 2LEBA 2C22A 1U26A 1K0TA 3IWLA 2Q3PA 2LXFA 5KFAA 1DLOB 1Q78A 4O4RA 5KT6A 5KT3A 2YWFA 3GLJA 2NXCA 4X64F 1VC5A 2CNNB 4KV8B 1Y4ZB 1U8SA 1J5OB 1JXLA 2MQPA 3OFHA 1S0NA 1RAJA 4ZITA 3CB4A 3FFIA 1VK3A 2IHR1 4GVLA 1RU1A 2KXFA 3CJRA 4I69A 2BOAA 2I8EA 5B0CA 5KFGA 2UUCJ 3QRQA 1JJCB 3PRBA 3R6GB 4LBPA 4RZRA 2QRRA 3AD9C 4ILLA 5HBMA 2BJEA 4O3OA 1BHNA 1PG5B 2HIYA 4I2PA 2J6TA 1SIWB 3BGFA 1CULB 4F0MA 4Q2LA 5C2CA 4LF9J 4UZCA 1F2HA 3V6JA 2AX0A 2JHEA 4JI5F 4KTQA 1U1LA 1JLEB 3AY0A 4ZVSB 1I5OB 2NS1B 4HH1A 4L74A 2UUAJ 3HSJA 4OJGA 1E6VB 2A2DA 2W4DA 4B3MF 2A6OA 3LP2A 1X0FA 3P49B 3ZZRA 1PILA 4HACB 1ZTTA 1DFDA 1UFLA 1UW4A 4KB7A 5DZ6A 4OZ3A 4GKJF 2XGQA 3BEGB 2XCAA 3J81U 2N3LA 3L95X 1FT8A 4ECYA 1RHJB 3M8WA 3Q8UA 4OYMA 3S1TA 3ZFVA 4NA1A 3PNIA 5AXKA 3GIJA 1FCAA 1R31A 3VHQA 1GFWB 3BYPA 1S48A 4MKAA 1TTHB 1RWUA 4DFJA 4LF4J 3A8JA 3JSMB 3PW2A 4A8FA 5KFWA 3IBFB 4NLPA 3MEEA 1RADB 2HNDA 3OTBA 5LMNF 1AB8A 4IUFA 4DR3J 2J7UA 3EDRB 4ZPWR 1RT7B 1IM4A 2KRRA 3ZZPA 4ZJQA 1HW8A 5B7WA 2D3OR 2PA8D 2ZDPA 5L8RC 4DR2F 2C3MA 2O5DA 4X65F 4YMEA 2AF6A 2W8LA 1QUVA 5EX0A 1S72S 2J0WA 3MD1A 1UEUA 3MTKA 2AGOA 1WSRA 2UZAA 1SQFA 3MUTP 3KHHA 4C3MA 3CCSS 3RRHA 2FJXA 1U6FA 2F3JA 1Q81T 1RA6A 3D66A 1VHIA 3EGNA 5IQ6A 2J9DA 4WFNQ 3OR2A 5HP1A 1KHWA 3W9HA 4FBTA 4ES2A 4ZLLA 4Q7AA 2RQCA 2DO0A 2HLTA 3W2WA 3PEJA 3HM9A 4EYIB 4CTAA 1QVFR 2DNYA 3E01B 2LQ5A 2MZSA 4TKTA 4DZDA 4RUCA 1FXDA 2C2RA 1T8EA 4JI5J 4XTTA 1HMVB 2NUUG 4IRCA 5KFRA 1U1RA 4ED7A 3GFHA 2OMLA 3WHIA 5BR8F 4M5MA 3PW7A 4NCBA 1HBUB 2F8EX 2BM0A 2VG5A 3NOGA 3PX6A 3KLGA 3IXQA 1H72C 5AT1B 4YS2A 2ADBA 4ECQA 5KOWA 1C4CA 4ZPVR 1TV6A 5E3CA 5EX3A 4CRJA 1D8ZA 2VJVA 1RLDA 2YKAA 1UTAA 1MG7A 3VAFA 4CLLA 1VR6A 2X7IA 3K7RA 1HNIB 3IRXA 4ZVQB 3FMWA 5C25B 2MMYA 5DRKA 1PO6A 5KFLA 3D6MB 3IGVA 4K59A 3W5ZA 4LRCA 1W25A 4CLUA 4J9PA 1FX2A 2NXJA 3CDEA 4YY3F 2KZMA 2HAIA 3KHLA 2XS7A 4RW8B 3KKFA 3P96A 1J27A 1M5KC 4DI6A 4OJ1A 4YB7A 2FY1A 1UJ6A 2KXHA 3LGMA 5GMEA 2UXBF 1HWUA 1KR4A 2O67A 3AA8A 3CTRA 1V5IB 1WTFA 4QPXA 1N36J 1TFWA 2OEJA 1HNVB 1RLCL 2ILZA 2RF2B 2PDAA 3PX0A 4CLWA 3I32A 5E3PA 4K5SA 4X4OA 1OIAA 2F65A 3H2UB 3T1HF 4DR4F 3SIPB 3HHLB 1S1WA 2GHVC 2GVZB 4QIEA 3VAIA 1FJGF 3GG0A 5L39A 3CJ4A 3PM9A 2GMLA 4ZN3A 1VCTA 2BRLA 3ILLA 3KJVB 4ELUA 1KN6A 3MUMP 2HRYA 3CCTA 2GVDB 3Q89A 2GNKA 3GB0A 2N7CA 1CS4B 4RNFA 4OYPA 5KFZA 4CO1A 2H1YA 2G1HA 3ZTPA 1FWLA 2JX2A 2GFFA 1DLOA 2B5JB 1X5TA 4LF5F 5E41A 3OL9A 1R0CB 2EK1A 4NLOA 1UA0A 3DLJA 3HHLC 1FXRA 4DU7A 4FBUA 1HBNB 2Z2ZA 2QZ8A 3L7OA 1VQNS 3CJKA 2KFNA 2JNJA 2DIUA 4ZOSA 5B0DA 2AYMA 2G2ZA 2I9SA 5F8IA 1WF0A 3ENQA 3G6YA 1M90T 1GH8A 3C6UB 4TYBA 3RBZA 4WKYA 3KK2A 2JFKA 3UD5A 3VF0B 1R27B 4P9SA 1IKVA 3B6BA 2J7KA 2IRUA 1CJKB 2WBMA 4B3TJ 2CQCA 3M6WA 4ED0A 2VC1A 1EQMA 3CDUA 5M2RA 3X3UA 4DX5A 1VFJA 1TL4A 4RU2A 1XMQF 1CVJA 1G1XA 1WACA 1NJWA 5HQMA 1KQGB 1N48A 2VD3A 4X4NA 2UU9F 3JXOA 4Q44A 3DRPA 