4CO8A

Structure of the dna binding ets domain of human etv4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
MRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords ETS TRANSLOCATION VARIANT 4
total genus 31
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4co8A00
2ZXJA 4B09A 3C1DA 2VT2A 5E1WA 2F5EA 3EYYA 3KE2A 2DQRA 3HSFA 2UXXA 2XAJA 3HIFA 4UV9A 2RVCA 2DBBA 2P5VA 3K2ZA 5CVRA 2OBPA 2DK8A 3WG9A 1S8NA 2CWEA 2P7VB 1XCVA 3JAMK 3M1EA 1YG2A 5F1RA 4MQVA 3EYIA 1KYWA 1ON1A 4IHSA 2QUFA 2E1CA 3T5XA 5HLHA 1W7PD 2FBKA 4O6JA 3RTRA 1OPCA 2DAOA 1EH6A 4HX7A 2QZ8A 3GF2A 4ON0A 4RB1A 2PQ8A 5FD5A 2F5DA 4ZYEA 5BPDA 1WWXA 3HRTA 4EGYA 4L5IA 3H3UA 1J7KA 3BROA 4IRHA 3K9TA 4G9YA 1JHFA 1B4AA 2IA2A 5JHUA 1FYLA 3HHHA 1D8KA 1UHWA 1AWCA 5ED4A 3VB2A 1I1GA 2DQLA 2K27A 2L4AA 2CG4A 4Y17A 2A07F 4ZYGA 1JE8A 4LB5A 3V8KA 2Q8KA 3NQOA 1E2XA 1U2WA 1I1SA 1BOAA 1W7PB 2FNPA 4MTDA 2YX4A 2OQGA 4UUVA 3G73A 3U2RA 1J0RA 2XAFA 3M8EA 1Z6RA 5LEKA 2K4BA 2GIVA 2XASA 1R00A 2PN6A 1QQIA 2LNBA 2QYOA 5CVJA 1OKRA 3HOSA 4ESBA 4WXDA 4HF0A 3IKVA 3ZMZA 2ADUA 3I0TA 2AXLA 3KP7A 4L0ZB 4U7BA 4I2OA 1ODDA 1XD7A 3EDPA 2NS0A 3LFKA 4JBAA 2RQPA 2RKHA 2A61A 5K5RA 4UXNA 2RNJA 1SFEA 2GA1A 2STWA 4Q48A 4LG0B 1FBUA 5D4RA 4P55A 1R23A 4IVNA 3N97A 2XIGA 1QNTA 3DKWA 1K78A 3I54A 2XKOA 3H92A 3JTHA 2JRTA 3I64A 5FFXA 1ONVA 3QPHA 2JPBA 5D8LB 3FZVA 1JXSA 3E6BA 2EA2A 3HUGA 1IN7A 4CGZA 2FA5A 2G7HA 3TOBA 2BEOA 5LGUA 2XV4S 4A0YA 2M5WA 3F8FA 2Q0OA 2LSOA 1D3YA 4G8XA 1R5HA 1SD5A 5TJJA 5EEHA 2HTSA 5LLQA 3VODA 2QQ9A 1SD4A 4HDVA 3ZQ7A 3IC7A 1D8JA 2LF7A 2NNNA 3DF8A 3KP5A 2HZTA 1G3YA 4BYYA 3R0JA 5K5QA 1ZN2A 3O3KA 4UVAA 4LJZF 4ZZLA 1IN4A 3IHUA 5JFRA 5E17F 3V7RA 1W5TA 5DUKA 5K5OA 2BBYA 2ZNZA 3ZN0A 2ZKZA 1CGPA 2EV6A 2DW4A 3I59A 1P6RA 1NHAA 2XRNA 1Z7UA 2VONA 4I09A 5H6QA 4EJTA 3FM3A 2UXNA 1E17A 1RI7A 2HKXA 1UHMA 2HOEA 1R5GA 3GLXA 2Z5UA 2O0YA 3ZMDA 4A6DA 1ZG1A 3COAC 2RV8A 2IRFG 1BI0A 1JHHA 1U3EM 5D5VB 3K69A 1EH8A 1HKQA 2VBXA 3WGHA 1J9IA 1HSTA 4XBFA 2HWVA 1KA8A 1ZGAA 1V4RA 1ZRDA 3KP4A 3BPVA 1AOYA 2BYVE 1LNWA 1S7OA 5IT9Z 3SFZA 2OQRA 1CF7B 3SQNA 4BNCA 1J59A 1BM9A 1TW3A 4XSXF 2Z33A 1XCBA 5ILUA 3K1PA 3KLOA 4KA4A 1G3SA 4G6DA 4ASNA 1D5VA 3GUDA 2OA4A 2OD5A 1O3RA 2EV0A 5DCMB 1Z9CA 2P8TA 1FX7A 1TTYA 3QAHA 3I5UA 2FRHA 1ZRCA 3TO6A 1B9MA 1J75A 4LB6B 3F3XA 2M30A 3L2CA 2R3SA 2PG4A 4YFXF 2M87A 3ZPLA 3WTWC 5DCFA 3GFMA 3QPTA 2IJLA 1IN5A 2GA2A 3GW2A 1TQMA 2FF4A 3E3VA 