4CO7A

Crystal structure of human gate-16
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
SMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Polymorphism in Autophagy-Related Protein Gate-16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GAMMA-AMINOBUTYRIC ACID RECEPTOR-ASSOCIATED PROTEIN-LIKE 2
total genus 34
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4co7A00
2KNBA 4MH0E 2MW5A 2NBVB 3N32A 2YLMA 3T8MA 5C1ZA 4GGQA 4CHKA 4W9IA 3L54A 4G50A 3APDA 3QWZB 2ZNVC 4MJSA 4LJPB 4N9F4 3KVFB 2VRRB 4HLEA 4DHZB 3EECA 3TBLD 1UBIA 1WYWB 4DK5A 3L16A 1LFDA 2BYVE 1UD7A 3KW5B 2LVOA 4HVBA 3QX1A 3TIXA 3TMPB 4W9GA 5C23A 2L3ZA 4FULA 4WWOA 3V61A 1C1YB 3NZUA 4EZKA 1IYFA 1WGGA 1WX8A 1D3ZA 2A5UA 1NBFC 1WJUA 3ONSA 5CHVC 4NAWB 4FJYA 4K81A 4KIKB 2FCSA 4W9HA 2CHWA 5JHBA 3V62A 4F7ZA 1E7VA 2L76A 1L7YA 3ZTCA 3VUWA 2LWPA 5JZEB 2KFKB 2J0JA 4IUMB 5E6OA 1T0YA 1V2YA 1LXDA 3ZDMC 5LLIA 1PQSA 4AUQC 1OEYA 4G0NB 3B08A 1WH3A 4FHJA 4WQOB 3VXWA 5LXHA 4MDKE 1Z2MA 4BOZB 2FIDA 1UBQA 2WX1A 2L0TA 3ZLZA 2FCQA 1RLFA 2FCNA 1YD8U 4FJVB 1NI2A 2B3AA 2NBWB 5AZHA 3AXCA 4WJNA 1SE9A 3UINB 3VQIA 1CMXB 3VFKA 1WZ3A 3QC8B 1S3SG 4CO7A 3BY4B 3U30A 1NDDA 3AU5A 2KKCA 3PGEA 3VTWA 1ZKHA 4F1SA 1RRBA 3VTVA 5J17A 1WX7A 3NY5A 4GDKB 2LGXA 4P7IA 3RD2A 3ZUNA 3Q3JA 1WX9A 4K1RB 2HE7A 3DVGX 2M0XA 1XD3B 5DPSA 4AWJA 4I6NB 4ANXA 3IBEA 5JHAA 2NVUI 3CSFA 2K8HA 2N1WA 4W9LA 3DOWA 4RM9A 5HKHA 4HPMB 3A9JB 3K9PB 5EDSA 5D7GA 5KHQA 2JPHA 4HCPB 4XZ4A 2BYEA 1YX6B 4PS8A 1GC7A 2KMAA 2ZCBA 3DBLI 3JSVB 3TJPA 2KDEB 4FA6A 2DAJA 3RYTA 4MEMA 2HJ8A 4KZCA 2I1KA 3ZVVA 1GC6A 1P98A 2KQ7A 2JZ3B 2A4ZA 3M3JA 2BWFA 3PHWB 3ENEA 1WE7A 5DPRA 4EUTA 3N3KB 4HDOA 1WFYA 2QHOA 3MTNB 3GZNI 1KLVA 2L0FA 2BF8B 4HDQA 1P3QU 2I1JA 3TCAA 4NQLB 1G6JA 4FN2A 4JL9A 3B1LX 3Q3FA 2KDFB 2PJHA 1S1QB 4DHJD 2L00B 3VHTC 3R7QA 1V86A 3A1QB 3DVNU 3ECIA 1I35A 2KQSA 2RD0A 3PRPB 1J8CA 4RMAA 1KM7A 4AJWA 1WRDB 1L2NA 2AYOB 1EF5A 2LXAA 3PHXB 2CKHB 3DVNV 3ML9A 3H7SA 2NBUA 3PT2B 1WGRA 2KTRB 3IVFA 3T9LA 4FHKA 1R4NI 4OVUA 4WAAA 3D32A 3EHVA 3H1UA 1WJ6A 2G4DB 4IW0A 2CS4A 1V9JA 4BKTA 1TTNA 2MP2A 4A3PA 2C60A 3RCZA 3QHTA 4PYUA 3NOBA 3HM3A 4FBJB 2IY0B 2LUEA 4K7SA 1I42A 2O2VA 4I6LB 4NJ6A 4IC7B 4II3B 2MCNB 2UYZB 3R66C 2DZIA 2HD5B 2L05A 2XBBC 4KDIC 3VVWB 3I3TB 5D6JB 2LVQA 2ZCCA 3PV1A 2KJ6A 3U8ZA 3DVGY 3WAOA 2KO3A 2IO0B 2ASQA 3ALBA 2REXA 2KTFA 2DYOA 1VCBA 2LXCA 3OLMD 1IP9A 3EFUA 4ICVA 2K6QA 5J2RA 3V60A 1E8ZA 2KX0A 1WR1A 2KFKA 3IFWB 2J0KA 4IG7B 3QQ8B 1WXAA 2IO3B 2LVPA 4MELA 2N7EA 4NQKE 2C7HA 3UGBB 4YL8A 2GBKA 2KDIA 2EKEC 2G4SA 2BWES 1WI0A 3QAQA 4ANWA 4GXBA 4RM8A 2IO2B 5D94A 2DX5B 2O2VB 2AL3A 2ZVNA 1WR6E 2O6VB 2D07B 4KSKC 1TBEA 4WJQA 3QCAA 3PPAA 3L0WB 3M63B 5KHOA 4GDLA 5DCNA 1Y8RC 1XQQA 4ICUA 3RULA 4ZRIA 2ZPYA 4M8MA 1WM2A 4IWQA 3H7PB 2M8SA 4LCDE 4BKGA 1LM8B 2DYBA 3PRZA 1KJTA 3WANA 1R4MI 1M94A 1VD2A 2MBEA 2KDBA 2KK8A 5AZFA 3X23A 2M4NA 3DBRI 2FNJB 3APFA 3A9KA 3ZO5B 3S2AA 2C7NB 4NNJB 4MGIE 4DDID 4MGZE 4NPNA 3L13A 1RAXA 2GMIC 4KSLC 1WF9A 4PS7A 1AARA 1V5TA 2KD0A 2LJ5A 2KOXA 4HPLB 2FAZA 1J19A 2MSED 3JYUA 2K8BA 4MSQB 2BYFA 1V6EA 2LD9A 3C0RB 3KUCB 4HWIB 1EO6A 2MBOA 1UELA 3EC8A 3VUYA 3V6CB 4K7WA 2LGYA 1JRUA 2BKRB 2CHXA 4EZJA 4ZDVA 4MJSB 1TGZB 4HXDA 4MSMB 3SD5A 3SU8X 2C7MB 2MBQA 3ML8A 5JH5C 3B0AA 4OVVA 3R3MA 4DBGA 2PPHA 4GDLB 3ZRCA 2ZNVB 2FUHB 3OJ4B 3SDLC 2V4LA 2ZPNA 3ZNZB 5IA7A 4WWNA 3H7PA 2GOWA 4B9KA 1UH6A 2IY1B 4TV3A 3AU4A 4E3CA 3UIPB 1ISNA 3QJZA 4I6PA 2M1MA 2DZKA 3PVLA 2DZJA 3WAPA 3L17A 4G11A 3ZDTA 4BKSA 2CR5A 2N9XA 2WWZA 4GMVA 1K8RB 3VAWA 3VDZA 5TR5A 4AP4C 3AI5A 1TZ1A 2LZ6A 3DCGA 4JQWC 1WXSA 1Q5WB 3X0WA 2D3GA 3H6NA 1Q0WB 2LGDA 3VTUA 2FCMA 3QK0A 1WE6A 3IHPC 3IG3A 2C9WB 4MGKE 2GBRA 1P0RA 4BVUC 3DBHI 2N9PC 4GU2A 5D2MB 5J18A 4G3XB 4IWPA 5G55A 2GBNA 3PLUA 3HIZA 1WY8A 5CX3A 5FR6A 1QZEA 2LRWA 2EMSA 3H9DA 1OGWA 3A1QA 1GNUA 2R2OA 4JIOU 3ZRFA 2W9NA 1J0GA 3KUDB 1WM3A 2DENB 3CF6E 2ZZPB 4GDKA 1C3TA 4JGHB 3KUZA 2XK5B 3OAWA 3PRMB 4PYZA 4W9FA 3HK0A 4HK2A 5L83A 1P1AA 2FIFA 3CSTA 5GMVA 1OEYJ 1WJNA 2G45B 1EF1A 2LRUA 2MBBB 5AZGA 3L10B 3QIJA 4LJOB 4W9DA 5CTRC 2D11A 2L7RA 3U7DA 2K25A 1UGMA 3PSEB 2JF5A 4TQ1A 2CU1A 2GBJA 3BINA 3MJWA 1V49A 4XC2A 1V81A 4B6WA 4ANUA 2BKFA 4CYEA 4E74A 1WXVA 3RZWC 4ASWC 3QARA 3PS6A 2EMTA 1A5RA 2K8CA 4DWFA 1RFAA 2RSUA 4PS3A 4A20A 2AL6A 4ZRJA 1X1MA 2KMCA 2RPQA 3GOEA 3RZFA 2PE9A 4II2B 4FADA 5E6NA 2G3QB 4E71A 2WYQA 2NS5A 3A33B 2KC2A 2PEAA 4BOSC 4DHZE 4DXAB 2KWVB 1SIFA 2KJRA 1IPGA 3WA0A 4IM2A 1FXTB 2OJRA 2XK5A 4W9EA 4EKUA 2RR9A 3JVZX 3A4SC 3R7RA 4AOFA 2Z59B 5DPWA 2KFJA 1Q1OA 2NR2A 2WX0A 2KVRA 3VH4B 3DDCB 3N30A 2RGFA 2KANA 3A9KB 2L8JA 2J7QB 4DDGD 5L95C 3W1SA 3M95A 2DYMA 2N7DA 1Z5SB 5G2NA 4TQ0A 1E8XA 3UIOB 2K39A 4IM3A 2N4FA 1GJZA 5IAAC 4KV2A 2V1YA 1H8CA 4TUUA 3HM6X 3ZW3A 2D2QA 2MP2B 3TL5A 1V5OA 1MG8A 1WMHA 3A4RA 3KH0A 2JZZA 2KLCA 4JLCA 2MRPA 2AWTA 2MBHA 4NY0A 3AULA 2MX2A 2MQJA 1YX5B 3O65B 3LJ3A 2KJHB 3ZKJC 4NAWA 2V3SA 2K6DB 4KIKA 2KHWB 3ZNID 2ZJDA 5AEKB 4WWPA 3DQVA 4KZ0A 2KLGA 3ZNHB 5LXIB 4GIVA 1BT0A 3MHSD 3OJ3A 1E5WA 1OQYA 3W1YA 1WGHA 4EFOA 3LDZE 1ZW7A 3W1SC 4BBNC 3UQBA 4GSWA 3SHQA 4ANVA 2YVCA 4HJKA 4ZRKA 4DHJB 1HE8A 4F8CB 4LDTB 4NJ7A 3P2BA 2KXJA 3KYDD 4ZYNA 2UWQA 3WALA 2O6VD 2N1VA 2WDTB 3ZTDA 2NCNA 2JRHA 1SGHA 5DPTA 4EZLA 1GUAB 2AEHA 4LDTD 5E6PA 5CHFA 3PTFC 4HCNB 2XEWA 1YQBA 1V80A 4TKNA 4W9JA 3APCA 2D10A 2NPTA 1WGYA 4KVGB 1U4AA 4X57B 2J0MA 4AJYB 2MLBA 1WMHB 2ZEQA 3CMMB 3RT3B 2DAFA 3NS8A 4GB9A 2O6VA 1E90A 1E7UA 3WIMA 1F9JA 4MM3A 2JY6A 3ZIMA 4KDLB 4WJPA 1EUVB 3DBSA 3VUXA 1ZGUB 4EEWA 2K1FA 4BKSD 1E8YA 3L08A 4A3OA 2N9EB 3A9JA 4GOCA 1E8WA 2KWCA 3NHEB 3V6EB 2R2QA 3ZNGC 1WJ4A 4M8NA 4XX5A 2JVCA 2BGFA 1H4RA 4BBNF 4FJZA 4W9KA 1YIWA 3PLVA 4W9CA 2Z0EB 2JRIB 3JSVA 4IWOA 3UF8A 4IM0A 3DPDA 3PREA 2DZMA 3KYCD 3M62B 5CHWA 2Z0DB 4GN1A 2JUOA 2CHZA 2KWUB 2JXXA 4EOYA 1KOTA 2HTHA 2MWSB 1GG3A 1WIAA 2C5LC 3PZDA 3UQAA 4J6IA 1LQBA 2IYDB 1P9DU 2KC1A 2ZVOA 2PE6B 2M17A 4BFRA 1OTRB 2NPTB 3QA8A 1UZXB 2DHZA 2Y5BB 2IZVB 4FLHA 5BO4B 3WAMA 1WXMA 1WGDA 2LI5A 2KN5A 2JWZA 2GBMA 3K9OB 4URKA 2KZRA 4MGYE 3HHMA 2IBIB 2KX3A 2OOBB 4M0WB 4B95A 2MA9B 1YJ1A 3VH3B 2IO1B 3RUIB 4WJOA 1WZ0A 2LASA 2BPSA 1XT9B 2JT4B 2KTRA 3NZSA 3JW0X 4K7UA
chains in the Genus database with same CATH superfamily