1HARA 3MMAA 5KFBA 4ICLA 1Q86T 2P9EA 2OD6A 2C28A 1IBLJ 2FYXA 2IA6A 5HLFA 1NK7A 2BOPA 2B4UA 1C1CA 3SFGA 4OQJA 4C11A 2KFYA 4JV5J 1W2BR 3Q24A 1JLBA 2EFGA 2W4PA 2UV8A 3RAMA 2NLWA 2CPEA 1VQLS 3QFWA 2F4VF 5HVGA 3JYTA 1FK9A 2CPDA 1WEXA 2OPSA 3A8KA 3BV8A 4HI2A 2FHKA 1M1HA 4J37A 4WPAA 2RE1A 1AUDA 2FGCA 2OJ3A 1WWHA 3O2IA 3MUVP 2ZJRQ 3CCES 2VL1A 2IVFB 3O5TB 3TVYA 2RQMA 5D3GB 2CPFA 2K06A 3T1HJ 2HRUA 1VGYA 1WKJA 3R9LA 1RT2A 3J81j 2YH1A 3NS7B 5HP1B 2R8GA 3D5MA 3VZHA 2RDJA 2KT2A 2BEFA 1NJXA 2CZ9A 3DLKA 3MMBB 3PYGA 3VGTA 1WHXA 3H7HB 3VQSA 3SQGA 4HHHA 2QTWA 3AAWB 4I6AA 4FYWB 1BGXT 1WUUA 2YWKA 3BREA 3QGPA 4USJC 4KHPF 5LSOA 3FEYB 1LFWA 2W01A 1U49A 1S49A 1WI8A 4ATNA 2N3OA 3W2VA 4Q8EA 1ZOTA 3E8OA 4ID8A 5RUBA 1UMJA 5IM0B 3MFHA 3R2CJ 4DR7J 2VHGA 1HA1A 2AV5A 2CPHA 3LGNA 3FJ2A 3JSMA 4O3RA 3BH6B 4ZPBA 3GIKA 4RLEA 1RTHB 4P73A 9RUBA 4QPTA 3US5A 1SL0A 2VUGA 2BBEA 3DLEB 3FEZA 4DPOA 3M6VA 3J7Z5 1KEKA 1IWGA 2NPFA 4XPEA 3RB4A 1LK7A 4DR1J 3IM9A 2GX8A 4QWBA 4ZLJA 4GKKJ 3MECB 2HQIA 1TKTB 2W2MP 2U1AA 4IFVA 1VLYA 1PAUB 1TVRB 1ZM3A 2EFNA 1WC0A 2POKA 2V6AA 4IH5A 3BF4A 2HHHF 4ID5A 5FJ4A 4NI2B 2V5HG 2LP4A 5D4NA 3J7ZT 2YKNA 1Q53A 1S6PB 1WC6A 2DNQA 3D3CJ 2QA4G 4R5PA 3RB3A 2AYBA 3O1LA 1L3SA 2R7OA 4IQXA 3Q8VA 2GZOA 5KFUA 2JEJA 2YWHA 3HF5A 2UXBJ 4YHHJ 3L3CA 3AJ2A 1R8BA 3FSYA 1NPPA 4V1Ak 4QWEA 1DAXA 1VMBA 3SEOA 2VQEF 2Q6BA 3GFZA 4M5JA 2ALYB 1RT1B 4I2PB 1KHVA 3I9V9 3R7SB 3TA2A 2ADCA 1SC4B 4C9DA 4RW4A 1RKIA 2ZH4A 2RT3A 1AZSB 2F8MA 4RBTA 4F25A 4TQRA 4CP5A 4UUWA 3CUNA 2PFDA 1RSCA 2FVSA 4K4YA 4NXNF 2DGWA 2QIFA 2V50A 1MNEA 3AQPA 4XK8C 2HYIB 3FFIB 2ILYA 2ZH2A 1VOMA 5A0YA 1Z4UA 4TLQA 2U2FA 5LMUJ 3QIPB 4F2RA 5IT9Y 2B4PA 2WOMB 1D09B 4B17A 2ZZMA 3J7AN 3T41A 1YVFA 3IRWP 1FRXA 4PUOA 2V8PA 3DYAB 5HK4A 3I5BA 3M1VB 4N77A 4J9RA 3C15A 3DKDA 4KO0A 4LF8F 1YJ9S 4WXWA 4Y0FA 3GSIA 3I0SA 4HDHA 3UNYA 2IJNA 1FX4A 2HBRB 4RWWA 1UZHA 4ZP9A 4P71A 5HVHA 4FPRA 2B56A 3CT9A 3AXKA 2KRBA 4KIAA 2BJ1A 4UQTA 4USUA 4YQWA 2IIHA 1FVQA 1KFDA 1S0OA 4PRFA 3LQVA 3VVTA 3CCLS 3D6TB 4QQBA 5J1PA 2G0CA 4EBEA 3IMQJ 3BM7A 3ADAC 2BANB 4Y2AA 3NRBA 4MMOA 4CLPA 5DG8A 3RAXA 3QJJA 4Q0BA 1T94A 1ZM4A 3FQLA 5DDOC 2ZUGA 4Q5VA 3TUPA 1YI2S 2ZNYA 2HGNA 4B9TA 2GQCA 2M8HA 3M8SA 1N34F 4L75A 3QT5A 1N33J 2HFOA 1JNRB 4OHZA 1VQYA 2CQPA 3M2UB 4JI3F 2LXIA 1RWKB 1TKZB 3ETOA 2HHPA 4OX8A 1CBKA 4OMFG 3MECA 4HTIA 3TUIC 4DR4J 3EPIA 1IR0A 2NR0A 2MKIA 2Y8WA 3MM8A 3R5DA 3LUYA 2V0NA 1N5QA 4PXEA 3HK2A 4O0NA 2AIRB 2AP6A 2B4VA 3MM8B 4DN0A 2R2SA 1OO0B 4UOCA 1XNQF 3A13A 3UD3P 4F3QA 4LFAJ 3ZZTA 3TNVA 3M05A 4PEOA 3V2UC 5F8HA 1ZH5A 1AFIA 2VZ9A 2XWXA 4M5LA 1H2TZ 5IM0A 4DQIA 1RTIA 2FD2A 1TAUA 1IXKA 1NSPA 2DCUB 1KTQA 4L6V3 3UD4P 3A1YG 4P74A 2G2YA 3TEHB 3BR9A 1S6UA 4X4VA 3UWTA 3U1NA 5BYSA 3J7YU 2R4FA 4RX6A 3HCXA 2DNNA 1K44A 1HL6A 2HGMA 1QAYA 5HLFB 2G2OA 3NBPA 2RHQB 2VFSA 1FF2A 1QM9A 1VQSA 4JI4J 2YNHA 2DNGA 