2KJBA 3NRVA 3GZ5A 3RKWA 2DU9A 1YW7A 1Z91A 5DD4A 1MJAA 4HV6A 4GYGA 3F8NA 2ZO4A 2IW5A 5ERIA 1BJAA 4EM2A 4P9UA 3LWFA 2L01A 2W57A 3RJPA 1ZLJA 3TOAA 2ZNYA 1YW8A 1ZHFA 4HF2A 1FBQA 4MEXF 1FT9A 4E70A 3GX4X 5ICEA 2VBYA 4F7ZA 4HYEA 1KU7A 4YG2F 2LF8A 1K79A 5LGTA 1ZG3A 4HLYA 2DFIA 3T8RA 4N9IA 4YFNF 4Q5SF 4I0BA 2V1DA 2FBHA 3HOTA 1K7AA 3ECHA 2XKPA 2ETHA 3O6BB 1ZH5A 3R61A 5LRSA 2FOKA 3U9GA 3V8JA 3TKYA 5L3FA 2A69F 2FQ3A 2COMA 2O8XA 1IUYA 3E97A 3L7WA 3MCZA 1QZZA 1P92A 2BV6A 1LJ9A 4ZYDA 3RKXA 1XMAA 2P5LC 4KFCA 5L3CA 2VBWA 4KUMA 5KVRA 1U5TB 2EFNA 2A5YB 5DV5A 3GFJA 5BS6A 5D8KB 1DPRA 4IJAA 3GFLA 1V3FA 2V9VA 1IXSB 3FWEA 3BJOA 1FZPB 3LAJA 3R60A 1S29A 1LQ1A 3K1NA 2K7LA 4R8HA 1KQ9A 5ICFA 3V4GA 5KK1A 1P2FA 2GQQA 4U88A 1H9GA 3WE2A 5JVTA 2EFOA 1RUNA 1KU2A 2FBIA 5CVUA 3G3ZA 2MH2A 4UNOA 1IXCA 4KMFA 4EQQA 5F64A 3M7GA 4I01A 1QGPA 3HYIA 3E5UA 2EB7A 1W5SA 2MC3A 1TNSA 1O7LA 1F5TA 2Q2EA 5FFZA 3OOPA 3WGGA 1I5ZA 5HDKA 1MD0A 1OR7A 3RPUA 1ZREA 1RNLA 3FMQA 2DPUA 1IZ1A 3I58A 4WX9A 2DT5A 4MEYF 3CTAA 4GGGA 4O5VA 1JGSA 3GYHX 3GO5A 5CVIA 1P4AA 2K02A 4IRGA 4NB5A 2V79A 4G94A 2VC0A 1IF1A 2HKOA 2ZMEA 1RZ4A 2EFPA 5FD6A 2RGVA 1KU9A 4BHPA 3WGIA 4UV8A 3EQLF 4BHCA 4NHJA 3WTTC 5LHGA 3KZZA 4JK1X 3RI4A 4RB3C 2A68F 2WTEA 1SFXA 2CFXA 4RGXA 3VFZA 3ML6A 1I6XA 2E1NA 5DEQA 1LDKB 1XSXA 2W85A 2P6TA 3RPQA 4LG0A 2GZWA 3FXUA 4M71A 3BZ6A 1ZAOA 2NYXA 4HF1A 2ACJA 4OIPF 2H6BA 5F6FA 2FSWA 1R1UA 4XRFA 3S2WA 4ESFA 1K78B 1L0OC 4PGGA 2QWWA 1LDJA 1XB4A 3CUQA 2DO7A 4IHTA 3HSRA 4KIFA 1RUOA 1FY7A 3ZMTA 4M6YA 2QM3A 1S6LA 2E7XA 4UVBA 4KICA 3QU3A 3KEQA 4KNYA 3V7CA 4BHBA 2PBIA 4XLPF 3CUQC 1ZARA 1HW2A 4HZFA 3VEPA 1MJ9A 3IRQA 5K1YA 4EGZA 3BP8A 1U5TC 3GEZA 1DDNA 3LSTA 1WRJA 4LLLA 1PDNC 1YO5C 1PUEE 1OYYA 3WE3A 4PDKA 4LK0F 1ZRFA 3ELKA 4AWXB 4HX4A 5CYVA 4ENKA 1IAWA 3HHGA 4R1HA 3R0AA 4H0EA 2XUBA 1I27A 3C3WA 3JW4A 1BN5A 2AS5F 3F6VA 4GYIA 2O03A 1FYMA 1O7FA 2PMHA 5JI6A 3ZMSA 4A2UA 2OAZA 2EWNA 3SXYA 4QLCU 5IT9K 2H09A 2OZUA 2FU4A 2CW0F 2NRAC 1YQAA 1R7JA 4A5MA 4HAMA 4IF4A 2GXBA 2RC4A 2XAHA 1UCRA 4DNCA 2O6GE 4EM0B 3I53A 1T98A 4BAYA 2ESHA 2P7CB 5DD8A 1KU3A 1IN8A 1G3TA 3EETA 4I98B 2VE8A 3Q9SA 1OYIA 4MQ9F 2E7WA 4RGRA 1S3JA 3BWGA 2FEZA 3F72A 5D5WB 5LRRA 1T2KA 2V1XA 2D1HA 2OU2A 3MZHA 3DPTA 3WTUC 3IRRA 3BJAA 5J6XA 2IT0A 5DCMA 5L3BA 2TDXA 1T38A 1U78A 1HXDA 3KP6A 2G9WA 3TQNA 4G7ZF 4MTEA 2KIUA 3R6SA 4YIFA 4HW0A 4HBLA 1J2XA 4CHUA 4HX8A 3ABTA 3GZ6A 3FHZA 2MA3A 