4OVZA 1MPEA 2MW5A 4GGQA 4LNIA 4WURA 1M4VA 3ETRA 3APDA 3QWZB 2ZNVC 2FE8A 3Q8BA 4TSSA 1TS3A 2LHDA 3KVFB 2VRRB 1XCQL 3TEXA 2BYVE 4C80A 2CJOA 5MPOA 3KW5B 4ZRQA 4HVBA 4W9GA 5C23A 4WWOA 1C1YB 1IYFA 1WX8A 2A5UA 1SBBB 1BMLC 2FCSA 2NTSA 4LLGM 4EE2A 5G5GA 3ZTCA 3VUWA 2KFKB 2J0JA 3ZDMC 4G0NB 1Z2MA 2FBWB 1YNTE 2FIDA 1UBQA 2L0TA 1YD8U 1AYFA 4P1BC 1JWBD 3AXCA 2D3CA 3VFKA 3BY4B 5T8IA 3PGEA 3VTWA 1ZKHA 1WX7A 3NY5A 4C4VA 2LGXA 2AQ3B 1WX9A 5AUKA 3FILA 5HKHA 4HPMB 5EDSA 5D7GA 5BYQA 1YX6B 1GC7A 1LO5D 4KZCA 3W5VB 1GC6A 1P98A 1F2RI 2WDRB 1TS2A 1WE7A 5DPRA 4HDOA 2QHOA 1KLVA 2BF8B 3TCAA 2ICIA 4ACFA 2PJHA 1DOIA 3VHTC 3ECIA 2WS3B 4RMAA 4WAFA 1EF5A 2LXAA 2CKHB 1WGRA 1T3QA 2LMCA 4WAAA 3D32A 4IW0A 4BKTA 1ENFA 3OG5A 3HM3A 3UI3A 2IY0B 2LUEA 4K7SA 2O2VA 1RFKA 4IC7B 3R66C 3PZ7A 3FAHA 3VVWB 2N7JA 2ZCCA 4JPSA 3ALBA 3BVZA 2DYOA 1J7BA 1WRIA 3VR8B 1IP9A 3EFUA 3NZ3A 3BWUD 2V3PA 4LK0M 1E8ZA 2KFKA 2LGIA 1VZ8A 2J0KA 4NQKE 4YL8A 1PDXA 1I7HA 1DOYA 1R7SA 1PGAA 4C7ZA 1N5XA 4ANWA 4GXBA 2IO2B 2ZVNA 2O2VB 1TBEA 1TY0A 4YTNB 3DBRB 3M63B 3ZQ4A 4WQMA 1Y8RC 2ZPYA 4IWQA 1YN5A 3BK2A 1FXAA 1LM8B 3P63A 4LCDE 4FXCA 1KJTA 1D5ZC 2KDBA 2KK8A 2VZKD 3DBRI 3APFA 1KLGD 2KQ4X 2C7NB 1CZPA 2K22A 5LNK1 1RAXA 1AARA 1V5TA 5BYSA 3ABVB 3JYUA 1FNWA 3KQ4A 3C0RB 3EC8A 2RMMA 1PGBA 1D5MC 4EZJA 4ZDVA 1TGZB 4HXDA 4MSMB 3SD5A 3SU8X 3ZXRA 1KTKA 3R3MA 3ZRCA 5BMHA 4P16A 1L4ZB 3W2DA 3ZNZB 4WWNA 4YSXB 4TV3A 5HG2A 3AU4A 1AW7A 3NJTA 3N1ZC 3WAPA 2BVCA 4QAYA 5TR5A 3KLSX 3AI5A 1TZ1A 4RGTA 4JQWC 2GI9A 1WE6A 3IG3A 1L6VA 4MGKE 2GBRA 1P0RA 4RH6A 5D2MB 1HZ5A 4G3XB 1K50A 5FR6A 1JALA 3A1QA 5E6JA 2R2OA 3P4PB 2KMMA 1NENB 2W82A 3CF6E 2JYTA 1C3TA 4W9FA 1P7EA 5L83A 1GPXA 1B9RA 3ZJUA 5GMVA 3L10B 1UWMA 1PFDA 2L7RA 3U7DA 2K25A 2CU1A 4XC2A 4B6WA 3MC0B 2BKFA 4ASWC 1HEZE 4ZRPA 1STEA 4DWFA 4ITKA 3HRDD 1MI0A 1V1OA 4FADA 4II2B 2G3QB 1I4XA 4E71A 2NS5A 5HI1A 3Q6BA 4BOSC 1MVKA 4DXAB 1IPGA 1R4MB 3N9YC 4IM2A 4EKUA 2Z59B 4WWMA 2NR2A 4YSYB 2JZPA 3AEGB 5HHDG 2J7QB 1VR9A 1EWCA 3W1SA 3M95A 1EU4A 5BMGA 4NAMA 2K39A 1GJZA 2N4FA 1N61A 3AN1A 1ET9A 4KX6B 3HM6X 3ZW3A 1XLPA 3NRZA 3A4RA 2JZZA 2KLCA 2MRPA 2AWTA 4NY0A 2MX2A 1MG4A 1YX5B 2W3SA 2V3SA 2K6DB 2LJIA 1R4NB 3ZNID 2AQ1B 1PGXA 4UDUC 1E5WA 3BYTB 4C4VB 4EFOA 1MJDA 1NYRA 4L23A 4XWWA 4ZRKA 4F8CB 3ZXVA 1ZE3D 2N1VA 2W55A 3ZTDA 2WNMA 1SGHA 5E6PA 2BB6A 3PTFC 1V80A 3APCA 4KVGB 2D10A 1WGYA 1U4AA 2J0MA 2N9KA 3CMMB 2ZEQA 1QQRA 1ZXHA 3ZJVA 3NUHB 3R2TA 2K9XA 1ZP0B 3DBSA 1ZGUB 1E8YA 2INPE 3L08A 5D3IB 1SJHD 3A9JA 3V6EB 4M8NA 4XX5A 2JVCA 4FJZA 4W9CA 3JSVA 4LNFA 4L1BA 4IM0A 4DXFA 2DZMA 3KYCD 5IP4D 2G1EA 2JUOA 5EE1A 1KOTA 5H92C 2KN4A 3B2FA 2IYDB 2M17A 3I63C 2DHZA 2IZVB 1XLNA 2QCZA 3IAM1 3VRAB 2GBMA 1XCTL 3K9OB 4GLSC 4A8XC 2IGDA 4M0WB 2LASA 4US8A 4YT0B 2BS3B 1XT9B 2JT4B 3NZSA 3T8MA 5TSSA 2NBVB 4G50A 2WXJA 4MJSA 4HLEA 1IBXA 3TBLD 1WYWB 3L16A 3Q8EA 3AEDB 2MJ3A 3Q3MC 1I4RA 1NI3A 4FULA 4EZKA 3NZUA 1ZOYB 1ROEA 1NBFC 4NAWB 4FJYA 4KIKB 1HTQA 4W9HA 4B0MA 3V62A 1DGJA 1E7VA 3KWVA 3HUIA 1EU3A 4IUMB 5LLIA 4FHJA 1E0ZA 2DBYA 3AEBB 2I2YA 4YTMB 3BYYB 1NI2A 2B3AA 1UNSA 3I57A 3BVMA 3VQIA 3SR6A 1CMXB 4ZHOA 1WZ3A 1S3SG 4ARIA 1NDDA 4F1SA 1QOBA 1RRBA 2K5PA 3ZUNA 4K1RB 2HE7A 1JMLA 4I6NB 3IBEA 5D3DA 2K8HA 4W9LA 2PKOA 4RM9A 1J7CA 1ET6A 3A9JB 2JPHA 1C78A 2BYEA 3AECB 1DOXA 2ZCBA 4P6VF 3JSVB 3TJPA 3RYTA 1CK1A 2I1KA 4XYCA 1MHXA 2A4ZA 2NTTA 3P4RB 1I4QA 3E9SA 1WFYA 3MTNB 2BT6A 1QOGA 2L0FA 4HDQA 2I1JA 1G6JA 4JL9A 3B1LX 2KDFB 1S1QB 3R7QA 4HKZE 3AE3B 1I35A 1J8CA 2BB5A 1L2NA 3EUB2 3PHXB 3ML9A 3H7SA 2NBUA 3IVFA 2PVGC 4IOIE 3NG0A 1R4NI 1YQ3B 4RF0A 1V9JA 1TTNA 2MP2A 2C60A 3RCZA 4PYUA 3N20C 4OZBA 2LUMA 1FNUA 4I6LB 5EE0A 2DZIA 2HD5B 1HA5A 2L05A 2E3TA 1XLOA 3IT6B 5D6JB 2LVQA 3PV1A 2KJ6A 3U8ZA 4HEA1 3AE4B 1FCCC 2KTFA 3AB5A 5J2RA 3V60A 2KAJA 3MJ5A 1I4HA 1GB4A 4IG7B 1SSNA 2LVPA 4MELA 2N7EA 2Y5PA 2C7HA 4KKIA 3IAS1 3AE6B 3R8BA 5D94A 2DX5B 2AL3A 2D07B 4KSKC 4WJQA 1IUEA 1TYGB 4ICUA 3NVYA 1NVID 2M8SA 4BKGA 3PRZA 3WANA 4YSZB 4LNOA 2DNFA 2WXMA 3NVZA 3ZO5B 4DDID 4MGZE 2GMIC 2KD0A 2LJ5A 2QSDA 1J19A 3H8HA 2K8BA 4XDCA 4MSQB 2BYFA 1V6EA 1ZXIA 1WYGA 2LD9A 3VUYA 2KWDA 1OQQA 2LGYA 5EE3A 4MJSB 5JH5C 4RGNA 1HQRD 4DBGA 4GDLB 1QILA 2KVZA 1TKEA 1F2RC 2V4LA 2ZPNA 1T0SC 3AEFB 1MFWA 3QJZA 2M1MA 4AQ7A 4O1NA 2BS4B 3L17A 2CR5A 2WU2B 1FO4A 1K8RB 3VAWA 1Y56A 3FKYA 3X0WA 2D3GA 2LGDA 3Q69A 4BVUC 3DBHI 1C4PA 4WIPA 2ZW0A 5G55A 3U2SC 4D2KA 3PLUA 1WY8A 3BK1A 4JWSC 1QZEA 2LRWA 2EMSA 5CX3A 4RGMA 1OGWA 1SJED 2QEJC 2ZZPB 1C9FA 2XK5B 4PYZA 3WCQA 1WJNA 1EF1A 2LRUA 2V9HA 3KWLA 3QIJA 4LJOB 2QJLA 5CTRC 4XWTA 2JWUA 4TQ1A 2AX5A 4ANUA 4CYEA 1WXVA 3QARA 4ARCA 4KKJA 3AEEB 1X1MA 1PYWD 3RZFA 1L0YB 1FD6A 3A33B 2L83A 2PEAA 2YEPF 1SIFA 1FXTB 4W9EA 2XK5A 1VZ6A 1J7AA 3JVZX 4AOFA 5DPWA 5FR3A 3TEYA 2KFJA 1C79A 1AN8A 1ZDXA 3L4PA 2GB1A 4TQ0A 1E8XA 3UIOB 4KV2A 1PUTA 2WU5B 2V1YA 4P1CC 1H8CA 1WMHA 3KH0A 2WXPA 2MBHA 3AULA 4OZAA 2WXKA 2MQJA 2PW9A 2VZKB 5JXVA 3ZKJC 1IGDA 2LFIA 4WWPA 3DQVA 3ZNHB 5LXIB 1GAQB 5H8YE 3W1YA 3LDZE 1ZW7A 4DHJB 3GZNB 2KXJA 4ZYNA 3RMKC 3WALA 2WDTB 3V3XA 1FIQA 1TS4A 4EZLA 4LDTD 4HCNB 2OEDA 4M02A 2XEWA 4TKNA 4W9JA 2NPTA 1WMHB 2L52A 1FNVA 2O6VA 4KGSA 1E7UA 1F9JA 3ZIMA 4KDLB 1EUVB 3E56A 3VUXA 4EEWA 2K1FA 3Q2AC 4GOCA 2KWCA 2HDEA 2R2QA 2MHJA 2SAKA 4BBNF 1KH0A 3I9V1 3PLVA 4L2YA 4LNKA 3SFEB 3AE7B 3DPDA 3DHGC 4GN1A 2CHZA 1SIJA 4XE0A 1C77A 2KC1A 2ZVOA 3C19A 2NPTB 4JE3B 2Y5BB 3AE8B 4FLHA 4PT5A 3WAMA 1WXMA 3P1MA 1C4AA 1ESFA 2JWZA 1ACCA 4REZA 3HHMA 2OOBB 4OZCA 3VH3B 2ACZB 1SE4A 3AMZA 1D5XC 4A6QA 2KNBA 5C1ZA 3N32A 2UU7A 2YLMA 4CHKA 4W9IA 3L54A 4N9F4 3AE1B 4LJPB 3ZYYX 4HKQA 4DHZB 3RNFC 1T6BX 3EECA 2WXGA 1UD7A 3Q8CA 3QX1A 3TIXA 2VH2A 1WGGA 2EKIA 4N6EB 1WJUA 3ONSA 2EELA 4K81A 4JWUC 2CHWA 2W54A 5JHBA 2IPKD 2L76A 1I4PA 2LWPA 5E6OA 1T0YA 1LXDA 1V2YA 2L1AA 2WLBA 1PQSA 4AUQC 3RNCC 2IGHA 3B08A 4WQOB 3RNGC 4AS1A 2WX1A 2FCQA 2FCNA 3B9JA 1XEEA 4FJVB 2NBWB 5AZHA 1SE9A 5C2TB 2DWQA 2PTLA 3QC8B 3FC4A 1ZDVA 1JWSD 2Q5WD 4P7IA 2QILA 1XD3B 5DPSA 4AWJA 4ANXA 5JHAA 3CSFA 3K9PB 4HCPB 1BUIC 2Y3AA 3O13A 4FA6A 4CQNA 2DAJA 2JYEA 2INNE 4MEMA 1UF0A 3AV8A 2KQ7A 2JZ3B 3M3JA 2BWFA 4MACA 3ENEA 1VLBA 3N3KB 4MM3B 3GZNI 4NQLB 1VJKA 2WXIA 3Q3FA 3TUOA 4DHJD 2K0PA 1JROA 1L5PA 2V4IB 2RD0A 4IDIA 1D6EC 2JSVX 3SEBA 4AJWA 1WRDB 2AYOB 3DVNV 2J52A 2KTRB 3T9LA 4FHKA 1T0QC 3LB8C 3U4EG 1WJ6A 3QHTA 3VRBB 3DWMA 2QC8A 1I42A 2UYZB 2XBBC 4KDIC 2G9HD 2WXLA 3WAOA 2KO3A 3AEAB 5GXGB 4B0EA 4ICVA 4PK1A 2ON8A 4YWGG 1WR1A 3QQ8B 1WXAA 4YTPB 2IO3B 3UGBB 2GBKA 2WDVB 1WI0A 3QAQA 4RM8A 3MP9A 1V1PB 1WWTA 3GB1A 2ONQA 1YJJA 5DCNA 2FUG1 1XQQA 4ZRIA 3RNBC 4LTUA 3H7PB 2DYBA 1L0VB 1R4MI 2MBEA 5AZFA 1Q10A 5IN7A 3FILB 3X23A 3A9KA 3S2AA 3CIRB 4KSLC 4PS7A 2KOXA 4HPLB 4XGAB 3VR9B 4C00A 5HFYA 2M19A 3KUCB 1EO6A 2D5GA 1UELA 1QT9A 1YQ4B 2MBOA 2X8XX 3RI7C 2BKRB 2C7MB 3RFZB 3BZDB 2BW2A 4OVVA 2ZNVB 2FUHB 3OJ4B 3SDLC 2IDYA 1FRDA 3H7PA 2GOWA 4B9KA 1GOZA 2IY1B 3U7ZA 1LGRA 3J9CA 1ISNA 1YN3A 4I6PA 3PVLA 4BKSA 3Q14C 3VDZA 1FFUA 3ZJTA 1Q5WB 1Q0WB 1FEHA 3QK0A 3IHPC 1KRHA 5J18A 1D4BA 2GBNA 3H9DA 2NMQA 1RM6C 3ZRFA 4JIOU 1FPYA 1QOFA 2W9NA 2MEKA 4H2AA 1WM3A 1FCLA 4JGHB 2N9LA 3HK0A 1P1AA 5EE9A 3CSTA 1OEYJ 3NS1A 4M01A 5AZGA 2V3NA 4W9DA 2D11A 2K3UA 2GBJA 4MH8A 1V81A 2Z8LA 3PS6A 4HROA 5BMIA 1RFAA 2RSUA 4PS3A 1UGJA 2AL6A 2JXTA 4ZRJA 1KF6B 2KMCA 2GLSA 2RPQA 4C56C 2PE9A 1YMHE 2WYQA 1K53A 2KWVB 2KJRA 3R7RA 2WXOA 1Q1OA 2KVRA 4RF1A 3VH4B 2J53A 1FXIA 2RGFA 3A9KB 2L8JA 4N58A 4DDGD 3RNEC 5L95C 2DYMA 2N7DA 5G2NA 3JW0X 4IM3A 4TUUA 3TL5A 1JCKB 1MG8A 1I4GA 2KT7A 3O65B 2KJHB 4NAWA 1N5WA 4KIKA 2KHWB 1SXTA 5AEKB 1EM7A 1L0XB 2PVOD 2QIEB 1WGHA 1TIFA 3UQBA 4KGTA 1WXQA 3SHQA 4ANVA 4HJKA 1F0ZA 3TSSA 4NJ7A 3P2BA 2WXNA 3KYDD 2YEPB 3I5JC 1C76A 2NCNA 5DPTA 2AEHA 5CHFA 3RNAC 2WXRA 2LHEA 1FFVA 1RYJA 2MLBA 1HTOA 2DAFA 3Q3OC 3NS8A 1BXTA 4GB9A 3Q3NC 1V1PA 1UWXA 1E90A 3WIMA 2KACA 4MM3A 2JY6A 4WJPA 1SE3A 4A3OA 3ZGZA 2N9EB 1TT5B 1E8WA 3NHEB 2QMTA 4C7YA 2TSSA 1H4RA 2OHFA 2JRIB 1YJIA 2J4XA 4ZYSA 3PREA 3B2GA 3M62B 4JX1C 2KWUB 4EOYA 1GG3A 2E6XA 1WIAA 2MWSB 3UQAA 4J6IA 1E9MA 1P9DU 4NJCA 2IJ0A 2JQRB 3BVGA 2PE6B 4BFRA 3QA8A 5FKAC 1KLUD 1N6ZA 5IKCM 4K3BA 1HXYD 