4CO8A

Structure of the dna binding ets domain of human etv4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
b'MRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS TRANSLOCATION VARIANT 4
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4co8A00
2DT5A 3FMRA 4P5OA 1S6LA 4EJTA 4WXDA 3VOEA 5KVRA 2HKOA 1W7PB 2QQBA 1LEAA 4PGGA 4YG2F 3F3XA 2CW0F 4E70A 5ILSA 1TQMA 3CUQC 2QWWA 5TJJA 1YG2A 2IA0A 1IXSB 4CXFA 3MQ0A 3DPLC 3U1DA 5LEKA 4A0YA 1USTA 4HAMA 4LK1F 1RUOA 2HTSA 1Y0UA 3HOTA 2D1HA 1T0FA 1YTYA 1HBXG 3I53A 4UVAA 1IRGA 2CFXA 3I54A 2P5LC 4ESFA 1OR7A 2Q8KA 4EGYA 3NEUA 2XASA 5BMZA 4AVPA 1FC3A 2OZUA 4ENKA 1XGOA 4WXHA 3GW2A 2MLKA 2Y75A 1YYVA 4ENMA 4GXOA 3E6BA 1F9NA 3SXYA 1B9NA 1MJBA 1R5HA 5IT3A 2FXAA 2W84A 1U5TC 3Q5FA 3C7JA 2Z33A 3F8NA 4EJVA 1D8JA 1BI3A 5F64A 1P6RA 2KIFA 1S7OA 2OQGA 2Z3YA 3ZMTA 3K1MA 3FMQA 1P92A 5ILUA 2ZMEB 3K0LA 4ZZLA 2J5PA 1T2KA 1RZ4A 5DDGA 4G7OF 2JRTA 1SD6A 2HKXA 3FHZA 5E17F 1TTYA 2DLLA 2Y48A 1IN4A 2CSOA 4G7ZF 1FOKA 5BPIA 4JBAA 2FBIA 3WE2A 2Q0OA 3BWGA 4CO8A 1MKMA 2L01A 3HHGA 4L0YB 3FXRA 4RGSA 1BOAA 2EFQA 2XAHA 3KETA 3MWMA 4MNUA 2O0YA 2PBIA 5E20A 4ON0A 3I4PA 2D45A 4M73A 4CGZA 3EQLF 2H6CA 4P55A 2YU3A 2L4AA 5FD5A 1P4AA 2NNNA 2MD5A 2STWA 3C1DA 2FSWA 1BIAA 3LFKA 2O6GE 2DAOA 3KFWX 5H6RA 3ABUA 4G6QA 1U5TA 4EM1A 5JVTA 2G7HA 4Q47A 4M74A 3TDZC 1B1BA 3M9AA 5K1YA 2VT3A 1F5TA 4OMYA 5EEHA 1BC7C 4BHCA 2HWVA 1JE8A 2VXZA 3GVAA 4XLNF 2A69F 3BJ6A 4OIQF 2QUFA 1WI9A 2H94A 4I0BA 3KP5A 3EETA 3KEQA 2NYXA 4GCVA 4L5JA 2FBHA 2VONA 1D3YA 3O2PE 1TQIA 3FM3A 3P9IA 3V7RA 4IRGA 1KA8A 5LEJA 3ERED 2ISYA 3CLOA 4A6DA 1U2WA 1R36A 2MBFA 2P5VA 2L54A 2R7DA 5ICFA 3T8RA 1K78A 2F2EA 4O5VA 3WTSC 5CVJA 3J80Z 3I0TA 2F5DA 1MGTA 5DCMB 2VBZA 1YIOA 2OAZA 1XDUA 2CWEA 3K2ZA 2M8EA 4XRFA 3CDHA 2DQLA 2MC3A 2QM3A 4HZFA 1ZREA 1S7AA 1FNNA 2FBKA 1FP2A 1WRJA 4OIPF 2HGCA 2W24A 2ZNZA 2KJBA 3K9TA 2FF4A 3WTVC 1I1SA 2W25A 1OMIA 3IWZA 2DBBA 1SFUA 1I5ZA 2DPUA 2XRNA 3P9CA 5D5UB 1T39A 1RI7A 1HW1A 4RB0A 3P9KA 5LLQA 3HHHA 4BH9A 3I71A 2QLZA 3Q9SA 3CUOA 2F5FA 2A07F 3LA3A 4KMUX 3I58A 5HS9A 4UUVA 4I01A 2A5YB 2K27A 1STZA 4A6EA 5DV5A 1SD7A 5ED4A 1KYWA 3MZHA 1YW8A 5HDNA 3QU6A 2EFNA 4KN7X 2KRFA 3BJOA 3E3VA 2R3SA 3R0JA 2DK8A 1XSXA 3H3UA 2ZCWA 2OZ6A 1LB2A 3T1BA 1JHFA 2CGPA 2GAUA 1ZN2A 3HSEA 5FD6A 2V1UA 3CO6C 2DO7A 4OIRF 2ZKZA 3ZMVA 1PUEE 4UHTA 3L09A 3C3WA 1ZG3A 3I59B 4EM0B 1YS6A 2HTJA 5L3EA 4FT8A 5JFRA 4UXNA 3ECHA 2Q2EA 5LHGA 1OYIA 4BNCA 3T8TA 5ICGA 5LHHA 2OD5A 3KEOA 2GQQA 1MDMB 2LF7A 4XLPF 3LAJA 4G94A 2KIMA 3GXOA 1CF7B 3W6KB 5ICEA 2EK5A 4Z2YA 3V8LA 3KLNA 1BI1A 1W5SA 4K2EA 2YR2A 3TQNA 1LDDA 2V9VA 4HV5A 1HXDA 3DKWA 4EJUA 2EB7A 5HS7A 5HDGA 1J7KA 3T5XA 3PFIA 2CG4A 4KIFA 3WTYC 4B8XA 1EH6A 2ZBKA 3E6MA 1DDNA 1Z1DA 3IRQA 1GXQA 2ISZA 1FP1D 4IXAA 1K6OA 2M30A 2XROA 3DPTA 2A6EF 4HX8A 1S8NA 4FX0A 2DK5A 1G3YA 3LWFA 1EH7A 2FRHA 2PMHA 1LJ9A 1IAWA 4WWCA 4IHSA 2HDCA 4WXCA 3R0AA 4LFUA 2FMYA 5BS6A 1W7PD 4YFNF 2QYOA 2COMA 2BEOA 1I27A 3GUDA 3KP3A 1R00A 1E2XA 5FGMA 4KDPA 4L9VA 2P7VB 2L02A 2HYFA 1O3SA 1ZG5A 2K4BA 3DF8A 1FBQA 4YIFA 1OYYA 2NRAC 2A61A 2HEOA 2PI0A 5IT9K 2JPBA 1MD0A 1XSVA 3K69A 3HSRA 2EFOA 3L00A 3ZMZA 4BHPA 1FY7A 4LK0F 3CUQB 2XAJA 1KQ0A 4QWQA 3F21A 3IHUA 4KMFA 1ZAOA 4CYDA 1H9GA 3WGHA 3WU0A 1JXSA 3HRTA 4UV9A 4UV8A 1IUYA 1XCBA 1V3FA 3QP5A 1WSUA 1IW7F 2LF8A 3HTUA 3J80K 1KU3A 2PLYA 4DNCA 1BN5A 5DD8A 4S05A 4LMYA 4AIHA 2QQ9A 5F6FA 5BOXA 3IC7A 1B59A 4ZYHA 1FYLA 2TDXA 5ERIA 3ZMDA 1FYMA 2RV8A 1DPUA 3LAPA 2XGXA 4NHJA 1HSJA 2ETHA 3ZN0A 5LGTA 3DQVC 3GEZA 3LA7A 3Q9VA 2LNBA 2R7FA 1LQ1A 4L9NA 1FBSA 3VEPA 2XVCA 4FX4A 1U5TB 1HW2A 5BPDA 1ON2A 4N9IA 1MZBA 3N4MA 2FNAA 4R8HA 2ELHA 4IF4A 3VFZA 3GLXA 4B09A 4MQ9F 4YIIA 2IA2A 3MCZA 1ZG1A 2CYYA 4G6DA 2IP2A 3WGIA 2BE5F 2XAFA 3E5XA 3F8MA 4LLNA 4D0PA 2M87A 2XV4S 1BI0A 2O8XA 3HYIA 4L18B 4AWXB 1ZHFA 4IRIA 2FEZA 4ESJA 2H09A 5ICCA 4CHUA 5HLIA 1IXRC 3JSPA 1BJAA 1YQAA 1TW3A 3F72A 2H27A 3U2RA 2K7LA 1TLHB 4L5IA 1QZYA 3EYIA 5J8CA 4HDUA 3P7NA 1W7PA 5JR3A 1W5TA 3M1EA 2GWRA 2WC2A 2ESNA 2BBYA 4G7HF 1ZRCA 3ZPLA 3ABTA 4RGRA 2ZXJA 4IVNA 4EJOA 2IPQX 2EV6A 3V4GA 3OV8A 2EFPA 2FMLA 4ENNA 3MAJA 3V7CA 1B6AA 4M6XA 2K86A 1FSHA 4I2OA 3R61A 4N0BA 3WE3A 3R4KA 3C18A 3QU3A 2VE8A 2RN7A 3QPTA 2QBYB 3R60A 1RUNA 2DU9A 2XIGA 1C0WA 4A12A 3B02A 4P9FA 2JT1A 3M8FA 1P4WA 1B4AA 4GO1A 3BROA 1JHHA 1XSDA 2WWYA 3TO6A 1A04A 3FXUA 1AOYA 3ZMUA 5ILVA 4H0EA 2ACJA 3KZYA 5CVVA 3F22A 2Z99A 1Z9CA 1KYZA 4EQQA 4RB2C 4G8XA 5AONA 3BP8A 5LGNA 1LDJA 1XD7A 3FXQA 4R79A 1F4KA 4AD9A 1IN7A 2GXBA 1PP7U 2HFHA 4UNOA 2RC4A 2ZMEA 3WTZA 2L3DA 1ZYRF 3ECOA 4PGHA 4MHGA 2ESHA 3QAHA 1J75A 1H0MA 1ONVA 1QQIA 3F8BA 3BJAA 2PG4A 3RYRA 1G3TA 5CYVA 1S3JA 2KKOA 5J8FA 5HVQC 2HYGD 3WODF 1ZRDA 4RGXA 1G3SA 1TW2A 3I64A 3BDDA 4LG0B 4I02A 2VODA 1F1ZA 2QZ8A 5D4RA 4MTDA 4DQ2A 2P7CB 1UFMA 1HQCA 2STTA 2PN6A 2HR3A 2EFWA 1J2XA 2AXLA 2VC0A 2XHKA 5L3DA 2F5CA 1ZARA 2VBWA 1IRFA 1R5GA 3GZ6A 4A2UA 1KQ9A 3FF5A 1YFHA 2YSRA 4LD5A 3PQKA 3LSTA 1XMKA 4M72A 1DP7P 3L7WA 1D8KA 3LQQA 3WU1B 3WTWC 3HTSB 4LB6B 2RVCA 2Y0MA 2KJCA 3CO7C 1R7JA 3ZMSA 3BOQA 2X0LA 1L0OC 2WTEA 5H20A 3RDIA 1REPC 1D5VA 1K7AA 4I98B 4IRHA 4KUMA 1J9IA 1ZGJA 3FZVA 1KQ8A 3E6DA 2GXGA 1XMAA 2O61A 5FFXA 4OMZA 5DCMA 2F5EA 3KCCA 5HLHA 1YW7A 1IN5A 2QQAA 1FWZA 5FO5A 1U6GA 2UXXA 1Z7UA 4U88A 1ZH5A 2PFBA 4HF2A 3RIRA 2PQ8A 6PAXA 3KP7A 1HW5A 2YX4A 4A5NA 3RKWA 1SD4A 2LDUA 1YLFA 4WK8F 4LJZF 2NS0A 3TKYA 2D1VA 2X4HA 2C6YA 2HOEA 3CJNA 5LRRA 1XGMA 3GF2A 2VOOA 1T98A 3DP7A 2DPDA 4EVIA 1BBYA 1XGNA 2XKOA 1HSTA 1Q1HA 2WV0A 3GFIA 1G3WA 4MEXF 3MZYA 3MEXA 2YPRA 4G9YA 4EGZA 4IJAA 3GX4X 1J59A 1ZLKA 5D8LB 2IRFG 3R6SA 2OU2A 3TGNA 1U78A 1O3TA 1FYKA 1QGPA 3EUHA 3H3ZA 4L9JA 2JPCA 3ML6A 1Z6RA 4Q5SF 2QENA 3HOSA 2P5KA 5K5OA 1SD5A 2RNJA 4O6JA 4A5MA 2M1BA 1OPCA 2DQRA 3RKYA 4GYIA 4Y17A 3KP6A 3NRVA 1X3UA 4U0YA 2GA1A 3M8EA 3SZPA 5L3BA 4MEYF 3BPVA 4PDKA 4HX4A 4IHTA 1QO0D 3HRSA 4XSZF 3QOPA 1HKTA 4Q48A 4HOBA 3F6OA 2OQRA 2EV0A 3TOAA 4CZZA 3KLOA 3BPXA 3ISPA 3B73A 3I59A 5AIQA 3JAMZ 1PP8F 4BHBA 5DEQA 2P6TA 4LB5A 1UCRA 5AIPA 4OINF 1GHCA 3V8KA 1Z91A 3T0YA 3QP6A 2HS5A 4XSXF 1R1TA 5HOOA 3E5QA 4RB1A 1MDMA 3BZ6A 1IZ1A 4KIBA 2E7WA 2G7UA 4Y15A 1DUXC 1CF7A 4L0ZB 1LEBA 3RPQA 2HQNA 4OIOF 3N97A 2OA4A 4LGWA 5K5RA 1L3LA 5A2QZ 3G73A 5CVIA 2VBXA 1LVAA 3COAC 5D4SA 4Y13A 3DXJF 1K79A 3DV8A 2IW5A 2B0LA 1ON1A 4L9TA 2ZO4A 5H6QA 5TRDA 3D0SA 1MJ9A 5DUKA 5DD4A 3EDPA 4NB5A 2OBPA 2FE3A 1S29A 4HLXA 4BXUA 2M45A 2GZWA 3IWFA 3RYPA 2RGVA 3RTRA 2J5OA 4BAYA 5JHUA 4WF2A 2JTVA 5FFZA 3GFLA 5HLGA 4TV7A 2FA5A 4WCGA 1XCVA 4KN4X 3V8JA 2E1NA 1PDNC 2FNPA 1QPMA 5D5WB 3JW4A 2FU4A 5CJ9A 1AWCA 4LLGF 5FB2A 3GZ5A 4YFKF 1XGSA 2ADUA 2NNYA 4HBLA 3L2CA 5BQTA 5L3FA 3OOPA 4MQVA 4EMSA 2UZKA 2RDPA 5E1XA 1SFXA 1SMYF 1SFEA 4MTEA 4CDGA 3O3KA 3QPHA 1NHAA 2PMUA 1DPRA 1KGSA 1K78B 1KU7A 1JGSA 4QLCU 4ZYEA 4S04A 5CVUA 3RKXA 5D5VB 1IN8A 2NAZA 3CUQA 2P6SA 3H92A 2DI3A 1R1UA 2EV5A 2DTRA 4HQEA 4HF1A 4KFCA 4N9HA 4ETSA 3WG9A 4JK1X 3WGGA 3F23A 2VBYA 2KIUA 3E5UA 4M71A 3TO7A 5DUIA 1SMTA 1EH8A 3J81Z 1KU9A 3K1NA 2ZJ2A 5E8GA 1FT9A 1WQ2A 1E17A 2YX7A 4HW0A 3HIFA 4HLYA 4HV6A 4OU0A 3HUGA 1FBUA 3VODA 3GYHX 1R22A 1O7LA 3IKTA 1TNTA 1BI2A 1HKQA 3J7AO 4RB3C 3I5UA 4ZYDA 3IRRA 2PEXA 4KNYA 3EYYA 1XDSA 1XB4A 1G6NA 3K1PA 4P9UA 2EA4A 3F8CA 1GXPA 5J6XA 1ZLJA 1IF1A 3FM5A 4U0VA 2MA3A 4PZJA 2E1CA 5KK1A 3LQRA 4GGGA 2XAGA 4ZZDA 4WX9A 1YW9A 1Z05A 3IL2A 1LDKB 3V7SA 4F7ZA 2IT0A 3TDUC 1BC8C 3ELKA 5D6FA 2ZNYA 3U9GA 5IT9Z 2VN2A 2EJRA 1HKSA 1R1VA 2W57A 3DFGA 3ROUA 2EA2A 5FLXZ 5D5XB 1O3QA 2VOPA 1BIBA 1R23A 1UB9A 1QBJA 4EM2A 1P4XA 2IA1A 3O6BB 1RIOH 4RS8A 1ZGAA 1FZPB 2D2WA 2XKPA 3FWEA 2BV6A 3FMSA 3L9FA 4ENJA 2A6HF 2HQRA 1P2FA 2XAQA 2GIVA 3CTAA 3IKVA 1FSEA 2DW4A 2P8TA 5DCFA 4FHTA 1O3RA 4ESBA 4HF0A 1QZZA 4U7BA 2QVOA 3JAMK 4HDVA 1VTNC 5HDKA 1MJAA 4BQAA 4YFXF 2V6CA 4OOIA 2K02A 3E6CC 4RGUA 4UVBA 1I1GA 2PJPA 3E97A 3HRUA 3NQOA 1WWXA 3AAFA 1YS7A 4GYGA 2E7XA 4A0ZA 2BGCA 3W6JB 1FLIA 3S2WA 2LKPA 2RKHA 1TBXA 2BYVE 3SZTA 3QRFF 5K5QA 1FX7A 4UVCA 3TOBA 1T6SA 3ZP5A 2QBYA 4M6YA 5CLSA 2P4WA 5L3GA 5A2QK 2FQ3A 5E8IA 3GFMA 2IJLA 1KU2A 1J0RA 3RJPA 4ZH4F 4U7DA 4HX7A 1YO5C 3MFKA 1H9TA 2K4JA 4HQMA 2HZTA 5EEGA 1SAXA 3KZZA 4AIKA 1I6XA 4KICA 2CQKA 4IPAA 2V79A 5E18F 1U8RA 5D8KB 1ZRFA 1IN6A 5F1RA 4I7HA 4KT5C 1J5YA 3D5LA 2UWMA 2O3FA 2ZFWA 2G9WA 2MH9A 2JZYA 4O3MA 5E1ZB 3JSOA 1LNWA 2VC1A 5HS8A 3ZQ7A 2A3SA 4M9XA 3SFZA 4EV0A 3WTTC 2CO5A 2IVMA 4LG0A 1G4DA 3FX3A 1TQPA 2MLGA 1CGPA 1QNTA 1OKRA 1WKMA 2AS5F 4MGRA 5D6EA 1TNSA 1UHMA 3KE2A 1BM9A 4I09A 1Z6TA 3ULQB 3SQNA 3GWZA 5LBQA 4U0WA 2LSOA 4M9ZA 3REOA 2JSCA 3BY6A 2UXNA 3KP2A 4RAZA 3J81K 3GO5A 3F8FA 1R58A 3VB2A 3TO9A 1IXCA 5LGUA 4HA8A 3F6VA 4PCQA 2M5WA 1GVJA 4A0XA 1OYWA 5LRSA 2V1DA 5DYMA 3WTXC 4I0AA 4ASNA 2FOKA 3LA2A 3G3ZA 4EJWA 2W85A 3WTUC 2L4MA 1ULYA 4JQFA 3RPUA 4XBFA 4CICA 1U3EM 2EWNA 3HRMA 4KYWA 2RQPA 2DFIA 2H6BA 4ZYGA 4BYYA 3PQJA 4RAYA 1FPQA 4LLLA 5L3CA 1W4MA 2XUBA 4Q4ZF 3ZN1A 3M7GA 2O03A 4R1HA 3SHFA 5E1WA 3KP4A 1V4RA 4P96A 3GFJA 1B9MA 1O7FA 2V1XA 4M9SA 4AIJA 4KIGA 4HYEA 2A68F 3HSFA 3RI4A 1RNLA 1O57A 5CVRA 2MH2A 5JI6A 4KA4A 1XN7A 2GA2A 2VT2A 5FLXK 1UHWA 2VE9A 3JTHA 3JTGA 2Z9OA 1EV7A 1T38A 1ODDA 1USSA 5LHIA 3DEUA 2Z5UA 4NQWA
chains in the Genus database with same CATH superfamily
2DT5A 2VJIA 3FMRA 3BC8A 4D9JA 4P5OA 1S6LA 1V5EA 3RQIA 4EJTA 3LOCA 4WXDA 1MSFC 3HOWJ 1WH5A 3VOEA 5F1JA 1R5ID 5KVRA 5JLXA 2AQFA 2HKOA 1W7PB 3ESWB 4RAFA 2CFOA 2QQBA 1LEAA 2WAFA 3JRDA 4PGGA 5J4YA 4BQOA 4YG2F 2LC2A 2R5ZA 3F3XA 1U0JA 2CW0F 4E4HA 4E70A 1UZCA 5ILSA 1TQMA 4GDFA 3CUQC 3PIOF 2CQ7A 2QWWA 4LIUA 5TJJA 4ANJA 3FXJA 3AG4H 1VNDA 1YG2A 2HOTA 2IA0A 3TW7A 3AL0B 3BQYA 3WHBA 1IXSB 3B6CA 3E1SA 4CXFA 3MQ0A 3DPLC 3U1DA 3H5RA 5LEKA 1T8IA 4A0YA 2LR8A 1USTA 3S2DJ 4HAMA 4XQFA 4LK1F 2DJIA 1RUOA 1WFXA 2HTSA 1Y0UA 1Z0XA 3HOTA 2D1HA 2M9HA 4C9YA 4BEHA 1T0FA 1W0UA 1YTYA 1HBXG 3I53A 4DZJA 1WJAA 4UVAA 3OYEA 1IRGA 2DA7A 1IV8A 1POGA 2CFXA 3I54A 5H2FC 5EGOB 2P5LC 3DU5A 3AKZA 5B5EC 4ESFA 1VQKI 2GM4A 1Y1WJ 4B4CA 1OR7A 2XF5A 2Q8KA 2MGQA 4EGYA 3NEUA 2XASA 2R7VA 1T95A 5F27A 1RC9A 5BMZA 2W4SA 4XN0A 5C44J 2LVSA 3CCRI 4AVPA 2K5CA 3BZCA 1FC3A 3S17J 4IKFA 2OZUA 5FROA 3LSRA 4ENKA 1XGOA 4WXHA 3GW2A 1S7EA 2K40A 2MLKA 2Y75A 2ID6A 2WY8Q 1R9TJ 2H8RA 1YYVA 2F4IA 5FKMA 4ENMA 2PMZN 4GXOA 2K85A 5M5YJ 3E6BA 1F9NA 2ECCA 2MYSA 3SXYA 5K7ZA 4C30A 3FXLA 2KP6A 1B9NA 1T56A 3S3NA 1MJBA 1R5HA 1OQYA 5IT3A 2FXAA 2W84A 1U5TC 3Q5FA 2DJNA 3C7JA 2Z33A 3F8NA 1E3OC 1VQOI 4EJVA 1D8JA 1BI3A 2E1MB 5F64A 1P6RA 2KIFA 1E3PA 1JTYA 1JT0A 1S7OA 2OQGA 2Z3YA 3ZMTA 1R4NB 1HA8A 4PK4A 1ERDA 3K1MA 3FMQA 1KONA 2VKHA 4E7ZA 1F43A 1P92A 2KZVA 3J7AY 2Y31A 5ILUA 2ZMEB 2BY2A 3CJTB 3LSIA 2E2HJ 3K0LA 4ZZLA 2J5PA 1T2KA 1RZ4A 5DDGA 3LSHA 3IH2A 3OYGA 4E7HA 1Z21A 1FIAA 4G7OF 2JRTA 1SD6A 2XPWA 2HKXA 1P9QC 4UB8C 3FHZA 2IGOA 5E17F 2VQCA 1TTYA 2DLLA 2Y48A 4XKCA 1IN4A 1IJWC 2CSOA 4G7ZF 4JOMA 1FOKA 3CP8A 1YI2I 5BPIA 2JWTA 4JBAA 3ZQFA 1YX3A 2JVHA 4N4OB 2FBIA 3WE2A 2CH0A 2Q0OA 3BWGA 4CO8A 1MKMA 2L01A 2IBDA 2R5YB 1XMXA 3HHGA 2WB1A 4L0YB 3CP2A 4E7IA 1AU7A 3FXRA 2WV1A 2V9PA 4RGSA 1BOAA 2EFQA 2XAHA 4N4NB 3F0CA 3KETA 3MWMA 2IS2A 4MNUA 2O0YA 2PBIA 5E20A 4ON0A 3I4PA 2D45A 4M73A 2MC4A 4CGZA 2G0EA 2DFFA 2EPFA 2LKXA 3I4MJ 3EQLF 3I56I 2VQHA 2H6CA 2F5VA 2X6YA 2YU3A 3CQZJ 3KYCB 4P55A 3QWLA 2RAEA 1FMWA 2L4AA 2Y0SN 5FD5A 1P4AA 2QA4I 2NNNA 4H4KC 2VQLA 3CCEI 2MD5A 3BR5A 1VQPI 4AU7A 2STWA 2XDVA 3C1DA 2FSWA 2QKMB 3AG2H 4IHVA 1BIAA 2H8WA 3LFKA 5E3OA 2O6GE 2DAOA 3KFWX 5H6RA 3ABUA 4LITA 1SFOJ 3J7YJ 1GUUA 2UUZA 4G6QA 1U5TA 4EM1A 5JVTA 2G7HA 3BG7A 4Q47A 4M74A 2Z1DA 3TDZC 1B1BA 3M9AA 5K1YA 2VT3A 1F5TA 4OMYA 5EEHA 1BC7C 2HDDA 2Q1ZB 