4LF8J 3CMES 3KLEB 4DV0J 4B3SJ 2UXDF 4F3MA 3HVTB 3T5HA 3PX4A 4ECVA 3A8EA 1WOOA 3L9ZA 4OZ0A 4WK3A 1A0OB 3BO4A 4IYQA 4LRAA 2MZRA 5BJRA 1WTBA 2CXEA 3KG1A 3TUZC 2E7VA 5DETA 2ZHBA 3A3OB 3PW0A 4USTA 1AZSA 2BKOA 4FS1A 3MAAB 1TK0A 1Y0HA 3CJTA 3HVWA 3UN3A 3D28A 1V9OA 2CPYA 4NLYA 1AW0A 1HD0A 4Q8FA 2QL9B 3MD3A 2QG9B 5K8MA 1G6BA 3QFHA 3R5GA 2B0GA 2F4FA 2PT0A 2GCFA 4DMZA 2LA4A 1CJVB 1YBAA 4ICLB 4ZA1A 5M2PA 1TFYA 2L9DA 4J9UE 5H1SV 4ZLNA 4M5DA 1SQGA 3TP2A 3RR7A 5L38A 1F9HA 1TP7A 1X4DA 2VKRA 3CJ5A 2QLBB 3N4WA 3FCVA 2FLOA 3MPWA 2JEGA 1CLFA 1DZ5A 2DO4A 1CJKA 4FKYA 3MEDA 4B3OA 4O0IA 2YBVA 3POTA 2ZJPQ 2DXDA 4NLQA 2M7SA 2YQ0A 3HHLA 4I56A 1SJRA 4NLWA 5IV3A 3NGSA 4F50A 3PY8A 4DSEA 3LALA 2UVRA 4ALZA 2RDIA 2QA2A 1WKLA 2KKHA 4ZMMA 4L3NA 3DM2A 1OY8A 2HWHA 5AE1A 4V19X 1S0VA 1XNRJ 2IM2A 3U1MA 2VG7A 4DR7F 4S0MA 4O3QA 1J5EJ 1NJIT 3BN7A 1REVA 4CT9A 4U6PA 3BQ2A 1YJNS 2RMLA 4DFPA 1S59A 2W2NP 3PW5A 5KFJA 4M5GA 1N6QB 3EE3A 2XMJA 2RS2A 2Y1RI 3HLUA 3KJVA 3BSNA 1I3OB 2R8JA 2CUYA 3IRXB 3MPUB 2LMIA 2XTJP 2GGPB 2LQBA 2C2EA 3OT9A 2YKMB 1RB0A 3EICA 4PABA 4GO5X 2HHHJ 1ZA1B 3D68A 4DPUA 4ED4A 4C8KA 2WZ1A 3IG1B 1S9EA 4EZ6A 3THPA 3W61A 3MWBA 2IRYA 2CQGA 4Y65A 2FVRA 4Q43A 3H40A 1NM2A 3VGUA 1LWCB 4WU2A 1F5BA 4Y2IA 5EDWA 3TZWA 2KM8B 3LAKA 1MMDA 4ZIVA 4HYKA 2D3O1 1U6ZA 4DSFA 2MB0B 2HVDA 3OFFA 4DU8A 5FDLA 3Q8RB 2ZH1A 2B8QA 1HWJA 1DTQA 1O5JA 1IR1A 2EW9A 3I96A 4FYXB 1OQ6A 1BWVA 2BJ9A 4KFBB 2EFVA 3G71S 3NMRA 1FRMA 3DLKB 4CLYA 5K8PA 2B6AB 4BWMA 3FNNA 4KH0B 5A2QU 4IQMA 1MW7A 3QGGA 1LQ9A 1HPZB 2QYCA 5KFPA 5DO2A 3KLHA 5AXNA 4DV5J 2QSFA 2X3GA 3T6BA 4C3LA 3V81A 2XS2A 4RNMA 1FWKA 1S7HA 2GO8A 3BR8A 1JNZB 2DXEA 4RNOA 2IC3B 2MSTA 3AOAA 3DHWC 4NZ6A 2FJAB 1NDPA 2HNZA 3LWLA 3MPVA 1PIEA 4NYOA 3MMCB 5KFXA 3ZTOA 3HD1A 3BB5A 4NWBA 1S5ZA 1S57A 3D4JA 4CTAB 1U48A 4KPYA 1B0PA 3W2WB 3MOJB 1OJ4A 3EGVA 3MEEB 3OW2R 4Y2CA 1JLCB 5T7LA 1BQNB 1X31C 1DTTA 2IA0A 2XMAA 4P7VA 4JI4F 2K8GA 3EMTA 5IC6B 1U1KA 1SKRA 2HMIA 4DR6F 5J1NA 2BVZA 3CE8A 1RUSA 2FTRA 1L5UA 1VRQC 3LH2S 1PJ7A 2O01C 1FHTA 4TY9A 2RDDA 1U0HA 2OPQB 1A9NB 4F26A 4USKA 2VJUA 4YEAA 4IOAQ 2KYZA 1SJ3P 4DG1A 4DL5A 1UVIA 5G0RA 3QGHA 4U8VA 5JMNA 3OLAA 2KFZA 2UXCF 4LUBA 3IAS9 2AZ1A 1G3OA 3GMGA 1E6VA 1YQHA 2K2PA 2XNQA 3M2RB 2KZZA 4NMLA 5GAHI 3F44A 2IJRA 2AGPA 1F9FA 4EZ9A 3R6LB 1RBOB 3CCUS 3C2PA 4FYVB 5KFIA 1RWWB 3HJVA 4EWTA 5GADU 3ENVA 3A12A 1R0AB 5AE2A 4K4UA 2BQUA 1APSA 3T9NA 5HAOA 3DU6A 3C46A 3X1LB 3R7BB 5JJBA 2ASYA 3RRGA 4ZDNA 3ITHA 4TU8A 2W9BB 2Y1IA 2XG8A 1FDNA 5F8JA 2XNRA 9ATCB 2BW7A 1ULRA 4ZVGA 5LOQA 1H73A 1KDNA 4FVCA 4H4KC 3NCQA 1S12A 4X4RA 1NK9A 4BWJA 1KRPA 4PCQA 4XPCA 2I0XA 3K5MA 3VAKA 3GR0A 1ZETA 3IA0A 2D3UA 1O0PA 5E33A 3NLCA 4JP8A 4IOBA 2HBYB 2HK3A 3LANA 3RW7A 1VQMS 2Z2YB 3KDOA 5G4DA 3QRPA 3AB4B 4OYXA 3R8YA 2NXUA 1YRTA 3PJ9A 3QLHA 4LVOP 3R5CA 2AWZA 3FKBA 1NH7A 2FUG9 3CF5Q 1X9WA 2V94A 3MCSA 