2LI5A 1WGDA 2KN5A 1XXGA 2KZRA 1E6EB 2IBIB 3AH7A 4B95A 4WJOA 2BPSA 1XLQA 4LNNA 1IGCA 1RWSA 1NEKB 4MH0E 4RNAA 2H88B 3NVWA 3GE8C 4XDDA 1UBIA 4DK5A 1LFDA 2LVOA 3TMPB 2L3ZA 3V61A 2WP9B 1D3ZA 5CHVC 1B1ZA 1JQ4A 4DQOC 1CQVA 4M0WA 2M0AA 4KGRA 4F7ZA 2KYWA 1L7YA 3DWGC 1N62A 4YXDB 1T0RC 5JZEB 1E10A 1OEYA 2BQQA 2L32A 3VXWA 1WH3A 2GRIA 4BZAA 1XO3A 4MDKE 5LXHA 4BOZB 1TS5A 1HZ6A 3ZLZA 1QLBB 5C3JB 1RLFA 4NZLB 4DXGA 3OWEB 4WJNA 2X38A 4K3CA 3UINB 2SEBD 3EGRA 4CO7A 3U30A 3AE2B 3AU5A 2KKCA 2WDQB 5J17A 3N1XC 3VTVA 1V8CA 4GDKB 3RD2A 3Q3JA 1FMAD 3DVGX 2M0XA 4S17A 4USAA 3TEZA 2NVUI 2N1WA 3DOWA 3V05A 5KHQA 4XZ4A 1L6UA 4PS8A 2KMAA 2CU3A 3DBLI 2KDEB 3GE3C 2HJ8A 3U52E 3ZVVA 2V0GA 3PHWB 1AWDA 4EUTA 3TEWA 1P3QU 2AQ2B 2W3RA 3NVVA 1L4DB 4FN2A 1YN4A 2L00B 1K51A 1V86A 2XN9C 3A1QB 3DVNU 3P42A 2KQSA 4S0RA 3PRPB 1JW9D 2PMVA 1KM7A 3P4SB 3IT4B 1SE2A 1VDVA 3PT2B 4OVUA 3T3NA 3EHVA 3H1UA 1JWUD 2G4DB 2CS4A 3Q8AA 2Y5CA 3SFDB 4A3PA 3AE9B 1GB1A 3NOBA 4FBJB 4NJ6A 3GP7A 2MCNB 4II3B 3N1YC 2BS2B 3HVDA 3I3TB 4A9AA 3DVGY 2J42A 2IO0B 2ASQA 2REXA 1VCBA 2LXCA 3BIID 4ZHPA 3OLMD 2OJWA 2K6QA 2KX0A 3EFCA 3IFWB 1A70A 1QOAA 2WXFA 2N0SB 2KDIA 2EKEC 2G4SA 2BWES 4RCOA 2M56B 1ZUD2 1WR6E 2O6VB 5FK9C 3QCAA 4HJGE 3PPAA 3L0WB 5KHOA 4IKGA 4HRSA 4GDLA 3RULA 4M8MA 1WM2A 4RFBA 1VD2A 1M94A 2JU6X 2M4NA 1VRAB 2FNJB 4NNJB 2PLPA 4MGIE 4NPNA 3L13A 1WF9A 4US9A 2FAZA 2MSED 2PIAA 3Q8FA 1FM0D 3P4QB 1OQRA 3DBHB 4HWIB 1EWYC 5IO9A 3V6CB 2D3BA 4K7WA 1JRUA 2CHXA 3HVZA 1QKZA 2MBQA 3AM9A 2HJ1A 1IBXB 3ML8A 3B0AA 1C4CA 2PPHA 1TZOA 5IA7A 2BYTA 1UH6A 4E3CA 3UIPB 1N60A 1SF0A 3RPFC 2DZKA 4HPPA 2DZJA 4G11A 3ZDTA 1F77A 2N9XA 3AE5B 2WWZA 2CJNA 4OW0A 4GMVA 4WH4A 4AP4C 2ZW1A 2I38A 2LZ6A 3DCGA 1WXSA 2KDMA 4ZOHC 1ZPSA 3H6NA 3MC9A 3VTUA 2FCMA 2VH1A 2C9WB 2WGSA 2N9PC 4GU2A 2MJDA 1JWAD 4IWPA 1CJEA 5G5HA 3LYYA 3HIZA 3W5UB 1GNUA 3DBLB 2RPVA 1J0GA 3KUDB 3C8YA 2DENB 4GDKA 2RDBC 3KUZA 3OAWA 3PRMB 2IGGA 4HK2A 2FIFA 2D3AA 2G45B 2MBBB 3W9CB 1FRRA 3T3OA 3IXSA 1UGMA 3PSEB 2JF5A 3MJWA 3BINA 1P7FA 1V49A 4E74A 3RZWC 3CWIA 1TKYA 2EMTA 1A5RA 2K8CA 1E7PB 2INDC 4M00A 4A20A 2B76B 2MH7A 3GOEA 2RDGA 5E6NA 2INCC 2KC2A 1JRPA 4DHZE 3WA0A 2OJRA 2RR9A 2QDFA 3A4SC 2WX0A 2HTME 2JX5A 3DDCB 3N30A 1WSPA 2KANA 3PO0A 4N59A 5AUIA 4RGOS 2R61A 1Z5SB 1XF5L 2BBCA 1F52A 5IOIA 1MHHE 5IAAC 1TKGA 3MHZA 3DHIC 2DLBA 2D2QA 2MP2B 1DYQA 1SEBD 1V5OA 2LGSA 4JLCA 1QF6A 3LJ3A 2BTEA 3EA6A 2ZJDA 1SB3C 4KZ0A 2KLGA 4GIVA 1BT0A 3MHSD 3OJ3A 4OHJA 1OQYA 2MJEA 1OFFA 3W1SC 4BBNC 4GSWA 1JWMD 2YVCA 3MFGA 1HE8A 4LDTB 3PZ8A 2UWQA 2O6VD 1TY2A 2JRHA 3LXFA 3URYA 1GUAB 2WXHA 1YQBA 4X57B 4AJYB 1KFYB 3RT3B 4Q2JA 4MT5A 2WQYB 5BYRA 1UUPA 2XNAC 4BKSD 3ZNGC 2RDHA 1WJ4A 4BAXA 2BGFA 4W9KA 1YIWA 2Z0EB 3RN9C 4TMAB 1VZ7A 1TJEA 4IWOA 3UF8A 5CHWA 2Z0DB 1NYQA 3DHHC 1K52A 4A55A 2WHIA 2JXXA 5I4DA 2HTHA 1T5XD 3PZDA 2C5LC 4J3OD 1LQBA 1OTRB 2LEKA 1UZXB 1WGKA 5BO4B 4A90A 4URKA 4MGYE 2H89B 2KX3A 4R3DA 3MC8A 2MA9B 1YJ1A 2IO1B 3GS2A 1YOVB 3RUIB 3R2IA 1WZ0A 2WXQA 1N63A 1V97A 2KTRA 1F1HA 4K7UA
chains in the Genus database with same CATH topology
2KNBA 4MH0E 2MW5A 2NBVB 3N32A 2YLMA 3T8MA 5C1ZA 4GGQA 4CHKA 4W9IA 3L54A 4G50A 3APDA 3QWZB 2ZNVC 4MJSA 4LJPB 4N9F4 3KVFB 2VRRB 4HLEA 4DHZB 3EECA 3TBLD 1UBIA 1WYWB 4DK5A 3L16A 1LFDA 2BYVE 1UD7A 3KW5B 2LVOA 4HVBA 3QX1A 3TIXA 3TMPB 4W9GA 5C23A 2L3ZA 4FULA 4WWOA 3V61A 1C1YB 3NZUA 4EZKA 1IYFA 1WGGA 1WX8A 1D3ZA 2A5UA 1NBFC 1WJUA 3ONSA 5CHVC 4NAWB 4FJYA 4K81A 4KIKB 2FCSA 4W9HA 2CHWA 5JHBA 3V62A 4F7ZA 1E7VA 2L76A 1L7YA 3ZTCA 3VUWA 2LWPA 5JZEB 2KFKB 2J0JA 4IUMB 5E6OA 1T0YA 1V2YA 1LXDA 3ZDMC 5LLIA 1PQSA 4AUQC 1OEYA 4G0NB 3B08A 1WH3A 4FHJA 4WQOB 3VXWA 5LXHA 4MDKE 1Z2MA 4BOZB 2FIDA 1UBQA 2WX1A 2L0TA 3ZLZA 2FCQA 1RLFA 2FCNA 1YD8U 4FJVB 1NI2A 2B3AA 2NBWB 5AZHA 3AXCA 4WJNA 1SE9A 3UINB 3VQIA 1CMXB 3VFKA 1WZ3A 3QC8B 1S3SG 4CO7A 3BY4B 3U30A 1NDDA 3AU5A 2KKCA 3PGEA 3VTWA 1ZKHA 4F1SA 1RRBA 3VTVA 5J17A 1WX7A 3NY5A 4GDKB 2LGXA 4P7IA 3RD2A 3ZUNA 3Q3JA 1WX9A 4K1RB 2HE7A 3DVGX 2M0XA 1XD3B 5DPSA 4AWJA 4I6NB 4ANXA 3IBEA 5JHAA 2NVUI 3CSFA 2K8HA 2N1WA 4W9LA 3DOWA 4RM9A 5HKHA 4HPMB 3A9JB 3K9PB 5EDSA 5D7GA 5KHQA 2JPHA 4HCPB 4XZ4A 2BYEA 1YX6B 4PS8A 1GC7A 2KMAA 2ZCBA 3DBLI 3JSVB 3TJPA 2KDEB 4FA6A 2DAJA 3RYTA 4MEMA 2HJ8A 4KZCA 2I1KA 3ZVVA 1GC6A 1P98A 2KQ7A 2JZ3B 2A4ZA 3M3JA 2BWFA 3PHWB 3ENEA 1WE7A 5DPRA 4EUTA 3N3KB 4HDOA 1WFYA 2QHOA 3MTNB 3GZNI 1KLVA 2L0FA 2BF8B 4HDQA 1P3QU 2I1JA 3TCAA 4NQLB 1G6JA 4FN2A 4JL9A 3B1LX 3Q3FA 2KDFB 2PJHA 1S1QB 4DHJD 2L00B 3VHTC 3R7QA 1V86A 3A1QB 3DVNU 3ECIA 1I35A 2KQSA 2RD0A 3PRPB 1J8CA 4RMAA 1KM7A 4AJWA 1WRDB 1L2NA 2AYOB 1EF5A 2LXAA 3PHXB 2CKHB 3DVNV 3ML9A 3H7SA 2NBUA 3PT2B 1WGRA 2KTRB 3IVFA 3T9LA 4FHKA 1R4NI 4OVUA 4WAAA 3D32A 3EHVA 3H1UA 1WJ6A 2G4DB 4IW0A 2CS4A 1V9JA 4BKTA 1TTNA 2MP2A 4A3PA 2C60A 3RCZA 3QHTA 4PYUA 3NOBA 3HM3A 4FBJB 2IY0B 2LUEA 4K7SA 1I42A 2O2VA 4I6LB 4NJ6A 4IC7B 4II3B 2MCNB 2UYZB 3R66C 2DZIA 2HD5B 2L05A 2XBBC 4KDIC 3VVWB 3I3TB 5D6JB 2LVQA 2ZCCA 3PV1A 2KJ6A 3U8ZA 3DVGY 3WAOA 2KO3A 2IO0B 2ASQA 3ALBA 2REXA 2KTFA 2DYOA 1VCBA 2LXCA 3OLMD 1IP9A 3EFUA 4ICVA 2K6QA 5J2RA 3V60A 1E8ZA 2KX0A 1WR1A 2KFKA 3IFWB 2J0KA 4IG7B 3QQ8B 1WXAA 2IO3B 2LVPA 4MELA 2N7EA 4NQKE 2C7HA 3UGBB 4YL8A 2GBKA 2KDIA 2EKEC 2G4SA 2BWES 1WI0A 3QAQA 4ANWA 4GXBA 4RM8A 2IO2B 5D94A 2DX5B 2O2VB 2AL3A 2ZVNA 1WR6E 2O6VB 2D07B 4KSKC 1TBEA 4WJQA 3QCAA 3PPAA 3L0WB 3M63B 5KHOA 4GDLA 5DCNA 1Y8RC 1XQQA 4ICUA 3RULA 4ZRIA 2ZPYA 4M8MA 1WM2A 4IWQA 3H7PB 2M8SA 4LCDE 4BKGA 1LM8B 2DYBA 3PRZA 1KJTA 3WANA 1R4MI 1M94A 1VD2A 2MBEA 2KDBA 2KK8A 5AZFA 3X23A 2M4NA 3DBRI 2FNJB 3APFA 3A9KA 3ZO5B 3S2AA 2C7NB 4NNJB 4MGIE 4DDID 4MGZE 4NPNA 3L13A 1RAXA 2GMIC 4KSLC 1WF9A 4PS7A 1AARA 1V5TA 2KD0A 2LJ5A 2KOXA 4HPLB 2FAZA 1J19A 2MSED 3JYUA 2K8BA 4MSQB 2BYFA 1V6EA 2LD9A 3C0RB 3KUCB 4HWIB 1EO6A 2MBOA 1UELA 3EC8A 3VUYA 3V6CB 4K7WA 2LGYA 1JRUA 2BKRB 2CHXA 4EZJA 4ZDVA 4MJSB 1TGZB 4HXDA 4MSMB 3SD5A 3SU8X 2C7MB 2MBQA 3ML8A 5JH5C 3B0AA 4OVVA 3R3MA 4DBGA 2PPHA 4GDLB 3ZRCA 2ZNVB 2FUHB 3OJ4B 3SDLC 2V4LA 2ZPNA 3ZNZB 5IA7A 4WWNA 3H7PA 2GOWA 4B9KA 1UH6A 2IY1B 4TV3A 3AU4A 4E3CA 3UIPB 1ISNA 3QJZA 4I6PA 2M1MA 2DZKA 3PVLA 2DZJA 3WAPA 3L17A 4G11A 3ZDTA 4BKSA 2CR5A 2N9XA 2WWZA 4GMVA 1K8RB 3VAWA 3VDZA 5TR5A 4AP4C 3AI5A 1TZ1A 2LZ6A 3DCGA 4JQWC 1WXSA 1Q5WB 3X0WA 2D3GA 3H6NA 1Q0WB 2LGDA 3VTUA 2FCMA 3QK0A 1WE6A 3IHPC 3IG3A 2C9WB 4MGKE 2GBRA 1P0RA 4BVUC 3DBHI 2N9PC 4GU2A 5D2MB 5J18A 4G3XB 4IWPA 5G55A 2GBNA 3PLUA 3HIZA 1WY8A 5CX3A 5FR6A 1QZEA 2LRWA 2EMSA 3H9DA 1OGWA 3A1QA 1GNUA 2R2OA 4JIOU 3ZRFA 2W9NA 1J0GA 3KUDB 1WM3A 2DENB 3CF6E 2ZZPB 4GDKA 1C3TA 4JGHB 3KUZA 2XK5B 3OAWA 3PRMB 4PYZA 4W9FA 3HK0A 4HK2A 5L83A 1P1AA 2FIFA 3CSTA 5GMVA 1OEYJ 1WJNA 2G45B 1EF1A 2LRUA 2MBBB 5AZGA 3L10B 3QIJA 4LJOB 4W9DA 5CTRC 2D11A 2L7RA 3U7DA 2K25A 1UGMA 3PSEB 2JF5A 4TQ1A 2CU1A 2GBJA 3BINA 3MJWA 1V49A 4XC2A 1V81A 4B6WA 4ANUA 2BKFA 4CYEA 4E74A 1WXVA 3RZWC 4ASWC 3QARA 3PS6A 2EMTA 1A5RA 2K8CA 4DWFA 1RFAA 2RSUA 4PS3A 4A20A 2AL6A 4ZRJA 1X1MA 2KMCA 2RPQA 3GOEA 3RZFA 2PE9A 4II2B 4FADA 5E6NA 2G3QB 4E71A 2WYQA 2NS5A 3A33B 2KC2A 2PEAA 4BOSC 4DHZE 4DXAB 2KWVB 1SIFA 2KJRA 1IPGA 3WA0A 4IM2A 1FXTB 2OJRA 2XK5A 4W9EA 4EKUA 2RR9A 3JVZX 3A4SC 