2DN0A 2HWVA 4BHCA 3K4KA 1JE8A 1OJLA 2VXZA 3GVAA 4XLNF 1MBKA 2A69F 3BJ6A 4OIQF 3ZQIA 1VQ4I 2QUFA 1WI9A 2H94A 1R4MB 4I0BA 2E71A 3KP5A 4UUTA 2R7ZJ 3EETA 2BY0A 2NYXA 3KEQA 4GCVA 4L5JA 3OY9A 4E7LA 2FBHA 1XPXA 1UJ8A 4G12A 2VONA 1QPIA 1D3YA 3O2PE 1FTZA 1Y8RB 4BS9A 4IZZA 1TQIA 3FM3A 3P9IA 4FCYA 3V7RA 4IRGA 1ETVA 2CMPA 5EYRA 1KA8A 5LEJA 1FOYA 3ERED 2ISYA 3BTIA 3CLOA 4RBOA 4A6DA 2R7UA 1U2WA 1X1DA 2HVSA 2DA1A 1R36A 2KDOA 2MBFA 2P5VA 3LSMA 4J19A 5GPAA 2L54A 5F0FA 4ZTJA 2R7DA 2PMZA 4HSRA 5ICFA 3T8RA 4IEJA 3TW6A 3HM5A 4PUSA 3GCMA 1RESA 4NC8A 3OYDA 1Y56A 1K78A 2JJ7A 2F2EA 4CCJA 1SEUA 4O5VA 3WTSC 3S1MJ 3C2GA 2IAIA 3OIPA 2KPMA 3H3VK 5CVJA 3J80Z 3I0TA 2K3PA 2F5DA 1MGTA 5DCMB 2VBZA 3H5AA 4ZTFA 1YIOA 2OAZA 1SFKA 2E5ZA 1TT0A 3BR0A 4RA2A 1XDUA 2CWEA 2QKLB 3QOEA 4E7KA 1ETQA 1ETOA 1J09A 4UB6C 3K2ZA 1GV5A 2M8EA 4XRFA 3CDHA 1I50J 1JUSA 4XL9A 1NK2P 2DQLA 2MC3A 2QM3A 3RPUD 4HZFA 4HRIA 4W1UA 1ZREA 3OIQA 1S7AA 4OAYA 3KIOA 3Q0VA 2CJJA 1WH7A 2IEKA 1FNNA 2FBKA 1FP2A 1WRJA 4OIPF 2P81A 2X6OA 2HGCA 2LP0A 3N05A 2DT6A 2W24A 2ZNZA 3M1CA 2KJBA 3K9TA 2FF4A 1JKPC 4XORA 2EZLA 3G1OA 2HI3A 3WTVC 1TWAJ 1I1SA 2W25A 1OMIA 4F91B 3IWZA 2DBBA 1SFUA 1I5ZA 2K9NA 1VQ5I 3DKYA 2DPUA 1HF0A 2XRNA 3P9CA 2DOEA 3OS0A 9ANTA 3DPUA 3FBNB 1FEXA 5D5UB 1T39A 2MG4A 1I6HJ 1RI7A 1YX5A 3ZR8X 1HW1A 3L2WA 4RB0A 1TWFJ 2Y0SA 2OPTA 3P9KA 5FRNA 4DOZA 1VQ8I 5LLQA 3E7LA 1V5GA 2V6EA 1MBHA 3HHHA 2LY2A 3FISA 4OAZA 2L9NA 4BH9A 2HYJA 2JK3A 1A5JA 2DMNA 3I71A 2QLZA 3Q9SA 2LFBA 3CUOA 2F5FA 2A07F 2NVUB 1VQLI 1AKHB 1SANA 3PO2J 3S93A 4BKXA 1WZ2A 1PYVA 2TCTA 3LA3A 2DMTA 4KMUX 3I58A 2NVQJ 1LE8A 4BBSJ 5HS9A 4UUVA 3CF5F 4I01A 2A5YB 2K27A 1VF9A 1NTCA 1B72A 2DMPA 1GDTA 3MN2A 3AG3H 2HVRA 4B48A 1XS9A 1WHUA 1STZA 4A6EA 2HOAA 5DV5A 1SD7A 5ED4A 2BY1A 3G1MA 3K4CA 1KYWA 1ETYA 3MZHA 4A93J 1W1WE 1YW8A 2XRLA 5HDNA 3QU6A 3HOXJ 2EFNA 4KN7X 3GTQJ 1OFCX 2KRFA 2ZJQF 3BJOA 4M3BA 3HKZN 4D5CA 3E3VA 2R3SA 3R0JA 2DK8A 4NBQA 5KHDA 1RRJA 1XSXA 3AG1H 3H3UA 2ZCWA 1X4OA 2OZ6A 1LB2A 3T1BA 5J1RA 2BXZA 2LBFB 1VFCA 1JHFA 4B3XA 3FKJA 2CGPA 2GAUA 3PNYA 1ZN2A 4B1RA 3HSEA 2NXNB 4B43A 4NC6A 4Y4RA 5FD6A 2V1UA 3CO6C 2DO7A 4M3EA 4OIRF 1P7IA 2ZKZA 3ZMVA 1PUEE 4UHTA 3FXMA 3L09A 2L5QA 2OF7A 5EDNA 1VQ7I 3C3WA 1ZG3A 3I59B 1H89C 2ME6A 4EM0B 2A05A 3KZIC 2NS8A 1YS6A 2CU7A 2HTJA 3ZQHA 2Y9ZA 5L3EA 3S15J 1Z7LA 1JI8A 2ELKA 3QYFA 4RAGA 1HC8A 4FT8A 3A4CA 5JFRA 3GTOJ 3S16J 4UXNA 4ZDOA 2DDAA 1RR8C 5IYCJ 3ECHA 2Q2EA 5LHGA 1OYIA 4BNCA 2OCEA 4A3FJ 3T8TA 1MW7A 5ICGA 5LHHA 1LPQA 2OD5A 3KEOA 4BU2A 2GQQA 4A3IJ 1Y1VJ 1MDMB 3SZGA 3P5JA 2LF7A 4XLPF 3LAJA 4D1QA 4G94A 2KIMA 3GXOA 1FJLA 4IO9F 1CF7B 3W6KB 2NOJB 2DA3A 5ICEA 3HJEA 2EK5A 4Z2YA 3V8LA 2K9SA 2L9RA 4II3A 5F0CA 1MMAA 3KLNA 1BI1A 1W5SA 1P7JA 4K2EA 2YR2A 3TQNA 3M4OJ 3BG5A 1LDDA 1JT6A 2CV2A 3TMOA 2LY1A 2V9VA 4HV5A 1HXDA 2XGCA 1X1BA 2KISA 4U87A 2LD5A 3DKWA 4EJUA 2ICWG 2EB7A 5HS7A 5HDGA 1J7KA 5EG0A 3T5XA 3PFIA 2CG4A 2HVQA 4KIFA 3WTYC 4B8XA 2WY7Q 1MBJA 3BTLA 1EH6A 1G59A 2ZBKA 3E6MA 1DDNA 1RKTA 1Z1DA 2ZXIA 5B1AH 1GXQA 3IRQA 2ISZA 1FP1D 4IXAA 5CQEA 1K6OA 2M30A 2XROA 3DPTA 2A6EF 4HX8A 4JX6A 3MD2A 1S8NA 2X85A 3W2WA 3NAUA 4PJLA 4FX0A 2NVTJ 2DK5A 1G3YA 5CKTA 2XGDA 3LWFA 2ZXWH 1EH7A 4A3GJ 3I4NJ 4XLAA 1A6QA 1LKXA 2FRHA 5BNGA 3HBLA 3ONQA 2PMHA 1LJ9A 1IAWA 2W82A 1IGNA 4WWCA 4IHSA 1AHDP 2HDCA 4WXCA 3QPSA 1B8IB 3V42A 1X3WB 3OYCA 3BTCA 4YIRX 3R0AA 4LFUA 2FMYA 1X1AA 3BLYA 5BS6A 1W7PD 4YFNF 5IP7J 2QYOA 2M3AA 2COMA 2BEOA 1AA7A 1Z67A 2I10A 1I27A 3GUDA 3KP3A 1R00A 3HKZA 2L2OA 1IDYA 1E2XA 2D5VA 5FGMA 4BY7J 4KDPA 4L9VA 2VPRA 1FOWA 2P7VB 1T0FC 2L02A 3LNQA 3PO3J 2HYFA 4XNFA 1O3SA 1ZG5A 2K4BA 3DF8A 1FBQA 5B1BH 4YIFA 3X2QH 1OYYA 4BE0A 2NRAC 4JYKA 2A61A 5E3NA 2HEOA 1T08B 2PI0A 5IT9K 1OR7C 2JPBA 2XAUA 3QYEA 1MD0A 1IRXA 4M6VA 1XSVA 3K69A 2MFZA 2JQ7A 3HSRA 2EFOA 5E79C 5DTDA 4Y7NJ 2HNHA 3PJRA 2V4JC 3S3MA 3VYUB 4CYCB 3L00A 2VXDA 3ZMZA 4BHPA 1FY7A 4LK0F 3CUQB 2XAJA 1KQ0A 4M3GA 4QWQA 2QCOA 3F21A 5FKKA 3IHUA 4CH7A 5J4VA 4KMFA 1ZAOA 4CYDA 2DA6A 1H9GA 3WGHA 3SEZA 3WU0A 1ZGWA 1JXSA 2K9MA 3HRTA 4XM3A 1JKQC 4UV9A 4UV8A 1YRNB 1IUYA 1XCBA 2XB5A 3HC7A 3K4BA 1V3FA 2E36A 2HU9A 1HDDC 2A5WA 3QP5A 3BG6A 5LFAA 1WSUA 1IW7F 2LF8A 3HTUA 3J80K 5E3MA 3BG3A 1KU3A 2PLYA 3ZXSA 4DNCA 3MMYB 1BN5A 2ME0A 5DD8A 4S05A 2KHMA 4LMYA 4AIHA 2QQ9A 4C2MJ 3HUGB 5F6FA 5BOXA 3IC7A 2AO9A 1X1CA 3EPZA 1B59A 4ZYHA 1FYLA 2TDXA 1EF4A 2VLAA 5ERIA 3ZMDA 4UUSA 3LSPA 4A3DJ 4HEA2 2JUCA 1FYMA 2HPMA 2CW8A 3BR2A 2RV8A 1DPUA 3LAPA 2XGXA 2LRDA 4AM3A 2DMUA 4NHJA 3JCUC 1HSJA 3CLQA 1JTXA 2ETHA 4BE1A 3CC2I 2OCCH 4XOPA 3ZN0A 3FXOA 5LGTA 4Y52J 4CCKA 1N77A 3DQVC 3GEZA 3LA7A 2LMDA 3Q9VA 2LNBA 2R7FA 1LQ1A 4ZDLA 4L9NA 3GMEA 3RKQA 1FBSA 3VEPA 2COBA 4AVZA 2XVCA 4FX4A 3K4JA 2TRTA 1DP3A 1U5TB 5FKOA 5K7HA 1HW2A 5BPDA 1ON2A 4N9IA 3CESA 1MZBA 3ZQLA 1ZR2A 4BXFA 3N4MA 1YJWI 2FNAA 4NNJA 4R8HA 2ELHA 4IF4A 5KAFC 1TWGJ 3VFZA 3GLXA 4ZJZA 3BQZA 3QPLA 4B09A 1VQNI 4MQ9F 4CSWA 4XONA 4YIIA 2IA2A 3DLLF 3MCZA 1LFUP 4L5EA 4PJJA 1ZG1A 4BL0B 2CYYA 5IP9J 4IX7A 4C3IJ 4FASD 4G6DA 2Y69H 2IP2A 4XLFA 5HLTA 3WGIA 2BE5F 1GVDA 3VYTB 3H9JA 2KT0A 2XAFA 4XK4A 3E5XA 3F8MA 2LG4A 4LLNA 4D0PA 2M87A 3QODA 2XV4S 1BI0A 3FBIB 2O8XA 2KZGA 5FJ8J 2CS3A 3HYIA 2B63J 2RREA 4L18B 4AWXB 1ZHFA 3CJQB 4IRIA 3DTEA 2FEZA 4ESJA 4PJMA 3A01B 3KPHA 2H09A 1G2HA 2BW3B 3Q0UA 1XTAA 3RZDJ 5ICCA 4CHUA 2QSFX 5GAHJ 3H9GA 1A6IA 2E60A 1IXRC 5HLIA 1BJAA 3JSPA 4RDUA 1YQAA 5GP9A 1TW3A 2Z16A 3F72A 2H27A 3U2RA 1TWCJ 2K7LA 1TLHB 4I99C 4L5IA 1QZYA 2NS7A 3EYIA 4LG3A 4YRVA 4NUBA 1OCTC 5J8CA 3M07A 3NARA 1LVKA 4YELA 4HDUA 3P7NA 1W7PA 5JR3A 1W5TA 3M1EA 4C3HJ 2GWRA 3RZOJ 3LSJA 2WC2A 2ESNA 2BBYA 4G7HF 1ZRCA 3ZPLA 2L7MP 3ABTA 5GTIC 4RGRA 2B7EA 1OLTA 2ZXJA 1SAUA 4J00A 4IVNA 4EJOA 4QTRA 4D7NA 2IPQX 4C2TA 4HNTA 2EV6A 3V4GA 3OV8A 2BVMA 2EFPA 2FMLA 1HLVA 1BL0A 4V2GA 4ENNA 3HEFA 3FDYA 3MAJA 1LFBA 3V7CA 1K4TA 1B6AA 4M6XA 2K86A 2OTJI 1FSHA 3ZQCA 4I2OA 3R61A 3OSFA 5EGOA 4N0BA 3WE3A 3FK7A 3C18A 3R4KA 2HOSA 4QSHA 3QU3A 2VE8A 2RN7A 3QPTA 2QBYB 2MABA 1MMGA 3R60A 1RUNA 3GTMJ 2DU9A 2XIGA 3BR1A 2F48A 1C0WA 4A12A 4HSTA 4E7JA 2IGKA 3B02A 4FQGA 5C4JJ 4P9FA 3A0HC 3G1LA 2JT1A 2O5RA 3M8FA 1P4WA 1B4AA 4GO1A 3BROA 3E0JB 1JHHA 1XSDA 2WWYA 3IH3A 2R93J 1ETXA 3TO6A 1A04A 3FXUA 1B72B 4KITB 1AOYA 1E3HA 3ZMUA 5ILVA 4H0EA 2ACJA 3JR9A 3S14J 3KZYA 1YJ9I 5CVVA 3F22A 3K4NA 4A3MJ 2FJ1A 4BE2A 2Z99A 1Z9CA 2AHQA 3DBLB 1X58A 1KYZA 4EQQA 5F08A 4RB2C 4YEJA 2DCEA 2XSDC 4G8XA 5AONA 4B44A 1MNDA 1ORKA 3S32A 4DYRA 3BP8A 5LGNA 1LDJA 1XD7A 2VB6A 3FXQA 4R79A 1F4KA 4AD9A 1IN7A 2GXBA 1ZK8A 1PP7U 2HFHA 4UNOA 2RC4A 2ZMEA 5KCMA 3WTZA 2L3DA 4BQNA 5DM7F 2YU9J 3FKIJ 1ZYRF 4F93B 3ECOA 4PGHA 4MHGA 2ESHA 3QAHA 1J75A 3H5NA 1H0MA 4IQJA 5GPCA 3PIPF 3NWSA 4IHXA 4XKWA 1Y39A 1ONVA 1QQIA 1O4XA 1K83J 4D5FA 1BR4A 4MFDA 4IHWA 1V54H 3CCUI 3F8BA 3BJAA 2XC7A 2M8GX 2VASA 2PG4A 2R7OA 4ZC3A 4W97A 1G3TA 1QVTA 3RYRA 2ZSIB 5CYVA 1K6YA 2CQNA 1S3JA 4S0HB 2KKOA 3KYDB 5HVQC 2HYGD 3WODF 5J8FA 2R5YA 1ZRDA 4RGXA 1G3SA 1TW2A 1D1BA 2Z2SB 3I64A 4FE7A 3BDDA 4LG0B 2LY9A 2A6TA 2KIQA 4I02A 2VODA 4FETA 1ZQ3P 1IUFA 1F1ZA 2QZ8A 3DEWA 3GLLA 3I9V2 5D4RA 1T33A 4ABZA 3HOVJ 4MTDA 4BQQA 3G71I 1JJ6C 2LYCA 3IV5A 4DQ2A 3CF2A 4MLOA 2P7CB 1UFMA 1WJEA 1HQCA 2STTA 2X48A 2EIMH 2PN6A 2X6WA 2HR3A 2EFWA 1J2XA 4XRMA 2AXLA 2VC0A 2XHKA 5L3DA 4CZCA 3UKGA 1ITYA 2F5CA 1ZARA 4RM2A 2VBWA 1HDPA 1IRFA 1R5GA 3DLAA 3GZ6A 2DODA 2R7RA 4A2UA 5FKLA 1KQ9A 3FF5A 5CQGA 1X2NA 1YFHA 1PUFA 2HDWA 2YSRA 4LD5A 1K61A 1ETKA 3CC7I 4M3DA 3PQKA 3LSTA 4RLFA 1XMKA 4M72A 3ZCOA 1W0TA 1U8BA 2X51A 3L7WA 1DP7P 1D8KA 3LQQA 3ZGKA 3WU1B 2DA4A 3WTWC 3JRBA 3HTSB 1OISA 4LB6B 2RVCA 2M7BA 2Y0MA 3G2BA 4ZDPA 3CC4I 2KJCA 5M5WJ 1UG0A 3CO7C 1R71A 5JVGF 3OL4A 4IHYA 1IRZA 2EZHA 3L2QA 1R7JA 3ZMSA 2JA8J 3BOQA 4AYBN 2V1NA 2X0LA 1N78A 5GADJ 2Y9YA 2FOWA 1JJ8C 2CV1A 1MBGA 2BY3A 1L0OC 2EIKH 3ABLH 2WTEA 1Y6IA 4FE4A 2CRGA 2CW7A 5H20A 3RDIA 2DA5A 3OS2A 1REPC 4HPQA 1D5VA 2PJRB 1K7AA 4BBRJ 2EILH 1OCRH 4I98B 4IRHA 4KUMA 2KRCA 1J9IA 3K7AJ 1ZGJA 1QU3A 4EEFG 5HNHA 5J1UA 3EUHC 3FZVA 1KQ8A 3E6DA 2GXGA 3KEYA 1XMAA 2M4GA 2O61A 1BW5A 5FFXA 3DU6A 1RKWA 3WU2C 4OMZA 2DXIA 5DCMA 4ITVA 2F5EA 3DTIA 1FTTA 3KCCA 2R7QA 1RPWA 3FIWA 5HLHA 1YW7A 1IN5A 2WA0A 1YOVB 2CUEA 1IO2A 2QQAA 1JUPA 3VSLA 4A3CJ 2M2EA 3ZOBA 1TZLA 2N8GA 1FWZA 5FO5A 3CMAI 1U6GA 1FIPA 2UXXA 1Z7UA 4U88A 1ZH5A 2Y2ZA 1X3ZB 2PFBA 4HF2A 3RIRA 2PQ8A 6PAXA 1LFPA 3EUKL 3KP7A 2R92J 1VQMI 1HW5A 2YX4A 4A5NA 3RKWA 1JGGA 2V9KA 2KRHA 2JUGA 1SD4A 2LDUA 2YUSA 3ASNH 2L9SA 3GTJJ 1Q1VA 1BW6A 3BR3A 1JKOC 2XF7A 3SDBA 2ZB9A 1YLFA 1MH3A 3RCOA 2B9SA 1DGRM 5IOZA 1BR2A 3U1KA 4WK8F 4LJZF 2NS0A 4NQWB 3TKYA 2K9QA 2D1VA 2VIXA 2X4HA 2C6YA 3RQ4A 2HOEA 3CJNA 3VDXA 3SFIA 2XPVA 5LRRA 1Z3YA 1XGMA 2FX0A 2I8DA 3GF2A 2VOOA 1T98A 3DP7A 2DPDA 1YJNI 4EVIA 3DBRB 1BBYA 4MO7A 3JRIA 3A02A 4F92B 1XGNA 5IOYA 2XKOA 1HSTA 1Q1HA 2WV0A 2R5ZB 2WAQN 3GFIA 1G3WA 3PL8A 2LK2A 3TEDA 4MEXF 3MZYA 3OYJA 3MEXA 2YPRA 2NVYJ 2OUMA 2ZSHB 2VPLA 1Y8QB 4G9YA 4EGZA 4IJAA 3GX4X 5K7FA 4KISA 1N75A 3S1RJ 1J59A 5D8LB 1ZLKA 2EQRA 2IRFG 3HPHA 2VKDA 3R6SA 2OU2A 3TGNA 1U78A 1O3TA 1FYKA 1QGPA 1AKHA 3EUHA 3H3ZA 4L9JA 2QGUA 2JPCA 4G6TB 3OYBA 2JRMA 2ZJRF 2E5NA 3H0DA 1D0ZA 1YHQI 2JSPA 3ML6A 2ZFUA 3W2AA 1Z6RA 4Q5SF 2QENA 3HOSA 2P5KA 4BEHB 5K5OA 3JRCA 4J01A 1SD5A 2PX9A 3ASOH 2RNJA 4O6JA 4A5MA 2M1BA 1I3AA 1OPCA 2DQRA 3RKYA 4GYIA 2KL4A 1WI3A 4Y17A 3GTGJ 2XSJC 3KP6A 3PNTA 3NRVA 1X2MA 1X3UA 3LSKA 4U0YA 1HCRA 2GA1A 3M8EA 3SZPA 5L3BA 4DW6A 1JKRC 3OL3A 2GOXB 4MEYF 3BPVA 3W6VA 4PDKA 3ABMH 4MFEA 4HX4A 4AYBA 2V7FA 4IHTA 1QO0D 3HRSA 4XSZF 3I3LA 3QYBA 3GTKJ 4V2FA 3QOPA 2LBFA 4AC0A 1HKTA 4Q48A 4HOBA 5B66C 4PJNA 1XC5A 2M0CA 3F6OA 1W36D 2E2IJ 2OQRA 4ZYAA 2EV0A 5J40A 2KDZA 1MSEC 2VJ5A 3TOAA 3OYFA 2P0WA 4CZZA 1X19A 5M3MJ 2L0KA 3KLOA 3QQAA 3BPXA 3ISPA 1H8AC 3B73A 5IYDJ 3I59A 2ELJA 3MKLA 2M7AA 5AIQA 2HZDA 2XGEA 2KLOA 5KNLA 1D5YA 4RMNA 1VQ6I 3JAMZ 1XG1A 1PP8F 4DIQA 5IP6A 1MMDA 3UR3C 3OYMA 4BHBA 4DYQA 1Z3XA 2F4MB 2P6TA 1QRYA 5DEQA 3S3OA 2O7OA 3J7ZI 3HXLA 4LB5A 1RR7A 1UCRA 1UELB 2O9LA 4X1EA 5AIPA 4OINF 1GHCA 3V8KA 1Z91A 3M3YJ 3HGGA 3T0YA 3U21A 3QP6A 2HS5A 4XSXF 4BACA 1MBFA 1R1TA 3E5QA 5HOOA 4RB1A 2DTZA 2ZXHA 1TT5B 1MDMA 2QSGX 3BZ6A 5J1YA 1IZ1A 3F9KA 1NG6A 4KIBA 4KJZA 2E7WA 2G7UA 4Y15A 1ACIA 3EUAA 1DUXC 4M3FA 4V19K 1CF7A 3O8HA 3HGYA 4L0ZB 1LEBA 3RPQA 3KX2A 3OS1A 2HQNA 1NH3A 4OIOF 3N97A 3PM1A 3SEQA 2HQ5A 4AIDA 2OA4A 4LGWA 3G6EI 2KMUA 1MBEA 5K5RA 1L3LA 4UY8I 5A2QZ 1SVLA 3A0BC 3G73A 5CVIA 2VBXA 1LVAA 3COAC 2E34A 5D4SA 3MVPA 4Y13A 4CA0A 3DXJF 4E6KG 1K79A 2QQ8A 1DGWY 4IOCF 2MD0A 3B6AA 3DV8A 2X9DA 3OYLA 2IW5A 2B0LA 3GTPJ 1ON1A 2DT7B 4L9TA 2ZO4A 4F55A 3CZ6A 3H1CA 5H6QA 5GAEJ 5TRDA 3D0SA 2IS6A 3ZQGA 1MJ9A 2LH9A 5DUKA 3K4LA 3VPRA 3CDIA 3K10A 2H1LA 5DD4A 2WAQA 3EDPA 4BY1J 4NB5A 2OBPA 2FE3A 4DJAA 1S29A 4HLXA 5JHFA 4BXUA 2M45A 2GZWA 1YIJI 2JVGA 4CCNA 3IWFA 2F4OB 3RYPA 4GFBA 2RGVA 4XICA 2VUMJ 3RTRA 2J5OA 4BAYA 5JHUA 4WF2A 2JTVA 1JUMA 3GFLA 5FFZA 5HLGA 2VI6A 4TV7A 2FA5A 3JRHA 4WCGA 1XCVA 4KN4X 4IL6C 3V8JA 1GV2A 2E1NA 3PSIA 1B8IA 1PDNC 4CCOA 4CCMA 3S1NJ 2FNPA 1QPMA 5D5WB 3JW4A 1D0YA 2FU4A 3AL0C 4HNUA 5CJ9A 3D1NI 3BR6A 1W36C 1AWCA 4LLGF 5FB2A 3HPGA 3GZ5A 4YFKF 4DBQA 1Z77A 1XGSA 5HODA 1E0EA 2ADUA 1YE9A 2NNYA 5E3LA 4HBLA 4IQ4A 3L2CA 4HNVA 5BQTA 5L3FA 1ETWA 2OJED 4XRSA 3OOPA 2IGMA 4MQVA 4EMSA 2UZKA 2RDPA 2LLKA 2DOAA 5E1XA 2E2JJ 2VKVA 1SFXA 1SVMA 3CDLA 3OR2C 1SMYF 2EINH 2LOOA 1EA3A 1SFEA 2M34A 4MTEA 1ENHA 4CDGA 3O3KA 1IG7A 2W1OA 4F3QA 3QPHA 2AXTC 1NHAA 2PMUA 1M1EB 3BCAA 2DFEA 5FLMJ 4XR6A 1BOBA 1UMQA 2EH3A 2R7XA 1DPRA 1KGSA 2E19A 1WCMJ 1K78B 1KU7A 1JGSA 4QLCU 4CYCA 1DU6A 4ZYEA 5CVUA 3RKXA 4S04A 