5CVVA 4I02A 1Q1HA 4I7HA 1YIOA 3M8FA 5D4SA 3IWZA 3P9KA 3MAJA 2W24A 2RN7A 3WTYC 5A2QK 1BI2A 2WV0A 4ESJA 4IPAA 4WWCA 3JTGA 3R4KA 2XROA 4OIOF 2ESNA 2XHKA 1EV7A 2PJPA 4RGSA 5HLGA 2W25A 5LGNA 2ZBKA 4IXAA 4P5OA 5D6EA 5HS7A 3CO6C 4M9SA 1Z1DA 3DPLC 4IRIA 3SZTA 5L3EA 5AIPA 2A3SA 1SD6A 4O3MA 2PMUA 5HVQC 1W4MA 4EJVA 5HOOA 2K86A 3PQJA 5IT3A 4Q47A 2WWYA 1QPMA 2FNAA 3OV8A 2MLGA 1XMKA 3TO7A 2ZCWA 2W84A 5HS9A 3PQKA 1IXRC 2HDCA 2FXAA 4HQMA 1EH7A 2QLZA 6PAXA 2XAGA 3LAPA 3HSEA 3TO9A 3FXRA 3KZYA 3F6OA 2J5OA 2CSOA 2LDUA 2FE3A 1SMYF 2HQRA 5E8IA 4ZZDA 1FC3A 1U6GA 3ULQB 2F2EA 2M45A 3QP6A 1LVAA 1G4DA 3QRFF 2EFQA 1TQPA 4WXCA 4L0YB 3DEUA 3SHFA 3JSOA 3J7AO 4G6QA 1KGSA 4ETSA 2EK5A 1G3WA 2JT1A 4KN7X 4OMYA 4NQWA 5J8FA 2P4WA 1SMTA 2L54A 3KEOA 3MQ0A 4L9VA 2F5CA 1K6OA 2ZFWA 4CICA 4CXFA 1GXPA 1BI3A 2HFHA 1R22A 2HR3A 3BDDA 3FX3A 1F9NA 1R36A 1LDDA 2DI3A 3K0LA 4CDGA 1R1TA 3ERED 3E6DA 3RDIA 4BXUA 4B8XA 2V6CA 4KYWA 2VBZA 4Z2YA 3WTSC 2PFBA 1XDUA 2EV5A 2D1VA 2QBYB 3RKYA 2ZMEB 2ZJ2A 3GWZA 2KIFA 5E18F 4TV7A 5DUIA 2GXGA 2QENA 4U0YA 2HQNA 3IWFA 4L5JA 1B1BA 1BIAA 5DDGA 3RYPA 1BBYA 1B6AA 2EFWA 5FGMA 1G6NA 3LA7A 1FP1D 3D5LA 1HSJA 1WQ2A 1H9TA 3F8BA 3MFKA 4HQEA 2CQKA 2STTA 3I71A 2EJRA 1TBXA 3H3ZA 5LHHA 4G7OF 4M6XA 4XLNF 1QZYA 1WSUA 2YX7A 2P5KA 5JR3A 2HYGD 1O3TA 1Y0UA 3AAFA 3B73A 1MJBA 3BPXA 3J81Z 5HLIA 1C0WA 2VOPA 1TQIA 1RIOH 1MKMA 2OZ6A 4U0VA 3GVAA 4RAZA 3WU1B 4YIIA 3L00A 4HOBA 4MHGA 3WODF 3F8CA 1GHCA 2IA1A 4RB2C 3P9IA 4GCVA 1FLIA 3BJ6A 2YU3A 3WTVC 1HBXG 4WCGA 1XSVA 3HRSA 2MD5A 2VE9A 4LD5A 4RS8A 2J5PA 3ZP5A 4EJOA 4MNUA 3Q9VA 5LHIA 5E8GA 1A04A 2HS5A 1PP7U 3TGNA 2VODA 5LEJA 3B02A 4Q4ZF 4FX0A 1ZLKA 1SD7A 4L9NA 2PEXA 2DK5A 3FXQA 1BIBA 1KQ8A 4LLNA 5ILSA 4RGUA 1R58A 4A12A 2H94A 1HQCA 3FM5A 3LQQA 4N0BA 5DYMA 3HRMA 3ISPA 1SAXA 2NNYA 3F23A 5HDGA 1DUXC 5FLXK 2V1UA 4WXHA 1YLFA 1W7PA 1R1VA 3HTSB 1KQ0A 2MBFA 4Y15A 1LEAA 3KP2A 4M9ZA 2Z99A 4AIHA 3VOEA 3MWMA 3TDZC 4WF2A 1FOKA 2VOOA 4LMYA 1LEBA 3W6JB 5FB2A 4OMZA 1TLHB 4AVPA 3I59B 3C18A 2D45A 1YFHA 2X0LA 1MGTA 2CYYA 3CUQB 4WK8F 2Z3YA 2IVMA 3WTZA 1HKTA 3BY6A 1YS6A 3CJNA 2H6CA 3V8LA 4AD9A 2UWMA 5J8CA 2R7FA 4LFUA 4ENMA 3T0YA 2JTVA 1FPQA 1MZBA 4LK1F 4BQAA 2P6SA 1ZGJA 1X3UA 1FSEA 1P4XA 1XGSA 3RYRA 1LB2A 2GAUA 4KIBA 1WKMA 2XAQA 4EMSA 1CF7A 1PP8F 5D5UB 4KN4X 4EJWA 4P9FA 2VT3A 2WC2A 5A2QZ 3DV8A 3MEXA 1BI1A 4N9HA 3J80Z 4L18B 2VXZA 4U0WA 1ZG5A 2O61A 1HKSA 2Y48A 1XSDA 3ZMUA 3F22A 