3R7RA 4AOFA 2Z59B 5DPWA 2KFJA 1Q1OA 2NR2A 2WX0A 2KVRA 3VH4B 3DDCB 3N30A 2RGFA 2KANA 3A9KB 2L8JA 2J7QB 4DDGD 5L95C 3W1SA 3M95A 2DYMA 2N7DA 1Z5SB 5G2NA 4TQ0A 1E8XA 3UIOB 2K39A 4IM3A 2N4FA 1GJZA 5IAAC 4KV2A 2V1YA 1H8CA 4TUUA 3HM6X 3ZW3A 2D2QA 2MP2B 3TL5A 1V5OA 1MG8A 1WMHA 3A4RA 3KH0A 2JZZA 2KLCA 4JLCA 2MRPA 2AWTA 2MBHA 4NY0A 3AULA 2MX2A 2MQJA 1YX5B 3O65B 3LJ3A 2KJHB 3ZKJC 4NAWA 2V3SA 2K6DB 4KIKA 2KHWB 3ZNID 2ZJDA 5AEKB 4WWPA 3DQVA 4KZ0A 2KLGA 3ZNHB 5LXIB 4GIVA 1BT0A 3MHSD 3OJ3A 1E5WA 1OQYA 3W1YA 1WGHA 4EFOA 3LDZE 1ZW7A 3W1SC 4BBNC 3UQBA 4GSWA 3SHQA 4ANVA 2YVCA 4HJKA 4ZRKA 4DHJB 1HE8A 4F8CB 4LDTB 4NJ7A 3P2BA 2KXJA 3KYDD 4ZYNA 2UWQA 3WALA 2O6VD 2N1VA 2WDTB 3ZTDA 2NCNA 2JRHA 1SGHA 5DPTA 4EZLA 1GUAB 2AEHA 4LDTD 5E6PA 5CHFA 3PTFC 4HCNB 2XEWA 1YQBA 1V80A 4TKNA 4W9JA 3APCA 2D10A 2NPTA 1WGYA 4KVGB 1U4AA 4X57B 2J0MA 4AJYB 2MLBA 1WMHB 2ZEQA 3CMMB 3RT3B 2DAFA 3NS8A 4GB9A 2O6VA 1E90A 1E7UA 3WIMA 1F9JA 4MM3A 2JY6A 3ZIMA 4KDLB 4WJPA 1EUVB 3DBSA 3VUXA 1ZGUB 4EEWA 2K1FA 4BKSD 1E8YA 3L08A 4A3OA 2N9EB 3A9JA 4GOCA 1E8WA 2KWCA 3NHEB 3V6EB 2R2QA 3ZNGC 1WJ4A 4M8NA 4XX5A 2JVCA 2BGFA 1H4RA 4BBNF 4FJZA 4W9KA 1YIWA 3PLVA 4W9CA 2Z0EB 2JRIB 3JSVA 4IWOA 3UF8A 4IM0A 3DPDA 3PREA 2DZMA 3KYCD 3M62B 5CHWA 2Z0DB 4GN1A 2JUOA 2CHZA 2KWUB 2JXXA 4EOYA 1KOTA 2HTHA 2MWSB 1GG3A 1WIAA 2C5LC 3PZDA 3UQAA 4J6IA 1LQBA 2IYDB 1P9DU 2KC1A 2ZVOA 2PE6B 2M17A 4BFRA 1OTRB 2NPTB 3QA8A 1UZXB 2DHZA 2Y5BB 2IZVB 4FLHA 5BO4B 3WAMA 1WXMA 1WGDA 2LI5A 2KN5A 2JWZA 2GBMA 3K9OB 4URKA 2KZRA 4MGYE 3HHMA 2IBIB 2KX3A 2OOBB 4M0WB 4B95A 2MA9B 1YJ1A 3VH3B 2IO1B 3RUIB 4WJOA 1WZ0A 2LASA 2BPSA 1XT9B 2JT4B 2KTRA 3NZSA 3JW0X 4K7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNB A;  4MH0 E;  2MW5 A;  2NBV B;  3N32 A;  2YLM A;  3T8M A;  5C1Z A;  4GGQ A;  4CHK A;  4W9I A;  3L54 A;  4G50 A;  3APD A;  3QWZ B;  2ZNV C;  4MJS A;  4LJP B;  4N9F 4;  3KVF B;  2VRR B;  4HLE A;  4DHZ B;  3EEC A;  3TBL D;  1UBI A;  1WYW B;  4DK5 A;  3L16 A;  1LFD A;  2BYV E;  1UD7 A;  3KW5 B;  2LVO A;  4HVB A;  3QX1 A;  3TIX A;  3TMP B;  4W9G A;  5C23 A;  2L3Z A;  4FUL A;  4WWO A;  3V61 A;  1C1Y B;  3NZU A;  4EZK A;  1IYF A;  1WGG A;  1WX8 A;  1D3Z A;  2A5U A;  1NBF C;  1WJU A;  3ONS A;  5CHV C;  4NAW B;  4FJY A;  4K81 A;  4KIK B;  2FCS A;  4W9H A;  2CHW A;  5JHB A;  3V62 A;  4F7Z A;  1E7V A;  2L76 A;  1L7Y A;  3ZTC A;  3VUW A;  2LWP A;  5JZE B;  2KFK B;  2J0J A;  4IUM B;  5E6O A;  1T0Y A;  1V2Y A;  1LXD A;  3ZDM C;  5LLI A;  1PQS A;  4AUQ C;  1OEY A;  4G0N B;  3B08 A;  1WH3 A;  4FHJ A;  4WQO B;  3VXW A;  5LXH A;  4MDK E;  1Z2M A;  4BOZ B;  2FID A;  1UBQ A;  2WX1 A;  2L0T A;  3ZLZ A;  2FCQ A;  1RLF A;  2FCN A;  1YD8 U;  4FJV B;  1NI2 A;  2B3A A;  2NBW B;  5AZH A;  3AXC A;  4WJN A;  1SE9 A;  3UIN B;  3VQI A;  1CMX B;  3VFK A;  1WZ3 A;  3QC8 B;  1S3S G;  4CO7 A;  3BY4 B;  3U30 A;  1NDD A;  3AU5 A;  2KKC A;  3PGE A;  3VTW A;  1ZKH A;  4F1S A;  1RRB A;  3VTV A;  5J17 A;  1WX7 A;  3NY5 A;  4GDK B;  2LGX A;  4P7I A;  3RD2 A;  3ZUN A;  3Q3J A;  1WX9 A;  4K1R B;  2HE7 A;  3DVG X;  2M0X A;  1XD3 B;  5DPS A;  4AWJ A;  4I6N B;  4ANX A;  3IBE A;  5JHA A;  2NVU I;  3CSF A;  2K8H A;  2N1W A;  4W9L A;  3DOW A;  4RM9 A;  5HKH A;  4HPM B;  3A9J B;  3K9P B;  5EDS A;  5D7G A;  5KHQ A;  2JPH A;  4HCP B;  4XZ4 A;  2BYE A;  1YX6 B;  4PS8 A;  1GC7 A;  2KMA A;  2ZCB A;  3DBL I;  3JSV B;  3TJP A;  2KDE B;  4FA6 A;  2DAJ A;  3RYT A;  4MEM A;  2HJ8 A;  4KZC A;  2I1K A;  3ZVV A;  1GC6 A;  1P98 A;  2KQ7 A;  2JZ3 B;  2A4Z A;  3M3J A;  2BWF A;  3PHW B;  3ENE A;  1WE7 A;  5DPR A;  4EUT A;  3N3K B;  4HDO A;  1WFY A;  2QHO A;  3MTN B;  3GZN I;  1KLV A;  2L0F A;  2BF8 B;  4HDQ A;  1P3Q U;  2I1J A;  3TCA A;  4NQL B;  1G6J A;  4FN2 A;  4JL9 A;  3B1L X;  3Q3F A;  2KDF B;  2PJH A;  1S1Q B;  4DHJ D;  2L00 B;  3VHT C;  3R7Q A;  1V86 A;  3A1Q B;  3DVN U;  3ECI A;  1I35 A;  2KQS A;  2RD0 A;  3PRP B;  1J8C A;  4RMA A;  1KM7 A;  4AJW A;  1WRD B;  1L2N A;  2AYO B;  1EF5 A;  2LXA A;  3PHX B;  2CKH B;  3DVN V;  3ML9 A;  3H7S A;  2NBU A;  3PT2 B;  1WGR A;  2KTR B;  3IVF A;  3T9L A;  4FHK A;  1R4N I;  4OVU A;  4WAA A;  3D32 A;  3EHV A;  3H1U A;  1WJ6 A;  2G4D B;  4IW0 A;  2CS4 A;  1V9J A;  4BKT A;  1TTN A;  2MP2 A;  4A3P A;  2C60 A;  3RCZ A;  3QHT A;  4PYU A;  3NOB A;  3HM3 A;  4FBJ B;  2IY0 B;  2LUE A;  4K7S A;  1I42 A;  2O2V A;  4I6L B;  4NJ6 A;  4IC7 B;  4II3 B;  2MCN B;  2UYZ B;  3R66 C;  2DZI A;  2HD5 B;  2L05 A;  2XBB C;  4KDI C;  3VVW B;  3I3T B;  5D6J B;  2LVQ A;  2ZCC A;  3PV1 A;  2KJ6 A;  3U8Z A;  3DVG Y;  3WAO A;  2KO3 A;  2IO0 B;  2ASQ A;  3ALB A;  2REX A;  2KTF A;  2DYO A;  1VCB A;  2LXC A;  3OLM D;  1IP9 A;  3EFU A;  4ICV A;  2K6Q A;  5J2R A;  3V60 A;  1E8Z A;  2KX0 A;  1WR1 A;  2KFK A;  3IFW B;  2J0K A;  4IG7 B;  3QQ8 B;  1WXA A;  2IO3 B;  2LVP A;  4MEL A;  2N7E A;  4NQK E;  2C7H A;  3UGB B;  4YL8 A;  2GBK A;  2KDI A;  2EKE C;  2G4S A;  2BWE S;  1WI0 A;  3QAQ A;  4ANW A;  4GXB A;  4RM8 A;  2IO2 B;  5D94 A;  2DX5 B;  2O2V B;  2AL3 A;  2ZVN A;  1WR6 E;  2O6V B;  2D07 B;  4KSK C;  1TBE A;  4WJQ A;  3QCA A;  3PPA A;  3L0W B;  3M63 B;  5KHO A;  4GDL A;  5DCN A;  1Y8R C;  1XQQ A;  4ICU A;  3RUL A;  4ZRI A;  2ZPY A;  4M8M A;  1WM2 A;  4IWQ A;  3H7P B;  2M8S A;  4LCD E;  4BKG A;  1LM8 B;  2DYB A;  3PRZ A;  1KJT A;  3WAN A;  1R4M I;  1M94 A;  1VD2 A;  2MBE A;  2KDB A;  2KK8 A;  5AZF A;  3X23 A;  2M4N A;  3DBR I;  2FNJ B;  3APF A;  3A9K A;  3ZO5 B;  3S2A A;  2C7N B;  4NNJ B;  4MGI E;  4DDI D;  4MGZ E;  4NPN A;  3L13 A;  1RAX A;  2GMI C;  4KSL C;  1WF9 A;  4PS7 A;  1AAR A;  1V5T A;  2KD0 A;  2LJ5 A;  2KOX A;  4HPL B;  2FAZ A;  1J19 A;  2MSE D;  3JYU A;  2K8B A;  4MSQ B;  2BYF A;  1V6E A;  2LD9 A;  3C0R B;  3KUC B;  4HWI B;  1EO6 A;  2MBO A;  1UEL A;  3EC8 A;  3VUY A;  3V6C B;  4K7W A;  2LGY A;  1JRU A;  2BKR B;  2CHX A;  4EZJ A;  4ZDV A;  4MJS B;  1TGZ B;  4HXD A;  4MSM B;  3SD5 A;  3SU8 X;  2C7M B;  2MBQ A;  3ML8 A;  5JH5 C;  3B0A A;  4OVV A;  3R3M A;  4DBG A;  2PPH A;  4GDL B;  3ZRC A;  2ZNV B;  2FUH B;  3OJ4 B;  3SDL C;  2V4L A;  2ZPN A;  3ZNZ B;  5IA7 A;  4WWN A;  3H7P A;  2GOW A;  4B9K A;  1UH6 A;  2IY1 B;  4TV3 A;  3AU4 A;  4E3C A;  3UIP B;  1ISN A;  3QJZ A;  4I6P A;  2M1M A;  2DZK A;  3PVL A;  2DZJ A;  3WAP A;  3L17 A;  4G11 A;  3ZDT A;  4BKS A;  2CR5 A;  2N9X A;  2WWZ A;  4GMV A;  1K8R B;  3VAW A;  3VDZ A;  5TR5 A;  4AP4 C;  3AI5 A;  1TZ1 A;  2LZ6 A;  3DCG A;  4JQW C;  1WXS A;  1Q5W B;  3X0W A;  2D3G A;  3H6N A;  1Q0W B;  2LGD A;  3VTU A;  2FCM A;  3QK0 A;  1WE6 A;  3IHP C;  3IG3 A;  2C9W B;  4MGK E;  2GBR A;  1P0R A;  4BVU C;  3DBH I;  2N9P C;  4GU2 A;  5D2M B;  5J18 A;  4G3X B;  4IWP A;  5G55 A;  2GBN A;  3PLU A;  3HIZ A;  1WY8 A;  5CX3 A;  5FR6 A;  1QZE A;  2LRW A;  2EMS A;  3H9D A;  1OGW A;  3A1Q A;  1GNU A;  2R2O A;  4JIO U;  3ZRF A;  2W9N A;  1J0G A;  3KUD B;  1WM3 A;  2DEN B;  3CF6 E;  2ZZP B;  4GDK A;  1C3T A;  4JGH B;  3KUZ A;  2XK5 B;  3OAW A;  3PRM B;  4PYZ A;  4W9F A;  3HK0 A;  4HK2 A;  5L83 A;  1P1A A;  2FIF A;  3CST A;  5GMV A;  1OEY J;  1WJN A;  2G45 B;  1EF1 A;  2LRU A;  2MBB B;  5AZG