5D5VB 1IN8A 2NAZA 3CUQA 2P6SA 2R4GA 3H92A 2DI3A 4X0GA 1R1UA 3A1YA 3VYRB 4BJ6C 2EV5A 2DTRA 3PUFA 4QPQA 4HQEA 4HF1A 3MZ8A 4KFCA 4N9HA 4BUPA 4ETSA 3WG9A 4JK1X 2VBYA 2KIUA 3E5UA 4M71A 3TO7A 3HB9A 3WGGA 3BG9A 3F23A 5DUIA 1YRNA 1SMTA 1EH8A 3J81Z 3C2BA 1KU9A 2E1MC 2EBIA 3K1NA 2EZIA 2ZJ2A 1N25A 5E8GA 2R0QC 1IV6A 1WQ2A 1FT9A 3PSFA 3WHCA 3HOYJ 2YX7A 4HW0A 1E17A 3C2HA 1VI0A 3WG7H 2CV0A 3HIFA 4HLYA 4HV6A 4OU0A 4I6ZA 1GT0C 1WVRA 2HXOA 3HUGA 1FBUA 2ZMEC 3VODA 3OYAA 3GYHX 1R22A 1O7LA 3IKTA 1TNTA 2DA2A 1BI2A 1HKQA 3J7AO 4RB3C 1U9NA 3H36A 3I5UA 4ZYDA 4BJ5C 3CMMA 2LREA 1TP4A 3IRRA 1V5FA 3CD6I 5J3LA 2PEXA 4KNYA 5CPRB 2W7NA 3MKYB 3EYYA 1XDSA 1XB4A 2OC6A 1G6NA 3K1PA 4P9UA 2EA4A 3F8CA 1GXPA 2UV1A 5C4XJ 1UAAA 3OOUA 5J6XA 2L7FP 1UHSA 1U9OA 1TL8A 1ZLJA 1IF1A 1QVUA 3CCSI 3FM5A 3BCBA 1APLC 3TBIA 4U0VA 2MA3A 4PZJA 2GOMA 2MW8A 5GAGJ 2WAEA 2E1CA 5KK1A 2IXSA 3OYNA 1PUFB 3LQRA 1I39A 4GGGA 1RETA 3S8PA 2XAGA 3DBHB 4ZZDA 1LE8B 4WX9A 1YW9A 1Z05A 3H35A 5FLVA 3IL2A 1LDKB 3V7SA 4F7ZA 4Z6YA 2IT0A 2CQQA 5B3SH 2Y30A 3ABKH 3TDUC 4OWRB 4CUGA 1BC8C 3ELKA 5D6FA 2ZNYA 3U9GA 4DBRA 4C2UA 5IT9Z 2VN2A 4XLHA 4BDYA 2EJRA 3BZKA 1HKSA 1R1VA 2W57A 3DFGA 3ROUA 1S72I 4IOAF 3W3CA 2JA2A 5F0HA 4A3LJ 2EA2A 5FLXZ 3LSGA 5D5XB 1O3QA 2VOPA 1BIBA 1A36A 1R23A 1MMSA 2XB0X 2JN6A 1UB9A 1OCPA 1QBJA 4DYCA 4EM2A 2HPIA 1P4XA 2IA1A 3KYLA 3VSKA 1R49A 3O6BB 4XMYA 1RIOH 4RS8A 3HOZJ 3RSNA 1ZGAA 1FZPB 2D2WA 2XKPA 1SVOA 3FWEA 2BV6A 3A01A 2RNGA 3CCVI 1K4SA 1WJBA 3FMSA 5LD2C 2BW3A 3L9FA 1WPKA 4ENJA 3K6GA 4XIDA 2A6HF 3SJMA 5IPAA 5M5XJ 2HQRA 1P2FA 3I55I 2XAQA 1H88C 3HG9A 3OR1C 2GIVA 3CTAA 3IKVA 3L2RA 1FSEA 2DW4A 2EZKA 2OTLI 2P8TA 5DCFA 5EJCA 2OV7A 4FHTA 4QIWN 1S5LC 1O3RA 5F04A 1QHGA 2R7TA 4ESBA 4HF0A 4GRIA 1QZZA 2E1OA 3JREA 4U7BA 3PUBA 1GLNA 2Q2EB 3OMYA 1UG2A 3H9QA 4B3AA 3H0GJ 2QVOA 5FKNA 3JAMK 4HDVA 1VTNC 5HDKA 1MJAA 2QSHX 2AQEA 1Y0NA 3FHNA 4BQAA 1FOXA 4XN3A 3FK6A 4YFXF 2V6CA 4BDZA 1WJ5A 4LIVA 4OOIA 2K02A 3E6CC 3OYIA 4RGUA 4UVBA 1I1GA 5EEAA 1WJFA 5IY5H 2PJPA 2CUFA 2H1KA 4PJ0C 3E97A 3HRUA 3NQOA 1WWXA 4XRSG 3ZRGA 4XLEA 3AAFA 3VWBA 1YS7A 4GYGA 1W5CC 2BHZA 2E7XA 4JX5A 3OSGA 1A35A 4A0ZA 2BGCA 3W6JB 1S9HA 2DDBA 3S2WA 2VJJA 2GLOA 1FLIA 2LKPA 2RKHA 5EZHA 2K9LA 1TBXA 2BYVE 4E7SA 2X6XA 3TP0A 2XF6A 3CCYA 3SZTA 2CUZA 2V26A 3M8JA 3QRFF 1MH4A 1IDZA 2FUG2 5K5QA 1FX7A 4A69C 4UVCA 3TOBA 4LOCA 2GXAA 1T6SA 1V55H 3DCFA 1X4PA 3ZP5A 5EG0B 2M0MA 3DKXA 2QBYA 4M6YA 3W2VA 1OCOH 3LMMA 5CLSA 2YS9A 2P4WA 5L3GA 3TL4X 1OCCH 5A2QK 4NC7A 2FQ3A 3K2AA 5E8IA 3GFMA 2IJLA 1KU2A 1J0RA 2NVXJ 4DZPA 2VKEA 2F6CA 3RJPA 4ZH4F 2X1CA 1ZR4A 1PVEA 2E35A 1HOMA 4U7DA 4XKBA 2L7KA 3G4SI 4HX7A 1YO5C 1EJ9A 4B47A 3MFKA 1H9TA 4EATA 4KT6A 3OIOA 3ZQQA 2K4JA 3PNVA 1A31A 4HQMA 2HZTA 2X1EA 4RM3A 5EEGA 5KAIC 1SAXA 3D5SC 2ID3A 1XX5A 4XOTA 3HL2A 2XPUA 3KZZA 1EKEA 4AIKA 2L7ZA 1I6XA 4KICA 2CQKA 4IPAA 2V79A 5E18F 3JRGA 2JA5J 1U8RA 5D8KB 1ZRFA 1IN6A 2I5UA 5EZGA 5F1RA 4I7HA 4KT5C 4QPOA 2LKSA 3AFHA 3GTLJ 1MNEA 5JLWA 1D1CA 4FTHA 1J5YA 3D5LA 2UWMA 2KFDA 2O3FA 3DTKA 2W48A 1G8XA 2ZFWA 3Q0WA 5M3FJ 2G9WA 2MH9A 2JZYA 4O3MA 3GZNB 4FISA 2X1DA 2DYRH 3IAM2 5E1ZB 3JSOA 4X6AJ 2QF7A 1CQTA 1LNWA 2R7SA 3S2HJ 1TC3C 2VC1A 2K3FA 5GTHC 5TGTA 3JRAA 4D7MA 5HS8A 3ZQ7A 2A3SA 5DS9A 4M9XA 3SFZA 4EV0A 4Y33A 3CCLI 3DEEA 1F36A 3NWTA 3WTTC 2CQXA 4A3KJ 2CO5A 2IVMA 4JX4A 4LG0A 3D5RC 2IS1A 4XKVA 2CUJA 2EIJH 1G4DA 2BZTA 3FX3A 1TQPA 3CMEI 2MLGA 3L1PA 1CGPA 2DOFA 1QNTA 5HNFA 1OKRA 1VZ0A 3K70D 3L2VA 1WKMA 4A3EJ 1ZELA 4CCLA 2AS5F 3O8GA 4MGRA 5D6EA 4A3BJ 1TNSA 2DYSH 2JMWA 1UHMA 1I3QJ 3TP3A 3KE2A 1BM9A 4I09A 1Z6TA 3ULQB 3SQNA 3GWZA 5LBQA 2GIZA 1MNMC 2FQ4A 2ZC2A 4U0WA 2RQQA 2BOLA 3IH4A 5IYBJ 2LSOA 4M9ZA 2VQGA 1KZHA 3REOA 3BT9A 2JSCA 3HZJA 4AUXA 3BY6A 2UXNA 3OYKA 3KP2A 3K4MA 4RAZA 1PJRA 3CCMI 3J81K 3GO5A 1BJZA 3F8FA 1R58A 3VB2A 3TO9A 3SDGA 1IXCA 3SYTA 3UNGC 1QA6A 4UUSB 4BXXJ 5LGUA 1SC7A 4DGWB 4HA8A 5EF6A 3F6VA 4PCQA 3JRFA 2M5WA 1OCZH 1ZTRA 1IC8A 2VL8A 1GVJA 4A0XA 1OYWA 5LRSA 3BTJA 1DQUA 4PSXA 2VJ4A 2V1DA 5DYMA 3WTXC 1LUJB 4I0AA 4ASNA 3IP4B 2FOKA 2HQAA 3ERMA 3MKWB 3LA2A 3G3ZA 2FD5A 3A03A 4EJWA 2W85A 3HDDA 3WTUC 2ECBA 1WGXA 3OWTA 4HG2A 2IS4A 3Q3SA 3CMYA 2L4MA 1ULYA 4JQFA 3RPUA 2KQRA 1QZEA 4XBFA 1MMNA 4CICA 1U3EM 4JP0A 4NDLA 1BR1A 3LL7A 2EWNA 2JA7J 2BXYA 1D0XA 3VYSB 4F52A 1YITI 2DFHA 4P1WA 1D1AA 3HRMA 1DU0A 5C3EJ 4KYWA 2PJRA 1QHHD 2LTPA 3S1QJ 5J47A 2RQPA 1ZKGA 1VQ9I 2DFIA 2H6BA 4ZYGA 4BYYA 3IAS2 3PQJA 2WADA 1FMVA 2DMQA 1NK3P 4PSWA 4RAYA 1FPQA 1MIJA 2HXIA 2M4KA 3CJRB 4LLLA 5L3CA 1W4MA 2XUBA 4Q4ZF 3LFUA 3ZN1A 4BGDA 3M7GA 2O03A 4R1HA 3SHFA 3GBGA 5E1WA 4BJTA 3KP4A 2BVLA 1V4RA 4P96A 4Y3OA 4MIMA 3GFJA 1B9MA 1O7FA 2V1XA 4A3JJ 1WJCA 4II2A 4M9SA 2L9VA 4AIJA 2MSYA 4KIGA 3HOUJ 4PFOA 3IUOA 4HYEA 4PFPA 4RLQA 4XLCA 3MKZA 2A68F 2O8KA 2ZJPF 3HSFA 3RI4A 2W00A 1RNLA 1O57A 5CVRA 2MH2A 5JI6A 4KA4A 1XN7A 2GA2A 2VT2A 3A2KA 3CCQI 5FLXK 1BA5A 1UHWA 2VE9A 4C3JJ 3L2UA 4I76A 1TWHJ 2WBMA 3DWLE 5TISC 1NG7A 2IGNA 2JA6J 1WJDA 2BHYA 3K70C 2GBYA 3JTHA 3JTGA 2NOGA 3CCJI 2Z9OA 1EV7A 3PFYA 2QEXI 1T38A 1ODDA 1USSA 5LHIA 5DM6F 3DEUA 5FRMA 3FXKA 1X1PA 3OYHA 2WB1N 2R7WA 2Z5UA 1R6RA 4NQWA
chains in the Genus database with same CATH topology
2DT5A 3FMRA 4P5OA 1S6LA 4EJTA 4WXDA 3VOEA 5KVRA 2HKOA 1W7PB 2QQBA 1LEAA 4PGGA 4YG2F 3F3XA 2CW0F 4E70A 5ILSA 1TQMA 3CUQC 2QWWA 5TJJA 1YG2A 2IA0A 1IXSB 4CXFA 3MQ0A 3DPLC 3U1DA 5LEKA 4A0YA 1USTA 4HAMA 4LK1F 1RUOA 2HTSA 1Y0UA 3HOTA 2D1HA 1T0FA 1YTYA 1HBXG 3I53A 4UVAA 1IRGA 2CFXA 3I54A 2P5LC 4ESFA 1OR7A 2Q8KA 4EGYA 3NEUA 2XASA 5BMZA 4AVPA 1FC3A 2OZUA 4ENKA 1XGOA 4WXHA 3GW2A 2MLKA 2Y75A 1YYVA 4ENMA 4GXOA 3E6BA 1F9NA 3SXYA 1B9NA 1MJBA 1R5HA 5IT3A 2FXAA 2W84A 1U5TC 3Q5FA 3C7JA 2Z33A 3F8NA 4EJVA 1D8JA 1BI3A 5F64A 1P6RA 2KIFA 1S7OA 2OQGA 2Z3YA 3ZMTA 3K1MA 3FMQA 1P92A 5ILUA 2ZMEB 3K0LA 4ZZLA 2J5PA 1T2KA 1RZ4A 5DDGA 4G7OF 2JRTA 1SD6A 2HKXA 3FHZA 5E17F 1TTYA 2DLLA 2Y48A 1IN4A 2CSOA 4G7ZF 1FOKA 5BPIA 4JBAA 2FBIA 3WE2A 2Q0OA 3BWGA 4CO8A 1MKMA 2L01A 3HHGA 4L0YB 3FXRA 4RGSA 1BOAA 2EFQA 2XAHA 3KETA 3MWMA 4MNUA 2O0YA 2PBIA 5E20A 4ON0A 3I4PA 2D45A 4M73A 4CGZA 3EQLF 2H6CA 4P55A 2YU3A 2L4AA 5FD5A 1P4AA 2NNNA 2MD5A 2STWA 3C1DA 2FSWA 1BIAA 3LFKA 2O6GE 2DAOA 3KFWX 5H6RA 3ABUA 4G6QA 1U5TA 4EM1A 5JVTA 2G7HA 4Q47A 4M74A 3TDZC 1B1BA 3M9AA 5K1YA 2VT3A 1F5TA 4OMYA 5EEHA 1BC7C 4BHCA 2HWVA 1JE8A 2VXZA 3GVAA 4XLNF 2A69F 3BJ6A 4OIQF 2QUFA 1WI9A 2H94A 4I0BA 3KP5A 3EETA 3KEQA 2NYXA 4GCVA 4L5JA 2FBHA 2VONA 1D3YA 3O2PE 1TQIA 3FM3A 3P9IA 3V7RA 4IRGA 1KA8A 5LEJA 3ERED 2ISYA 3CLOA 4A6DA 1U2WA 1R36A 2MBFA 2P5VA 2L54A 2R7DA 5ICFA 3T8RA 1K78A 2F2EA 4O5VA 3WTSC 5CVJA 3J80Z 3I0TA 2F5DA 1MGTA 5DCMB 2VBZA 1YIOA 2OAZA 1XDUA 2CWEA 3K2ZA 2M8EA 4XRFA 3CDHA 2DQLA 2MC3A 2QM3A 4HZFA 1ZREA 1S7AA 1FNNA 2FBKA 1FP2A 1WRJA 4OIPF 2HGCA 2W24A 2ZNZA 2KJBA 3K9TA 2FF4A 3WTVC 1I1SA 2W25A 1OMIA 3IWZA 2DBBA 1SFUA 1I5ZA 2DPUA 2XRNA 3P9CA 5D5UB 1T39A 1RI7A 1HW1A 4RB0A 3P9KA 5LLQA 3HHHA 4BH9A 3I71A 2QLZA 3Q9SA 3CUOA 2F5FA 2A07F 3LA3A 4KMUX 3I58A 5HS9A 4UUVA 4I01A 2A5YB 2K27A 1STZA 4A6EA 5DV5A 1SD7A 5ED4A 1KYWA 3MZHA 1YW8A 5HDNA 3QU6A 2EFNA 4KN7X 2KRFA 3BJOA 3E3VA 2R3SA 3R0JA 2DK8A 1XSXA 3H3UA 2ZCWA 2OZ6A 1LB2A 3T1BA 1JHFA 2CGPA 2GAUA 1ZN2A 3HSEA 5FD6A 2V1UA 3CO6C 2DO7A 4OIRF 2ZKZA 3ZMVA 1PUEE 4UHTA 3L09A 3C3WA 1ZG3A 3I59B 4EM0B 1YS6A 2HTJA 5L3EA 4FT8A 5JFRA 4UXNA 3ECHA 2Q2EA 5LHGA 1OYIA 4BNCA 3T8TA 5ICGA 5LHHA 2OD5A 3KEOA 2GQQA 1MDMB 2LF7A 4XLPF 3LAJA 4G94A 2KIMA 3GXOA 1CF7B 3W6KB 5ICEA 2EK5A 4Z2YA 3V8LA 3KLNA 1BI1A 1W5SA 4K2EA 2YR2A 3TQNA 1LDDA 2V9VA 4HV5A 1HXDA 3DKWA 4EJUA 2EB7A 5HS7A 5HDGA 1J7KA 3T5XA 3PFIA 2CG4A 4KIFA 3WTYC 4B8XA 1EH6A 2ZBKA 3E6MA 1DDNA 1Z1DA 3IRQA 1GXQA 2ISZA 1FP1D 4IXAA 1K6OA 2M30A 2XROA 3DPTA 2A6EF 4HX8A 1S8NA 4FX0A 2DK5A 1G3YA 3LWFA 1EH7A 2FRHA 2PMHA 1LJ9A 1IAWA 4WWCA 4IHSA 2HDCA 4WXCA 3R0AA 4LFUA 2FMYA 5BS6A 1W7PD 4YFNF 2QYOA 2COMA 2BEOA 1I27A 3GUDA 3KP3A 1R00A 1E2XA 5FGMA 4KDPA 4L9VA 2P7VB 2L02A 2HYFA 1O3SA 1ZG5A 2K4BA 3DF8A 1FBQA 4YIFA 1OYYA 2NRAC 2A61A 2HEOA 2PI0A 5IT9K 2JPBA 1MD0A 1XSVA 3K69A 3HSRA 2EFOA 3L00A 3ZMZA 4BHPA 1FY7A 4LK0F 3CUQB 2XAJA 1KQ0A 4QWQA 3F21A 3IHUA 4KMFA 1ZAOA 4CYDA 1H9GA 3WGHA 3WU0A 1JXSA 3HRTA 4UV9A 4UV8A 1IUYA 1XCBA 1V3FA 3QP5A 1WSUA 1IW7F 2LF8A 3HTUA 3J80K 1KU3A 2PLYA 4DNCA 1BN5A 5DD8A 4S05A 4LMYA 4AIHA 2QQ9A 5F6FA 5BOXA 3IC7A 1B59A 4ZYHA 1FYLA 2TDXA 5ERIA 3ZMDA 1FYMA 2RV8A 1DPUA 3LAPA 2XGXA 4NHJA 1HSJA 2ETHA 3ZN0A 5LGTA 3DQVC 3GEZA 3LA7A 3Q9VA 2LNBA 2R7FA 1LQ1A 4L9NA 1FBSA 3VEPA 2XVCA 4FX4A 1U5TB 1HW2A 5BPDA 1ON2A 4N9IA 1MZBA 3N4MA 2FNAA 4R8HA 2ELHA 4IF4A 3VFZA 3GLXA 4B09A 4MQ9F 4YIIA 2IA2A 3MCZA 1ZG1A 2CYYA 4G6DA 2IP2A 3WGIA 2BE5F 2XAFA 3E5XA 3F8MA 4LLNA 4D0PA 2M87A 2XV4S 1BI0A 2O8XA 3HYIA 4L18B 4AWXB 1ZHFA 4IRIA 2FEZA 4ESJA 2H09A 5ICCA 4CHUA 5HLIA 1IXRC 3JSPA 1BJAA 1YQAA 1TW3A 3F72A 2H27A 3U2RA 2K7LA 1TLHB 4L5IA 1QZYA 3EYIA 5J8CA 4HDUA 3P7NA 1W7PA 5JR3A 1W5TA 3M1EA 2GWRA 2WC2A 2ESNA 2BBYA 4G7HF 1ZRCA 3ZPLA 3ABTA 4RGRA 2ZXJA 4IVNA 4EJOA 2IPQX 2EV6A 3V4GA 3OV8A 2EFPA 2FMLA 4ENNA 3MAJA 3V7CA 1B6AA 4M6XA 2K86A 1FSHA 4I2OA 3R61A 4N0BA 3WE3A 3R4KA 3C18A 3QU3A 2VE8A 2RN7A 3QPTA 2QBYB 3R60A 1RUNA 2DU9A 2XIGA 1C0WA 4A12A 3B02A 4P9FA 2JT1A 3M8FA 1P4WA 1B4AA 4GO1A 3BROA 1JHHA 1XSDA 2WWYA 3TO6A 1A04A 3FXUA 1AOYA 3ZMUA 5ILVA 4H0EA 2ACJA 3KZYA 5CVVA 3F22A 2Z99A 1Z9CA 1KYZA 4EQQA 4RB2C 4G8XA 5AONA 3BP8A 5LGNA 1LDJA 1XD7A 3FXQA 4R79A 1F4KA 4AD9A 1IN7A 2GXBA 1PP7U 2HFHA 4UNOA 2RC4A 2ZMEA 3WTZA 2L3DA 1ZYRF 3ECOA 4PGHA 4MHGA 2ESHA 3QAHA 1J75A 1H0MA 1ONVA 1QQIA 3F8BA 3BJAA 2PG4A 3RYRA 1G3TA 5CYVA 1S3JA 2KKOA 5J8FA 5HVQC 2HYGD 3WODF 1ZRDA 4RGXA 1G3SA 1TW2A 3I64A 3BDDA 4LG0B 4I02A 2VODA 1F1ZA 2QZ8A 5D4RA 4MTDA 4DQ2A 2P7CB 1UFMA 1HQCA 2STTA 2PN6A 2HR3A 2EFWA 1J2XA 2AXLA 2VC0A 2XHKA 5L3DA 2F5CA 1ZARA 2VBWA 1IRFA 1R5GA 3GZ6A 4A2UA 1KQ9A 3FF5A 1YFHA 2YSRA 4LD5A 3PQKA 3LSTA 1XMKA 4M72A 1DP7P 3L7WA 1D8KA 3LQQA 3WU1B 3WTWC 3HTSB 4LB6B 2RVCA 2Y0MA 2KJCA 3CO7C 1R7JA 3ZMSA 3BOQA 2X0LA 1L0OC 2WTEA 5H20A 3RDIA 1REPC 1D5VA 1K7AA 4I98B 4IRHA 4KUMA 1J9IA 1ZGJA 3FZVA 1KQ8A 3E6DA 2GXGA 1XMAA 2O61A 5FFXA 4OMZA 5DCMA 2F5EA 3KCCA 5HLHA 1YW7A 1IN5A 2QQAA 1FWZA 5FO5A 1U6GA 2UXXA 1Z7UA 4U88A 1ZH5A 2PFBA 4HF2A 3RIRA 2PQ8A 6PAXA 3KP7A 1HW5A 2YX4A 4A5NA 3RKWA 1SD4A 2LDUA 1YLFA 4WK8F 4LJZF 2NS0A 3TKYA 2D1VA 2X4HA 2C6YA 2HOEA 3CJNA 5LRRA 1XGMA 3GF2A 2VOOA 1T98A 3DP7A 2DPDA 4EVIA 1BBYA 1XGNA 2XKOA 1HSTA 1Q1HA 2WV0A 3GFIA 1G3WA 4MEXF 3MZYA 3MEXA 2YPRA 4G9YA 4EGZA 4IJAA 3GX4X 1J59A 1ZLKA 5D8LB 2IRFG 3R6SA 2OU2A 3TGNA 1U78A 1O3TA 1FYKA 1QGPA 3EUHA 3H3ZA 4L9JA 2JPCA 3ML6A 1Z6RA 4Q5SF 2QENA 3HOSA 2P5KA 5K5OA 1SD5A 2RNJA 4O6JA 4A5MA 2M1BA 1OPCA 2DQRA 3RKYA 4GYIA 4Y17A 3KP6A 3NRVA 1X3UA 4U0YA 2GA1A 3M8EA 3SZPA 5L3BA 4MEYF 3BPVA 4PDKA 4HX4A 4IHTA 1QO0D 3HRSA 4XSZF 3QOPA 1HKTA 4Q48A 4HOBA 3F6OA 2OQRA 2EV0A 3TOAA 4CZZA 3KLOA 3BPXA 3ISPA 3B73A 3I59A 5AIQA 3JAMZ 1PP8F 4BHBA 5DEQA 2P6TA 4LB5A 1UCRA 5AIPA 4OINF 1GHCA 3V8KA 1Z91A 3T0YA 3QP6A 2HS5A 4XSXF 1R1TA 5HOOA 3E5QA 4RB1A 1MDMA 3BZ6A 1IZ1A 4KIBA 2E7WA 2G7UA 4Y15A 1DUXC 1CF7A 4L0ZB 1LEBA 3RPQA 2HQNA 4OIOF 3N97A 2OA4A 4LGWA 5K5RA 1L3LA 5A2QZ 3G73A 5CVIA 2VBXA 1LVAA 3COAC 5D4SA 4Y13A 3DXJF 1K79A 3DV8A 2IW5A 2B0LA 1ON1A 4L9TA 2ZO4A 5H6QA 5TRDA 3D0SA 1MJ9A 5DUKA 5DD4A 3EDPA 4NB5A 2OBPA 2FE3A 1S29A 4HLXA 4BXUA 2M45A 2GZWA 3IWFA 3RYPA 2RGVA 3RTRA 2J5OA 4BAYA 5JHUA 4WF2A 2JTVA 5FFZA 3GFLA 5HLGA 4TV7A 2FA5A 4WCGA 1XCVA 4KN4X 3V8JA 2E1NA 1PDNC 2FNPA 1QPMA 5D5WB 3JW4A 2FU4A 5CJ9A 1AWCA 4LLGF 5FB2A 3GZ5A 4YFKF 1XGSA 2ADUA 2NNYA 4HBLA 3L2CA 5BQTA 5L3FA 3OOPA 4MQVA 4EMSA 2UZKA 2RDPA 5E1XA 