1P6TA 3V6DA 1T9TA 4ZHRA 4UF4A 1CSJA 3CMQA 1N5YB 2E5LJ 2DRDA 3BBCA 3N9UC 4FVMA 4H4KA 3ZNUA 4Z7YA 2MGZA 5L1JA 2YNFA 1HHTP 4OX9J 3KHGA 4ECWA 3IAM9 2JLFA 2ZH8A 3NNAA 1RISA 4ZPAA 4OZLA 1U24A 4ETZA 2RIJA 4DL4A 2HS0A 2RHSB 3CGIA 2MQNA 2PA3A 4KRWA 5D0GA 1Z1ZA 3LP1B 3C3LA 3D1HA 1T9VA 1FD2A 1FDDA 2BUNA 3HVAA 2XLKA 4FZVA 5ETSA 3FQKA 3E01A 3QNWB 2W7AA 4OFZA 4DG1B 1VI7A 2YNIB 5E3AA 1RYRA 4U95A 1VQ8S 4O44B 4EEYA 2BDPA 5K20B 4J90A 1FE4A 2DTJA 4OYAA 2EEYA 3RAQA 2DH7A 2CJQA 2P9CA 4EK2A 1PAEX 2IC3A 5KFNA 1XMOJ 2J9EA 1V3ZA 1YWXA 1YJVA 3DC2A 2O3DA 2CJYB 1Y3JA 1DY3A 2Q6CA 2MGZB 3O3LA 1TMJA 2EFOA 3TQEA 2E1PA 1RI7A 2PE8A 5J2NB 5E0OA 3OD2A 5C7PA 3CCRS 4LBIA 4DLEA 2I38A 1DURA 1C0TB 3MEGB 4HACA 4USWA 1J5EF 4N76A 1GXTA 1T9UA 3EVOA 5EWFA 3QSYB 3QJLA 4PWDB 1I94F 2X1FA 2DR7A 3H20A 3QMQA 1X8DA 4ANCA 1WC4A 3PV8A 3Q2TC 3M9NB 1K0VA 1LWCA 3JTNA 1KP6A 2VKZG 4QYZK 3ZTSA 5I3QA 1T05A 2FC9A 3LAMA 4WP9A 4DR1F 3H0PA 1N32F 2OPPA 2HBQB 2P6TA 1O51A 1YLXA 2DY9A 2MHEA 4ILRA 1UVMA 5ETOA 2B6AA 1VIOA 3T19A 2VBZA 1QAIA 1FRIA 2AHOB 2XMMA 4DJBA 3LOUA 1RAEB 1WORA 3G8QA 2GQ2A 1WHVA 2ZKTA 3RUBL 4B9UA 2XO7A 5KG0A 2ROPA 3QATA 4I4BA 3R5AA 2YY3A 1WG1A 4LF6F 2DYAA 4J9KA 4NYZA 1M5SA 1RZMA 2F9JA 4HT7A 1KQKA 3PYEA 4C98A 3PKYA 4K4VA 3R1LA 2VONA 1T3OA 4KV8A 3ULHA 3TZZA 1SJFA 5F3ZA 2E29A 1S1UA 2LEPA 2V8GA 4C8MA 3KG0A 4OZ2A 5K14B 3KLFB 2EXUA 4LSLB 5CYMB 2ZHOA 1PKUA 3GFYA 5F0WA 2R9LA 3DGPB 1NK0A 3HFZB 4EMDA 5T41A 2BE7D 1SH3A 3DOMB 2HEKA 1FE0A 2R8IA 2UUCF 5ETMA 5DQIA 1MU2B 4ANEA 2NPIA 4ECZA 3GV5B 3H25A 5HQ8A 2BM1A 1NMEB 1REVB 1FEHA 3ZXWA 4USMA 3CPWR 3TAQA 2A10A 2B7BB 2NREA 3IGNA 1PSDA 1Q8KA 2H54B 1M0SA 1KLMB 2MPUA 4PG8A 1RTJB 3LGHA 1UL3A 3MM5A 2J76E 5IV4A 4M5DB 3I82A 4TQSA 3BJYA 4B9SA 1B64A 1CJTB 3HSGA 4NCGB 2X3DA 2FHMA 4EFAC 4ED8A 1B4SA 2HQCA 3GV7B 4CQ1A 1IKYA 3UCUP 1HNXF 3RBEA 2W25A 3QYYA 3WQPA 1NK4A 3POTB 4AQYF 3M8PB 1PJ5A 1WKKA 3GWCA 3W65A 3H5XA 2G13A 4A4JA 5KFCA 4IR9A 3K57A 2HHTA 2B9XA 3M32A 4MK8A 5D8HB 3ELHA 1ZAVA 5GADI 3CCJS 3LPEA 4WYLA 4Z7CA 3V4IB 1WSVA 4JI8J 3ZZ0A 3N79A 1HWKA 4M5IA 5A6WA 4DXLA 1HQEB 1ZAXA 2RD5C 3BGRB 5LM7E 4CH7A 3KLHB 2RAQA 1JLQB 1BUXA 3D0GE 1HNZF 3TAMB 2BE2A 3D1OA 1NSQA 1H0HB 1FNXH 2QJ3A 3EM1A 3DRSA 1IBKJ 3IR5B 4MIBA 3ISNC 4M8LA 5C42A 1KSPA 4OI3A 2HHSA 1UJ4A 3FK4A 2ABYA 2GMJA 1LOUA 4BS2A 2XMKA 2LA6A 1U0SA 3PR4A 3LO3A 1JJ2R 2FLPA 2DH8A 3CO9A 5KFYA 4YB1P 1FNOA 2KO1A 3CNQP 4LF7J 3BKFA 1HQEA 4IKAA 2VG6B 1K1QA 2CVIA 2OPPB 3NWRA 2HSEB 4TY8B 4X66F 4O3SA 2HHQA 3GSDA 1HIYA 1T9WA 5D6GA 3J7A1 2XBPA 2MSSA 3QZ8A 2MZ1A 4BC7A 4I0WA 2MEWA 2M9KA 2WVCA 3TZYA 4NMXA 2GGPA 2KJWA 2Z58B 4HR2A 3J80U 2W7PA 1NRKA 3PDNA 2OD4A 4O3PA 1OPZA 4TXSA 5KFFA 3KXDA 1JKHA 3DOKB 4A8MP 4H4MA 1X4AA 3GE9A 3WC2A 4RUAA 2LQJA 1TL7A 2AT1B 4OYBA 2K1RB 3N28A 3QJPA 2CADA 2FJBB 1CQMA 3FEXB 1RTIB 5E3RA 3NGDA 3BBBA 4G1QB 3MCNA 3PACA 1TL3B 1S99A 2C2KB 4UZBA 