3ABUA 1YTYA 3DP7A 4MGRA 5H20A 4KMUX 3J81K 2PI0A 1O3QA 5E1ZB 3HRUA 4AIKA 1DPUA 1Z05A 4OINF 2M1BA 1ULYA 1USTA 1Z6TA 2HYFA 3LQRA 4HA8A 2Y0MA 5AONA 2MLKA 1XDSA 1USSA 2YSRA 4OU0A 5CJ9A 5FO5A 1U8RA 2HEOA 3QU6A 2EA4A 2DLLA 3T1BA 2KJCA 3P7NA 1O57A 4ZYHA 1T39A 2KKOA 2Z9OA 3L9FA 4EJUA 2H27A 2D2WA 3M9AA 4L9TA 4UVCA 2QBYA 5L3GA 2JZYA 2JPCA 3C7JA 2BE5F 2YR2A 2XVCA 4QWQA 4PZJA 2LKPA 4PGHA 2KRFA 3D0SA 3PFIA 1YS7A 1OMIA 5FLXZ 3QP5A 3K1MA 3KETA 2QQBA 4HDUA 1HW1A 5D5XB 4KDPA 1B59A 5BQTA 2L4MA 4XSZF 3P9CA 3DQVC 4A6EA 3E5QA 3F8MA 3REOA 4AIJA 4EV0A 3IKTA 5CLSA 4CO8A 3LA3A 1HW5A 3FF5A 1GXQA 3KP3A 4ZH4F 3ROUA 1U5TA 4CZZA 3E5XA 5AIQA 1F1ZA 1TW2A 4OOIA 4M72A 1MDMA 2KIMA 4M73A 2Y75A 1DP7P 3CLOA 4A0XA 2MH9A 4M9XA 1FBSA 2IA0A 2NAZA 1ON2A 1WI9A 1P4WA 5BMZA 3Q5FA 2DPDA 1XGNA 4GO1A 4YFKF 1QBJA 4UHTA 3N4MA 4R79A 4S05A 3WTXC 2XGXA 4JQFA 4RB0A 2CGPA 2VN2A 1VTNC 4OIRF 3J80K 4ENNA 3GXOA 3NEUA 3MZYA 4CYDA 3RIRA 4ENJA 3SZPA 2ISYA 3V7SA 1B9NA 3ZN1A 2ISZA 3ZMVA 4LGWA 3DFGA 1L3LA 1IRFA 3E6MA 1MDMB 3HTUA 2RDPA 4GXOA 4HV5A 3T8TA 1KYZA 4RAYA 2BGCA 3DXJF 2GWRA 1FNNA 3BOQA 5BOXA 5ICGA 2ELHA 1T6SA 2A6HF 3ECOA 4BH9A 1GVJA 1OYWA 2IPQX 3O2PE 2C6YA 1IRGA 5TRDA 2M8EA 4LLGF 2R7DA 1XGOA 3EUHA 2JSCA 1QO0D 1T0FA 4FT8A 2IP2A 1FYKA 4K2EA 5BPIA 5HDNA 2F5FA 4FHTA 5E1XA 1IN6A 4EVIA 1YYVA 4S04A 5H6RA 1XN7A 4D0PA 4HLXA 3KCCA 3KLNA 3TDUC 2G7UA 2CO5A 3QOPA 2FMLA 3W6KB 3GFIA 5LBQA 4OIQF 1ZYRF 5D6FA 4DQ2A 2HTJA 1YW9A 1J5YA 5HS8A 3I4PA 1FSHA 3KFWX 3CUOA 3CDHA 3E6CC 4G7HF 3WU0A 4P96A 1BC7C 2A6EF 3F21A 1IW7F 2QVOA 1FP2A 2X4HA 1H0MA 2L02A 4M74A 1BC8C 3CO7C 1STZA 4A0ZA 1SFUA 3JAMZ 2VC1A 2HGCA 5L3DA 3U1DA 4FX4A 1UB9A 5ICCA 3LA2A 2B0LA 2YPRA 3FMSA 1F4KA 3FMRA 1XGMA 2L3DA 2O3FA 4KT5C 3JSPA 3L09A 2FMYA 4EM1A 2K4JA 1O3SA 4PCQA 4L9JA 4A5NA 4U7DA 2DTRA 1REPC 2QQAA 4Y13A 3IL2A 4KIGA 5E20A 4I0AA 5ILVA 5EEGA 2UZKA 1UFMA 1TNTA 1FWZA 2PLYA 1S7AA
chains in the Genus database with same CATH superfamily
2ZXJA 3CC7I 4B09A 2DYSH 3C1DA 2VT2A 4JOMA 1BR1A 1ZELA 5E1WA 2F5EA 3EYYA 3KE2A 2DQRA 4BL0B 2X6WA 3HSFA 2UXXA 1FOYA 2VASA 2XAJA 3HIFA 1Z7LA 3SJMA 1O4XA 4UV9A 1ETXA 2VUMJ 1WJ5A 2RVCA 3AKZA 2DBBA 2P5VA 3K2ZA 5CVRA 2OBPA 2DK8A 5IYBJ 3WG9A 1S8NA 2HYJA 4II2A 3G2BA 3H9JA 2CWEA 3J7AY 1DU6A 2P7VB 5DTDA 3OYGA 1XCVA 3O8HA 3M1EA 3JAMK 4FASD 2XPUA 1OISA 1YG2A 5F1RA 5M3MJ 4MQVA 2CH0A 3EYIA 1RRJA 2ME6A 5FRNA 1KYWA 1ON1A 5M5WJ 4F91B 4IHSA 3ZRGA 2QUFA 