1SFXA 1SMYF 1SFEA 4MTEA 4CDGA 3O3KA 3QPHA 1NHAA 2PMUA 1DPRA 1KGSA 1K78B 1KU7A 1JGSA 4QLCU 4ZYEA 4S04A 5CVUA 3RKXA 5D5VB 1IN8A 2NAZA 3CUQA 2P6SA 3H92A 2DI3A 1R1UA 2EV5A 2DTRA 4HQEA 4HF1A 4KFCA 4N9HA 4ETSA 3WG9A 4JK1X 3WGGA 3F23A 2VBYA 2KIUA 3E5UA 4M71A 3TO7A 5DUIA 1SMTA 1EH8A 3J81Z 1KU9A 3K1NA 2ZJ2A 5E8GA 1FT9A 1WQ2A 1E17A 2YX7A 4HW0A 3HIFA 4HLYA 4HV6A 4OU0A 3HUGA 1FBUA 3VODA 3GYHX 1R22A 1O7LA 3IKTA 1TNTA 1BI2A 1HKQA 3J7AO 4RB3C 3I5UA 4ZYDA 3IRRA 2PEXA 4KNYA 3EYYA 1XDSA 1XB4A 1G6NA 3K1PA 4P9UA 2EA4A 3F8CA 1GXPA 5J6XA 1ZLJA 1IF1A 3FM5A 4U0VA 2MA3A 4PZJA 2E1CA 5KK1A 3LQRA 4GGGA 2XAGA 4ZZDA 4WX9A 1YW9A 1Z05A 3IL2A 1LDKB 3V7SA 4F7ZA 2IT0A 3TDUC 1BC8C 3ELKA 5D6FA 2ZNYA 3U9GA 5IT9Z 2VN2A 2EJRA 1HKSA 1R1VA 2W57A 3DFGA 3ROUA 2EA2A 5FLXZ 5D5XB 1O3QA 2VOPA 1BIBA 1R23A 1UB9A 1QBJA 4EM2A 1P4XA 2IA1A 3O6BB 1RIOH 4RS8A 1ZGAA 1FZPB 2D2WA 2XKPA 3FWEA 2BV6A 3FMSA 3L9FA 4ENJA 2A6HF 2HQRA 1P2FA 2XAQA 2GIVA 3CTAA 3IKVA 1FSEA 2DW4A 2P8TA 5DCFA 4FHTA 1O3RA 4ESBA 4HF0A 1QZZA 4U7BA 2QVOA 3JAMK 4HDVA 1VTNC 5HDKA 1MJAA 4BQAA 4YFXF 2V6CA 4OOIA 2K02A 3E6CC 4RGUA 4UVBA 1I1GA 2PJPA 3E97A 3HRUA 3NQOA 1WWXA 3AAFA 1YS7A 4GYGA 2E7XA 4A0ZA 2BGCA 3W6JB 1FLIA 3S2WA 2LKPA 2RKHA 1TBXA 2BYVE 3SZTA 3QRFF 5K5QA 1FX7A 4UVCA 3TOBA 1T6SA 3ZP5A 2QBYA 4M6YA 5CLSA 2P4WA 5L3GA 5A2QK 2FQ3A 5E8IA 3GFMA 2IJLA 1KU2A 1J0RA 3RJPA 4ZH4F 4U7DA 4HX7A 1YO5C 3MFKA 1H9TA 2K4JA 4HQMA 2HZTA 5EEGA 1SAXA 3KZZA 4AIKA 1I6XA 4KICA 2CQKA 4IPAA 2V79A 5E18F 1U8RA 5D8KB 1ZRFA 1IN6A 5F1RA 4I7HA 4KT5C 1J5YA 3D5LA 2UWMA 2O3FA 2ZFWA 2G9WA 2MH9A 2JZYA 4O3MA 5E1ZB 3JSOA 1LNWA 2VC1A 5HS8A 3ZQ7A 2A3SA 4M9XA 3SFZA 4EV0A 3WTTC 2CO5A 2IVMA 4LG0A 1G4DA 3FX3A 1TQPA 2MLGA 1CGPA 1QNTA 1OKRA 1WKMA 2AS5F 4MGRA 5D6EA 1TNSA 1UHMA 3KE2A 1BM9A 4I09A 1Z6TA 3ULQB 3SQNA 3GWZA 5LBQA 4U0WA 2LSOA 4M9ZA 3REOA 2JSCA 3BY6A 2UXNA 3KP2A 4RAZA 3J81K 3GO5A 3F8FA 1R58A 3VB2A 3TO9A 1IXCA 5LGUA 4HA8A 3F6VA 4PCQA 2M5WA 1GVJA 4A0XA 1OYWA 5LRSA 2V1DA 5DYMA 3WTXC 4I0AA 4ASNA 2FOKA 3LA2A 3G3ZA 4EJWA 2W85A 3WTUC 2L4MA 1ULYA 4JQFA 3RPUA 4XBFA 4CICA 1U3EM 2EWNA 3HRMA 4KYWA 2RQPA 2DFIA 2H6BA 4ZYGA 4BYYA 3PQJA 4RAYA 1FPQA 4LLLA 5L3CA 1W4MA 2XUBA 4Q4ZF 3ZN1A 3M7GA 2O03A 4R1HA 3SHFA 5E1WA 3KP4A 1V4RA 4P96A 3GFJA 1B9MA 1O7FA 2V1XA 4M9SA 4AIJA 4KIGA 4HYEA 2A68F 3HSFA 3RI4A 1RNLA 1O57A 5CVRA 2MH2A 5JI6A 4KA4A 1XN7A 2GA2A 2VT2A 5FLXK 1UHWA 2VE9A 3JTHA 3JTGA 2Z9OA 1EV7A 1T38A 1ODDA 1USSA 5LHIA 3DEUA 2Z5UA 4NQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT5 A;  3FMR A;  4P5O A;  1S6L A;  4EJT A;  4WXD A;  3VOE A;  5KVR A;  2HKO A;  1W7P B;  2QQB A;  1LEA A;  4PGG A;  4YG2 F;  3F3X A;  2CW0 F;  4E70 A;  5ILS A;  1TQM A;  3CUQ C;  2QWW A;  5TJJ A;  1YG2 A;  2IA0 A;  1IXS B;  4CXF A;  3MQ0 A;  3DPL C;  3U1D A;  5LEK A;  4A0Y A;  1UST A;  4HAM A;  4LK1 F;  1RUO A;  2HTS A;  1Y0U A;  3HOT A;  2D1H A;  1T0F A;  1YTY A;  1HBX G;  3I53 A;  4UVA A;  1IRG A;  2CFX A;  3I54 A;  2P5L C;  4ESF A;  1OR7 A;  2Q8K A;  4EGY A;  3NEU A;  2XAS A;  5BMZ A;  4AVP A;  1FC3 A;  2OZU A;  4ENK A;  1XGO A;  4WXH A;  3GW2 A;  2MLK A;  2Y75 A;  1YYV A;  4ENM A;  4GXO A;  3E6B A;  1F9N A;  3SXY A;  1B9N A;  1MJB A;  1R5H A;  5IT3 A;  2FXA A;  2W84 A;  1U5T C;  3Q5F A;  3C7J A;  2Z33 A;  3F8N A;  4EJV A;  1D8J A;  1BI3 A;  5F64 A;  1P6R A;  2KIF A;  1S7O A;  2OQG A;  2Z3Y A;  3ZMT A;  3K1M A;  3FMQ A;  1P92 A;  5ILU A;  2ZME B;  3K0L A;  4ZZL A;  2J5P A;  1T2K A;  1RZ4 A;  5DDG A;  4G7O F;  2JRT A;  1SD6 A;  2HKX A;  3FHZ A;  5E17 F;  1TTY A;  2DLL A;  2Y48 A;  1IN4 A;  2CSO A;  4G7Z F;  1FOK A;  5BPI A;  4JBA A;  2FBI A;  3WE2 A;  2Q0O A;  3BWG A;  4CO8 A;  1MKM A;  2L01 A;  3HHG A;  4L0Y B;  3FXR A;  4RGS A;  1BOA A;  2EFQ A;  2XAH A;  3KET A;  3MWM A;  4MNU A;  2O0Y A;  2PBI A;  5E20 A;  4ON0 A;  3I4P A;  2D45 A;  4M73 A;  4CGZ A;  3EQL F;  2H6C A;  4P55 A;  2YU3 A;  2L4A A;  5FD5 A;  1P4A A;  2NNN A;  2MD5 A;  2STW A;  3C1D A;  2FSW A;  1BIA A;  3LFK A;  2O6G E;  2DAO A;  3KFW X;  5H6R A;  3ABU A;  4G6Q A;  1U5T A;  4EM1 A;  5JVT A;  2G7H A;  4Q47 A;  4M74 A;  3TDZ C;  1B1B A;  3M9A A;  5K1Y A;  2VT3 A;  1F5T A;  4OMY A;  5EEH A;  1BC7 C;  4BHC A;  2HWV A;  1JE8 A;  2VXZ A;  3GVA A;  4XLN F;  2A69 F;  3BJ6 A;  4OIQ F;  2QUF A;  1WI9 A;  2H94 A;  4I0B A;  3KP5 A;  3EET A;  3KEQ A;  2NYX A;  4GCV A;  4L5J A;  2FBH A;  2VON A;  1D3Y A;  3O2P E;  1TQI A;  3FM3 A;  3P9I A;  3V7R A;  4IRG A;  1KA8 A;  5LEJ A;  3ERE D;  2ISY A;  3CLO A;  4A6D A;  1U2W A;  1R36 A;  2MBF A;  2P5V A;  2L54 A;  2R7D A;  5ICF A;  3T8R A;  1K78 A;  2F2E A;  4O5V A;  3WTS C;  5CVJ A;  3J80 Z;  3I0T A;  2F5D A;  1MGT A;  5DCM B;  2VBZ A;  1YIO A;  2OAZ A;  1XDU A;  2CWE A;  3K2Z A;  2M8E A;  4XRF A;  3CDH A;  2DQL A;  2MC3 A;  2QM3 A;  4HZF A;  1ZRE A;  1S7A A;  1FNN A;  2FBK A;  1FP2 A;  1WRJ A;  4OIP F;  2HGC A;  2W24 A;  2ZNZ A;  2KJB A;  3K9T A;  2FF4 A;  3WTV C;  1I1S A;  2W25 A;  1OMI A;  3IWZ A;  2DBB A;  1SFU A;  1I5Z A;  2DPU A;  2XRN A;  3P9C A;  5D5U B;  1T39 A;  1RI7 A;  1HW1 A;  4RB0 A;  3P9K A;  5LLQ A;  3HHH A;  4BH9 A;  3I71 A;  2QLZ A;  3Q9S A;  3CUO A;  2F5F A;  2A07 F;  3LA3 A;  4KMU X;  3I58 A;  5HS9 A;  4UUV A;  4I01 A;  2A5Y B;  2K27 A;  1STZ A;  4A6E A;  5DV5 A;  1SD7 A;  5ED4 A;  1KYW A;  3MZH A;  1YW8 A;  5HDN A;  3QU6 A;  2EFN A;  4KN7 X;  2KRF A;  3BJO A;  3E3V A;  2R3S A;  3R0J A;  2DK8 A;  1XSX A;  3H3U A;  2ZCW A;  2OZ6 A;  1LB2 A;  3T1B A;  1JHF A;  2CGP A;  2GAU A;  1ZN2 A;  3HSE A;  5FD6 A;  2V1U A;  3CO6 C;  2DO7 A;  4OIR F;  2ZKZ A;  3ZMV A;  1PUE E;  4UHT A;  3L09 A;  3C3W A;  1ZG3 A;  3I59 B;  4EM0 B;  1YS6 A;  2HTJ A;  5L3E A;  4FT8 A;  5JFR A;  4UXN A;  3ECH A;  2Q2E A;  5LHG A;  1OYI A;  4BNC A;  3T8T A;  5ICG A;  5LHH A;  2OD5 A;  3KEO A;  2GQQ A;  1MDM B;  2LF7 A;  4XLP F;  3LAJ A;  4G94 A;  2KIM A;  3GXO A;  1CF7 B;  3W6K B;  5ICE A;  2EK5 A;  4Z2Y A;  3V8L A;  3KLN A;  1BI1 A;  1W5S A;  4K2E A;  2YR2 A;  3TQN A;  1LDD A;  2V9V A;  4HV5 A;  1HXD A;  3DKW A;  4EJU A;  2EB7 A;  5HS7 A;  5HDG A;  1J7K A;  3T5X A;  3PFI A;  2CG4 A;  4KIF A;  3WTY C;  4B8X A;  1EH6 A;  2ZBK A;  3E6M A;  1DDN A;  1Z1D A;  3IRQ A;  1GXQ A;  2ISZ A;  1FP1 D;  4IXA A;  1K6O A;  2M30 A;  2XRO A;  3DPT A;  2A6E F;  4HX8 A;  1S8N A;  4FX0 A;  2DK5 A;  1G3Y A;  3LWF A;  1EH7 A;  2FRH A;  2PMH A;  1LJ9 A;  1IAW A;  4WWC A;  4IHS A;  2HDC A;  4WXC A;  3R0A A;  4LFU A;  2FMY A;  5BS6 A;  1W7P D;  4YFN F;  2QYO A;  2COM A;  2BEO A;  1I27 A;  3GUD A;  3KP3 A;  1R00 A;  1E2X A;  5FGM A;  4KDP A;  4L9V A;  2P7V B;  2L02 A;  2HYF A;  1O3S A;  1ZG5 A;  2K4B A;  3DF8 A;  1FBQ A;  4YIF A;  1OYY A;  2NRA C;  2A61 A;  2HEO A;  2PI0 A;  5IT9 K;  2JPB A;  1MD0 A;  1XSV A;  3K69 A;  3HSR A;  2EFO A;  3L00 A;  3ZMZ A;  4BHP A;  1FY7 A;  4LK0 F;  3CUQ B;  2XAJ A;  1KQ0 A;  4QWQ A;  3F21 A;  3IHU A;  4KMF A;  1ZAO A;  4CYD A;  1H9G A;  3WGH A;  3WU0 A;  1JXS A;  3HRT A;  4UV9 A;  4UV8 A;  1IUY A;  1XCB A;  1V3F A;  3QP5 A;  1WSU A;  1IW7 F;  2LF8 A;  3HTU A;  3J80 K;  1KU3 A;  2PLY A;  4DNC A;  1BN5 A;  5DD8 A;  4S05 A;  4LMY A;  4AIH A;  2QQ9 A;  5F6F A;  5BOX A;  3IC7 A;  1B59 A;  4ZYH A;  1FYL A;  2TDX A;  5ERI A;  3ZMD A;  1FYM A;  2RV8 A;  1DPU A;  3LAP A;  2XGX A;  4NHJ A;  1HSJ A;  2ETH A;  3ZN0 A;  5LGT A;  3DQV C;  3GEZ A;  3LA7 A;  3Q9V A;  2LNB A;  2R7F A;  1LQ1 A;  4L9N A;  1FBS A;  3VEP A;  2XVC A;  4FX4 A;  1U5T B;  1HW2 A;  5BPD A;  1ON2 A;  4N9I A;  1MZB A;  3N4M A;  2FNA A;  4R8H A;  2ELH A;  4IF4 A;  3VFZ A;  3GLX A;  4B09 A;  4MQ9 F;  4YII A;  2IA2 A;  3MCZ A;  1ZG1 A;  2CYY A;  4G6D A;  2IP2 A;  3WGI A;  2BE5 F;  2XAF A;  3E5X A;  3F8M A;  4LLN A;  4D0P A;  2M87 A;  2XV4 S;  1BI0 A;  2O8X A;  3HYI A;  4L18 B;  4AWX B;  1ZHF A;  4IRI A;  2FEZ A;  4ESJ A;  2H09 A;  5ICC A;  4CHU A;  5HLI A;  1IXR C;  3JSP A;  1BJA A;  1YQA A;  1TW3 A;  3F72 A;  2H27 A;  3U2R A;  2K7L A;  1TLH B;  4L5I A;  1QZY A;  3EYI A;  5J8C A;  4HDU A;  3P7N A;  1W7P A;  5JR3 A;  1W5T A;  3M1E A;  2GWR A;  2WC2 A;  2ESN A;  2BBY A;  4G7H F;  1ZRC A;  3ZPL A;  3ABT A;  4RGR A;  2ZXJ A;  4IVN A;  4EJO A;  2IPQ X;  2EV6 A;  3V4G A;  3OV8 A;  2EFP A;  2FML A;  4ENN A;  3MAJ A;  3V7C A;  1B6A A;  4M6X A;  2K86 A;  1FSH A;  4I2O A;  3R61 A;  4N0B A;  3WE3 A;  3R4K A;  3C18 A;  3QU3 A;  2VE8 A;  2RN7 A;  3QPT A;  2QBY B;  3R60 A;  1RUN A;  2DU9 A;  2XIG A;  1C0W A;  4A12 A;  3B02 A;  4P9F A;  2JT1 A;  3M8F A;  1P4W A;  1B4A A;  4GO1 A;  3BRO A;  1JHH A;  1XSD A;  2WWY A;  3TO6 A;  1A04 A;  3FXU A;  1AOY A;  3ZMU A;  5ILV A;  4H0E A;  2ACJ A;  3KZY A;  5CVV A;  3F22 A;  2Z99 A;  1Z9C A;  1KYZ A;  4EQQ A;  4RB2 C;  4G8X A;  5AON A;  3BP8 A;  5LGN A;  1LDJ A;  1XD7 A;  3FXQ A;  4R79 A;  1F4K A;  4AD9 A;  1IN7 A;  2GXB A;  1PP7 U;  2HFH A;  4UNO A;  2RC4 A;  2ZME A;  3WTZ A;  2L3D A;  1ZYR F;  3ECO A;  4PGH A;  4MHG A;  2ESH A;  3QAH A;  1J75 A;  1H0M A;  1ONV A;  1QQI A;  3F8B A;  3BJA A;  2PG4 A;  3RYR A;  1G3T A;  5CYV A;  1S3J A;  2KKO A;  5J8F A;  5HVQ C;  2HYG D;  3WOD F;  1ZRD A;  4RGX A;  1G3S A;  1TW2 A;  3I64 A;  3BDD A;  4LG0 B;  4I02 A;  2VOD A;  1F1Z A;  2QZ8 A;  5D4R A;  4MTD A;  4DQ2 A;  2P7C B;  1UFM A;  1HQC A;  2STT A;  2PN6 A;  2HR3 A;  2EFW A;  1J2X A;  2AXL A;  2VC0 A;  2XHK A;  5L3D A;  2F5C A;  1ZAR A;  2VBW A;  1IRF A;  1R5G A;  3GZ6 A;  4A2U A;  1KQ9 A;  3FF5 A;  1YFH A;  2YSR A;  4LD5 A;  3PQK A;  3LST A;  1XMK A;  4M72 A;  1DP7 P;  3L7W A;  1D8K A;  3LQQ A;  3WU1 B;  3WTW C;  3HTS B;  4LB6 B;  2RVC A;  2Y0M A;  2KJC A;  3CO7 C;  1R7J A;  3ZMS A;  3BOQ A;  2X0L A;  1L0O C;  2WTE A;  5H20 A;  3RDI A;  1REP C;  1D5V A;  1K7A A;  4I98 B;  4IRH A;  4KUM A;  1J9I A;  1ZGJ A;  3FZV A;  1KQ8 A;  3E6D A;  2GXG A;  1XMA A;  2O61 A;  5FFX A;  4OMZ A;  5DCM A;  2F5E A;  3KCC A;  5HLH A;  1YW7 A;  1IN5 A;  2QQA A;  1FWZ A;  5FO5 A;  1U6G A;  2UXX A;  1Z7U A;  4U88 A;  1ZH5 A;  2PFB A;  4HF2 A;  3RIR A;  2PQ8 A;  6PAX A;  3KP7 A;  1HW5 A;  2YX4 A;  4A5N A;  3RKW A;  1SD4 A;  2LDU A;  1YLF A;  4WK8 F;  4LJZ F;  2NS0 A;  3TKY A;  2D1V A;  2X4H A;  2C6Y A;  2HOE A;  3CJN A;  5LRR A;  1XGM A;  3GF2 A;  2VOO A;  1T98 A;  3DP7 A;  2DPD A;  4EVI A;  1BBY A;  1XGN A;  2XKO A;  1HST A;  1Q1H A;  2WV0 A;  3GFI A;  1G3W A;  4MEX F;  3MZY A;  3MEX A;  2YPR A;  4G9Y A;  4EGZ A;  4IJA A;  3GX4 X;  1J59 A;  1ZLK A;  5D8L B;  2IRF G;  3R6S A;  2OU2 A;  3TGN A;  1U78 A;  1O3T A;  1FYK A;  1QGP A;  3EUH A;  3H3Z A;  4L9J A;  2JPC A;  3ML6 A;  1Z6R A;  4Q5S F;  2QEN A;  3HOS A;  2P5K A;  5K5O A;  1SD5 A;  2RNJ A;  4O6J A;  4A5M A;  2M1B A;  1OPC A;  2DQR A;  3RKY A;  4GYI A;  4Y17 A;  3KP6 A;  3NRV A;  1X3U A;  4U0Y A;  2GA1 A;  3M8E A;  3SZP A;  5L3B A;  4MEY F;  3BPV A;  4PDK A;  4HX4 A;  4IHT A;  1QO0 D;  3HRS A;  4XSZ F;  3QOP A;  1HKT A;  4Q48 A;  4HOB A;  3F6O A;  2OQR A;  2EV0 A;  3TOA A;  4CZZ A;  3KLO A;  3BPX A;  3ISP A;  3B73 A;  3I59 A;  5AIQ A;  3JAM Z;  1PP8 F;  4BHB A;  5DEQ A;  2P6T A;  4LB5 A;  1UCR A;  5AIP A;  4OIN F;  1GHC A;  3V8K A;  1Z91 A;  3T0Y A;  3QP6 A;  2HS5 A;  4XSX F;  1R1T A;  5HOO A;  3E5Q A;  4RB1 A;  1MDM A;  3BZ6 A;  1IZ1 A;  4KIB A;  2E7W A;  2G7U A;  4Y15 A;  1DUX C;  1CF7 A;  4L0Z B;  1LEB A;  3RPQ A;  2HQN A;  4OIO F;  3N97 A;  2OA4 A;  4LGW A;  5K5R A;  1L3L A;  5A2Q Z;  3G73 A;  5CVI A;  2VBX A;  1LVA A;  3COA C;  5D4S A;  4Y13 A;  3DXJ F;  1K79 A;  3DV8 A;  2IW5 A;  2B0L A;  1ON1 A;  4L9T A;  2ZO4 A;  5H6Q A;  5TRD