2MLYA 1XC9A 2HS4A 2ASJA 1WEYA 1NO8A 2X1GA 4P10A 2BANA 1FRLA 5BR8J 1RBAA 1U1NA 2F7VA 2IDLA 3NCRA 3D7SB 4HHJA 5CQGA 4CZCA 2W2PP 4ZJOA 5KFMA 5I42B 3OTEA 3CCVS 3VAHA 1BC6A 2H65B 4HDGA 1Y5LB 5I3PA 1F0XA 4J9MA 1SKSA 4K4SA 4YB6A 1KNZA 1GTEA 4IH6A 4MK9A 1IBMF 3M8PA 3QO9B 2QMUB 5H9FJ 3T5JA 4ZPDA 3M2UA 5F8NA 3M8RA 4EGLA 1NPKA 3MEDB 2AEJA 2VA2A 1VS3A 3N6NA 1H3DA 1FKPB 4EYHB 4Y6IA 4C0HA 3RB6A 3I0SB 2JFDA 4FKXA 4A8QA 1I6JA 4KE5A 4KO0B 4Y28C 1QDUB 2ZZNA 2PO4A 2CAJA 3JQJA 4X4TA 4DV6F 4A8WA 4D3GA 1SB6A 4DS5A 2MY8A 2DXFA 4G1IA 1KLMA 4RW6B 5EWGA 2RQKA 5L1KA 1CJVA 3ILOA 5A2QY 2DGVA 3ET6B 4TNOA 2FZGB 2LKZA 1VBKA 1YJ7A 3GTYX 4DPYA 3RBDA 2HQFA 1QAXA 4J7CA 2EFQA 4NLRA 5CZXA 4ED2A 1T3NA 4DV1J 1BQXA 5EN1A 4DPTA 2N4CA 4NLDA 1EZZB 4U67Q 3CIMA 4PG6A 4G3IA 1QUPA 1HQUA 5A8RB 2L08A 3SZ2A 2AW0A 2FVCA 2XWYA 3DN9A 3EDQB 4B02A 2VV5A 2AYGA 2HNYA 5CYMA 4C0OC 3BH7B 3PJWA 4LSLA 3DHXA 5IC4B 4N7TA 2HHXA 3IBWA 2IYIA 2QC3A 2W2OP 3HVTA 2HVHA 2RRNA 2B9YA 3SMZA 4DUYF 2DPIA 3KOAA 3G82A 4K4TA 1EP4B 1WF2A 2WOMA 2Q43A 3OJSA 3D0IE 4DSKA 4CO5A 4O4GB 3MCOA 3IWNC 1WG5A 2HFNA 2Q66A 2G9OA 1RAAB 2RUGA 1S1XB 5HJXA 2ZE2B 2EVZA 2OFGX 3UVJA 4YFUA 2XO6A 2YKNB 1N32J 1KC8T 2WB1D 3HHLD 2KB2A 4OHWA 5D4PA 1KS2A 2M5YA 3UN5A 2GJFA 1TK5A 1MSWD 5F41A 3SXLA 3GJQB 3NOCA 2NXNA 1E6YA 2XYHB 3UR3C 3W64A 3E3XA 2FHOB 4LIRA 4A8YA 4B9MA 1EJ7L 2WONB 2G0IA 4OV6A 5CD4H 5DLFA 2J6UA 1VISA 2YKPA 3I56S 4WU3A 1HNZJ 4W4MA 1D9AA 3NY0A 3M8ZA 5BYRA 1KQSR 1YZ6A 2OTLS 3WIUA 1TR0A 3P8BB 2DGSA 2XGPA 2OPRA 1RJJA 1RWMB 2BABA 3BBFA 3G4SS 1VQOS 3MPDA 2F9DA 2KN4A 1FDBA 3G87A 3K5PA 1VRUA 2EKYA 3PFOA 2DNPA 5DS7A 1YBTA 1K8AT 2AJ4A 1URRA 2OPQA 1U8WA 1JK9B 4NA2A 3EX7B 2Y1JA 3DDKA 4ETXA 4EO6A 2A3JA 3GIRA 5HANA 2MY7A 4NE9C 1NNDA 1IJEB 2VA3A 3L09A 1Q7LB 1BD6A 1WEZA 2HFUA 2I5JA 2MZTA 1OPIA 2QSWA 3GJTB 2XZDB 3OBIA 1FTCA 4KYZA 1RAIB 2ZVSA 3PRDA 4HT5A 1TELA 2CDRB 4MK7A 3V6HA 4TVAB 1RA7A 2COLA 3NGRA 3VR1A 4ZP6A 4ZHRB 3GP9A 5GAHU 4ITSA 2EFPA 3VGVA 3W2VB 4DEZA 4F4AA 1VBZA 1U6BA 4C7QA 3F41A 4R8UB 3NMAA 2CNKB 5U47A 4MYTA 5IT0A 2BX6A 3MCMA 5J1EA 2H51B 3FUYA 4HVZA 2HNZB 3MZIA 3PR5B 4ELTA 1N8RT 3JTOA 4NX9A 4C11B 2VPWB 2Y3YA 1AYEA 3CC4S 2QL7B 5HN0A 2GC8A 4QW8A 3K0JA 3J81Y 2ZM6F 2IRXA 3OQ2A 4MIAA 4NASA 1SC1B 4K5RA 1RT2B 2UV8G 2D7SA 1WC5A 2IY5B 1YZ7A 3DLBA 4PWWA 2JC1A 1HPZA 4DHVA 4P2MA 4A8XA 3V6DB 1EIYB 4JI8F 3ENWA 1Z2ZA 1ZA2B 4NYPA 4UUXA 3SSQA 4URSA 1FWPA 4F8RA 3H5YA 3AODA 3KG4A 3IP0A 4IG0B 2XZTB 4LRDA 3LTOA 3BQ0A 3H4BA 2E9TA 2BR0A 2ACMA 4ZVFA 1BY9A 1CJUB 2C3PA 2WVFA 4CO0A 1F5CA 2ZH6A 4NLGA 1BQMA 1HHQA 3ZTRA 4DLGA 3MMAB 4G1PA 4PZVA 1WOSA 4YHHF 1V6HA 3QWUA 4DR3F 1YJUA 3LWMA 2JEFA 4DV1F 3AHPA 2KL8A 1JLAA 1IKXA 2R8HA 1CS4A 1SJ1A 3UPFA 1FI4A 4NI2A 1NB2A 1FRKA 4DV3F 4JYAF 1RT4A 3M30A 4X4PA 4WF9Q 3DNCA 3PW4A 3TI0A 1H2UX 1R0AA 1N54B 4DX7A 2BA9A 1KVIA 3ZC4A 2DIVA 2UVWA 5HJYA 4I2QA 4PWUA 5ETNA 