2E1CA 1TL8A 3T5XA 5HLHA 2G0EA 1W7PD 2FBKA 4O6JA 3RTRA 4B4CA 2NOJB 1OPCA 2DAOA 4UB8C 3WG7H 1EH6A 4HX7A 1J09A 2QZ8A 3GF2A 4ON0A 1XMXA 3CCUI 1ETVA 4RB1A 4BQNA 3S2HJ 3K70C 2PQ8A 4X6AJ 5FD5A 4FQGA 2F5DA 2E35A 4ZYEA 5BPDA 1WWXA 3HRTA 3LSMA 5FKMA 4EGYA 4NC7A 3BTJA 4L5IA 2CUJA 1J7KA 3H3UA 2X6XA 3BROA 4CCJA 4NUBA 4IRHA 3K9TA 4G9YA 3OYBA 1CQTA 3RSNA 1JHFA 3QPSA 1B4AA 2IA2A 4CYCA 2CRGA 5JHUA 1FYLA 1UZCA 3HHHA 1D8KA 3OYHA 1UHWA 2DCEA 3PJRA 1AWCA 4J01A 5ED4A 3VB2A 1I1GA 2DQLA 2K27A 2L4AA 2CG4A 4Y17A 2A07F 1IDYA 4ZYGA 2M34A 3PUBA 1JE8A 1VQNI 1MBJA 2BOLA 4JX5A 4LB5A 4BJ5C 3DTEA 2MFZA 4IZZA 3V8KA 2Q8KA 3NQOA 1E2XA 1U2WA 2DTZA 1I1SA 1BOAA 1W7PB 2FNPA 4MTDA 2YX4A 2BZTA 2OQGA 1WPKA 4UUVA 3G73A 3U2RA 1J0RA 2XAFA 2D5VA 3M8EA 1Z6RA 2FOWA 5LEKA 2K4BA 3AFHA 2GIVA 2XASA 4IHYA 4CCMA 1R00A 2PN6A 3BR6A 3CF2A 4HNVA 4A3GJ 1QQIA 2LNBA 2QYOA 4IO9F 3I55I 5CVJA 1OKRA 3HOSA 1ETQA 3JRAA 1LE8A 4ESBA 3J7ZI 4CCKA 3OMYA 1JUMA 4XLAA 4WXDA 4HF0A 1I3AA 4Z6YA 3IKVA 3ZMZA 2DMQA 2ADUA 3I0TA 2AXLA 3KP7A 4M3BA 4U7BA 2I10A 4L0ZB 1X19A 1X1AA 2M2EA 3Q0WA 2CW7A 1X4PA 4HG2A 4I2OA 1MBKA 1ODDA 1DU0A 3FXLA 1XD7A 4E6KG 1MMDA 2O5RA 1I3QJ 2K5CA 5IYCJ 3EDPA 2NS0A 1V5FA 3LFKA 4JBAA 2XF6A 2RQPA 4A3KJ 2RKHA 2A61A 1YJ9I 5K5RA 4UB6C 3H0DA 4UXNA 1A6IA 1BR2A 2ELKA 2RNJA 2KZVA 1SFEA 4ZTJA 2GA1A 2STWA 4Q48A 3S16J 3JRHA 4LG0B 5F0CA 2MD0A 1FBUA 4IX7A 4NNJA 2DT7B 2CV0A 5D4RA 4P55A 1R23A 4IVNA 2VKVA 4G12A 2IEKA 1VQKI 3G71I 3N97A 2MSYA 3F0CA 2XIGA 3LMMA 1QNTA 2NVTJ 2VXDA 3B6CA 3DKWA 3HEFA 3CD6I 5EG0A 3MKZA 1V5EA 1K78A 3ASNH 1A6QA 3I54A 2XKOA 3H92A 3JTHA 2JRTA 3E7LA 3E0JB 4UY8I 3ERMA 3I64A 4RM2A 3CZ6A 1ACIA 2DXIA 2BY3A 5FFXA 1ONVA 3ZGKA 3QPHA 2CJJA 4D7NA 2JPBA 2B9SA 2NOGA 5D8LB 5EF6A 3FZVA 1JXSA 3E6BA 2EA2A 2R7WA 4BUPA 3HUGA 1IN7A 4XL9A 1MBHA 4CGZA 4Y52J 1UELB 2FA5A 3OS2A 2G7HA 3TOBA 1YE9A 2EQRA 2BEOA 3JRFA 2BXYA 4I99C 2GOXB 3QODA 3AL0B 3LSHA 5LGUA 2XV4S 1PUFA 2YS9A 4A0YA 2HOTA 2M5WA 3MKYB 3F8FA 3MMYB 1UJ8A 5FKOA 3I4MJ 1VQ9I 4BACA 1JTYA 1Q1VA 1WH7A 1VQ6I 2Q0OA 2LSOA 4CH7A 3BT9A 1D3YA 3MN2A 3KYCB 4G8XA 1R5HA 1SD5A 5TJJA 5TISC 5EEHA 2HTSA 5LLQA 3VODA 2KMUA 2QQ9A 1SD4A 4HDVA 3ZQ7A 5F04A 2JVHA 3IC7A 1D8JA 2LF7A 2NNNA 3DF8A 3KP5A 3FISA 2RREA 2HZTA 1G3YA 2H1KA 4BYYA 3R0JA 1V5GA 5K5QA 1XTAA 1ZN2A 2LKSA 2JA8J 3FK6A 3LSRA 3O3KA 3JCUC 4UVAA 2LD5A 4LJZF 4ZZLA 1IN4A 3ABKH 3IHUA 5JFRA 5E17F 3V7RA 3CJRB 1W5TA 1LFUP 3IH3A 5DUKA 3HKZN 4YIRX 