A;  3D0S A;  1MJ9 A;  5DUK A;  5DD4 A;  3EDP A;  4NB5 A;  2OBP A;  2FE3 A;  1S29 A;  4HLX A;  4BXU A;  2M45 A;  2GZW A;  3IWF A;  3RYP A;  2RGV A;  3RTR A;  2J5O A;  4BAY A;  5JHU A;  4WF2 A;  2JTV A;  5FFZ A;  3GFL A;  5HLG A;  4TV7 A;  2FA5 A;  4WCG A;  1XCV A;  4KN4 X;  3V8J A;  2E1N A;  1PDN C;  2FNP A;  1QPM A;  5D5W B;  3JW4 A;  2FU4 A;  5CJ9 A;  1AWC A;  4LLG F;  5FB2 A;  3GZ5 A;  4YFK F;  1XGS A;  2ADU A;  2NNY A;  4HBL A;  3L2C A;  5BQT A;  5L3F A;  3OOP A;  4MQV A;  4EMS A;  2UZK A;  2RDP A;  5E1X A;  1SFX A;  1SMY F;  1SFE A;  4MTE A;  4CDG A;  3O3K A;  3QPH A;  1NHA A;  2PMU A;  1DPR A;  1KGS A;  1K78 B;  1KU7 A;  1JGS A;  4QLC U;  4ZYE A;  4S04 A;  5CVU A;  3RKX A;  5D5V B;  1IN8 A;  2NAZ A;  3CUQ A;  2P6S A;  3H92 A;  2DI3 A;  1R1U A;  2EV5 A;  2DTR A;  4HQE A;  4HF1 A;  4KFC A;  4N9H A;  4ETS A;  3WG9 A;  4JK1 X;  3WGG A;  3F23 A;  2VBY A;  2KIU A;  3E5U A;  4M71 A;  3TO7 A;  5DUI A;  1SMT A;  1EH8 A;  3J81 Z;  1KU9 A;  3K1N A;  2ZJ2 A;  5E8G A;  1FT9 A;  1WQ2 A;  1E17 A;  2YX7 A;  4HW0 A;  3HIF A;  4HLY A;  4HV6 A;  4OU0 A;  3HUG A;  1FBU A;  3VOD A;  3GYH X;  1R22 A;  1O7L A;  3IKT A;  1TNT A;  1BI2 A;  1HKQ A;  3J7A O;  4RB3 C;  3I5U A;  4ZYD A;  3IRR A;  2PEX A;  4KNY A;  3EYY A;  1XDS A;  1XB4 A;  1G6N A;  3K1P A;  4P9U A;  2EA4 A;  3F8C A;  1GXP A;  5J6X A;  1ZLJ A;  1IF1 A;  3FM5 A;  4U0V A;  2MA3 A;  4PZJ A;  2E1C A;  5KK1 A;  3LQR A;  4GGG A;  2XAG A;  4ZZD A;  4WX9 A;  1YW9 A;  1Z05 A;  3IL2 A;  1LDK B;  3V7S A;  4F7Z A;  2IT0 A;  3TDU C;  1BC8 C;  3ELK A;  5D6F A;  2ZNY A;  3U9G A;  5IT9 Z;  2VN2 A;  2EJR A;  1HKS A;  1R1V A;  2W57 A;  3DFG A;  3ROU A;  2EA2 A;  5FLX Z;  5D5X B;  1O3Q A;  2VOP A;  1BIB A;  1R23 A;  1UB9 A;  1QBJ A;  4EM2 A;  1P4X A;  2IA1 A;  3O6B B;  1RIO H;  4RS8 A;  1ZGA A;  1FZP B;  2D2W A;  2XKP A;  3FWE A;  2BV6 A;  3FMS A;  3L9F A;  4ENJ A;  2A6H F;  2HQR A;  1P2F A;  2XAQ A;  2GIV A;  3CTA A;  3IKV A;  1FSE A;  2DW4 A;  2P8T A;  5DCF A;  4FHT A;  1O3R A;  4ESB A;  4HF0 A;  1QZZ A;  4U7B A;  2QVO A;  3JAM K;  4HDV A;  1VTN C;  5HDK A;  1MJA A;  4BQA A;  4YFX F;  2V6C A;  4OOI A;  2K02 A;  3E6C C;  4RGU A;  4UVB A;  1I1G A;  2PJP A;  3E97 A;  3HRU A;  3NQO A;  1WWX A;  3AAF A;  1YS7 A;  4GYG A;  2E7X A;  4A0Z A;  2BGC A;  3W6J B;  1FLI A;  3S2W A;  2LKP A;  2RKH A;  1TBX A;  2BYV E;  3SZT A;  3QRF F;  5K5Q A;  1FX7 A;  4UVC A;  3TOB A;  1T6S A;  3ZP5 A;  2QBY A;  4M6Y A;  5CLS A;  2P4W A;  5L3G A;  5A2Q K;  2FQ3 A;  5E8I A;  3GFM A;  2IJL A;  1KU2 A;  1J0R A;  3RJP A;  4ZH4 F;  4U7D A;  4HX7 A;  1YO5 C;  3MFK A;  1H9T A;  2K4J A;  4HQM A;  2HZT A;  5EEG A;  1SAX A;  3KZZ A;  4AIK A;  1I6X A;  4KIC A;  2CQK A;  4IPA A;  2V79 A;  5E18 F;  1U8R A;  5D8K B;  1ZRF A;  1IN6 A;  5F1R A;  4I7H A;  4KT5 C;  1J5Y A;  3D5L A;  2UWM A;  2O3F A;  2ZFW A;  2G9W A;  2MH9 A;  2JZY A;  4O3M A;  5E1Z B;  3JSO A;  1LNW A;  2VC1 A;  5HS8 A;  3ZQ7 A;  2A3S A;  4M9X A;  3SFZ A;  4EV0 A;  3WTT C;  2CO5 A;  2IVM A;  4LG0 A;  1G4D A;  3FX3 A;  1TQP A;  2MLG A;  1CGP A;  1QNT A;  1OKR A;  1WKM A;  2AS5 F;  4MGR A;  5D6E A;  1TNS A;  1UHM A;  3KE2 A;  1BM9 A;  4I09 A;  1Z6T A;  3ULQ B;  3SQN A;  3GWZ A;  5LBQ A;  4U0W A;  2LSO A;  4M9Z A;  3REO A;  2JSC A;  3BY6 A;  2UXN A;  3KP2 A;  4RAZ A;  3J81 K;  3GO5 A;  3F8F A;  1R58 A;  3VB2 A;  3TO9 A;  1IXC A;  5LGU A;  4HA8 A;  3F6V A;  4PCQ A;  2M5W A;  1GVJ A;  4A0X A;  1OYW A;  5LRS A;  2V1D A;  5DYM A;  3WTX C;  4I0A A;  4ASN A;  2FOK A;  3LA2 A;  3G3Z A;  4EJW A;  2W85 A;  3WTU C;  2L4M A;  1ULY A;  4JQF A;  3RPU A;  4XBF A;  4CIC A;  1U3E M;  2EWN A;  3HRM A;  4KYW A;  2RQP A;  2DFI A;  2H6B A;  4ZYG A;  4BYY A;  3PQJ A;  4RAY A;  1FPQ A;  4LLL A;  5L3C A;  1W4M A;  2XUB A;  4Q4Z F;  3ZN1 A;  3M7G A;  2O03 A;  4R1H A;  3SHF A;  5E1W A;  3KP4 A;  1V4R A;  4P96 A;  3GFJ A;  1B9M A;  1O7F A;  2V1X A;  4M9S A;  4AIJ A;  4KIG A;  4HYE A;  2A68 F;  3HSF A;  3RI4 A;  1RNL A;  1O57 A;  5CVR A;  2MH2 A;  5JI6 A;  4KA4 A;  1XN7 A;  2GA2 A;  2VT2 A;  5FLX K;  1UHW A;  2VE9 A;  3JTH A;  3JTG A;  2Z9O A;  1EV7 A;  1T38 A;  1ODD A;  1USS A;  5LHI A;  3DEU A;  2Z5U A;  4NQW A; 
#chains in the Genus database with same CATH topology
 2DT5 A;  2VJI A;  3FMR A;  3BC8 A;  4D9J A;  4P5O A;  1S6L A;  1V5E A;  3RQI A;  4EJT A;  3LOC A;  4WXD A;  1MSF C;  3HOW J;  1WH5 A;  3VOE A;  5F1J A;  1R5I D;  5KVR A;  5JLX A;  2AQF A;  2HKO A;  1W7P B;  3ESW B;  4RAF A;  2CFO A;  2QQB A;  1LEA A;  2WAF A;  3JRD A;  4PGG A;  5J4Y A;  4BQO A;  4YG2 F;  2LC2 A;  2R5Z A;  3F3X A;  1U0J A;  2CW0 F;  4E4H A;  4E70 A;  1UZC A;  5ILS A;  1TQM A;  4GDF A;  3CUQ C;  3PIO F;  2CQ7 A;  2QWW A;  4LIU A;  5TJJ A;  4ANJ A;  3FXJ A;  3AG4 H;  1VND A;  1YG2 A;  2HOT A;  2IA0 A;  3TW7 A;  3AL0 B;  3BQY A;  3WHB A;  1IXS B;  3B6C A;  3E1S A;  4CXF A;  3MQ0 A;  3DPL C;  3U1D A;  3H5R A;  5LEK A;  1T8I A;  4A0Y A;  2LR8 A;  1UST A;  3S2D J;  4HAM A;  4XQF A;  4LK1 F;  2DJI A;  1RUO A;  1WFX A;  2HTS A;  1Y0U A;  1Z0X A;  3HOT A;  2D1H A;  2M9H A;  4C9Y A;  4BEH A;  1T0F A;  1W0U A;  1YTY A;  1HBX G;  3I53 A;  4DZJ A;  1WJA A;  4UVA A;  3OYE A;  1IRG A;  2DA7 A;  1IV8 A;  1POG A;  2CFX A;  3I54 A;  5H2F C;  5EGO B;  2P5L C;  3DU5 A;  3AKZ A;  5B5E C;  4ESF A;  1VQK I;  2GM4 A;  1Y1W J;  4B4C A;  1OR7 A;  2XF5 A;  2Q8K A;  2MGQ A;  4EGY A;  3NEU A;  2XAS A;  2R7V A;  1T95 A;  5F27 A;  1RC9 A;  5BMZ A;  2W4S A;  4XN0 A;  5C44 J;  2LVS A;  3CCR I;  4AVP A;  2K5C A;  3BZC A;  1FC3 A;  3S17 J;  4IKF A;  2OZU A;  5FRO A;  3LSR A;  4ENK A;  1XGO A;  4WXH A;  3GW2 A;  1S7E A;  2K40 A;  2MLK A;  2Y75 A;  2ID6 A;  2WY8 Q;  1R9T J;  2H8R A;  1YYV A;  2F4I A;  5FKM A;  4ENM A;  2PMZ N;  4GXO A;  2K85 A;  5M5Y J;  3E6B A;  1F9N A;  2ECC A;  2MYS A;  3SXY A;  5K7Z A;  4C30 A;  3FXL A;  2KP6 A;  1B9N A;  1T56 A;  3S3N A;  1MJB A;  1R5H A;  1OQY A;  5IT3 A;  2FXA A;  2W84 A;  1U5T C;  3Q5F A;  2DJN A;  3C7J A;  2Z33 A;  3F8N A;  1E3O C;  1VQO I;  4EJV A;  1D8J A;  1BI3 A;  2E1M B;  5F64 A;  1P6R A;  2KIF A;  1E3P A;  1JTY A;  1JT0 A;  1S7O A;  2OQG A;  2Z3Y A;  3ZMT A;  1R4N B;  1HA8 A;  4PK4 A;  1ERD A;  3K1M A;  3FMQ A;  1KON A;  2VKH A;  4E7Z A;  1F43 A;  1P92 A;  2KZV A;  3J7A Y;  2Y31 A;  5ILU A;  2ZME B;  2BY2 A;  3CJT B;  3LSI A;  2E2H J;  3K0L A;  4ZZL A;  2J5P A;  1T2K A;  1RZ4 A;  5DDG A;  3LSH A;  3IH2 A;  3OYG A;  4E7H A;  1Z21 A;  1FIA A;  4G7O F;  2JRT A;  1SD6 A;  2XPW A;  2HKX A;  1P9Q C;  4UB8 C;  3FHZ A;  2IGO A;  5E17 F;  2VQC A;  1TTY A;  2DLL A;  2Y48 A;  4XKC A;  1IN4 A;  1IJW C;  2CSO A;  4G7Z F;  4JOM A;  1FOK A;  3CP8 A;  1YI2 I;  5BPI A;  2JWT A;  4JBA A;  3ZQF A;  1YX3 A;  2JVH A;  4N4O B;  2FBI A;  3WE2 A;  2CH0 A;  2Q0O A;  3BWG A;  4CO8 A;  1MKM A;  2L01 A;  2IBD A;  2R5Y B;  1XMX A;  3HHG A;  2WB1 A;  4L0Y B;  3CP2 A;  4E7I A;  1AU7 A;  3FXR A;  2WV1 A;  2V9P A;  4RGS A;  1BOA A;  2EFQ A;  2XAH A;  4N4N B;  3F0C A;  3KET A;  3MWM A;  2IS2 A;  4MNU A;  2O0Y A;  2PBI A;  5E20 A;  4ON0 A;  3I4P A;  2D45 A;  4M73 A;  2MC4 A;  4CGZ A;  2G0E A;  2DFF A;  2EPF A;  2LKX A;  3I4M J;  3EQL F;  3I56 I;  2VQH A;  2H6C A;  2F5V A;  2X6Y A;  2YU3 A;  3CQZ J;  3KYC B;  4P55 A;  3QWL A;  2RAE A;  1FMW A;  2L4A A;  2Y0S N;  5FD5 A;  1P4A A;  2QA4 I;  2NNN A;  4H4K C;  2VQL A;  3CCE I;  2MD5 A;  3BR5 A;  1VQP I;  4AU7 A;  2STW A;  2XDV A;  3C1D A;  2FSW A;  2QKM B;  3AG2 H;  4IHV A;  1BIA A;  2H8W A;  3LFK A;  5E3O A;  2O6G E;  2DAO A;  3KFW X;  5H6R A;  3ABU A;  4LIT A;  1SFO J;  3J7Y J;  1GUU A;  2UUZ A;  4G6Q A;  1U5T A;  4EM1 A;  5JVT A;  2G7H A;  3BG7 A;  4Q47 A;  4M74 A;  2Z1D A;  3TDZ C;  1B1B A;  3M9A A;  5K1Y A;  2VT3 A;  1F5T A;  4OMY A;  5EEH A;  1BC7 C;  2HDD A;  2Q1Z B;  2DN0 A;  2HWV A;  4BHC A;  3K4K A;  1JE8 A;  1OJL A;  2VXZ A;  3GVA A;  4XLN F;  1MBK A;  2A69 F;  3BJ6 A;  4OIQ F;  3ZQI A;  1VQ4 I;  2QUF A;  1WI9 A;  2H94 A;  1R4M B;  4I0B A;  2E71 A;  3KP5 A;  4UUT A;  2R7Z J;  3EET A;  2BY0 A;  2NYX A;  3KEQ A;  4GCV A;  4L5J A;  3OY9 A;  4E7L A;  2FBH A;  1XPX A;  1UJ8 A;  4G12 A;  2VON A;  1QPI A;  1D3Y A;  3O2P E;  1FTZ A;  1Y8R B;  4BS9 A;  4IZZ A;  1TQI A;  3FM3 A;  3P9I A;  4FCY A;  3V7R A;  4IRG A;  1ETV A;  2CMP A;  5EYR A;  1KA8 A;  5LEJ A;  1FOY A;  3ERE D;  2ISY A;  3BTI A;  3CLO A;  4RBO A;  4A6D A;  2R7U A;  1U2W A;  1X1D A;  2HVS A;  2DA1 A;  1R36 A;  2KDO A;  2MBF A;  2P5V A;  3LSM A;  4J19 A;  5GPA A;  2L54 A;  5F0F A;  4ZTJ A;  2R7D A;  2PMZ A;  4HSR A;  5ICF A;  3T8R A;  4IEJ A;  3TW6 A;  3HM5 A;  4PUS A;  3GCM A;  1RES A;  4NC8 A;  3OYD A;  1Y56 A;  1K78 A;  2JJ7 A;  2F2E A;  4CCJ A;  1SEU A;  4O5V A;  3WTS C;  3S1M J;  3C2G A;  2IAI A;  3OIP A;  2KPM A;  3H3V K;  5CVJ A;  3J80 Z;  3I0T A;  2K3P A;  2F5D A;  1MGT A;  5DCM B;  2VBZ A;  3H5A A;  4ZTF A;  1YIO A;  2OAZ A;  1SFK A;  2E5Z A;  1TT0 A;  3BR0 A;  4RA2 A;  1XDU A;  2CWE A;  2QKL B;  3QOE A;  4E7K A;  1ETQ A;  1ETO A;  1J09 A;  4UB6 C;  3K2Z A;  1GV5 A;  2M8E A;  4XRF A;  3CDH A;  1I50 J;  1JUS A;  4XL9 A;  1NK2 P;  2DQL A;  2MC3 A;  2QM3 A;  3RPU D;  4HZF A;  4HRI A;  4W1U A;  1ZRE A;  3OIQ A;  1S7A A;  4OAY A;  3KIO A;  3Q0V A;  2CJJ A;  1WH7 A;  2IEK A;  1FNN A;  2FBK A;  1FP2 A;  1WRJ A;  4OIP F;  2P81 A;  2X6O A;  2HGC A;  2LP0 A;  3N05 A;  2DT6 A;  2W24 A;  2ZNZ A;  3M1C A;  2KJB A;  3K9T A;  2FF4 A;  1JKP C;  4XOR A;  2EZL A;  3G1O A;  2HI3 A;  3WTV C;  1TWA J;  1I1S A;  2W25 A;  1OMI A;  4F91 B;  3IWZ A;  2DBB A;  1SFU A;  1I5Z A;  2K9N A;  1VQ5 I;  3DKY A;  2DPU A;  1HF0 A;  2XRN A;  3P9C A;  2DOE A;  3OS0 A;  9ANT A;  3DPU A;  3FBN B;  1FEX A;  5D5U B;  1T39 A;  2MG4 A;  1I6H J;  1RI7 A;  1YX5 A;  3ZR8 X;  1HW1 A;  3L2W A;  4RB0 A;  1TWF J;  2Y0S A;  2OPT A;  3P9K A;  5FRN A;  4DOZ A;  1VQ8 I;  5LLQ A;  3E7L A;  1V5G A;  2V6E A;  1MBH A;  3HHH A;  2LY2 A;  3FIS A;  4OAZ A;  2L9N A;  4BH9 A;  2HYJ A;  2JK3 A;  1A5J A;  2DMN A;  3I71 A;  2QLZ A;  3Q9S A;  2LFB A;  3CUO A;  2F5F A;  2A07 F;  2NVU B;  1VQL I;  1AKH B;  1SAN A;  3PO2 J;  3S93 A;  4BKX A;  1WZ2 A;  1PYV A;  2TCT A;  3LA3 A;  2DMT A;  4KMU X;  3I58 A;  2NVQ J;  1LE8 A;  4BBS J;  5HS9 A;  4UUV A;  3CF5 F;  4I01 A;  2A5Y B;  2K27 A;  1VF9 A;  1NTC A;  1B72 A;  2DMP A;  1GDT A;  3MN2 A;  3AG3 H;  2HVR A;  4B48 A;  1XS9 A;  1WHU A;  1STZ A;  4A6E A;  2HOA A;  5DV5 A;  1SD7 A;  5ED4 A;  2BY1 A;  3G1M A;  3K4C A;  1KYW A;  1ETY A;  3MZH A;  4A93 J;  1W1W E;  1YW8 A;  2XRL A;  5HDN A;  3QU6 A;  3HOX J;  2EFN A;  4KN7 X;  3GTQ J;  1OFC X;  2KRF A;  2ZJQ F;  3BJO A;  4M3B A;  3HKZ N;  4D5C A;  3E3V A;  2R3S A;  3R0J A;  2DK8 A;  4NBQ A;  5KHD A;  1RRJ A;  1XSX A;  3AG1 H;  3H3U A;  2ZCW A;  1X4O A;  2OZ6 A;  1LB2 A;  3T1B A;  5J1R A;  2BXZ A;  2LBF B;  1VFC A;  1JHF A;  4B3X A;  3FKJ A;  2CGP A;  2GAU A;  3PNY A;  1ZN2 A;  4B1R A;  3HSE A;  2NXN B;  4B43 A;  4NC6 A;  4Y4R A;  5FD6 A;  2V1U A;  3CO6 C;  2DO7 A;  4M3E A;  4OIR F;  1P7I A;  2ZKZ A;  3ZMV A;  1PUE E;  4UHT A;  3FXM A;  3L09 A;  2L5Q A;  2OF7 A;  5EDN A;  1VQ7 I;  3C3W A;  1ZG3 A;  3I59 B;  1H89 C;  2ME6 A;  4EM0 B;  2A05 A;  3KZI C;  2NS8 A;  1YS6 A;  2CU7 A;  2HTJ A;  3ZQH A;  2Y9Z A;  5L3E A;  3S15 J;  1Z7L A;  1JI8 A;  2ELK A;  3QYF A;  4RAG A;  1HC8 A;  4FT8 A;  3A4C A;  5JFR A;  3GTO J;  3S16 J;  4UXN A;  4ZDO A;  2DDA A;  1RR8 C;  5IYC J;  3ECH A;  2Q2E A;  5LHG A;  1OYI A;  4BNC A;  2OCE A;  4A3F J;  3T8T A;  1MW7 