3C14A 2RF2A 4M95A 1TQLA 2E1AA 1HI1A 2E9RX 2B4OA 2YX4A 3TX0A 3WIVA 4N56A 2ZOGA 2LVWA 2XULA 3UDLA 2N4DA 1NHVA 2VBWA 1CQNA 2QFIA 1N5VA 2F1FA 5L1IA 1JWWA 5G0RB 1SJ4P 4FS2A 1WHYA 3GCXP 4HI1A 4ECTA 4C4WA 1SXLA 1X60A 1A6LA 1SPBP 3M2VA 2XMUA 3QAUA 4NOHA 4MIWA 1VQKS 1UVKA 1LW2B 4UTGA 3UDCA 1VK8A 3MMBA 4KGXB 7FD1A 1HNVA 1YDLA 4IG3A 4QR0A 2G4BA 2DGQA 2HMIB 4AYBD 4CYUA 2UVVA 3RG6A 3K8VA 3I55S 1RWNB 2ZDOA 4CLZA 4TU7A 1DTTB 2Z56B 3FMBA 3WDOA 3EYZA 2HQGA 2J9DE 3RR8A 1GT8A 4RW8A 4ZCMA 3KYLA 1HBUA 2VG5B 3L7PA 3PO4A 3MEKA 5B08A 2ATLA 4AL7A 4DFMA 3MMCA 4F7VA 5HROB 3B4MA 3HHDA 2HZAA 5KG4A
chains in the Genus database with same CATH topology
3CD7A 5FIIA 4ZLPA 3DLHA 1P27B 2CQIA 4ZCLA 3SDEB 3Q23A 2ZC4A 1QAJA 2LQ9A 3T5KA 4RU9A 4CO2A 3K58A 3V81B 1TZ0A 2MKJA 5BYQA 4I6WA 5J2PB 4F4YA 3DLLQ 4Q45A 2AJQA 3SDEA 4DL7A 2AQ4A 3OPKA 3UR0A 2YKOA 4YDDB 3PIPQ 3V6JA 3DRYA 1S0VA 4Y2KA 4WE1A 4XAKA 4FF2A 2HFZA 2L41A 2Z2LA 2APOA 4PXBA 3HI9A 2UUTA 4X84A 3M2VB 1RT7A 2KHCA 1Q1KA 3SCJE 1N6QA 3MM7A 2CPXA 5CH7B 4LT6A 2V4JB 1U47A 3NL0A 5KFOA 4OI0A 1NU4A 3KHRA 2XMVA 4KC5A 4QCLA 4FYDA 4C3KA 2J5AA 1S9EB 3DXBA 1FKOB 2V9KA 3THTA 1AFJA 4RBVA 1Q8LA 1X4EA 5D4OA 4A8KA 4URQU 1Q4RA 4R25A 1XR7A 4BBYA 3C8YA 1N0UA 4OHYA 3EGWB 5THWA 1ZPVA 1KONA 4CIOA 2JSXA 1FO1A 4OX7A 4C2MA 3KMSA 5AXLA 5DQGA 3HFKA 1LV5A 2XLJA 1VBXA 4BDPA 3AJ1A 4O4GA 1K73T 2DHSA 3CC7S 2VB6A 2ZD1B 2DITA 3CDAA 1F5AA 4PG4A 2QFJA 1SJQA 1G2EA 2JOQA 4OLOA 1T03B 5MLCV 1KQFB 3BO2A 3GFXA 4OIXA 4IRDA 3G86A 3H4DA 4RW7B 1U7LA 3FZ2A 1SH0A 1NB7A 2R7RA 2PMHA 2BRKA 2MQLA 1P8GA 5EWEA 4HKQA 4C8OA 1FA0A 4JI2F 2O1PA 1N5TA 1S1XA 4ZP7A 1TAQA 3FRZA 1X4HA 3VQTA 3DYAA 2YVSA 2CFXA 1Q7YT 3HMJG 4ED6A 3NWGA 4QWAA 3QIPA 1V3SA 3E2EA 5DM6Q 4JBCA 3K5OA 4DN9A 4X4UA 1S1VA 5J2MA 1P9QC 2IM0A 2DNLA 5IQQA 3N01A 4Y34A 4BC9A 1HQUB 5A8RA 4OJHA 1TL1A 2E5IA 1YSJA 4I67A 3LF0A 4ZVEA 2MZQA 3GQCA 1S6QB 4C97A 3TQ1A 3H5SA 1CC7A 2P5VA 2BZ2A 1MMNA 2I5JB 3MAHA 1RYSA 2R7QA 5CA5A 4Z2XA 1HBOB 2XB2D 3NNHA 3KMQA 2CJBA 4CH0S 2HW3A 3T6JA 1C1BA 4K2XA 4MAKA 1TKZA 1TL3A 1CEZA 4R0JA 1IBLF 4WTYA 5HO4A 4JV5F 4IH7A 1KFSA 3IFEA 3OR1A 3EZ5A 3HHKA 1VQ4S 3GZ7A 1S97A 4P2SA 1TVRA 1NKEA 2JRSA 5IS2A 2XI2A 1U1PA 4JOUA 4Q0BB 1FERA 1HBMB 2DR5A 1UVNA 3ZZZA 2AD9A 3TA1A 1Y3KA 3IN5A 3J80Y 1SIZA 1DHMA 1S79A 1T7PA 2IVYA 4F67A 1HBMA 2J0XA 3MR3A 4ZPCA 5JXSA 5F8MA 4TY8A 1VQ9S 4DSJA 1E6YB 1GX5A 2Q79A 1D8YA 3I5CA 3OR1B 3PFEA 1U4BA 4ZCIA 3DXSX 1LKZA 4I1TA 1VRTB 3MHYA 2OSRA 5HI7A 4PQAA 4OL8A 1XEZA 1SL2A 2DGUA 5L9NA 5B0BA 4X62F 2KT5A 2ZHAA 2CJKA 1JLEA 2KDOA 4QIGA 3UE2A 1GX6A 3KLIB 5IWAF 1YHQS 3TARA 4E8UA 2DB1A 2VG6A 1VC6A 1ZZNA 1MROB 1QJHA 3DU5A 3BZQA 4NLXA 4GKKF 1TL1B 2KTQA 4WZMA 5LXYA 1SQEA 1VJWA 4DV2F 3NKYA 2V8HA 3CULA 3DRSB 1H7WA 3M1VA 2RB7A 4EUVA 4Y2MA 4A8SA 2HHVA 1IKYB 1DBDA 5KFTA 1IKWB 3G6VA 3TAPA 1S1TB 3BGRA 4WZQA 1GNKA 2CG4A 2LLZA 3S8SA 1IN0A 