A;  3L10 B;  3QIJ A;  4LJO B;  4W9D A;  5CTR C;  2D11 A;  2L7R A;  3U7D A;  2K25 A;  1UGM A;  3PSE B;  2JF5 A;  4TQ1 A;  2CU1 A;  2GBJ A;  3BIN A;  3MJW A;  1V49 A;  4XC2 A;  1V81 A;  4B6W A;  4ANU A;  2BKF A;  4CYE A;  4E74 A;  1WXV A;  3RZW C;  4ASW C;  3QAR A;  3PS6 A;  2EMT A;  1A5R A;  2K8C A;  4DWF A;  1RFA A;  2RSU A;  4PS3 A;  4A20 A;  2AL6 A;  4ZRJ A;  1X1M A;  2KMC A;  2RPQ A;  3GOE A;  3RZF A;  2PE9 A;  4II2 B;  4FAD A;  5E6N A;  2G3Q B;  4E71 A;  2WYQ A;  2NS5 A;  3A33 B;  2KC2 A;  2PEA A;  4BOS C;  4DHZ E;  4DXA B;  2KWV B;  1SIF A;  2KJR A;  1IPG A;  3WA0 A;  4IM2 A;  1FXT B;  2OJR A;  2XK5 A;  4W9E A;  4EKU A;  2RR9 A;  3JVZ X;  3A4S C;  3R7R A;  4AOF A;  2Z59 B;  5DPW A;  2KFJ A;  1Q1O A;  2NR2 A;  2WX0 A;  2KVR A;  3VH4 B;  3DDC B;  3N30 A;  2RGF A;  2KAN A;  3A9K B;  2L8J A;  2J7Q B;  4DDG D;  5L95 C;  3W1S A;  3M95 A;  2DYM A;  2N7D A;  1Z5S B;  5G2N A;  4TQ0 A;  1E8X A;  3UIO B;  2K39 A;  4IM3 A;  2N4F A;  1GJZ A;  5IAA C;  4KV2 A;  2V1Y A;  1H8C A;  4TUU A;  3HM6 X;  3ZW3 A;  2D2Q A;  2MP2 B;  3TL5 A;  1V5O A;  1MG8 A;  1WMH A;  3A4R A;  3KH0 A;  2JZZ A;  2KLC A;  4JLC A;  2MRP A;  2AWT A;  2MBH A;  4NY0 A;  3AUL A;  2MX2 A;  2MQJ A;  1YX5 B;  3O65 B;  3LJ3 A;  2KJH B;  3ZKJ C;  4NAW A;  2V3S A;  2K6D B;  4KIK A;  2KHW B;  3ZNI D;  2ZJD A;  5AEK B;  4WWP A;  3DQV A;  4KZ0 A;  2KLG A;  3ZNH B;  5LXI B;  4GIV A;  1BT0 A;  3MHS D;  3OJ3 A;  1E5W A;  1OQY A;  3W1Y A;  1WGH A;  4EFO A;  3LDZ E;  1ZW7 A;  3W1S C;  4BBN C;  3UQB A;  4GSW A;  3SHQ A;  4ANV A;  2YVC A;  4HJK A;  4ZRK A;  4DHJ B;  1HE8 A;  4F8C B;  4LDT B;  4NJ7 A;  3P2B A;  2KXJ A;  3KYD D;  4ZYN A;  2UWQ A;  3WAL A;  2O6V D;  2N1V A;  2WDT B;  3ZTD A;  2NCN A;  2JRH A;  1SGH A;  5DPT A;  4EZL A;  1GUA B;  2AEH A;  4LDT D;  5E6P A;  5CHF A;  3PTF C;  4HCN B;  2XEW A;  1YQB A;  1V80 A;  4TKN A;  4W9J A;  3APC A;  2D10 A;  2NPT A;  1WGY A;  4KVG B;  1U4A A;  4X57 B;  2J0M A;  4AJY B;  2MLB A;  1WMH B;  2ZEQ A;  3CMM B;  3RT3 B;  2DAF A;  3NS8 A;  4GB9 A;  2O6V A;  1E90 A;  1E7U A;  3WIM A;  1F9J A;  4MM3 A;  2JY6 A;  3ZIM A;  4KDL B;  4WJP A;  1EUV B;  3DBS A;  3VUX A;  1ZGU B;  4EEW A;  2K1F A;  4BKS D;  1E8Y A;  3L08 A;  4A3O A;  2N9E B;  3A9J A;  4GOC A;  1E8W A;  2KWC A;  3NHE B;  3V6E B;  2R2Q A;  3ZNG C;  1WJ4 A;  4M8N A;  4XX5 A;  2JVC A;  2BGF A;  1H4R A;  4BBN F;  4FJZ A;  4W9K A;  1YIW A;  3PLV A;  4W9C A;  2Z0E B;  2JRI B;  3JSV A;  4IWO A;  3UF8 A;  4IM0 A;  3DPD A;  3PRE A;  2DZM A;  3KYC D;  3M62 B;  5CHW A;  2Z0D B;  4GN1 A;  2JUO A;  2CHZ A;  2KWU B;  2JXX A;  4EOY A;  1KOT A;  2HTH A;  2MWS B;  1GG3 A;  1WIA A;  2C5L C;  3PZD A;  3UQA A;  4J6I A;  1LQB A;  2IYD B;  1P9D U;  2KC1 A;  2ZVO A;  2PE6 B;  2M17 A;  4BFR A;  1OTR B;  2NPT B;  3QA8 A;  1UZX B;  2DHZ A;  2Y5B B;  2IZV B;  4FLH A;  5BO4 B;  3WAM A;  1WXM A;  1WGD A;  2LI5 A;  2KN5 A;  2JWZ A;  2GBM A;  3K9O B;  4URK A;  2KZR A;  4MGY E;  3HHM A;  2IBI B;  2KX3 A;  2OOB B;  4M0W B;  4B95 A;  2MA9 B;  1YJ1 A;  3VH3 B;  2IO1 B;  3RUI B;  4WJO A;  1WZ0 A;  2LAS A;  2BPS A;  1XT9 B;  2JT4 B;  2KTR A;  3NZS A;  3JW0 X;  4K7U A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  1MPE A;  2MW5 A;  4GGQ A;  4LNI A;  4WUR A;  1M4V A;  3ETR A;  3APD A;  3QWZ B;  2ZNV C;  2FE8 A;  3Q8B A;  4TSS A;  1TS3 A;  2LHD A;  3KVF B;  2VRR B;  1XCQ L;  3TEX A;  2BYV E;  4C80 A;  2CJO A;  5MPO A;  3KW5 B;  4ZRQ A;  4HVB A;  4W9G A;  5C23 A;  4WWO A;  1C1Y B;  1IYF A;  1WX8 A;  2A5U A;  1SBB B;  1BML C;  2FCS A;  2NTS A;  4LLG M;  4EE2 A;  5G5G A;  3ZTC A;  3VUW A;  2KFK B;  2J0J A;  3ZDM C;  4G0N B;  1Z2M A;  2FBW B;  1YNT E;  2FID A;  1UBQ A;  2L0T A;  1YD8 U;  1AYF A;  4P1B C;  1JWB D;  3AXC A;  2D3C A;  3VFK A;  3BY4 B;  5T8I A;  3PGE A;  3VTW A;  1ZKH A;  1WX7 A;  3NY5 A;  4C4V A;  2LGX A;  2AQ3 B;  1WX9 A;  5AUK A;  3FIL A;  5HKH A;  4HPM B;  5EDS A;  5D7G A;  5BYQ A;  1YX6 B;  1GC7 A;  1LO5 D;  4KZC A;  3W5V B;  1GC6 A;  1P98 A;  1F2R I;  2WDR B;  1TS2 A;  1WE7 A;  5DPR A;  4HDO A;  2QHO A;  1KLV A;  2BF8 B;  3TCA A;  2ICI A;  4ACF A;  2PJH A;  1DOI A;  3VHT C;  3ECI A;  2WS3 B;  4RMA A;  4WAF A;  1EF5 A;  2LXA A;  2CKH B;  1WGR A;  1T3Q A;  2LMC A;  4WAA A;  3D32 A;  4IW0 A;  4BKT A;  1ENF A;  3OG5 A;  3HM3 A;  3UI3 A;  2IY0 B;  2LUE A;  4K7S A;  2O2V A;  1RFK A;  4IC7 B;  3R66 C;  3PZ7 A;  3FAH A;  3VVW B;  2N7J A;  2ZCC A;  4JPS A;  3ALB A;  3BVZ A;  2DYO A;  1J7B A;  1WRI A;  3VR8 B;  1IP9 A;  3EFU A;  3NZ3 A;  3BWU D;  2V3P A;  4LK0 M;  1E8Z A;  2KFK A;  2LGI A;  1VZ8 A;  2J0K A;  4NQK E;  4YL8 A;  1PDX A;  1I7H A;  1DOY A;  1R7S A;  1PGA A;  4C7Z A;  1N5X A;  4ANW A;  4GXB A;  2IO2 B;  2ZVN A;  2O2V B;  1TBE A;  1TY0 A;  4YTN B;  3DBR B;  3M63 B;  3ZQ4 A;  4WQM A;  1Y8R C;  2ZPY A;  4IWQ A;  1YN5 A;  3BK2 A;  1FXA A;  1LM8 B;  3P63 A;  4LCD E;  4FXC A;  1KJT A;  1D5Z C;  2KDB A;  2KK8 A;  2VZK D;  3DBR I;  3APF A;  1KLG D;  2KQ4 X;  2C7N B;  1CZP A;  2K22 A;  5LNK 1;  1RAX A;  1AAR A;  1V5T A;  5BYS A;  3ABV B;  3JYU A;  1FNW A;  3KQ4 A;  3C0R B;  3EC8 A;  2RMM A;  1PGB A;  1D5M C;  4EZJ A;  4ZDV A;  1TGZ B;  4HXD A;  4MSM B;  3SD5 A;  3SU8 X;  3ZXR A;  1KTK A;  3R3M A;  3ZRC A;  5BMH A;  4P16 A;  1L4Z B;  3W2D A;  3ZNZ B;  4WWN A;  4YSX B;  4TV3 A;  5HG2 A;  3AU4 A;  1AW7 A;  3NJT A;  3N1Z C;  3WAP A;  2BVC A;  4QAY A;  5TR5 A;  3KLS X;  3AI5 A;  1TZ1 A;  4RGT A;  4JQW C;  2GI9 A;  1WE6 A;  3IG3 A;  1L6V A;  4MGK E;  2GBR A;  1P0R A;  4RH6 A;  5D2M B;  1HZ5 A;  4G3X B;  1K50 A;  5FR6 A;  1JAL A;  3A1Q A;  5E6J A;  2R2O A;  3P4P B;  2KMM A;  1NEN B;  2W82 A;  3CF6 E;  2JYT A;  1C3T A;  4W9F A;  1P7E A;  5L83 A;  1GPX A;  1B9R A;  3ZJU A;  5GMV A;  3L10 B;  1UWM A;  1PFD A;  2L7R A;  3U7D A;  2K25 A;  2CU1 A;  4XC2 A;  4B6W A;  3MC0 B;  2BKF A;  4ASW C;  1HEZ E;  4ZRP A;  1STE A;  4DWF A;  4ITK A;  3HRD D;  1MI0 A;  1V1O A;  4FAD A;  4II2 B;  2G3Q B;  1I4X A;  4E71 A;  2NS5 A;  5HI1 A;  3Q6B A;  4BOS C;  1MVK A;  4DXA B;  1IPG A;  1R4M B;  3N9Y C;  4IM2 A;  4EKU A;  2Z59 B;  4WWM A;  2NR2 A;  4YSY B;  2JZP A;  3AEG B;  5HHD G;  2J7Q B;  1VR9 A;  1EWC A;  3W1S A;  3M95 A;  1EU4 A;  5BMG A;  4NAM A;  2K39 A;  1GJZ A;  2N4F A;  1N61 A;  3AN1 A;  1ET9 A;  4KX6 B;  3HM6 X;  3ZW3 A;  1XLP A;  3NRZ A;  3A4R A;  2JZZ A;  2KLC A;  2MRP A;  2AWT A;  4NY0 A;  2MX2 A;  1MG4 A;  1YX5 B;  2W3S A;  2V3S A;  2K6D B;  2LJI A;  1R4N B;  3ZNI D;  2AQ1 B;  1PGX A;  4UDU C;  1E5W A;  3BYT B;  4C4V B;  4EFO A;  1MJD A;  1NYR A;  4L23 A;  4XWW A;  4ZRK A;  4F8C B;  3ZXV A;  1ZE3 D;  2N1V A;  2W55 A;  3ZTD A;  2WNM A;  1SGH A;  5E6P A;  2BB6 A;  3PTF C;  1V80 A;  3APC A;  4KVG B;  2D10 A;  1WGY A;  1U4A A;  2J0M A;  2N9K A;  3CMM B;  2ZEQ A;  1QQR A;  1ZXH A;  3ZJV A;  3NUH B;  3R2T A;  2K9X A;  1ZP0 B;  3DBS A;  1ZGU B;  1E8Y A;  2INP E;  3L08 A;  5D3I B;  1SJH D;  3A9J A;  3V6E B;  4M8N A;  4XX5 A;  2JVC A;  4FJZ A;  4W9C A;  3JSV A;  4LNF A;  4L1B A;  4IM0 A;  4DXF A;  2DZM A;  3KYC D;  5IP4 D;  2G1E A;  2JUO A;  5EE1 A;  1KOT A;  5H92 C;  