A;  5ICG A;  5LHH A;  1LPQ A;  2OD5 A;  3KEO A;  4BU2 A;  2GQQ A;  4A3I J;  1Y1V J;  1MDM B;  3SZG A;  3P5J A;  2LF7 A;  4XLP F;  3LAJ A;  4D1Q A;  4G94 A;  2KIM A;  3GXO A;  1FJL A;  4IO9 F;  1CF7 B;  3W6K B;  2NOJ B;  2DA3 A;  5ICE A;  3HJE A;  2EK5 A;  4Z2Y A;  3V8L A;  2K9S A;  2L9R A;  4II3 A;  5F0C A;  1MMA A;  3KLN A;  1BI1 A;  1W5S A;  1P7J A;  4K2E A;  2YR2 A;  3TQN A;  3M4O J;  3BG5 A;  1LDD A;  1JT6 A;  2CV2 A;  3TMO A;  2LY1 A;  2V9V A;  4HV5 A;  1HXD A;  2XGC A;  1X1B A;  2KIS A;  4U87 A;  2LD5 A;  3DKW A;  4EJU A;  2ICW G;  2EB7 A;  5HS7 A;  5HDG A;  1J7K A;  5EG0 A;  3T5X A;  3PFI A;  2CG4 A;  2HVQ A;  4KIF A;  3WTY C;  4B8X A;  2WY7 Q;  1MBJ A;  3BTL A;  1EH6 A;  1G59 A;  2ZBK A;  3E6M A;  1DDN A;  1RKT A;  1Z1D A;  2ZXI A;  5B1A H;  1GXQ A;  3IRQ A;  2ISZ A;  1FP1 D;  4IXA A;  5CQE A;  1K6O A;  2M30 A;  2XRO A;  3DPT A;  2A6E F;  4HX8 A;  4JX6 A;  3MD2 A;  1S8N A;  2X85 A;  3W2W A;  3NAU A;  4PJL A;  4FX0 A;  2NVT J;  2DK5 A;  1G3Y A;  5CKT A;  2XGD A;  3LWF A;  2ZXW H;  1EH7 A;  4A3G J;  3I4N J;  4XLA A;  1A6Q A;  1LKX A;  2FRH A;  5BNG A;  3HBL A;  3ONQ A;  2PMH A;  1LJ9 A;  1IAW A;  2W82 A;  1IGN A;  4WWC A;  4IHS A;  1AHD P;  2HDC A;  4WXC A;  3QPS A;  1B8I B;  3V42 A;  1X3W B;  3OYC A;  3BTC A;  4YIR X;  3R0A A;  4LFU A;  2FMY A;  1X1A A;  3BLY A;  5BS6 A;  1W7P D;  4YFN F;  5IP7 J;  2QYO A;  2M3A A;  2COM A;  2BEO A;  1AA7 A;  1Z67 A;  2I10 A;  1I27 A;  3GUD A;  3KP3 A;  1R00 A;  3HKZ A;  2L2O A;  1IDY A;  1E2X A;  2D5V A;  5FGM A;  4BY7 J;  4KDP A;  4L9V A;  2VPR A;  1FOW A;  2P7V B;  1T0F C;  2L02 A;  3LNQ A;  3PO3 J;  2HYF A;  4XNF A;  1O3S A;  1ZG5 A;  2K4B A;  3DF8 A;  1FBQ A;  5B1B H;  4YIF A;  3X2Q H;  1OYY A;  4BE0 A;  2NRA C;  4JYK A;  2A61 A;  5E3N A;  2HEO A;  1T08 B;  2PI0 A;  5IT9 K;  1OR7 C;  2JPB A;  2XAU A;  3QYE A;  1MD0 A;  1IRX A;  4M6V A;  1XSV A;  3K69 A;  2MFZ A;  2JQ7 A;  3HSR A;  2EFO A;  5E79 C;  5DTD A;  4Y7N J;  2HNH A;  3PJR A;  2V4J C;  3S3M A;  3VYU B;  4CYC B;  3L00 A;  2VXD A;  3ZMZ A;  4BHP A;  1FY7 A;  4LK0 F;  3CUQ B;  2XAJ A;  1KQ0 A;  4M3G A;  4QWQ A;  2QCO A;  3F21 A;  5FKK A;  3IHU A;  4CH7 A;  5J4V A;  4KMF A;  1ZAO A;  4CYD A;  2DA6 A;  1H9G A;  3WGH A;  3SEZ A;  3WU0 A;  1ZGW A;  1JXS A;  2K9M A;  3HRT A;  4XM3 A;  1JKQ C;  4UV9 A;  4UV8 A;  1YRN B;  1IUY A;  1XCB A;  2XB5 A;  3HC7 A;  3K4B A;  1V3F A;  2E36 A;  2HU9 A;  1HDD C;  2A5W A;  3QP5 A;  3BG6 A;  5LFA A;  1WSU A;  1IW7 F;  2LF8 A;  3HTU A;  3J80 K;  5E3M A;  3BG3 A;  1KU3 A;  2PLY A;  3ZXS A;  4DNC A;  3MMY B;  1BN5 A;  2ME0 A;  5DD8 A;  4S05 A;  2KHM A;  4LMY A;  4AIH A;  2QQ9 A;  4C2M J;  3HUG B;  5F6F A;  5BOX A;  3IC7 A;  2AO9 A;  1X1C A;  3EPZ A;  1B59 A;  4ZYH A;  1FYL A;  2TDX A;  1EF4 A;  2VLA A;  5ERI A;  3ZMD A;  4UUS A;  3LSP A;  4A3D J;  4HEA 2;  2JUC A;  1FYM A;  2HPM A;  2CW8 A;  3BR2 A;  2RV8 A;  1DPU A;  3LAP A;  2XGX A;  2LRD A;  4AM3 A;  2DMU A;  4NHJ A;  3JCU C;  1HSJ A;  3CLQ A;  1JTX A;  2ETH A;  4BE1 A;  3CC2 I;  2OCC H;  4XOP A;  3ZN0 A;  3FXO A;  5LGT A;  4Y52 J;  4CCK A;  1N77 A;  3DQV C;  3GEZ A;  3LA7 A;  2LMD A;  3Q9V A;  2LNB A;  2R7F A;  1LQ1 A;  4ZDL A;  4L9N A;  3GME A;  3RKQ A;  1FBS A;  3VEP A;  2COB A;  4AVZ A;  2XVC A;  4FX4 A;  3K4J A;  2TRT A;  1DP3 A;  1U5T B;  5FKO A;  5K7H A;  1HW2 A;  5BPD A;  1ON2 A;  4N9I A;  3CES A;  1MZB A;  3ZQL A;  1ZR2 A;  4BXF A;  3N4M A;  1YJW I;  2FNA A;  4NNJ A;  4R8H A;  2ELH A;  4IF4 A;  5KAF C;  1TWG J;  3VFZ A;  3GLX A;  4ZJZ A;  3BQZ A;  3QPL A;  4B09 A;  1VQN I;  4MQ9 F;  4CSW A;  4XON A;  4YII A;  2IA2 A;  3DLL F;  3MCZ A;  1LFU P;  4L5E A;  4PJJ A;  1ZG1 A;  4BL0 B;  2CYY A;  5IP9 J;  4IX7 A;  4C3I J;  4FAS D;  4G6D A;  2Y69 H;  2IP2 A;  4XLF A;  5HLT A;  3WGI A;  2BE5 F;  1GVD A;  3VYT B;  3H9J A;  2KT0 A;  2XAF A;  4XK4 A;  3E5X A;  3F8M A;  2LG4 A;  4LLN A;  4D0P A;  2M87 A;  3QOD A;  2XV4 S;  1BI0 A;  3FBI B;  2O8X A;  2KZG A;  5FJ8 J;  2CS3 A;  3HYI A;  2B63 J;  2RRE A;  4L18 B;  4AWX B;  1ZHF A;  3CJQ B;  4IRI A;  3DTE A;  2FEZ A;  4ESJ A;  4PJM A;  3A01 B;  3KPH A;  2H09 A;  1G2H A;  2BW3 B;  3Q0U A;  1XTA A;  3RZD J;  5ICC A;  4CHU A;  2QSF X;  5GAH J;  3H9G A;  1A6I A;  2E60 A;  1IXR C;  5HLI A;  1BJA A;  3JSP A;  4RDU A;  1YQA A;  5GP9 A;  1TW3 A;  2Z16 A;  3F72 A;  2H27 A;  3U2R A;  1TWC J;  2K7L A;  1TLH B;  4I99 C;  4L5I A;  1QZY A;  2NS7 A;  3EYI A;  4LG3 A;  4YRV A;  4NUB A;  1OCT C;  5J8C A;  3M07 A;  3NAR A;  1LVK A;  4YEL A;  4HDU A;  3P7N A;  1W7P A;  5JR3 A;  1W5T A;  3M1E A;  4C3H J;  2GWR A;  3RZO J;  3LSJ A;  2WC2 A;  2ESN A;  2BBY A;  4G7H F;  1ZRC A;  3ZPL A;  2L7M P;  3ABT A;  5GTI C;  4RGR A;  2B7E A;  1OLT A;  2ZXJ A;  1SAU A;  4J00 A;  4IVN A;  4EJO A;  4QTR A;  4D7N A;  2IPQ X;  4C2T A;  4HNT A;  2EV6 A;  3V4G A;  3OV8 A;  2BVM A;  2EFP A;  2FML A;  1HLV A;  1BL0 A;  4V2G A;  4ENN A;  3HEF A;  3FDY A;  3MAJ A;  1LFB A;  3V7C A;  1K4T A;  1B6A A;  4M6X A;  2K86 A;  2OTJ I;  1FSH A;  3ZQC A;  4I2O A;  3R61 A;  3OSF A;  5EGO A;  4N0B A;  3WE3 A;  3FK7 A;  3C18 A;  3R4K A;  2HOS A;  4QSH A;  3QU3 A;  2VE8 A;  2RN7 A;  3QPT A;  2QBY B;  2MAB A;  1MMG A;  3R60 A;  1RUN A;  3GTM J;  2DU9 A;  2XIG A;  3BR1 A;  2F48 A;  1C0W A;  4A12 A;  4HST A;  4E7J A;  2IGK A;  3B02 A;  4FQG A;  5C4J J;  4P9F A;  3A0H C;  3G1L A;  2JT1 A;  2O5R A;  3M8F A;  1P4W A;  1B4A A;  4GO1 A;  3BRO A;  3E0J B;  1JHH A;  1XSD A;  2WWY A;  3IH3 A;  2R93 J;  1ETX A;  3TO6 A;  1A04 A;  3FXU A;  1B72 B;  4KIT B;  1AOY A;  1E3H A;  3ZMU A;  5ILV A;  4H0E A;  2ACJ A;  3JR9 A;  3S14 J;  3KZY A;  1YJ9 I;  5CVV A;  3F22 A;  3K4N A;  4A3M J;  2FJ1 A;  4BE2 A;  2Z99 A;  1Z9C A;  2AHQ A;  3DBL B;  1X58 A;  1KYZ A;  4EQQ A;  5F08 A;  4RB2 C;  4YEJ A;  2DCE A;  2XSD C;  4G8X A;  5AON A;  4B44 A;  1MND A;  1ORK A;  3S32 A;  4DYR A;  3BP8 A;  5LGN A;  1LDJ A;  1XD7 A;  2VB6 A;  3FXQ A;  4R79 A;  1F4K A;  4AD9 A;  1IN7 A;  2GXB A;  1ZK8 A;  1PP7 U;  2HFH A;  4UNO A;  2RC4 A;  2ZME A;  5KCM A;  3WTZ A;  2L3D A;  4BQN A;  5DM7 F;  2YU9 J;  3FKI J;  1ZYR F;  4F93 B;  3ECO A;  4PGH A;  4MHG A;  2ESH A;  3QAH A;  1J75 A;  3H5N A;  1H0M A;  4IQJ A;  5GPC A;  3PIP F;  3NWS A;  4IHX A;  4XKW A;  1Y39 A;  1ONV A;  1QQI A;  1O4X A;  1K83 J;  4D5F A;  1BR4 A;  4MFD A;  4IHW A;  1V54 H;  3CCU I;  3F8B A;  3BJA A;  2XC7 A;  2M8G X;  2VAS A;  2PG4 A;  2R7O A;  4ZC3 A;  4W97 A;  1G3T A;  1QVT A;  3RYR A;  2ZSI B;  5CYV A;  1K6Y A;  2CQN A;  1S3J A;  4S0H B;  2KKO A;  3KYD B;  5HVQ C;  2HYG D;  3WOD F;  5J8F A;  2R5Y A;  1ZRD A;  4RGX A;  1G3S A;  1TW2 A;  1D1B A;  2Z2S B;  3I64 A;  4FE7 A;  3BDD A;  4LG0 B;  2LY9 A;  2A6T A;  2KIQ A;  4I02 A;  2VOD A;  4FET A;  1ZQ3 P;  1IUF A;  1F1Z A;  2QZ8 A;  3DEW A;  3GLL A;  3I9V 2;  5D4R A;  1T33 A;  4ABZ A;  3HOV J;  4MTD A;  4BQQ A;  3G71 I;  1JJ6 C;  2LYC A;  3IV5 A;  4DQ2 A;  3CF2 A;  4MLO A;  2P7C B;  1UFM A;  1WJE A;  1HQC A;  2STT A;  2X48 A;  2EIM H;  2PN6 A;  2X6W A;  2HR3 A;  2EFW A;  1J2X A;  4XRM A;  2AXL A;  2VC0 A;  2XHK A;  5L3D A;  4CZC A;  3UKG A;  1ITY A;  2F5C A;  1ZAR A;  4RM2 A;  2VBW A;  1HDP A;  1IRF A;  1R5G A;  3DLA A;  3GZ6 A;  2DOD A;  2R7R A;  4A2U A;  5FKL A;  1KQ9 A;  3FF5 A;  5CQG A;  1X2N A;  1YFH A;  1PUF A;  2HDW A;  2YSR A;  4LD5 A;  1K61 A;  1ETK A;  3CC7 I;  4M3D A;  3PQK A;  3LST A;  4RLF A;  1XMK A;  4M72 A;  3ZCO A;  1W0T A;  1U8B A;  2X51 A;  3L7W A;  1DP7 P;  1D8K A;  3LQQ A;  3ZGK A;  3WU1 B;  2DA4 A;  3WTW C;  3JRB A;  3HTS B;  1OIS A;  4LB6 B;  2RVC A;  2M7B A;  2Y0M A;  3G2B A;  4ZDP A;  3CC4 I;  2KJC A;  5M5W J;  1UG0 A;  3CO7 C;  1R71 A;  5JVG F;  3OL4 A;  4IHY A;  1IRZ A;  2EZH A;  3L2Q A;  1R7J A;  3ZMS A;  2JA8 J;  3BOQ A;  4AYB N;  2V1N A;  2X0L A;  1N78 A;  5GAD J;  2Y9Y A;  2FOW A;  1JJ8 C;  2CV1 A;  1MBG A;  2BY3 A;  1L0O C;  2EIK H;  3ABL H;  2WTE A;  1Y6I A;  4FE4 A;  2CRG A;  2CW7 A;  5H20 A;  3RDI A;  2DA5 A;  3OS2 A;  1REP C;  4HPQ A;  1D5V A;  2PJR B;  1K7A A;  4BBR J;  2EIL H;  1OCR H;  4I98 B;  4IRH A;  4KUM A;  2KRC A;  1J9I A;  3K7A J;  1ZGJ A;  1QU3 A;  4EEF G;  5HNH A;  5J1U A;  3EUH C;  3FZV A;  1KQ8 A;  3E6D A;  2GXG A;  3KEY A;  1XMA A;  2M4G A;  2O61 A;  1BW5 A;  5FFX A;  3DU6 A;  1RKW A;  3WU2 C;  4OMZ A;  2DXI A;  5DCM A;  4ITV A;  2F5E A;  3DTI A;  1FTT A;  3KCC A;  2R7Q A;  1RPW A;  3FIW A;  5HLH A;  1YW7 A;  1IN5 A;  2WA0 A;  1YOV B;  2CUE A;  1IO2 A;  2QQA A;  1JUP A;  3VSL A;  4A3C J;  2M2E A;  3ZOB A;  1TZL A;  2N8G A;  1FWZ A;  5FO5 A;  3CMA I;  1U6G A;  1FIP A;  2UXX A;  1Z7U A;  4U88 A;  1ZH5 A;  2Y2Z A;  1X3Z B;  2PFB A;  4HF2 A;  3RIR A;  2PQ8 A;  6PAX A;  1LFP A;  3EUK L;  3KP7 A;  2R92 J;  1VQM I;  1HW5 A;  2YX4 A;  4A5N A;  3RKW A;  1JGG A;  2V9K A;  2KRH A;  2JUG A;  1SD4 A;  2LDU A;  2YUS A;  3ASN H;  2L9S A;  3GTJ J;  1Q1V A;  1BW6 A;  3BR3 A;  1JKO C;  2XF7 A;  3SDB A;  2ZB9 A;  1YLF A;  1MH3 A;  3RCO A;  2B9S A;  1DGR M;  5IOZ A;  1BR2 A;  3U1K A;  4WK8 F;  4LJZ F;  2NS0 A;  4NQW B;  3TKY A;  2K9Q A;  2D1V A;  2VIX A;  2X4H A;  2C6Y A;  3RQ4 A;  2HOE A;  3CJN A;  3VDX A;  3SFI A;  2XPV A;  5LRR A;  1Z3Y A;  1XGM A;  2FX0 A;  2I8D A;  3GF2 A;  2VOO A;  1T98 A;  3DP7 A;  2DPD A;  1YJN I;  4EVI A;  3DBR B;  1BBY A;  4MO7 A;  3JRI A;  3A02 A;  4F92 B;  1XGN A;  5IOY A;  2XKO A;  1HST A;  1Q1H A;  2WV0 A;  2R5Z B;  2WAQ N;  3GFI A;  1G3W A;  3PL8 A;  2LK2 A;  3TED A;  4MEX F;  3MZY A;  3OYJ A;  3MEX A;  2YPR A;  2NVY J;  2OUM A;  2ZSH B;  2VPL A;  1Y8Q B;  4G9Y A;  4EGZ A;  4IJA A;  3GX4 X;  5K7F A;  4KIS A;  1N75 A;  3S1R J;  1J59 A;  5D8L B;  1ZLK A;  2EQR A;  2IRF G;  3HPH A;  2VKD A;  3R6S A;  2OU2 A;  3TGN A;  1U78 A;  1O3T A;  1FYK A;  1QGP A;  1AKH A;  3EUH A;  3H3Z A;  4L9J A;  2QGU A;  2JPC A;  4G6T B;  3OYB A;  2JRM A;  2ZJR F;  2E5N A;  3H0D A;  1D0Z A;  1YHQ I;  2JSP A;  3ML6 A;  2ZFU A;  3W2A A;  1Z6R A;  4Q5S F;  2QEN A;  3HOS A;  2P5K A;  4BEH B;  5K5O A;  3JRC A;  4J01 A;  1SD5 A;  2PX9 A;  3ASO H;  2RNJ A;  4O6J A;  4A5M A;  2M1B A;  1I3A A;  1OPC A;  2DQR A;  3RKY A;  4GYI A;  2KL4 A;  1WI3 A;  4Y17 A;  3GTG J;  2XSJ C;  3KP6 A;  3PNT A;  3NRV A;  1X2M A;  1X3U A;  3LSK A;  4U0Y A;  1HCR A;  2GA1 A;  3M8E A;  3SZP A;  5L3B A;  4DW6 A;  1JKR C;  3OL3 A;  2GOX B;  4MEY F;  3BPV A;  3W6V A;  4PDK A;  3ABM H;  4MFE A;  4HX4 A;  4AYB A;  2V7F A;  4IHT A;  1QO0 D;  3HRS A;  4XSZ F;  3I3L A;  3QYB A;  3GTK J;  4V2F A;  3QOP A;  2LBF A;  4AC0 A;  1HKT A;  4Q48 A;  4HOB A;  5B66 C;  4PJN A;  1XC5 A;  2M0C A;  3F6O A;  1W36 D;  2E2I J;  2OQR A;  4ZYA A;  2EV0 A;  5J40 A;  2KDZ A;  1MSE C;  2VJ5 A;  3TOA A;  3OYF A;  2P0W A;  4CZZ A;  1X19 A;  5M3M J;  2L0K A;  3KLO A;  3QQA A;  3BPX A;  3ISP A;  1H8A C;  3B73 A;  5IYD J;  3I59 A;  2ELJ A;  3MKL A;  2M7A A;  5AIQ A;  2HZD A;  2XGE A;  2KLO A;  5KNL A;  1D5Y A;  4RMN A;  1VQ6 I;  3JAM Z;  1XG1 A;  1PP8 F;  4DIQ A;  5IP6 A;  1MMD A;  3UR3 C;  3OYM A;  4BHB A;  4DYQ A;  1Z3X A;  2F4M B;  2P6T A;  1QRY A;  5DEQ A;  3S3O A;  2O7O A;  3J7Z I;  3HXL A;  4LB5 A;  1RR7 A;  1UCR A;  1UEL B;  2O9L A;  4X1E A;  5AIP A;  4OIN F;  1GHC A;  3V8K A;  1Z91 A;  3M3Y J;  3HGG A;  3T0Y A;  3U21 A;  3QP6 A;  2HS5 A;  4XSX F;  4BAC A;  1MBF A;  1R1T A;  3E5Q A;  5HOO A;  4RB1 A;  2DTZ A;  2ZXH A;  1TT5 B;  1MDM A;  2QSG X;  3BZ6 A;  5J1Y A;  1IZ1 A;  3F9K A;  1NG6 A;  4KIB A;  4KJZ A;  2E7W A;  2G7U A;  4Y15 A;  1ACI A;  