3TYTA 4DOZA 3VZIA 2B7CB 3CWJA 3CIZA 2F8HA 4QW9A 3Q8SB 3DDNA 4K4XA 2OTJS 4WFXA 1X4CA 1IUJA 4M63A 2M2BA 4AFFA 3OXFA 4LF9F 5DG7A 1TUVA 3ONQA 5JUMA 4LFAF 1QE1A 3CJKB 4YUDA 1PC4A 2Z8QA 1RTHA 1JXEA 2CQ1A 3OTCA 2B5JA 7FDRA 2IAJB 4A47A 2Z0GA 3O44A 2R7SA 1U1QA 3R1HA 1JX4A 2JC0A 4DWIA 3HXMA 4XO0A 1QSYA 2D74B 2ZBIA 1DRZA 1QLNA 1QTMA 3Q8PB 4B3SF 4DV5F 2A2CA 4HLBA 1L3UA 3DCAA 2L9NA 2YWEA 2I2YA 2NZ4A 3HZEA 4KR0B 2VPZB 1S1UB 5K5MA 5D3GA 1XR6A 5K8NA 4F2SA 1ZZFA 2K3KA 2RKIA 2WHOA 3BDEA 2KJVA 2CJ9A 4YR2A 4PQUB 2DGXA 3BGLA 4F4XA 3JYTB 3TOQA 1VQ7S 4GC7A 4H4MB 1N56A 4QYZJ 2R7UA 5LJ3Y 4X4QA 1HR0F 2ACYA 2E7WA 4WE1B 1C1CB 1UVLA 1DARA 2J9CA 3BN4A 3CCZA 1N36F 1SUQB 1ROFA 2IMOA 1X5PA 3VTIA 3D2WA 3JSYA 4QBUA 4I7FB 4L72B 4DL0C 1KTVA 5LSRA 3QGIA 4QWCA 1SKWA 3G9CA 2PN6A 4DR5F 2PMZD 4B3RF 2ZOMA 4YP3A 5LMUF 2PFFB 1FK9B 2OPSB 1HWIA 5LXRA 4ECUA 2NSBA 4O44A 3CSKA 5KT7A 1N0VC 2MQQA 2PIIA 2IFXA 1M5OC 2MJNA 2CPIA 3W3SA 2YX1A 4N41A 4NCGA 1C1BB 2ASDA 1FNMA 1RT5A 2AJ0A 2DR9A 3WX4A 2VODA 3NGKA 3LPYA 2HPUA 5DM7Q 4U7UK 4B3TF 1LW2A 1IJFB 2MQOA 1H38A 2CQ0A 1N5YA 4YB5A 4X4SA 3VALA 3BSAA 1C0UA 3LW5C 3UI3A 1X5SA 3F73A 4IDKB 4AXJA 2WW8A 5CYJA 2GIQA 4UQGA 2HNDB 4DSIA 3CD6S 5J2MB 4J9QA 1R7IA 5HL7Q 1D3WA 2BQRA 3TR5A 4DQRA 2K3IA 2J7WA 5EUHA 2XHWA 1S10A 1YTYA 3OHBA 1UAWA 2OP5A 3Q8QB 3HHEA 4NCAA 3PKMA 3DRRB 2FJVA 2R8KA 4EBCA 3DOMA 2W9BA 1DJ0A 1RT6A 2KM8C 2R7TA 3MM9A 1HNIA 1S1WB 1VIXA 3I6PA 4HTJA 4ECXA 3HJFA 3QLHB 4LQ9A 3DGPA 3MM9B 3B4DA 3OL9A 3OL8A 3C6TB 1R43A 2VFVA 4KHMA 1H98A 1NZAA 5KT2A 2V8DA 3VCDA 3GV8B 4JI1F 2CPJA 3KLFA 5KFVA 3MDFA 2DCLA 2E1CA 4WIIA 1XBWA 4C8NA 5GAEU 4J9OA 2M88A 4AL6A 4IG0A 3ITHB 4ED1A 5J2QA 4PXDA 5CZVA 4DF8A 4C8ZA 4GC6A 4LFCF 4LMZA 3OR2B 5KFQA 1U09A 5IT4A 2LYVA 1W2IA 3KFWX 2FC8A 2DNOA 2FJEB 3QWPA 2B51A 2VC0A 5MAOA 3FSIA 2MKSA 5GVQA 1OSDA 2FDNA 4ZKAA 1LXNA 3PZPA 2DGOA 2QE5A 4PWDA 3M8QB 3NG8A 4KKOB 1NKBA 3OVSA 3Q22A 1SBRA 2MKHA 4NZ7A 4OI4A 4R8UA 5J2NA 1UP1A 1LWFA 2YKQA 3BO3A 1QVGR 2OKQA 4KKOA 2ZH3A 3MGJA 5KG5A 3LP1A 3I4PA 1XWLA 2NYIA 1KVJA 2MKCA 3TW0A 5C24B 4FF1A 2M4MA 5B0EA 4F4KA 4XDDA 5HMZA 1HFEL 1S77D 2JLEA 1SUQA 2PGCA 1LWFB 5DGAA 1RT3A 5KT4A 1XNRF 1QSLA 1KOHA 2E5HA 3GYXB 3V4MA 3H2LA 4E98A 3VAMA 1WHWA 3LP2B 1J2VA 1OSCA 2JDJA 3IO1A 3M8QA 2XLIA 1T02A 5HROA 4BCAA 1GTHA 4OV1A 4KGKA 5FD1A 2AJFE 4OZNA 1F2GA 3HVRA 4BHQA 4OHVA 1JB0C 2I1RA 5SUHA 3BQ1A 1S6OA 4ECSA 2DD8S 4WFBQ 2YNFB 3U02A 3K5NA 2ERRA 3FVYA 3TUJC 2MJUA 2XZWA 4JUZA 4EU0A 2HWIA 3PIOQ 4CCHA 3B78A 4IFYA 5I4MA 2R2UA 4ED3A 5HMYA 1X4BA 4YR3A 5E2QA 2Z2MA 5DDPC 4LVNP 4NLSA 3U7JA 1RT6B 1DTQB 4GO7X 5A8WA 2ZE2A 2CRLA 5F3TA 5FDLB 3ZZOA 4NLUA 4NRTA 4WFYA 1B0VA 4KSEB 3OTDA 4N8NA 2M52A 3OUYA 3OXGA 5AE3A 1K9MT 1P1TA 2BW2A 4YR0A 2UUBF 1U2FA 4CNYA 1HI0P 2WB4A 4FXDA 1YRUA 3AA9A 5KG7A 4YOEA 3C6TA 1SI9A 2B3TB 3BSCA 4MKBA 2KVIA 3RTVA 2RH3A 1HYSB 2WCXA 1MWYA 2KXNB 