2KN4 A;  3B2F A;  2IYD B;  2M17 A;  3I63 C;  2DHZ A;  2IZV B;  1XLN A;  2QCZ A;  3IAM 1;  3VRA B;  2GBM A;  1XCT L;  3K9O B;  4GLS C;  4A8X C;  2IGD A;  4M0W B;  2LAS A;  4US8 A;  4YT0 B;  2BS3 B;  1XT9 B;  2JT4 B;  3NZS A;  3T8M A;  5TSS A;  2NBV B;  4G50 A;  2WXJ A;  4MJS A;  4HLE A;  1IBX A;  3TBL D;  1WYW B;  3L16 A;  3Q8E A;  3AED B;  2MJ3 A;  3Q3M C;  1I4R A;  1NI3 A;  4FUL A;  4EZK A;  3NZU A;  1ZOY B;  1ROE A;  1NBF C;  4NAW B;  4FJY A;  4KIK B;  1HTQ A;  4W9H A;  4B0M A;  3V62 A;  1DGJ A;  1E7V A;  3KWV A;  3HUI A;  1EU3 A;  4IUM B;  5LLI A;  4FHJ A;  1E0Z A;  2DBY A;  3AEB B;  2I2Y A;  4YTM B;  3BYY B;  1NI2 A;  2B3A A;  1UNS A;  3I57 A;  3BVM A;  3VQI A;  3SR6 A;  1CMX B;  4ZHO A;  1WZ3 A;  1S3S G;  4ARI A;  1NDD A;  4F1S A;  1QOB A;  1RRB A;  2K5P A;  3ZUN A;  4K1R B;  2HE7 A;  1JML A;  4I6N B;  3IBE A;  5D3D A;  2K8H A;  4W9L A;  2PKO A;  4RM9 A;  1J7C A;  1ET6 A;  3A9J B;  2JPH A;  1C78 A;  2BYE A;  3AEC B;  1DOX A;  2ZCB A;  4P6V F;  3JSV B;  3TJP A;  3RYT A;  1CK1 A;  2I1K A;  4XYC A;  1MHX A;  2A4Z A;  2NTT A;  3P4R B;  1I4Q A;  3E9S A;  1WFY A;  3MTN B;  2BT6 A;  1QOG A;  2L0F A;  4HDQ A;  2I1J A;  1G6J A;  4JL9 A;  3B1L X;  2KDF B;  1S1Q B;  3R7Q A;  4HKZ E;  3AE3 B;  1I35 A;  1J8C A;  2BB5 A;  1L2N A;  3EUB 2;  3PHX B;  3ML9 A;  3H7S A;  2NBU A;  3IVF A;  2PVG C;  4IOI E;  3NG0 A;  1R4N I;  1YQ3 B;  4RF0 A;  1V9J A;  1TTN A;  2MP2 A;  2C60 A;  3RCZ A;  4PYU A;  3N20 C;  4OZB A;  2LUM A;  1FNU A;  4I6L B;  5EE0 A;  2DZI A;  2HD5 B;  1HA5 A;  2L05 A;  2E3T A;  1XLO A;  3IT6 B;  5D6J B;  2LVQ A;  3PV1 A;  2KJ6 A;  3U8Z A;  4HEA 1;  3AE4 B;  1FCC C;  2KTF A;  3AB5 A;  5J2R A;  3V60 A;  2KAJ A;  3MJ5 A;  1I4H A;  1GB4 A;  4IG7 B;  1SSN A;  2LVP A;  4MEL A;  2N7E A;  2Y5P A;  2C7H A;  4KKI A;  3IAS 1;  3AE6 B;  3R8B A;  5D94 A;  2DX5 B;  2AL3 A;  2D07 B;  4KSK C;  4WJQ A;  1IUE A;  1TYG B;  4ICU A;  3NVY A;  1NVI D;  2M8S A;  4BKG A;  3PRZ A;  3WAN A;  4YSZ B;  4LNO A;  2DNF A;  2WXM A;  3NVZ A;  3ZO5 B;  4DDI D;  4MGZ E;  2GMI C;  2KD0 A;  2LJ5 A;  2QSD A;  1J19 A;  3H8H A;  2K8B A;  4XDC A;  4MSQ B;  2BYF A;  1V6E A;  1ZXI A;  1WYG A;  2LD9 A;  3VUY A;  2KWD A;  1OQQ A;  2LGY A;  5EE3 A;  4MJS B;  5JH5 C;  4RGN A;  1HQR D;  4DBG A;  4GDL B;  1QIL A;  2KVZ A;  1TKE A;  1F2R C;  2V4L A;  2ZPN A;  1T0S C;  3AEF B;  1MFW A;  3QJZ A;  2M1M A;  4AQ7 A;  4O1N A;  2BS4 B;  3L17 A;  2CR5 A;  2WU2 B;  1FO4 A;  1K8R B;  3VAW A;  1Y56 A;  3FKY A;  3X0W A;  2D3G A;  2LGD A;  3Q69 A;  4BVU C;  3DBH I;  1C4P A;  4WIP A;  2ZW0 A;  5G55 A;  3U2S C;  4D2K A;  3PLU A;  1WY8 A;  3BK1 A;  4JWS C;  1QZE A;  2LRW A;  2EMS A;  5CX3 A;  4RGM A;  1OGW A;  1SJE D;  2QEJ C;  2ZZP B;  1C9F A;  2XK5 B;  4PYZ A;  3WCQ A;  1WJN A;  1EF1 A;  2LRU A;  2V9H A;  3KWL A;  3QIJ A;  4LJO B;  2QJL A;  5CTR C;  4XWT A;  2JWU A;  4TQ1 A;  2AX5 A;  4ANU A;  4CYE A;  1WXV A;  3QAR A;  4ARC A;  4KKJ A;  3AEE B;  1X1M A;  1PYW D;  3RZF A;  1L0Y B;  1FD6 A;  3A33 B;  2L83 A;  2PEA A;  2YEP F;  1SIF A;  1FXT B;  4W9E A;  2XK5 A;  1VZ6 A;  1J7A A;  3JVZ X;  4AOF A;  5DPW A;  5FR3 A;  3TEY A;  2KFJ A;  1C79 A;  1AN8 A;  1ZDX A;  3L4P A;  2GB1 A;  4TQ0 A;  1E8X A;  3UIO B;  4KV2 A;  1PUT A;  2WU5 B;  2V1Y A;  4P1C C;  1H8C A;  1WMH A;  3KH0 A;  2WXP A;  2MBH A;  3AUL A;  4OZA A;  2WXK A;  2MQJ A;  2PW9 A;  2VZK B;  5JXV A;  3ZKJ C;  1IGD A;  2LFI A;  4WWP A;  3DQV A;  3ZNH B;  5LXI B;  1GAQ B;  5H8Y E;  3W1Y A;  3LDZ E;  1ZW7 A;  4DHJ B;  3GZN B;  2KXJ A;  4ZYN A;  3RMK C;  3WAL A;  2WDT B;  3V3X A;  1FIQ A;  1TS4 A;  4EZL A;  4LDT D;  4HCN B;  2OED A;  4M02 A;  2XEW A;  4TKN A;  4W9J A;  2NPT A;  1WMH B;  2L52 A;  1FNV A;  2O6V A;  4KGS A;  1E7U A;  1F9J A;  3ZIM A;  4KDL B;  1EUV B;  3E56 A;  3VUX A;  4EEW A;  2K1F A;  3Q2A C;  4GOC A;  2KWC A;  2HDE A;  2R2Q A;  2MHJ A;  2SAK A;  4BBN F;  1KH0 A;  3I9V 1;  3PLV A;  4L2Y A;  4LNK A;  3SFE B;  3AE7 B;  3DPD A;  3DHG C;  4GN1 A;  2CHZ A;  1SIJ A;  4XE0 A;  1C77 A;  2KC1 A;  2ZVO A;  3C19 A;  2NPT B;  4JE3 B;  2Y5B B;  3AE8 B;  4FLH A;  4PT5 A;  3WAM A;  1WXM A;  3P1M A;  1C4A A;  1ESF A;  2JWZ A;  1ACC A;  4REZ A;  3HHM A;  2OOB B;  4OZC A;  3VH3 B;  2ACZ B;  1SE4 A;  3AMZ A;  1D5X C;  4A6Q A;  2KNB A;  5C1Z A;  3N32 A;  2UU7 A;  2YLM A;  4CHK A;  4W9I A;  3L54 A;  4N9F 4;  3AE1 B;  4LJP B;  3ZYY X;  4HKQ A;  4DHZ B;  3RNF C;  1T6B X;  3EEC A;  2WXG A;  1UD7 A;  3Q8C A;  3QX1 A;  3TIX A;  2VH2 A;  1WGG A;  2EKI A;  4N6E B;  1WJU A;  3ONS A;  2EEL A;  4K81 A;  4JWU C;  2CHW A;  2W54 A;  5JHB A;  2IPK D;  2L76 A;  1I4P A;  2LWP A;  5E6O A;  1T0Y A;  1LXD A;  1V2Y A;  2L1A A;  2WLB A;  1PQS A;  4AUQ C;  3RNC C;  2IGH A;  3B08 A;  4WQO B;  3RNG C;  4AS1 A;  2WX1 A;  2FCQ A;  2FCN A;  3B9J A;  1XEE A;  4FJV B;  2NBW B;  5AZH A;  1SE9 A;  5C2T B;  2DWQ A;  2PTL A;  3QC8 B;  3FC4 A;  1ZDV A;  1JWS D;  2Q5W D;  4P7I A;  2QIL A;  1XD3 B;  5DPS A;  4AWJ A;  4ANX A;  5JHA A;  3CSF A;  3K9P B;  4HCP B;  1BUI C;  2Y3A A;  3O13 A;  4FA6 A;  4CQN A;  2DAJ A;  2JYE A;  2INN E;  4MEM A;  1UF0 A;  3AV8 A;  2KQ7 A;  2JZ3 B;  3M3J A;  2BWF A;  4MAC A;  3ENE A;  1VLB A;  3N3K B;  4MM3 B;  3GZN I;  4NQL B;  1VJK A;  2WXI A;  3Q3F A;  3TUO A;  4DHJ D;  2K0P A;  1JRO A;  1L5P A;  2V4I B;  2RD0 A;  4IDI A;  1D6E C;  2JSV X;  3SEB A;  4AJW A;  1WRD B;  2AYO B;  3DVN V;  2J52 A;  2KTR B;  3T9L A;  4FHK A;  1T0Q C;  3LB8 C;  3U4E G;  1WJ6 A;  3QHT A;  3VRB B;  3DWM A;  2QC8 A;  1I42 A;  2UYZ B;  2XBB C;  4KDI C;  2G9H D;  2WXL A;  3WAO A;  2KO3 A;  3AEA B;  5GXG B;  4B0E A;  4ICV A;  4PK1 A;  2ON8 A;  4YWG G;  1WR1 A;  3QQ8 B;  1WXA A;  4YTP B;  2IO3 B;  3UGB B;  2GBK A;  2WDV B;  1WI0 A;  3QAQ A;  4RM8 A;  3MP9 A;  1V1P B;  1WWT A;  3GB1 A;  2ONQ A;  1YJJ A;  5DCN A;  2FUG 1;  1XQQ A;  4ZRI A;  3RNB C;  4LTU A;  3H7P B;  2DYB A;  1L0V B;  1R4M I;  2MBE A;  5AZF A;  1Q10 A;  5IN7 A;  3FIL B;  3X23 A;  3A9K A;  3S2A A;  3CIR B;  4KSL C;  4PS7 A;  2KOX A;  4HPL B;  4XGA B;  3VR9 B;  4C00 A;  5HFY A;  2M19 A;  3KUC B;  1EO6 A;  2D5G A;  1UEL A;  1QT9 A;  1YQ4 B;  2MBO A;  2X8X X;  3RI7 C;  2BKR B;  2C7M B;  3RFZ B;  3BZD B;  2BW2 A;  4OVV A;  2ZNV B;  2FUH B;  3OJ4 B;  3SDL C;  2IDY A;  1FRD A;  3H7P A;  2GOW A;  4B9K A;  1GOZ A;  2IY1 B;  3U7Z A;  1LGR A;  3J9C A;  1ISN A;  1YN3 A;  4I6P A;  3PVL A;  4BKS A;  3Q14 C;  3VDZ A;  1FFU A;  3ZJT A;  1Q5W B;  1Q0W B;  1FEH A;  3QK0 A;  3IHP C;  1KRH A;  5J18 A;  1D4B A;  2GBN A;  3H9D A;  2NMQ A;  1RM6 C;  3ZRF A;  4JIO U;  1FPY A;  1QOF A;  2W9N A;  2MEK A;  4H2A A;  1WM3 A;  1FCL A;  4JGH B;  2N9L A;  3HK0 A;  1P1A A;  5EE9 A;  3CST A;  1OEY J;  3NS1 A;  4M01 A;  5AZG A;  2V3N A;  4W9D A;  2D11 A;  2K3U A;  2GBJ A;  4MH8 A;  1V81 A;  2Z8L A;  3PS6 A;  4HRO A;  5BMI A;  1RFA A;  2RSU A;  4PS3 A;  1UGJ A;  2AL6 A;  2JXT A;  4ZRJ A;  1KF6 B;  2KMC A;  2GLS A;  2RPQ A;  4C56 C;  2PE9 A;  1YMH E;  2WYQ A;  1K53 A;  2KWV B;  2KJR A;  3R7R A;  2WXO A;  1Q1O A;  2KVR A;  4RF1 A;  3VH4 B;  2J53 A;  1FXI A;  2RGF A;  3A9K B;  2L8J A;  