3EUA A;  1DUX C;  4M3F A;  4V19 K;  1CF7 A;  3O8H A;  3HGY A;  4L0Z B;  1LEB A;  3RPQ A;  3KX2 A;  3OS1 A;  2HQN A;  1NH3 A;  4OIO F;  3N97 A;  3PM1 A;  3SEQ A;  2HQ5 A;  4AID A;  2OA4 A;  4LGW A;  3G6E I;  2KMU A;  1MBE A;  5K5R A;  1L3L A;  4UY8 I;  5A2Q Z;  1SVL A;  3A0B C;  3G73 A;  5CVI A;  2VBX A;  1LVA A;  3COA C;  2E34 A;  5D4S A;  3MVP A;  4Y13 A;  4CA0 A;  3DXJ F;  4E6K G;  1K79 A;  2QQ8 A;  1DGW Y;  4IOC F;  2MD0 A;  3B6A A;  3DV8 A;  2X9D A;  3OYL A;  2IW5 A;  2B0L A;  3GTP J;  1ON1 A;  2DT7 B;  4L9T A;  2ZO4 A;  4F55 A;  3CZ6 A;  3H1C A;  5H6Q A;  5GAE J;  5TRD A;  3D0S A;  2IS6 A;  3ZQG A;  1MJ9 A;  2LH9 A;  5DUK A;  3K4L A;  3VPR A;  3CDI A;  3K10 A;  2H1L A;  5DD4 A;  2WAQ A;  3EDP A;  4BY1 J;  4NB5 A;  2OBP A;  2FE3 A;  4DJA A;  1S29 A;  4HLX A;  5JHF A;  4BXU A;  2M45 A;  2GZW A;  1YIJ I;  2JVG A;  4CCN A;  3IWF A;  2F4O B;  3RYP A;  4GFB A;  2RGV A;  4XIC A;  2VUM J;  3RTR A;  2J5O A;  4BAY A;  5JHU A;  4WF2 A;  2JTV A;  1JUM A;  3GFL A;  5FFZ A;  5HLG A;  2VI6 A;  4TV7 A;  2FA5 A;  3JRH A;  4WCG A;  1XCV A;  4KN4 X;  4IL6 C;  3V8J A;  1GV2 A;  2E1N A;  3PSI A;  1B8I A;  1PDN C;  4CCO A;  4CCM A;  3S1N J;  2FNP A;  1QPM A;  5D5W B;  3JW4 A;  1D0Y A;  2FU4 A;  3AL0 C;  4HNU A;  5CJ9 A;  3D1N I;  3BR6 A;  1W36 C;  1AWC A;  4LLG F;  5FB2 A;  3HPG A;  3GZ5 A;  4YFK F;  4DBQ A;  1Z77 A;  1XGS A;  5HOD A;  1E0E A;  2ADU A;  1YE9 A;  2NNY A;  5E3L A;  4HBL A;  4IQ4 A;  3L2C A;  4HNV A;  5BQT A;  5L3F A;  1ETW A;  2OJE D;  4XRS A;  3OOP A;  2IGM A;  4MQV A;  4EMS A;  2UZK A;  2RDP A;  2LLK A;  2DOA A;  5E1X A;  2E2J J;  2VKV A;  1SFX A;  1SVM A;  3CDL A;  3OR2 C;  1SMY F;  2EIN H;  2LOO A;  1EA3 A;  1SFE A;  2M34 A;  4MTE A;  1ENH A;  4CDG A;  3O3K A;  1IG7 A;  2W1O A;  4F3Q A;  3QPH A;  2AXT C;  1NHA A;  2PMU A;  1M1E B;  3BCA A;  2DFE A;  5FLM J;  4XR6 A;  1BOB A;  1UMQ A;  2EH3 A;  2R7X A;  1DPR A;  1KGS A;  2E19 A;  1WCM J;  1K78 B;  1KU7 A;  1JGS A;  4QLC U;  4CYC A;  1DU6 A;  4ZYE A;  5CVU A;  3RKX A;  4S04 A;  5D5V B;  1IN8 A;  2NAZ A;  3CUQ A;  2P6S A;  2R4G A;  3H92 A;  2DI3 A;  4X0G A;  1R1U A;  3A1Y A;  3VYR B;  4BJ6 C;  2EV5 A;  2DTR A;  3PUF A;  4QPQ A;  4HQE A;  4HF1 A;  3MZ8 A;  4KFC A;  4N9H A;  4BUP A;  4ETS A;  3WG9 A;  4JK1 X;  2VBY A;  2KIU A;  3E5U A;  4M71 A;  3TO7 A;  3HB9 A;  3WGG A;  3BG9 A;  3F23 A;  5DUI A;  1YRN A;  1SMT A;  1EH8 A;  3J81 Z;  3C2B A;  1KU9 A;  2E1M C;  2EBI A;  3K1N A;  2EZI A;  2ZJ2 A;  1N25 A;  5E8G A;  2R0Q C;  1IV6 A;  1WQ2 A;  1FT9 A;  3PSF A;  3WHC A;  3HOY J;  2YX7 A;  4HW0 A;  1E17 A;  3C2H A;  1VI0 A;  3WG7 H;  2CV0 A;  3HIF A;  4HLY A;  4HV6 A;  4OU0 A;  4I6Z A;  1GT0 C;  1WVR A;  2HXO A;  3HUG A;  1FBU A;  2ZME C;  3VOD A;  3OYA A;  3GYH X;  1R22 A;  1O7L A;  3IKT A;  1TNT A;  2DA2 A;  1BI2 A;  1HKQ A;  3J7A O;  4RB3 C;  1U9N A;  3H36 A;  3I5U A;  4ZYD A;  4BJ5 C;  3CMM A;  2LRE A;  1TP4 A;  3IRR A;  1V5F A;  3CD6 I;  5J3L A;  2PEX A;  4KNY A;  5CPR B;  2W7N A;  3MKY B;  3EYY A;  1XDS A;  1XB4 A;  2OC6 A;  1G6N A;  3K1P A;  4P9U A;  2EA4 A;  3F8C A;  1GXP A;  2UV1 A;  5C4X J;  1UAA A;  3OOU A;  5J6X A;  2L7F P;  1UHS A;  1U9O A;  1TL8 A;  1ZLJ A;  1IF1 A;  1QVU A;  3CCS I;  3FM5 A;  3BCB A;  1APL C;  3TBI A;  4U0V A;  2MA3 A;  4PZJ A;  2GOM A;  2MW8 A;  5GAG J;  2WAE A;  2E1C A;  5KK1 A;  2IXS A;  3OYN A;  1PUF B;  3LQR A;  1I39 A;  4GGG A;  1RET A;  3S8P A;  2XAG A;  3DBH B;  4ZZD A;  1LE8 B;  4WX9 A;  1YW9 A;  1Z05 A;  3H35 A;  5FLV A;  3IL2 A;  1LDK B;  3V7S A;  4F7Z A;  4Z6Y A;  2IT0 A;  2CQQ A;  5B3S H;  2Y30 A;  3ABK H;  3TDU C;  4OWR B;  4CUG A;  1BC8 C;  3ELK A;  5D6F A;  2ZNY A;  3U9G A;  4DBR A;  4C2U A;  5IT9 Z;  2VN2 A;  4XLH A;  4BDY A;  2EJR A;  3BZK A;  1HKS A;  1R1V A;  2W57 A;  3DFG A;  3ROU A;  1S72 I;  4IOA F;  3W3C A;  2JA2 A;  5F0H A;  4A3L J;  2EA2 A;  5FLX Z;  3LSG A;  5D5X B;  1O3Q A;  2VOP A;  1BIB A;  1A36 A;  1R23 A;  1MMS A;  2XB0 X;  2JN6 A;  1UB9 A;  1OCP A;  1QBJ A;  4DYC A;  4EM2 A;  2HPI A;  1P4X A;  2IA1 A;  3KYL A;  3VSK A;  1R49 A;  3O6B B;  4XMY A;  1RIO H;  4RS8 A;  3HOZ J;  3RSN A;  1ZGA A;  1FZP B;  2D2W A;  2XKP A;  1SVO A;  3FWE A;  2BV6 A;  3A01 A;  2RNG A;  3CCV I;  1K4S A;  1WJB A;  3FMS A;  5LD2 C;  2BW3 A;  3L9F A;  1WPK A;  4ENJ A;  3K6G A;  4XID A;  2A6H F;  3SJM A;  5IPA A;  5M5X J;  2HQR A;  1P2F A;  3I55 I;  2XAQ A;  1H88 C;  3HG9 A;  3OR1 C;  2GIV A;  3CTA A;  3IKV A;  3L2R A;  1FSE A;  2DW4 A;  2EZK A;  2OTL I;  2P8T A;  5DCF A;  5EJC A;  2OV7 A;  4FHT A;  4QIW N;  1S5L C;  1O3R A;  5F04 A;  1QHG A;  2R7T A;  4ESB A;  4HF0 A;  4GRI A;  1QZZ A;  2E1O A;  3JRE A;  4U7B A;  3PUB A;  1GLN A;  2Q2E B;  3OMY A;  1UG2 A;  3H9Q A;  4B3A A;  3H0G J;  2QVO A;  5FKN A;  3JAM K;  4HDV A;  1VTN C;  5HDK A;  1MJA A;  2QSH X;  2AQE A;  1Y0N A;  3FHN A;  4BQA A;  1FOX A;  4XN3 A;  3FK6 A;  4YFX F;  2V6C A;  4BDZ A;  1WJ5 A;  4LIV A;  4OOI A;  2K02 A;  3E6C C;  3OYI A;  4RGU A;  4UVB A;  1I1G A;  5EEA A;  1WJF A;  5IY5 H;  2PJP A;  2CUF A;  2H1K A;  4PJ0 C;  3E97 A;  3HRU A;  3NQO A;  1WWX A;  4XRS G;  3ZRG A;  4XLE A;  3AAF A;  3VWB A;  1YS7 A;  4GYG A;  1W5C C;  2BHZ A;  2E7X A;  4JX5 A;  3OSG A;  1A35 A;  4A0Z A;  2BGC A;  3W6J B;  1S9H A;  2DDB A;  3S2W A;  2VJJ A;  2GLO A;  1FLI A;  2LKP A;  2RKH A;  5EZH A;  2K9L A;  1TBX A;  2BYV E;  4E7S A;  2X6X A;  3TP0 A;  2XF6 A;  3CCY A;  3SZT A;  2CUZ A;  2V26 A;  3M8J A;  3QRF F;  1MH4 A;  1IDZ A;  2FUG 2;  5K5Q A;  1FX7 A;  4A69 C;  4UVC A;  3TOB A;  4LOC A;  2GXA A;  1T6S A;  1V55 H;  3DCF A;  1X4P A;  3ZP5 A;  5EG0 B;  2M0M A;  3DKX A;  2QBY A;  4M6Y A;  3W2V A;  1OCO H;  3LMM A;  5CLS A;  2YS9 A;  2P4W A;  5L3G A;  3TL4 X;  1OCC H;  5A2Q K;  4NC7 A;  2FQ3 A;  3K2A A;  5E8I A;  3GFM A;  2IJL A;  1KU2 A;  1J0R A;  2NVX J;  4DZP A;  2VKE A;  2F6C A;  3RJP A;  4ZH4 F;  2X1C A;  1ZR4 A;  1PVE A;  2E35 A;  1HOM A;  4U7D A;  4XKB A;  2L7K A;  3G4S I;  4HX7 A;  1YO5 C;  1EJ9 A;  4B47 A;  3MFK A;  1H9T A;  4EAT A;  4KT6 A;  3OIO A;  3ZQQ A;  2K4J A;  3PNV A;  1A31 A;  4HQM A;  2HZT A;  2X1E A;  4RM3 A;  5EEG A;  5KAI C;  1SAX A;  3D5S C;  2ID3 A;  1XX5 A;  4XOT A;  3HL2 A;  2XPU A;  3KZZ A;  1EKE A;  4AIK A;  2L7Z A;  1I6X A;  4KIC A;  2CQK A;  4IPA A;  2V79 A;  5E18 F;  3JRG A;  2JA5 J;  1U8R A;  5D8K B;  1ZRF A;  1IN6 A;  2I5U A;  5EZG A;  5F1R A;  4I7H A;  4KT5 C;  4QPO A;  2LKS A;  3AFH A;  3GTL J;  1MNE A;  5JLW A;  1D1C A;  4FTH A;  1J5Y A;  3D5L A;  2UWM A;  2KFD A;  2O3F A;  3DTK A;  2W48 A;  1G8X A;  2ZFW A;  3Q0W A;  5M3F J;  2G9W A;  2MH9 A;  2JZY A;  4O3M A;  3GZN B;  4FIS A;  2X1D A;  2DYR H;  3IAM 2;  5E1Z B;  3JSO A;  4X6A J;  2QF7 A;  1CQT A;  1LNW A;  2R7S A;  3S2H J;  1TC3 C;  2VC1 A;  2K3F A;  5GTH C;  5TGT A;  3JRA A;  4D7M A;  5HS8 A;  3ZQ7 A;  2A3S A;  5DS9 A;  4M9X A;  3SFZ A;  4EV0 A;  4Y33 A;  3CCL I;  3DEE A;  1F36 A;  3NWT A;  3WTT C;  2CQX A;  4A3K J;  2CO5 A;  2IVM A;  4JX4 A;  4LG0 A;  3D5R C;  2IS1 A;  4XKV A;  2CUJ A;  2EIJ H;  1G4D A;  2BZT A;  3FX3 A;  1TQP A;  3CME I;  2MLG A;  3L1P A;  1CGP A;  2DOF A;  1QNT A;  5HNF A;  1OKR A;  1VZ0 A;  3K70 D;  3L2V A;  1WKM A;  4A3E J;  1ZEL A;  4CCL A;  2AS5 F;  3O8G A;  4MGR A;  5D6E A;  4A3B J;  1TNS A;  2DYS H;  2JMW A;  1UHM A;  1I3Q J;  3TP3 A;  3KE2 A;  1BM9 A;  4I09 A;  1Z6T A;  3ULQ B;  3SQN A;  3GWZ A;  5LBQ A;  2GIZ A;  1MNM C;  2FQ4 A;  2ZC2 A;  4U0W A;  2RQQ A;  2BOL A;  3IH4 A;  5IYB J;  2LSO A;  4M9Z A;  2VQG A;  1KZH A;  3REO A;  3BT9 A;  2JSC A;  3HZJ A;  4AUX A;  3BY6 A;  2UXN A;  3OYK A;  3KP2 A;  3K4M A;  4RAZ A;  1PJR A;  3CCM I;  3J81 K;  3GO5 A;  1BJZ A;  3F8F A;  1R58 A;  3VB2 A;  3TO9 A;  3SDG A;  1IXC A;  3SYT A;  3UNG C;  1QA6 A;  4UUS B;  4BXX J;  5LGU A;  1SC7 A;  4DGW B;  4HA8 A;  5EF6 A;  3F6V A;  4PCQ A;  3JRF A;  2M5W A;  1OCZ H;  1ZTR A;  1IC8 A;  2VL8 A;  1GVJ A;  4A0X A;  1OYW A;  5LRS A;  3BTJ A;  1DQU A;  4PSX A;  2VJ4 A;  2V1D A;  5DYM A;  3WTX C;  1LUJ B;  4I0A A;  4ASN A;  3IP4 B;  2FOK A;  2HQA A;  3ERM A;  3MKW B;  3LA2 A;  3G3Z A;  2FD5 A;  3A03 A;  4EJW A;  2W85 A;  3HDD A;  3WTU C;  2ECB A;  1WGX A;  3OWT A;  4HG2 A;  2IS4 A;  3Q3S A;  3CMY A;  2L4M A;  1ULY A;  4JQF A;  3RPU A;  2KQR A;  1QZE A;  4XBF A;  1MMN A;  4CIC A;  1U3E M;  4JP0 A;  4NDL A;  1BR1 A;  3LL7 A;  2EWN A;  2JA7 J;  2BXY A;  1D0X A;  3VYS B;  4F52 A;  1YIT I;  2DFH A;  4P1W A;  1D1A A;  3HRM A;  1DU0 A;  5C3E J;  4KYW A;  2PJR A;  1QHH D;  2LTP A;  3S1Q J;  5J47 A;  2RQP A;  1ZKG A;  1VQ9 I;  2DFI A;  2H6B A;  4ZYG A;  4BYY A;  3IAS 2;  3PQJ A;  2WAD A;  1FMV A;  2DMQ A;  1NK3 P;  4PSW A;  4RAY A;  1FPQ A;  1MIJ A;  2HXI A;  2M4K A;  3CJR B;  4LLL A;  5L3C A;  1W4M A;  2XUB A;  4Q4Z F;  3LFU A;  3ZN1 A;  4BGD A;  3M7G A;  2O03 A;  4R1H A;  3SHF A;  3GBG A;  5E1W A;  4BJT A;  3KP4 A;  2BVL A;  1V4R A;  4P96 A;  4Y3O A;  4MIM A;  3GFJ A;  1B9M A;  1O7F A;  2V1X A;  4A3J J;  1WJC A;  4II2 A;  4M9S A;  2L9V A;  4AIJ A;  2MSY A;  4KIG A;  3HOU J;  4PFO A;  3IUO A;  4HYE A;  4PFP A;  4RLQ A;  4XLC A;  3MKZ A;  2A68 F;  2O8K A;  2ZJP F;  3HSF A;  3RI4 A;  2W00 A;  1RNL A;  1O57 A;  5CVR A;  2MH2 A;  5JI6 A;  4KA4 A;  1XN7 A;  2GA2 A;  2VT2 A;  3A2K A;  3CCQ I;  5FLX K;  1BA5 A;  1UHW A;  2VE9 A;  4C3J J;  3L2U A;  4I76 A;  1TWH J;  2WBM A;  3DWL E;  5TIS C;  1NG7 A;  2IGN A;  2JA6 J;  1WJD A;  2BHY A;  3K70 C;  2GBY A;  3JTH A;  3JTG A;  2NOG A;  3CCJ I;  2Z9O A;  1EV7 A;  3PFY A;  2QEX I;  1T38 A;  1ODD A;  1USS A;  5LHI A;  5DM6 F;  3DEU A;  5FRM A;  3FXK A;  1X1P A;  3OYH A;  2WB1 N;  2R7W A;  2Z5U A;  1R6R A;  4NQW A; 
#chains in the Genus database with same CATH homology
 2DT5 A;  3FMR A;  4P5O A;  1S6L A;  4EJT A;  4WXD A;  3VOE A;  5KVR A;  2HKO A;  1W7P B;  2QQB A;  1LEA A;  4PGG A;  4YG2 F;  3F3X A;  2CW0 F;  4E70 A;  5ILS A;  1TQM A;  3CUQ C;  2QWW A;  5TJJ A;  1YG2 A;  2IA0 A;  1IXS B;  4CXF A;  3MQ0 A;  3DPL C;  3U1D A;  5LEK A;  4A0Y A;  1UST A;  4HAM A;  4LK1 F;  1RUO A;  2HTS A;  1Y0U A;  3HOT A;  2D1H A;  1T0F A;  1YTY A;  1HBX G;  3I53 A;  4UVA A;  1IRG A;  2CFX A;  3I54 A;  2P5L C;  4ESF A;  1OR7 A;  2Q8K A;  4EGY A;  3NEU A;  2XAS A;  5BMZ A;  4AVP A;  1FC3 A;  2OZU A;  4ENK A;  1XGO A;  4WXH A;  3GW2 A;  2MLK A;  2Y75 A;  1YYV A;  4ENM A;  4GXO A;  3E6B A;  1F9N A;  3SXY A;  1B9N A;  1MJB A;  1R5H A;  5IT3 A;  2FXA A;  2W84 A;  1U5T C;  3Q5F A;  3C7J A;  2Z33 A;  3F8N A;  4EJV A;  1D8J A;  1BI3 A;  5F64 A;  1P6R A;  2KIF A;  1S7O A;  2OQG A;  2Z3Y A;  3ZMT A;  3K1M A;  3FMQ A;  1P92 A;  5ILU A;  2ZME B;  3K0L A;  4ZZL A;  2J5P A;  1T2K A;  1RZ4 A;  5DDG A;  4G7O F;  2JRT A;  1SD6 A;  2HKX A;  3FHZ A;  5E17 F;  1TTY A;  2DLL A;  2Y48 A;  1IN4 A;  2CSO A;  4G7Z F;  1FOK A;  5BPI A;  4JBA A;  2FBI A;  3WE2 A;  2Q0O A;  3BWG A;  4CO8 A;  1MKM A;  2L01 A;  3HHG A;  4L0Y B;  3FXR A;  4RGS A;  1BOA A;  2EFQ A;  2XAH A;  3KET A;  3MWM A;  4MNU A;  2O0Y A;  2PBI A;  5E20 A;  4ON0 A;  3I4P A;  2D45 A;  4M73 A;  4CGZ A;  3EQL F;  2H6C A;  4P55 A;  2YU3 A;  2L4A A;  5FD5 A;  1P4A A;  2NNN A;  2MD5 A;  2STW A;  3C1D A;  2FSW A;  1BIA A;  3LFK A;  2O6G E;  2DAO A;  3KFW X;  5H6R A;  3ABU A;  4G6Q A;  1U5T A;  4EM1 A;  5JVT A;  2G7H A;  4Q47 A;  4M74 A;  3TDZ C;  1B1B A;  3M9A A;  5K1Y A;  2VT3 A;  1F5T A;  4OMY A;  5EEH A;  1BC7 C;  4BHC A;  2HWV A;  1JE8 A;  2VXZ A;  3GVA A;  4XLN F;  2A69 F;  3BJ6 A;  4OIQ F;  2QUF