5K5OA 2BBYA 2ZNZA 3ZN0A 3ZR8X 2ZKZA 4XOTA 1VQLI 1CGPA 2Z2SB 3CCYA 2EV6A 2XGEA 5J3LA 2OPTA 2DW4A 3I59A 1P6RA 1NHAA 2XRNA 3IAM2 1Z7UA 2VONA 4I09A 4NQWB 5H6QA 4EJTA 3FM3A 1D1BA 3SDGA 4RLFA 2UXNA 4XNFA 1E17A 1RI7A 2HKXA 1UHMA 3H9QA 2HOEA 1R5GA 1OCTC 3GLXA 3W2VA 2Z5UA 2O0YA 5LFAA 1T8IA 3ZMDA 4A6DA 3L2RA 2KPMA 1ZG1A 1EA3A 2M7AA 2RV8A 5FKNA 3COAC 1W36D 2IRFG 2V26A 1BI0A 1JHHA 2WV1A 1U3EM 2ZSIB 2R7RA 2GBYA 5D5VB 3K69A 1EH8A 4UUTA 2FJ1A 1HKQA 4C9YA 4E7JA 3HOYJ 2VBXA 3WGHA 1J9IA 1HSTA 2DMNA 1N25A 4XBFA 1TWFJ 2HWVA 1KA8A 4ZDPA 1T33A 1ZGAA 5FROA 2Z1DA 1V4RA 1RR7A 4DBRA 3DU6A 2HOAA 1ZRDA 3KP4A 3BPVA 3LSGA 2LOOA 1AOYA 2BYVE 1IV6A 4AYBA 1LNWA 1S7OA 5IT9Z 4HEA2 3SFZA 2OQRA 2DDBA 3PSFA 4W97A 4IHWA 1CF7B 3SQNA 1TWGJ 4BGDA 2XRLA 1E3PA 2BVMA 4FE7A 5IOZA 1IG7A 2AHQA 4BNCA 3CDIA 1J59A 1BM9A 1TW3A 4XSXF 2Z33A 1XCBA 5ILUA 3K1PA 3KLOA 4KA4A 1G3SA 2R7ZJ 3OYAA 1VQMI 1MNMC 4YEJA 4G6DA 4ASNA 1D5VA 1FIPA 2NS8A 1P7IA 3GUDA 2OA4A 2OD5A 4DYQA 1O3RA 4QIWN 1WVRA 3IV5A 1WI3A 2EV0A 5DCMB 1Z9CA 2P8TA 1FX7A 3OWTA 1TTYA 3QAHA 3I5UA 2FRHA 5C4JJ 1ZRCA 3TO6A 4BXFA 1HC8A 1B9MA 4XLEA 1BR4A 1J75A 4LB6B 3F3XA 2M30A 3L2CA 3GTKJ 2R3SA 5EG0B 4J19A 2PG4A 3K4JA 4YFXF 5HNHA 2M87A 1IC8A 3ZPLA 3WTWC 3CC2I 2IAIA 3PM1A 5DCFA 1U0JA 3CMAI 1OCOH 5GAGJ 3GFMA 3QPTA 2IJLA 1IN5A 4QPOA 3HGGA 2GA2A 3GW2A 1TQMA 3E3VA 2FF4A 2KJBA 3NRVA 2LREA 4DOZA 3GZ5A 1FIAA 1X2NA 4RM3A 3QYFA 2IXSA 2WY7Q 3RKWA 2DU9A 1YW7A 1Z91A 1X1CA 5CQGA 5DD4A 4B48A 4F93B 2X6YA 2W7NA 3W2AA 2R7OA 1JKRC 1MJAA 3PNYA 4ITVA 2DDAA 4HV6A 3DBHB 4GYGA 2MC4A 4QPQA 1WJAA 3GBGA 3F8NA 2K3PA 1VZ0A 2ZO4A 2IW5A 2WA0A 5ERIA 1BJAA 4EM2A 4P9UA 2UUZA 4E7IA 1R4NB 2M8GX 3LWFA 2L01A 4DYCA 2W57A 3HG9A 2OC6A 4NC8A 1QRYA 5GPAA 3RJPA 1R71A 1ZLJA 3TOAA 2ZNYA 3WHCA 3S17J 1YW8A 4A69C 5F1JA 1ZHFA 4HF2A 4XONA 1FBQA 2XB5A 3G6EI 4MEXF 1FT9A 2M0MA 4E70A 2X6OA 3GX4X 5ICEA 1QVTA 2VBYA 3VSKA 4F7ZA 2IS4A 4HYEA 5IP7J 1KU7A 1ITYA 4JX4A 4YG2F 4BDYA 1HF0A 3S8PA 5KHDA 2LF8A 4XRSG 3L2UA 1K79A 3S2DJ 3GMEA 5LGTA 2L7FP 4M3EA 1ZG3A 4V19K 2KRCA 4HLYA 2F6CA 2DFIA 3T8RA 4N9IA 5HODA 4AM3A 4HPQA 4YFNF 4Q5SF 3L2VA 4I0BA 1R9TJ 1AU7A 2V1DA 2FBHA 3HOTA 3H0GJ 1K7AA 3ECHA 2LMDA 2XKPA 2V6EA 2ETHA 2WADA 1TT0A 2LG4A 3O6BB 4C3IJ 1K61A 1LFBA 4A93J 4RAFA 1D0XA 3K4NA 3R61A 1ZH5A 2KDOA 1KONA 5LRSA 2FOKA 3U9GA 3V8JA 3TKYA 5L3FA 2JQ7A 2A69F 2COMA 2FQ3A 2HXOA 1A31A 2O8XA 1IUYA 1ZKGA 3I4NJ 3E97A 3L7WA 2UV1A 3TL4X 3M3YJ 