4N58 A;  4DDG D;  3RNE C;  5L95 C;  2DYM A;  2N7D A;  5G2N A;  3JW0 X;  4IM3 A;  4TUU A;  3TL5 A;  1JCK B;  1MG8 A;  1I4G A;  2KT7 A;  3O65 B;  2KJH B;  4NAW A;  1N5W A;  4KIK A;  2KHW B;  1SXT A;  5AEK B;  1EM7 A;  1L0X B;  2PVO D;  2QIE B;  1WGH A;  1TIF A;  3UQB A;  4KGT A;  1WXQ A;  3SHQ A;  4ANV A;  4HJK A;  1F0Z A;  3TSS A;  4NJ7 A;  3P2B A;  2WXN A;  3KYD D;  2YEP B;  3I5J C;  1C76 A;  2NCN A;  5DPT A;  2AEH A;  5CHF A;  3RNA C;  2WXR A;  2LHE A;  1FFV A;  1RYJ A;  2MLB A;  1HTO A;  2DAF A;  3Q3O C;  3NS8 A;  1BXT A;  4GB9 A;  3Q3N C;  1V1P A;  1UWX A;  1E90 A;  3WIM A;  2KAC A;  4MM3 A;  2JY6 A;  4WJP A;  1SE3 A;  4A3O A;  3ZGZ A;  2N9E B;  1TT5 B;  1E8W A;  3NHE B;  2QMT A;  4C7Y A;  2TSS A;  1H4R A;  2OHF A;  2JRI B;  1YJI A;  2J4X A;  4ZYS A;  3PRE A;  3B2G A;  3M62 B;  4JX1 C;  2KWU B;  4EOY A;  1GG3 A;  2E6X A;  1WIA A;  2MWS B;  3UQA A;  4J6I A;  1E9M A;  1P9D U;  4NJC A;  2IJ0 A;  2JQR B;  3BVG A;  2PE6 B;  4BFR A;  3QA8 A;  5FKA C;  1KLU D;  1N6Z A;  5IKC M;  4K3B A;  1HXY D;  2LI5 A;  1WGD A;  2KN5 A;  1XXG A;  2KZR A;  1E6E B;  2IBI B;  3AH7 A;  4B95 A;  4WJO A;  2BPS A;  1XLQ A;  4LNN A;  1IGC A;  1RWS A;  1NEK B;  4MH0 E;  4RNA A;  2H88 B;  3NVW A;  3GE8 C;  4XDD A;  1UBI A;  4DK5 A;  1LFD A;  2LVO A;  3TMP B;  2L3Z A;  3V61 A;  2WP9 B;  1D3Z A;  5CHV C;  1B1Z A;  1JQ4 A;  4DQO C;  1CQV A;  4M0W A;  2M0A A;  4KGR A;  4F7Z A;  2KYW A;  1L7Y A;  3DWG C;  1N62 A;  4YXD B;  1T0R C;  5JZE B;  1E10 A;  1OEY A;  2BQQ A;  2L32 A;  3VXW A;  1WH3 A;  2GRI A;  4BZA A;  1XO3 A;  4MDK E;  5LXH A;  4BOZ B;  1TS5 A;  1HZ6 A;  3ZLZ A;  1QLB B;  5C3J B;  1RLF A;  4NZL B;  4DXG A;  3OWE B;  4WJN A;  2X38 A;  4K3C A;  3UIN B;  2SEB D;  3EGR A;  4CO7 A;  3U30 A;  3AE2 B;  3AU5 A;  2KKC A;  2WDQ B;  5J17 A;  3N1X C;  3VTV A;  1V8C A;  4GDK B;  3RD2 A;  3Q3J A;  1FMA D;  3DVG X;  2M0X A;  4S17 A;  4USA A;  3TEZ A;  2NVU I;  2N1W A;  3DOW A;  3V05 A;  5KHQ A;  4XZ4 A;  1L6U A;  4PS8 A;  2KMA A;  2CU3 A;  3DBL I;  2KDE B;  3GE3 C;  2HJ8 A;  3U52 E;  3ZVV A;  2V0G A;  3PHW B;  1AWD A;  4EUT A;  3TEW A;  1P3Q U;  2AQ2 B;  2W3R A;  3NVV A;  1L4D B;  4FN2 A;  1YN4 A;  2L00 B;  1K51 A;  1V86 A;  2XN9 C;  3A1Q B;  3DVN U;  3P42 A;  2KQS A;  4S0R A;  3PRP B;  1JW9 D;  2PMV A;  1KM7 A;  3P4S B;  3IT4 B;  1SE2 A;  1VDV A;  3PT2 B;  4OVU A;  3T3N A;  3EHV A;  3H1U A;  1JWU D;  2G4D B;  2CS4 A;  3Q8A A;  2Y5C A;  3SFD B;  4A3P A;  3AE9 B;  1GB1 A;  3NOB A;  4FBJ B;  4NJ6 A;  3GP7 A;  2MCN B;  4II3 B;  3N1Y C;  2BS2 B;  3HVD A;  3I3T B;  4A9A A;  3DVG Y;  2J42 A;  2IO0 B;  2ASQ A;  2REX A;  1VCB A;  2LXC A;  3BII D;  4ZHP A;  3OLM D;  2OJW A;  2K6Q A;  2KX0 A;  3EFC A;  3IFW B;  1A70 A;  1QOA A;  2WXF A;  2N0S B;  2KDI A;  2EKE C;  2G4S A;  2BWE S;  4RCO A;  2M56 B;  1ZUD 2;  1WR6 E;  2O6V B;  5FK9 C;  3QCA A;  4HJG E;  3PPA A;  3L0W B;  5KHO A;  4IKG A;  4HRS A;  4GDL A;  3RUL A;  4M8M A;  1WM2 A;  4RFB A;  1VD2 A;  1M94 A;  2JU6 X;  2M4N A;  1VRA B;  2FNJ B;  4NNJ B;  2PLP A;  4MGI E;  4NPN A;  3L13 A;  1WF9 A;  4US9 A;  2FAZ A;  2MSE D;  2PIA A;  3Q8F A;  1FM0 D;  3P4Q B;  1OQR A;  3DBH B;  4HWI B;  1EWY C;  5IO9 A;  3V6C B;  2D3B A;  4K7W A;  1JRU A;  2CHX A;  3HVZ A;  1QKZ A;  2MBQ A;  3AM9 A;  2HJ1 A;  1IBX B;  3ML8 A;  3B0A A;  1C4C A;  2PPH A;  1TZO A;  5IA7 A;  2BYT A;  1UH6 A;  4E3C A;  3UIP B;  1N60 A;  1SF0 A;  3RPF C;  2DZK A;  4HPP A;  2DZJ A;  4G11 A;  3ZDT A;  1F77 A;  2N9X A;  3AE5 B;  2WWZ A;  2CJN A;  4OW0 A;  4GMV A;  4WH4 A;  4AP4 C;  2ZW1 A;  2I38 A;  2LZ6 A;  3DCG A;  1WXS A;  2KDM A;  4ZOH C;  1ZPS A;  3H6N A;  3MC9 A;  3VTU A;  2FCM A;  2VH1 A;  2C9W B;  2WGS A;  2N9P C;  4GU2 A;  2MJD A;  1JWA D;  4IWP A;  1CJE A;  5G5H A;  3LYY A;  3HIZ A;  3W5U B;  1GNU A;  3DBL B;  2RPV A;  1J0G A;  3KUD B;  3C8Y A;  2DEN B;  4GDK A;  2RDB C;  3KUZ A;  3OAW A;  3PRM B;  2IGG A;  4HK2 A;  2FIF A;  2D3A A;  2G45 B;  2MBB B;  3W9C B;  1FRR A;  3T3O A;  3IXS A;  1UGM A;  3PSE B;  2JF5 A;  3MJW A;  3BIN A;  1P7F A;  1V49 A;  4E74 A;  3RZW C;  3CWI A;  1TKY A;  2EMT A;  1A5R A;  2K8C A;  1E7P B;  2IND C;  4M00 A;  4A20 A;  2B76 B;  2MH7 A;  3GOE A;  2RDG A;  5E6N A;  2INC C;  2KC2 A;  1JRP A;  4DHZ E;  3WA0 A;  2OJR A;  2RR9 A;  2QDF A;  3A4S C;  2WX0 A;  2HTM E;  2JX5 A;  3DDC B;  3N30 A;  1WSP A;  2KAN A;  3PO0 A;  4N59 A;  5AUI A;  4RGO S;  2R61 A;  1Z5S B;  1XF5 L;  2BBC A;  1F52 A;  5IOI A;  1MHH E;  5IAA C;  1TKG A;  3MHZ A;  3DHI C;  2DLB A;  2D2Q A;  2MP2 B;  1DYQ A;  1SEB D;  1V5O A;  2LGS A;  4JLC A;  1QF6 A;  3LJ3 A;  2BTE A;  3EA6 A;  2ZJD A;  1SB3 C;  4KZ0 A;  2KLG A;  4GIV A;  1BT0 A;  3MHS D;  3OJ3 A;  4OHJ A;  1OQY A;  2MJE A;  1OFF A;  3W1S C;  4BBN C;  4GSW A;  1JWM D;  2YVC A;  3MFG A;  1HE8 A;  4LDT B;  3PZ8 A;  2UWQ A;  2O6V D;  1TY2 A;  2JRH A;  3LXF A;  3URY A;  1GUA B;  2WXH A;  1YQB A;  4X57 B;  4AJY B;  1KFY B;  3RT3 B;  4Q2J A;  4MT5 A;  2WQY B;  5BYR A;  1UUP A;  2XNA C;  4BKS D;  3ZNG C;  2RDH A;  1WJ4 A;  4BAX A;  2BGF A;  4W9K A;  1YIW A;  2Z0E B;  3RN9 C;  4TMA B;  1VZ7 A;  1TJE A;  4IWO A;  3UF8 A;  5CHW A;  2Z0D B;  1NYQ A;  3DHH C;  1K52 A;  4A55 A;  2WHI A;  2JXX A;  5I4D A;  2HTH A;  1T5X D;  3PZD A;  2C5L C;  4J3O D;  1LQB A;  1OTR B;  2LEK A;  1UZX B;  1WGK A;  5BO4 B;  4A90 A;  4URK A;  4MGY E;  2H89 B;  2KX3 A;  4R3D A;  3MC8 A;  2MA9 B;  1YJ1 A;  2IO1 B;  3GS2 A;  1YOV B;  3RUI B;  3R2I A;  1WZ0 A;  2WXQ A;  1N63 A;  1V97 A;  2KTR A;  1F1H A;  4K7U A; 
#chains in the Genus database with same CATH homology
 2KNB A;  4MH0 E;  2MW5 A;  2NBV B;  3N32 A;  2YLM A;  3T8M A;  5C1Z A;  4GGQ A;  4CHK A;  4W9I A;  3L54 A;  4G50 A;  3APD A;  3QWZ B;  2ZNV C;  4MJS A;  4LJP B;  4N9F 4;  3KVF B;  2VRR B;  4HLE A;  4DHZ B;  3EEC A;  3TBL D;  1UBI A;  1WYW B;  4DK5 A;  3L16 A;  1LFD A;  2BYV E;  1UD7 A;  3KW5 B;  2LVO A;  4HVB A;  3QX1 A;  3TIX A;  3TMP B;  4W9G A;  5C23 A;  2L3Z A;  4FUL A;  4WWO A;  3V61 A;  1C1Y B;  3NZU A;  4EZK A;  1IYF A;  1WGG A;  1WX8 A;  1D3Z A;  2A5U A;  1NBF C;  1WJU A;  3ONS A;  5CHV C;  4NAW B;  4FJY A;  4K81 A;  4KIK B;  2FCS A;  4W9H A;  2CHW A;  5JHB A;  3V62 A;  4F7Z A;  1E7V A;  2L76 A;  1L7Y A;  3ZTC A;  3VUW A;  2LWP A;  5JZE B;  2KFK B;  2J0J A;  4IUM B;  5E6O A;  1T0Y A;  1V2Y A;  1LXD A;  3ZDM C;  5LLI A;  1PQS A;  4AUQ C;  1OEY A;  4G0N B;  3B08 A;  1WH3 A;  4FHJ A;  4WQO B;  3VXW A;  5LXH A;  4MDK E;  1Z2M A;  4BOZ B;  2FID A;  1UBQ A;  2WX1 A;  2L0T A;  3ZLZ A;  2FCQ A;  1RLF A;  2FCN A;  1YD8 U;  4FJV B;  1NI2 A;  2B3A A;  2NBW B;  5AZH A;  3AXC A;  4WJN A;  1SE9 A;  3UIN B;  3VQI A;  1CMX B;  3VFK A;  1WZ3 A;  3QC8 B;  1S3S G;  4CO7 A;  3BY4 B;  3U30 A;  1NDD A;  3AU5 A;  2KKC A;  3PGE A;  3VTW A;  1ZKH A;  4F1S A;  1RRB A;  3VTV A;  5J17 A;  1WX7 A;  3NY5 A;  4GDK B;  2LGX A;  4P7I A;  3RD2 A;  3ZUN A;  3Q3J A;  1WX9 A;  4K1R B;  2HE7 A;  3DVG X;  2M0X A;  1XD3 B;  5DPS A;  4AWJ A;  4I6N B;  4ANX A;  3IBE A;  5JHA A;  2NVU I;  3CSF A;  2K8H A;  2N1W A;  4W9L A;  3DOW A;  4RM9 A;  5HKH A;  4HPM B;  3A9J