A;  1WI9 A;  2H94 A;  4I0B A;  3KP5 A;  3EET A;  3KEQ A;  2NYX A;  4GCV A;  4L5J A;  2FBH A;  2VON A;  1D3Y A;  3O2P E;  1TQI A;  3FM3 A;  3P9I A;  3V7R A;  4IRG A;  1KA8 A;  5LEJ A;  3ERE D;  2ISY A;  3CLO A;  4A6D A;  1U2W A;  1R36 A;  2MBF A;  2P5V A;  2L54 A;  2R7D A;  5ICF A;  3T8R A;  1K78 A;  2F2E A;  4O5V A;  3WTS C;  5CVJ A;  3J80 Z;  3I0T A;  2F5D A;  1MGT A;  5DCM B;  2VBZ A;  1YIO A;  2OAZ A;  1XDU A;  2CWE A;  3K2Z A;  2M8E A;  4XRF A;  3CDH A;  2DQL A;  2MC3 A;  2QM3 A;  4HZF A;  1ZRE A;  1S7A A;  1FNN A;  2FBK A;  1FP2 A;  1WRJ A;  4OIP F;  2HGC A;  2W24 A;  2ZNZ A;  2KJB A;  3K9T A;  2FF4 A;  3WTV C;  1I1S A;  2W25 A;  1OMI A;  3IWZ A;  2DBB A;  1SFU A;  1I5Z A;  2DPU A;  2XRN A;  3P9C A;  5D5U B;  1T39 A;  1RI7 A;  1HW1 A;  4RB0 A;  3P9K A;  5LLQ A;  3HHH A;  4BH9 A;  3I71 A;  2QLZ A;  3Q9S A;  3CUO A;  2F5F A;  2A07 F;  3LA3 A;  4KMU X;  3I58 A;  5HS9 A;  4UUV A;  4I01 A;  2A5Y B;  2K27 A;  1STZ A;  4A6E A;  5DV5 A;  1SD7 A;  5ED4 A;  1KYW A;  3MZH A;  1YW8 A;  5HDN A;  3QU6 A;  2EFN A;  4KN7 X;  2KRF A;  3BJO A;  3E3V A;  2R3S A;  3R0J A;  2DK8 A;  1XSX A;  3H3U A;  2ZCW A;  2OZ6 A;  1LB2 A;  3T1B A;  1JHF A;  2CGP A;  2GAU A;  1ZN2 A;  3HSE A;  5FD6 A;  2V1U A;  3CO6 C;  2DO7 A;  4OIR F;  2ZKZ A;  3ZMV A;  1PUE E;  4UHT A;  3L09 A;  3C3W A;  1ZG3 A;  3I59 B;  4EM0 B;  1YS6 A;  2HTJ A;  5L3E A;  4FT8 A;  5JFR A;  4UXN A;  3ECH A;  2Q2E A;  5LHG A;  1OYI A;  4BNC A;  3T8T A;  5ICG A;  5LHH A;  2OD5 A;  3KEO A;  2GQQ A;  1MDM B;  2LF7 A;  4XLP F;  3LAJ A;  4G94 A;  2KIM A;  3GXO A;  1CF7 B;  3W6K B;  5ICE A;  2EK5 A;  4Z2Y A;  3V8L A;  3KLN A;  1BI1 A;  1W5S A;  4K2E A;  2YR2 A;  3TQN A;  1LDD A;  2V9V A;  4HV5 A;  1HXD A;  3DKW A;  4EJU A;  2EB7 A;  5HS7 A;  5HDG A;  1J7K A;  3T5X A;  3PFI A;  2CG4 A;  4KIF A;  3WTY C;  4B8X A;  1EH6 A;  2ZBK A;  3E6M A;  1DDN A;  1Z1D A;  3IRQ A;  1GXQ A;  2ISZ A;  1FP1 D;  4IXA A;  1K6O A;  2M30 A;  2XRO A;  3DPT A;  2A6E F;  4HX8 A;  1S8N A;  4FX0 A;  2DK5 A;  1G3Y A;  3LWF A;  1EH7 A;  2FRH A;  2PMH A;  1LJ9 A;  1IAW A;  4WWC A;  4IHS A;  2HDC A;  4WXC A;  3R0A A;  4LFU A;  2FMY A;  5BS6 A;  1W7P D;  4YFN F;  2QYO A;  2COM A;  2BEO A;  1I27 A;  3GUD A;  3KP3 A;  1R00 A;  1E2X A;  5FGM A;  4KDP A;  4L9V A;  2P7V B;  2L02 A;  2HYF A;  1O3S A;  1ZG5 A;  2K4B A;  3DF8 A;  1FBQ A;  4YIF A;  1OYY A;  2NRA C;  2A61 A;  2HEO A;  2PI0 A;  5IT9 K;  2JPB A;  1MD0 A;  1XSV A;  3K69 A;  3HSR A;  2EFO A;  3L00 A;  3ZMZ A;  4BHP A;  1FY7 A;  4LK0 F;  3CUQ B;  2XAJ A;  1KQ0 A;  4QWQ A;  3F21 A;  3IHU A;  4KMF A;  1ZAO A;  4CYD A;  1H9G A;  3WGH A;  3WU0 A;  1JXS A;  3HRT A;  4UV9 A;  4UV8 A;  1IUY A;  1XCB A;  1V3F A;  3QP5 A;  1WSU A;  1IW7 F;  2LF8 A;  3HTU A;  3J80 K;  1KU3 A;  2PLY A;  4DNC A;  1BN5 A;  5DD8 A;  4S05 A;  4LMY A;  4AIH A;  2QQ9 A;  5F6F A;  5BOX A;  3IC7 A;  1B59 A;  4ZYH A;  1FYL A;  2TDX A;  5ERI A;  3ZMD A;  1FYM A;  2RV8 A;  1DPU A;  3LAP A;  2XGX A;  4NHJ A;  1HSJ A;  2ETH A;  3ZN0 A;  5LGT A;  3DQV C;  3GEZ A;  3LA7 A;  3Q9V A;  2LNB A;  2R7F A;  1LQ1 A;  4L9N A;  1FBS A;  3VEP A;  2XVC A;  4FX4 A;  1U5T B;  1HW2 A;  5BPD A;  1ON2 A;  4N9I A;  1MZB A;  3N4M A;  2FNA A;  4R8H A;  2ELH A;  4IF4 A;  3VFZ A;  3GLX A;  4B09 A;  4MQ9 F;  4YII A;  2IA2 A;  3MCZ A;  1ZG1 A;  2CYY A;  4G6D A;  2IP2 A;  3WGI A;  2BE5 F;  2XAF A;  3E5X A;  3F8M A;  4LLN A;  4D0P A;  2M87 A;  2XV4 S;  1BI0 A;  2O8X A;  3HYI A;  4L18 B;  4AWX B;  1ZHF A;  4IRI A;  2FEZ A;  4ESJ A;  2H09 A;  5ICC A;  4CHU A;  5HLI A;  1IXR C;  3JSP A;  1BJA A;  1YQA A;  1TW3 A;  3F72 A;  2H27 A;  3U2R A;  2K7L A;  1TLH B;  4L5I A;  1QZY A;  3EYI A;  5J8C A;  4HDU A;  3P7N A;  1W7P A;  5JR3 A;  1W5T A;  3M1E A;  2GWR A;  2WC2 A;  2ESN A;  2BBY A;  4G7H F;  1ZRC A;  3ZPL A;  3ABT A;  4RGR A;  2ZXJ A;  4IVN A;  4EJO A;  2IPQ X;  2EV6 A;  3V4G A;  3OV8 A;  2EFP A;  2FML A;  4ENN A;  3MAJ A;  3V7C A;  1B6A A;  4M6X A;  2K86 A;  1FSH A;  4I2O A;  3R61 A;  4N0B A;  3WE3 A;  3R4K A;  3C18 A;  3QU3 A;  2VE8 A;  2RN7 A;  3QPT A;  2QBY B;  3R60 A;  1RUN A;  2DU9 A;  2XIG A;  1C0W A;  4A12 A;  3B02 A;  4P9F A;  2JT1 A;  3M8F A;  1P4W A;  1B4A A;  4GO1 A;  3BRO A;  1JHH A;  1XSD A;  2WWY A;  3TO6 A;  1A04 A;  3FXU A;  1AOY A;  3ZMU A;  5ILV A;  4H0E A;  2ACJ A;  3KZY A;  5CVV A;  3F22 A;  2Z99 A;  1Z9C A;  1KYZ A;  4EQQ A;  4RB2 C;  4G8X A;  5AON A;  3BP8 A;  5LGN A;  1LDJ A;  1XD7 A;  3FXQ A;  4R79 A;  1F4K A;  4AD9 A;  1IN7 A;  2GXB A;  1PP7 U;  2HFH A;  4UNO A;  2RC4 A;  2ZME A;  3WTZ A;  2L3D A;  1ZYR F;  3ECO A;  4PGH A;  4MHG A;  2ESH A;  3QAH A;  1J75 A;  1H0M A;  1ONV A;  1QQI A;  3F8B A;  3BJA A;  2PG4 A;  3RYR A;  1G3T A;  5CYV A;  1S3J A;  2KKO A;  5J8F A;  5HVQ C;  2HYG D;  3WOD F;  1ZRD A;  4RGX A;  1G3S A;  1TW2 A;  3I64 A;  3BDD A;  4LG0 B;  4I02 A;  2VOD A;  1F1Z A;  2QZ8 A;  5D4R A;  4MTD A;  4DQ2 A;  2P7C B;  1UFM A;  1HQC A;  2STT A;  2PN6 A;  2HR3 A;  2EFW A;  1J2X A;  2AXL A;  2VC0 A;  2XHK A;  5L3D A;  2F5C A;  1ZAR A;  2VBW A;  1IRF A;  1R5G A;  3GZ6 A;  4A2U A;  1KQ9 A;  3FF5 A;  1YFH A;  2YSR A;  4LD5 A;  3PQK A;  3LST A;  1XMK A;  4M72 A;  1DP7 P;  3L7W A;  1D8K A;  3LQQ A;  3WU1 B;  3WTW C;  3HTS B;  4LB6 B;  2RVC A;  2Y0M A;  2KJC A;  3CO7 C;  1R7J A;  3ZMS A;  3BOQ A;  2X0L A;  1L0O C;  2WTE A;  5H20 A;  3RDI A;  1REP C;  1D5V A;  1K7A A;  4I98 B;  4IRH A;  4KUM A;  1J9I A;  1ZGJ A;  3FZV A;  1KQ8 A;  3E6D A;  2GXG A;  1XMA A;  2O61 A;  5FFX A;  4OMZ A;  5DCM A;  2F5E A;  3KCC A;  5HLH A;  1YW7 A;  1IN5 A;  2QQA A;  1FWZ A;  5FO5 A;  1U6G A;  2UXX A;  1Z7U A;  4U88 A;  1ZH5 A;  2PFB A;  4HF2 A;  3RIR A;  2PQ8 A;  6PAX A;  3KP7 A;  1HW5 A;  2YX4 A;  4A5N A;  3RKW A;  1SD4 A;  2LDU A;  1YLF A;  4WK8 F;  4LJZ F;  2NS0 A;  3TKY A;  2D1V A;  2X4H A;  2C6Y A;  2HOE A;  3CJN A;  5LRR A;  1XGM A;  3GF2 A;  2VOO A;  1T98 A;  3DP7 A;  2DPD A;  4EVI A;  1BBY A;  1XGN A;  2XKO A;  1HST A;  1Q1H A;  2WV0 A;  3GFI A;  1G3W A;  4MEX F;  3MZY A;  3MEX A;  2YPR A;  4G9Y A;  4EGZ A;  4IJA A;  3GX4 X;  1J59 A;  1ZLK A;  5D8L B;  2IRF G;  3R6S A;  2OU2 A;  3TGN A;  1U78 A;  1O3T A;  1FYK A;  1QGP A;  3EUH A;  3H3Z A;  4L9J A;  2JPC A;  3ML6 A;  1Z6R A;  4Q5S F;  2QEN A;  3HOS A;  2P5K A;  5K5O A;  1SD5 A;  2RNJ A;  4O6J A;  4A5M A;  2M1B A;  1OPC A;  2DQR A;  3RKY A;  4GYI A;  4Y17 A;  3KP6 A;  3NRV A;  1X3U A;  4U0Y A;  2GA1 A;  3M8E A;  3SZP A;  5L3B A;  4MEY F;  3BPV A;  4PDK A;  4HX4 A;  4IHT A;  1QO0 D;  3HRS A;  4XSZ F;  3QOP A;  1HKT A;  4Q48 A;  4HOB A;  3F6O A;  2OQR A;  2EV0 A;  3TOA A;  4CZZ A;  3KLO A;  3BPX A;  3ISP A;  3B73 A;  3I59 A;  5AIQ A;  3JAM Z;  1PP8 F;  4BHB A;  5DEQ A;  2P6T A;  4LB5 A;  1UCR A;  5AIP A;  4OIN F;  1GHC A;  3V8K A;  1Z91 A;  3T0Y A;  3QP6 A;  2HS5 A;  4XSX F;  1R1T A;  5HOO A;  3E5Q A;  4RB1 A;  1MDM A;  3BZ6 A;  1IZ1 A;  4KIB A;  2E7W A;  2G7U A;  4Y15 A;  1DUX C;  1CF7 A;  4L0Z B;  1LEB A;  3RPQ A;  2HQN A;  4OIO F;  3N97 A;  2OA4 A;  4LGW A;  5K5R A;  1L3L A;  5A2Q Z;  3G73 A;  5CVI A;  2VBX A;  1LVA A;  3COA C;  5D4S A;  4Y13 A;  3DXJ F;  1K79 A;  3DV8 A;  2IW5 A;  2B0L A;  1ON1 A;  4L9T A;  2ZO4 A;  5H6Q A;  5TRD A;  3D0S A;  1MJ9 A;  5DUK A;  5DD4 A;  3EDP A;  4NB5 A;  2OBP A;  2FE3 A;  1S29 A;  4HLX A;  4BXU A;  2M45 A;  2GZW A;  3IWF A;  3RYP A;  2RGV A;  3RTR A;  2J5O A;  4BAY A;  5JHU A;  4WF2 A;  2JTV A;  5FFZ A;  3GFL A;  5HLG A;  4TV7 A;  2FA5 A;  4WCG A;  1XCV A;  4KN4 X;  3V8J A;  2E1N A;  1PDN C;  2FNP A;  1QPM A;  5D5W B;  3JW4 A;  2FU4 A;  5CJ9 A;  1AWC A;  4LLG F;  5FB2 A;  3GZ5 A;  4YFK F;  1XGS A;  2ADU A;  2NNY A;  4HBL A;  3L2C A;  5BQT A;  5L3F A;  3OOP A;  4MQV A;  4EMS A;  2UZK A;  2RDP A;  5E1X A;  1SFX A;  1SMY F;  1SFE A;  4MTE A;  4CDG A;  3O3K A;  3QPH A;  1NHA A;  2PMU A;  1DPR A;  1KGS A;  1K78 B;  1KU7 A;  1JGS A;  4QLC U;  4ZYE A;  4S04 A;  5CVU A;  3RKX A;  5D5V B;  1IN8 A;  2NAZ A;  3CUQ A;  2P6S A;  3H92 A;  2DI3 A;  1R1U A;  2EV5 A;  2DTR A;  4HQE A;  4HF1 A;  4KFC A;  4N9H A;  4ETS A;  3WG9 A;  4JK1 X;  3WGG A;  3F23 A;  2VBY A;  2KIU A;  3E5U A;  4M71 A;  3TO7 A;  5DUI A;  1SMT A;  1EH8 A;  3J81 Z;  1KU9 A;  3K1N A;  2ZJ2 A;  5E8G A;  1FT9 A;  1WQ2 A;  1E17 A;  2YX7 A;  4HW0 A;  3HIF A;  4HLY A;  4HV6 A;  4OU0 A;  3HUG A;  1FBU A;  3VOD A;  3GYH X;  1R22 A;  1O7L A;  3IKT A;  1TNT A;  1BI2 A;  1HKQ A;  3J7A O;  4RB3 C;  3I5U A;  4ZYD A;  3IRR A;  2PEX A;  4KNY A;  3EYY A;  1XDS A;  1XB4 A;  1G6N A;  3K1P A;  4P9U A;  2EA4 A;  3F8C A;  1GXP A;  5J6X A;  1ZLJ A;  1IF1 A;  3FM5 A;  4U0V A;  2MA3 A;  4PZJ A;  2E1C A;  5KK1 A;  3LQR A;  4GGG A;  2XAG A;  4ZZD A;  4WX9 A;  1YW9 A;  1Z05 A;  3IL2 A;  1LDK B;  3V7S A;  4F7Z A;  2IT0 A;  3TDU C;  1BC8 C;  3ELK A;  5D6F A;  2ZNY A;  3U9G A;  5IT9 Z;  2VN2 A;  2EJR A;  1HKS A;  1R1V A;  2W57 A;  3DFG A;  3ROU A;  2EA2 A;  5FLX Z;  5D5X B;  1O3Q A;  2VOP A;  1BIB A;  1R23 A;  1UB9 A;  1QBJ A;  4EM2 A;  1P4X A;  2IA1 A;  3O6B B;  1RIO H;  4RS8 A;  1ZGA A;  1FZP B;  2D2W A;  2XKP A;  3FWE A;  2BV6 A;  3FMS A;  3L9F A;  4ENJ A;  2A6H F;  2HQR A;  1P2F A;  2XAQ A;  2GIV A;  3CTA A;  3IKV A;  1FSE A;  2DW4 A;  2P8T A;  5DCF A;  4FHT A;  1O3R A;  4ESB A;  4HF0 A;  1QZZ A;  4U7B A;  2QVO A;  3JAM K;  4HDV A;  1VTN C;  5HDK A;  1MJA A;  4BQA A;  4YFX F;  2V6C A;  4OOI A;  2K02 A;  3E6C C;  4RGU A;  4UVB A;  1I1G A;  2PJP A;  3E97 A;  3HRU A;  3NQO A;  1WWX A;  3AAF A;  1YS7 A;  4GYG A;  2E7X A;  4A0Z A;  2BGC A;  3W6J B;  1FLI A;  3S2W A;  2LKP A;  2RKH A;  1TBX A;  2BYV E;  3SZT A;  3QRF F;  5K5Q A;  1FX7 A;  4UVC A;  3TOB A;  1T6S A;  3ZP5 A;  2QBY A;  4M6Y A;  5CLS A;  2P4W A;  5L3G A;  5A2Q K;  2FQ3 A;  5E8I A;  3GFM A;  2IJL A;  1KU2 A;  1J0R A;  3RJP A;  4ZH4 F;  4U7D A;  4HX7 A;  1YO5 C;  3MFK A;  1H9T A;  2K4J A;  4HQM A;  2HZT A;  5EEG A;  1SAX A;  3KZZ A;  4AIK A;  1I6X A;  4KIC A;  2CQK A;  4IPA A;  2V79 A;  5E18 F;  1U8R A;  5D8K B;  1ZRF A;  1IN6 A;  5F1R A;  4I7H A;  4KT5 C;  1J5Y A;  3D5L A;  2UWM A;  2O3F A;  2ZFW A;  2G9W A;  2MH9 A;  2JZY A;  4O3M A;  5E1Z B;  3JSO A;  1LNW A;  2VC1 A;  5HS8 A;  3ZQ7 A;  2A3S A;  4M9X A;  3SFZ A;  4EV0 A;  3WTT C;  2CO5 A;  2IVM A;  4LG0 A;  1G4D A;  3FX3 A;  1TQP A;  2MLG A;  1CGP A;  1QNT A;  1OKR A;  1WKM A;  2AS5 F;  4MGR A;  5D6E A;  1TNS A;  1UHM A;  3KE2 A;  1BM9 A;  4I09 A;  1Z6T A;  3ULQ B;  3SQN A;  3GWZ A;  5LBQ A;  4U0W A;  2LSO A;  4M9Z A;  3REO A;  2JSC A;  3BY6 A;  2UXN A;  3KP2 A;  4RAZ A;  3J81 K;  3GO5 A;  3F8F A;  1R58 A;  3VB2 A;  3TO9 A;  1IXC A;  5LGU A;  4HA8 A;  3F6V A;  4PCQ A;  2M5W A;  1GVJ A;  4A0X A;  1OYW A;  5LRS A;  2V1D A;  5DYM A;  3WTX C;  4I0A A;  4ASN A;  2FOK A;  3LA2 A;  3G3Z A;  4EJW A;  2W85 A;  3WTU C;  2L4M A;  1ULY A;  4JQF A;  3RPU A;  4XBF A;  4CIC A;  1U3E M;  2EWN A;  3HRM A;  4KYW A;  2RQP A;  2DFI A;  2H6B A;  4ZYG A;  4BYY A;  3PQJ A;  4RAY A;  1FPQ A;  4LLL A;  5L3C A;  1W4M A;  2XUB A;  4Q4Z F;  3ZN1 A;  3M7G A;  2O03 A;  4R1H A;  3SHF A;  5E1W A;  3KP4 A;  1V4R A;  4P96 A;  3GFJ A;  1B9M A;  1O7F A;  2V1X A;  4M9S A;  4AIJ A;  4KIG A;  4HYE A;  2A68 F;  3HSF A;  3RI4 A;  1RNL A;  1O57 A;  5CVR A;  2MH2 A;  5JI6 A;  4KA4 A;  1XN7 A;  2GA2 A;  2VT2 A;  5FLX K;  1UHW A;  2VE9 A;  3JTH A;  3JTG A;  2Z9O A;  1EV7 A;  1T38 A;  1ODD A;  1USS A;  5LHI A;  3DEU A;  2Z5U A;  4NQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...