2IGNA 2LP0A 3MCZA 1QZZA 5IP6A 1P92A 2EZLA 2BV6A 1LJ9A 4ZYDA 3H5NA 1X1PA 3RKXA 3SFIA 3JR9A 2NXNB 3CCSI 1BJZA 1XMAA 2P5LC 2DFHA 4KFCA 3L2WA 1JTXA 5L3CA 2VBWA 4CA0A 3CMYA 4KUMA 4UUSB 1WHUA 5KVRA 1U5TB 2EFNA 3IH2A 3FKIJ 1IDZA 2OV7A 3GTPJ 3DTKA 4JP0A 5K7FA 1WJDA 2A5YB 5DV5A 3GFJA 5BS6A 4XORA 5D8KB 4BE1A 1DPRA 4IJAA 3GFLA 1V3FA 2V9VA 1IXSB 1FOWA 3DEEA 3FWEA 3BJOA 1Y8QB 1FZPB 3LAJA 3R60A 1S29A 2L2OA 2HVRA 1LQ1A 3KIOA 3K1NA 4QTRA 2K7LA 1ZTRA 5C44J 2W1OA 3J7YJ 1X3ZB 4R8HA 1KQ9A 5ICFA 3V4GA 5KK1A 1P2FA 1K4SA 2DJIA 2GQQA 4U88A 1H9GA 3CCMI 3WE2A 1E3HA 5JVTA 2EFOA 1Z3XA 1RUNA 1KU2A 2FBIA 5CVUA 3G3ZA 2MH2A 1Z3YA 4UNOA 3F9KA 2LY9A 2NS7A 3D5RC 1IXCA 4D7MA 4CYCB 4KMFA 3KX2A 4MLOA 1S9HA 4EQQA 1JT6A 5F64A 2P81A 3PO3J 2IS2A 3M7GA 2ZSHB 2XSJC 4I01A 3JRCA 2E1MC 1QGPA 2ID3A 3HYIA 3E5UA 2EB7A 2CU7A 1W5SA 2MC3A 1TNSA 2FQ4A 3KYDB 5HLTA 1VQ7I 3CMEI 1O7LA 2CUEA 4XLFA 1F5TA 2L9VA 2Q2EA 5FFZA 3HXLA 3OOPA 3WGGA 2L5QA 5E3LA 1YJWI 1PUFB 2EILH 1I5ZA 4XIDA 3OYEA 5HDKA 1MD0A 1OR7A 4B44A 3RPUA 1ZREA 1RNLA 3FMQA 4CZCA 2DPUA 3CP2A 2XPVA 1IZ1A 3TW6A 3I58A 4WX9A 2ZMEC 2R7VA 2DT5A 2JJ7A 4OAYA 1MBEA 4MEYF 3CTAA 4GGGA 4O5VA 1JGSA 3OOUA 3GYHX 2EPFA 3FXOA 4IOAF 3GO5A 1UAAA 1AA7A 5CVIA 2TRTA 1P4AA 2QA4I 2K02A 4IRGA 4NB5A 1LE8B 3PSIA 3BCAA 2XGCA 2Q1ZB 2V79A 4G94A 3G1MA 4XN0A 4MO7A 1MBFA 1AHDP 2KZGA 1YRNA 2E60A 2VC0A 2F4MB 1IF1A 2F48A 2HKOA 2BXZA 2F4OB 2E1OA 2ZMEA 3BTCA 1RZ4A 2EFPA 1U9NA 5FD6A 2RGVA 1YJNI 1KU9A 4BHPA 2IGKA 4C30A 2ICWG 1X4OA 2M4KA 4XICA 3WGIA 1Y8RB 2QKLB 2K9NA 2VKDA 2CQXA 4UV8A 3ZQIA 1SVOA 2QCOA 3M1CA 3EQLF 4BHCA 4NHJA 2DOEA 2CQ7A 1D1CA 3WTTC 3HPHA 5LHGA 1I39A 3OL3A 3KZZA 4JK1X 3FXMA 3RI4A 1PVEA 1OCRH 2KLOA 3OR2C 2VLAA 1R4MB 3BTLA 3QYEA 1XS9A 4RB3C 2A68F 2K3FA 1SFXA 2CFXA 2WTEA 4RGXA 1EF4A 1SFKA 3VFZA 4A3EJ 3ML6A 1I6XA 3S3OA 2E1NA 4ZYAA 2LLKA 5DEQA 1LDKB 1XSXA 2XGDA 2W85A 2P6TA 3RPQA 4LG0A 1S5LC 2GZWA 3PIPF 2PJRA 2E36A 3FXUA 4M71A 2IGOA 3MKLA 3BLYA 3BZ6A 4II3A 4Y7NJ 3VWBA 5DS9A 1ZAOA 1MSEC 1HCRA 2NYXA 4HF1A 1B8IA 3BR0A 2ACJA 3LSJA 2Z16A 4OIPF 2H6BA 4XM3A 3OR1C 5JVGF 3Q0VA 5F6FA 3UR3C 2FSWA 1R1UA 5KAFC 4XRFA 3S2WA 4ESFA 1K78B 1G8XA 1L0OC 4PGGA 2QWWA 1MMSA 1LDJA 1XB4A 3CUQA 2DO7A 3OYIA 4IHTA 3HSRA 4KIFA 3CCVI 2V9KA 3HDDA 1RUOA 1FY7A 3ZMTA 4M6YA 3SYTA 2WAQA 5CPRB 1Y56A 2QM3A 1S6LA 2E7XA 3DBRB 4UVBA 5GAHJ 3BG5A 1SC7A 4KICA 3QU3A 3KEQA 1ETKA 3PUFA 1MNDA 4KNYA 4HNUA 3V7CA 1JJ8C 4BHBA 2PBIA 