3N5FA 1S76D 4IRKA 1C0UB 3EUNA 5K8OA 4RUHA 4B3OB 3I31A 1HI8A 4OLPA 1UFWA 2ZNZA 1M1KT 4UY85 3ISND 2DGTA 1OWXA 4KJIA 1MMLA 4E0DA 3E51A 4NLTA 3SSSA 4RW6A 2IAJA 4R0EA 4TN2A 2M8DB 2C3YA 2YX7A 1H6KX 1RT5B 3DM2B 3NAIA 3KK1B 3BGUA 2EG1A 2C3OA 4FXVA 5L1LA 3OV7A 4GMKA 1XN9A 2MZJA 2JEIA 3GIIA 1Q16B 3FGVA 2QT7A 1DQAA 2GV1A 1AROP 1HNWF 4I64A 2FIUA 3EXCX 4N8OA 3NAHA 2VFUA 2IYGA 1NEEA 1Q8BA 2WRMA 5C5JA 4RNHA 3CJ0A 1MROA 1TL5A 2E9ZA 2EPIA 3RW6A 2KI2A 3G96A 4C8YA 1JLGA 3I87A 3M9OB 1FXLA 2MHNA 2HVIA 1UA1A 4G1QA 1N52B 4U7CA 3NBPB 3UCGA 5KOXA 4ZVHA 2WTFA 3K59A 3EZUA 1NJYA 1JLFA 1SV5A 1JKHB 3DOKA 5LL6d 1RP5A 3JTPA 2A18A 2H9ZA 4LSNB 4QZVB 2RU9A 4YDXA 4PQUA 2QA1A 5CCLA 4A8OA 4HH0A 2LXUA 3CD0A 3RB0A 1JJ4A 4W92B 4PPDA 4OI1A 1VC0A 1KOOA 3PEHA 3IS9A 1Q79A 5L9XA 3WZ0A 1X5OA 3LP0B 3KLIA 1NH8A 4NPOA 2GIRA 2X1AA 3B8HA 4DFKA 1URNA 1LFPA 2GJIA 1FJCA 2ZITA 4KFBA 3I5AA 2RS8A 3PHEA 3FCHA 4I6YA 1CPZA 5F8LA 4QJVA 2QV6A 2HWTA 4NRUA 2XMWA 4H4OB 2EK6A 4O23A 3U27A 4DUZF 2RKIB 3P3DA 4LFBF 4QU7A 4NXMF 2OPRB 4D3HA 3SI8A 5F9NA 3MR2A 2J0SD 2R7VA 3IC1A 3UCZP 4DL2A 3FZBA 2LU2A 1NAQA 2RQ4A 2LDIA 2ALZA 2XI3A 5DG9A 3OFGA 4F02A 3ZZYA 4ILMA 1S6QA 4B08A 1F60B 4LJMA 3T3FA 1OQ3A 4WKRA 3DI6B 3QPIA 4PPZA 4F4ZA 2ZOFA 3MXHP 4J9LA 1S1VB 4QR2A 1GAOA 4UY8T 1RTJA 3MM5B 1V3RA 4A48A 3K8WA 1K1SA 4TYAA 1S1TA 2CPZA 2HLUA 3ZZUA 3HT3A 2YNGB 2JJ4D 3OSNA 3J7YI 4WCEQ 4K4WA 1RTDA 1X4FA 2HVZA 3NCPA 2OIHA 1U2RA 1LK5A 2CDQA 1GXLA 4FXWA 4M1KA 3IR7B 2W9CA 4DL3A 1U45A 2HIQA 2DT9A 4ZS6A 1RTDB 4RW4B 4JV2A 3MR6A 3H5XA 1UEVA 1YJWS 5F9LA 5DQHA 2GHPA 2YNGA 1KD1T 4AL5A 3OL6A 4PKDB 5CXTA 3QAEA 4JI0F 4JV1A 4I68A 2GHWA 5KG6A 4DF4A 4CO3A 1WD6A 2XSJB 5A0YB 1D0EA 4WXOA 3UQSA 2SXLA 2XC9A 1M5PC 2BJDA 3KNGA 4QR1A 2W9CB 3NS6A 3CC2S 3FRYA 4RW7A 1VQPS 1B7FA 2VPXB 3R3TA 5F0UA 3U1LA 2ZKUA 4ID5B 5T14A 1D9DA 2PI4A 4B9NA 4RBUA 4DX8H 4DV4F 1RT1A 2Q1LA 3TANA 2EC0A 3FDSA 3HKZD 3KLEA 1B0TA 1P1LA 1U1MA 2FVPA 2W24A 3I0RA 5M2UA 3ISZA 5E3QA 1HHSA 2V8VA 4WYWA 1RQ0A 3HO1A 3DMJB 1CC8A 2FB0A 5HMWA 3CCMS 4ZCKA 4QIFA 1FDAA 4H4OA 3SCLE 4WFZA 3M6XA 2QLXA 1RGVA 5IZHA 1M5VC 3VAJA 3HDSA 3PJXA 4CH1A 3B82A 1N88A 1WG4A 3Q0AA 2IBOA 2HG4A 2WSEC 2XEXA 1Q82T 4B9LA 3WBZA 1FRHA 2ASLA 2YWGA 1ZTWA 2PC6A 3GR1A 4OZ5A 1CG2A 3UW1A 1ZM2A 3H98A 3H5UA 3EPIA 5KFSA 5JVGQ 4CT8A 3W7BA 2MDAA 2HGLA 2JVRA 4RKUC 2ZJQQ 2RU3A 3EPGA 2DNKA 2W4CA 2YNIA 3MM7B 3S7RA 5KFDA 4DQPA 3OJUA 2DJWA 2E1MC 1TKXA 1D9FA 4OX6A 3MAQA 5B09A 2J6SA 2WK4A 5KFKA 2XS5A 2OO4A 1JJHA 3TRGA 1FJ7A 4PUOB 4FF4A 4J5OA 2DH9A 1HBOA 3NNCA 3UNGC 2ROEA 4M94A 2MYFA 2JL9A 2R2RA 5J2PA 3IS9B 1HD1A 4FNIA 4QIVA 2BXJA 4ES3A 6FDRA 3FSXA 3MMJA 1Y5IB 4MFBA 1UJ5A 2VFRA 1IQZA 5GMKa 2FLLA 3TVKA 3BS9A 5F8GA 4LSNA 2Y0SD 4PG7A 3MM6A 3N6MA 1JIHA 5E7OB 2O66A 5SZTA 2VBYA 2WAQD 2KG0A 2CZ4A 3RYLA 3C6UA 4XDCA 3KK2B 1Y9OA 1XR5A 5GAGI 3M9MB 4WK1A 2ZD1A 4WJBA 2D41A 3F56A 4NZ0A