B;  3K9P B;  5EDS A;  5D7G A;  5KHQ A;  2JPH A;  4HCP B;  4XZ4 A;  2BYE A;  1YX6 B;  4PS8 A;  1GC7 A;  2KMA A;  2ZCB A;  3DBL I;  3JSV B;  3TJP A;  2KDE B;  4FA6 A;  2DAJ A;  3RYT A;  4MEM A;  2HJ8 A;  4KZC A;  2I1K A;  3ZVV A;  1GC6 A;  1P98 A;  2KQ7 A;  2JZ3 B;  2A4Z A;  3M3J A;  2BWF A;  3PHW B;  3ENE A;  1WE7 A;  5DPR A;  4EUT A;  3N3K B;  4HDO A;  1WFY A;  2QHO A;  3MTN B;  3GZN I;  1KLV A;  2L0F A;  2BF8 B;  4HDQ A;  1P3Q U;  2I1J A;  3TCA A;  4NQL B;  1G6J A;  4FN2 A;  4JL9 A;  3B1L X;  3Q3F A;  2KDF B;  2PJH A;  1S1Q B;  4DHJ D;  2L00 B;  3VHT C;  3R7Q A;  1V86 A;  3A1Q B;  3DVN U;  3ECI A;  1I35 A;  2KQS A;  2RD0 A;  3PRP B;  1J8C A;  4RMA A;  1KM7 A;  4AJW A;  1WRD B;  1L2N A;  2AYO B;  1EF5 A;  2LXA A;  3PHX B;  2CKH B;  3DVN V;  3ML9 A;  3H7S A;  2NBU A;  3PT2 B;  1WGR A;  2KTR B;  3IVF A;  3T9L A;  4FHK A;  1R4N I;  4OVU A;  4WAA A;  3D32 A;  3EHV A;  3H1U A;  1WJ6 A;  2G4D B;  4IW0 A;  2CS4 A;  1V9J A;  4BKT A;  1TTN A;  2MP2 A;  4A3P A;  2C60 A;  3RCZ A;  3QHT A;  4PYU A;  3NOB A;  3HM3 A;  4FBJ B;  2IY0 B;  2LUE A;  4K7S A;  1I42 A;  2O2V A;  4I6L B;  4NJ6 A;  4IC7 B;  4II3 B;  2MCN B;  2UYZ B;  3R66 C;  2DZI A;  2HD5 B;  2L05 A;  2XBB C;  4KDI C;  3VVW B;  3I3T B;  5D6J B;  2LVQ A;  2ZCC A;  3PV1 A;  2KJ6 A;  3U8Z A;  3DVG Y;  3WAO A;  2KO3 A;  2IO0 B;  2ASQ A;  3ALB A;  2REX A;  2KTF A;  2DYO A;  1VCB A;  2LXC A;  3OLM D;  1IP9 A;  3EFU A;  4ICV A;  2K6Q A;  5J2R A;  3V60 A;  1E8Z A;  2KX0 A;  1WR1 A;  2KFK A;  3IFW B;  2J0K A;  4IG7 B;  3QQ8 B;  1WXA A;  2IO3 B;  2LVP A;  4MEL A;  2N7E A;  4NQK E;  2C7H A;  3UGB B;  4YL8 A;  2GBK A;  2KDI A;  2EKE C;  2G4S A;  2BWE S;  1WI0 A;  3QAQ A;  4ANW A;  4GXB A;  4RM8 A;  2IO2 B;  5D94 A;  2DX5 B;  2O2V B;  2AL3 A;  2ZVN A;  1WR6 E;  2O6V B;  2D07 B;  4KSK C;  1TBE A;  4WJQ A;  3QCA A;  3PPA A;  3L0W B;  3M63 B;  5KHO A;  4GDL A;  5DCN A;  1Y8R C;  1XQQ A;  4ICU A;  3RUL A;  4ZRI A;  2ZPY A;  4M8M A;  1WM2 A;  4IWQ A;  3H7P B;  2M8S A;  4LCD E;  4BKG A;  1LM8 B;  2DYB A;  3PRZ A;  1KJT A;  3WAN A;  1R4M I;  1M94 A;  1VD2 A;  2MBE A;  2KDB A;  2KK8 A;  5AZF A;  3X23 A;  2M4N A;  3DBR I;  2FNJ B;  3APF A;  3A9K A;  3ZO5 B;  3S2A A;  2C7N B;  4NNJ B;  4MGI E;  4DDI D;  4MGZ E;  4NPN A;  3L13 A;  1RAX A;  2GMI C;  4KSL C;  1WF9 A;  4PS7 A;  1AAR A;  1V5T A;  2KD0 A;  2LJ5 A;  2KOX A;  4HPL B;  2FAZ A;  1J19 A;  2MSE D;  3JYU A;  2K8B A;  4MSQ B;  2BYF A;  1V6E A;  2LD9 A;  3C0R B;  3KUC B;  4HWI B;  1EO6 A;  2MBO A;  1UEL A;  3EC8 A;  3VUY A;  3V6C B;  4K7W A;  2LGY A;  1JRU A;  2BKR B;  2CHX A;  4EZJ A;  4ZDV A;  4MJS B;  1TGZ B;  4HXD A;  4MSM B;  3SD5 A;  3SU8 X;  2C7M B;  2MBQ A;  3ML8 A;  5JH5 C;  3B0A A;  4OVV A;  3R3M A;  4DBG A;  2PPH A;  4GDL B;  3ZRC A;  2ZNV B;  2FUH B;  3OJ4 B;  3SDL C;  2V4L A;  2ZPN A;  3ZNZ B;  5IA7 A;  4WWN A;  3H7P A;  2GOW A;  4B9K A;  1UH6 A;  2IY1 B;  4TV3 A;  3AU4 A;  4E3C A;  3UIP B;  1ISN A;  3QJZ A;  4I6P A;  2M1M A;  2DZK A;  3PVL A;  2DZJ A;  3WAP A;  3L17 A;  4G11 A;  3ZDT A;  4BKS A;  2CR5 A;  2N9X A;  2WWZ A;  4GMV A;  1K8R B;  3VAW A;  3VDZ A;  5TR5 A;  4AP4 C;  3AI5 A;  1TZ1 A;  2LZ6 A;  3DCG A;  4JQW C;  1WXS A;  1Q5W B;  3X0W A;  2D3G A;  3H6N A;  1Q0W B;  2LGD A;  3VTU A;  2FCM A;  3QK0 A;  1WE6 A;  3IHP C;  3IG3 A;  2C9W B;  4MGK E;  2GBR A;  1P0R A;  4BVU C;  3DBH I;  2N9P C;  4GU2 A;  5D2M B;  5J18 A;  4G3X B;  4IWP A;  5G55 A;  2GBN A;  3PLU A;  3HIZ A;  1WY8 A;  5CX3 A;  5FR6 A;  1QZE A;  2LRW A;  2EMS A;  3H9D A;  1OGW A;  3A1Q A;  1GNU A;  2R2O A;  4JIO U;  3ZRF A;  2W9N A;  1J0G A;  3KUD B;  1WM3 A;  2DEN B;  3CF6 E;  2ZZP B;  4GDK A;  1C3T A;  4JGH B;  3KUZ A;  2XK5 B;  3OAW A;  3PRM B;  4PYZ A;  4W9F A;  3HK0 A;  4HK2 A;  5L83 A;  1P1A A;  2FIF A;  3CST A;  5GMV A;  1OEY J;  1WJN A;  2G45 B;  1EF1 A;  2LRU A;  2MBB B;  5AZG A;  3L10 B;  3QIJ A;  4LJO B;  4W9D A;  5CTR C;  2D11 A;  2L7R A;  3U7D A;  2K25 A;  1UGM A;  3PSE B;  2JF5 A;  4TQ1 A;  2CU1 A;  2GBJ A;  3BIN A;  3MJW A;  1V49 A;  4XC2 A;  1V81 A;  4B6W A;  4ANU A;  2BKF A;  4CYE A;  4E74 A;  1WXV A;  3RZW C;  4ASW C;  3QAR A;  3PS6 A;  2EMT A;  1A5R A;  2K8C A;  4DWF A;  1RFA A;  2RSU A;  4PS3 A;  4A20 A;  2AL6 A;  4ZRJ A;  1X1M A;  2KMC A;  2RPQ A;  3GOE A;  3RZF A;  2PE9 A;  4II2 B;  4FAD A;  5E6N A;  2G3Q B;  4E71 A;  2WYQ A;  2NS5 A;  3A33 B;  2KC2 A;  2PEA A;  4BOS C;  4DHZ E;  4DXA B;  2KWV B;  1SIF A;  2KJR A;  1IPG A;  3WA0 A;  4IM2 A;  1FXT B;  2OJR A;  2XK5 A;  4W9E A;  4EKU A;  2RR9 A;  3JVZ X;  3A4S C;  3R7R A;  4AOF A;  2Z59 B;  5DPW A;  2KFJ A;  1Q1O A;  2NR2 A;  2WX0 A;  2KVR A;  3VH4 B;  3DDC B;  3N30 A;  2RGF A;  2KAN A;  3A9K B;  2L8J A;  2J7Q B;  4DDG D;  5L95 C;  3W1S A;  3M95 A;  2DYM A;  2N7D A;  1Z5S B;  5G2N A;  4TQ0 A;  1E8X A;  3UIO B;  2K39 A;  4IM3 A;  2N4F A;  1GJZ A;  5IAA C;  4KV2 A;  2V1Y A;  1H8C A;  4TUU A;  3HM6 X;  3ZW3 A;  2D2Q A;  2MP2 B;  3TL5 A;  1V5O A;  1MG8 A;  1WMH A;  3A4R A;  3KH0 A;  2JZZ A;  2KLC A;  4JLC A;  2MRP A;  2AWT A;  2MBH A;  4NY0 A;  3AUL A;  2MX2 A;  2MQJ A;  1YX5 B;  3O65 B;  3LJ3 A;  2KJH B;  3ZKJ C;  4NAW A;  2V3S A;  2K6D B;  4KIK A;  2KHW B;  3ZNI D;  2ZJD A;  5AEK B;  4WWP A;  3DQV A;  4KZ0 A;  2KLG A;  3ZNH B;  5LXI B;  4GIV A;  1BT0 A;  3MHS D;  3OJ3 A;  1E5W A;  1OQY A;  3W1Y A;  1WGH A;  4EFO A;  3LDZ E;  1ZW7 A;  3W1S C;  4BBN C;  3UQB A;  4GSW A;  3SHQ A;  4ANV A;  2YVC A;  4HJK A;  4ZRK A;  4DHJ B;  1HE8 A;  4F8C B;  4LDT B;  4NJ7 A;  3P2B A;  2KXJ A;  3KYD D;  4ZYN A;  2UWQ A;  3WAL A;  2O6V D;  2N1V A;  2WDT B;  3ZTD A;  2NCN A;  2JRH A;  1SGH A;  5DPT A;  4EZL A;  1GUA B;  2AEH A;  4LDT D;  5E6P A;  5CHF A;  3PTF C;  4HCN B;  2XEW A;  1YQB A;  1V80 A;  4TKN A;  4W9J A;  3APC A;  2D10 A;  2NPT A;  1WGY A;  4KVG B;  1U4A A;  4X57 B;  2J0M A;  4AJY B;  2MLB A;  1WMH B;  2ZEQ A;  3CMM B;  3RT3 B;  2DAF A;  3NS8 A;  4GB9 A;  2O6V A;  1E90 A;  1E7U A;  3WIM A;  1F9J A;  4MM3 A;  2JY6 A;  3ZIM A;  4KDL B;  4WJP A;  1EUV B;  3DBS A;  3VUX A;  1ZGU B;  4EEW A;  2K1F A;  4BKS D;  1E8Y A;  3L08 A;  4A3O A;  2N9E B;  3A9J A;  4GOC A;  1E8W A;  2KWC A;  3NHE B;  3V6E B;  2R2Q A;  3ZNG C;  1WJ4 A;  4M8N A;  4XX5 A;  2JVC A;  2BGF A;  1H4R A;  4BBN F;  4FJZ A;  4W9K A;  1YIW A;  3PLV A;  4W9C A;  2Z0E B;  2JRI B;  3JSV A;  4IWO A;  3UF8 A;  4IM0 A;  3DPD A;  3PRE A;  2DZM A;  3KYC D;  3M62 B;  5CHW A;  2Z0D B;  4GN1 A;  2JUO A;  2CHZ A;  2KWU B;  2JXX A;  4EOY A;  1KOT A;  2HTH A;  2MWS B;  1GG3 A;  1WIA A;  2C5L C;  3PZD A;  3UQA A;  4J6I A;  1LQB A;  2IYD B;  1P9D U;  2KC1 A;  2ZVO A;  2PE6 B;  2M17 A;  4BFR A;  1OTR B;  2NPT B;  3QA8 A;  1UZX B;  2DHZ A;  2Y5B B;  2IZV B;  4FLH A;  5BO4 B;  3WAM A;  1WXM A;  1WGD A;  2LI5 A;  2KN5 A;  2JWZ A;  2GBM A;  3K9O B;  4URK A;  2KZR A;  4MGY E;  3HHM A;  2IBI B;  2KX3 A;  2OOB B;  4M0W B;  4B95 A;  2MA9 B;  1YJ1 A;  3VH3 B;  2IO1 B;  3RUI B;  4WJO A;  1WZ0 A;  2LAS A;  2BPS A;  1XT9 B;  2JT4 B;  2KTR A;  3NZS A;  3JW0 X;  4K7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...