4XLPF 1YX3A 3CUQC 4PJLA 2E2HJ 4BEHB 1VFCA 3BG6A 1QHHD 3IAS2 4BKXA 1TWHJ 3CCEI 1ZARA 1HW2A 4HZFA 2EZHA 3VEPA 1MJ9A 3O8GA 5EGOB 3IRQA 3OYCA 4J00A 1YOVB 3LNQA 1SANA 4BQOA 5K1YA 3W2WA 2PJRB 4EGZA 3BP8A 1U5TC 3GCMA 1JUSA 2R5ZA 3GEZA 1DDNA 3LSTA 1WRJA 2CV2A 4HSRA 4LLLA 1PDNC 3OIPA 1YO5C 1PUEE 1OYYA 3WE3A 5F08A 2NVQJ 2JN6A 1RC9A 4PDKA 4LK0F 1GUUA 2WBMA 1ZRFA 3ELKA 4FISA 4AWXB 4HX4A 5CYVA 4LITA 3MKWB 4ENKA 2LC2A 1IAWA 3HHGA 1UMQA 4R1HA 2W4SA 3R0AA 4H0EA 2XUBA 3MD2A 1I27A 3C3WA 1YI2I 3KPHA 2E2IJ 1JI8A 3JW4A 1BN5A 4AIDA 3F6VA 4RLQA 2AS5F 4GYIA 2O03A 3SZGA 2W00A 3GTGJ 2LY1A 2ZXWH 1FYMA 1O7FA 4PK4A 4A3FJ 2FD5A 3GLLA 2PMHA 1VQ5I 4RAGA 5JI6A 3MVPA 3ZMSA 3HBLA 2X85A 4H4KC 4A2UA 3AG1H 2OAZA 3G1OA 3PNTA 3JREA 2BHZA 2EWNA 3SXYA 1NH3A 3BG9A 1POGA 2O7OA 3X2QH 4QLCU 5IT9K 2H09A 1MMNA 3S1RJ 2OZUA 2FU4A 2CW0F 2NRAC 1YQAA 3VYTB 1R7JA 2DT6A 1APLC 4A5MA 2VQCA 4HAMA 4IF4A 2ELJA 1PJRA 2E19A 2RC4A 2GXBA 4XRMA 2XAHA 1UCRA 5E3MA 2V9PA 4DNCA 2O6GE 1LVKA 2L9NA 5EGOA 2CS3A 3DLAA 1ENHA 4EM0B 3I53A 1TWAJ 4Y4RA 3S93A 1T98A 4BAYA 2ESHA 4D5CA 2P7CB 5DD8A 1KU3A 1IN8A 1G3TA 3EETA 1VI0A 4I98B 2NVYJ 4A3MJ 3A2KA 2VE8A 3Q9SA 1OYIA 4S0HB 2ZJRF 4MQ9F 2CV1A 3S32A 4BE2A 4PJJA 2E7WA 4RGRA 3EPZA 1S3JA 1X2MA 3BWGA 1AKHB 4C2UA 2ID6A 2FEZA 2JSPA 1PYVA 1GV2A 3F72A 1T08B 2X1EA 4IQ4A 5LRRA 5D5WB 1XPXA 4ZJZA 1RKTA 3NARA 1T2KA 2DN0A 2V1XA 2D1HA 1ZR2A 2OU2A 3MZHA 3DPTA 3BG3A 3WTUC 3BJAA 3OL4A 5J6XA 3IRRA 2IT0A 4CSWA 5DCMA 5L3BA 2TDXA 4FCYA 3D1NI 1T38A 1NK2P 3HL2A 1U78A 1HXDA 3GTJJ 1V54H 4GDFA 3RQ4A 3I9V2 2LVSA 4BDZA 2CW8A 3KP6A 2G9WA 3HGYA 3TQNA 4G7ZF 3H9GA 1S7EA 2KIUA 2W48A 4MTEA 3R6SA 4YIFA 4HW0A 5F0HA 4HBLA 1NG7A 3AG3H 4F52A 2AQEA 5M3FJ 4KISA 1J2XA 4BS9A 4CHUA 1Y1WJ 4ZDOA 1JJ6C 4HX8A 3DEWA 3QWLA 3ABTA 3GZ6A 2VB6A 2IS1A 5DM7F 3FHZA 2MA3A 5CVVA 3CDLA 3A4CA 2LK2A 1MBGA 2QSFX 3A01A 2HZDA 4F92B 3H5AA 2O9LA 4I02A 1Q1HA 2DOFA 1E0EA 4I7HA 4AYBN 5GTHC 1Y1VJ 1YIOA 1D5YA 3M8FA 1BOBA 5D4SA 1G2HA 3CCJI 2VPLA 3CCQI 3IWZA 2LYCA 4Y3OA 3P9KA 5HNFA 2VL8A 3MAJA 5TGTA 2W24A 4DIQA 2EIJH 2XSDC 2OCEA 2RN7A 3WTYC 4RA2A 2DMUA 1BI2A 5A2QK 2WV0A 2MYSA 3U21A 1WJFA 4ESJA 1OQYA 4IPAA 4WWCA 3JTGA 1N78A 3QOEA 3R4KA 2XROA 1R49A 2KRHA 3IP4B 4OIOF 3S15J 2ESNA 1LPQA 2RAEA 4HSTA 2ECBA 4XOPA 1T95A 3L2QA 2X1DA 2XHKA 2HI3A 2M9HA 1EV7A 2PJPA 2VI6A 1QPIA 4RGSA 4LIUA 5HLGA 2E5NA 5B1AH 2W25A 5LGNA 4M3GA 2ZBKA 1Y6IA 4IXAA 1QA6A 4P5OA 5D6EA 3AG4H 5HS7A 4XMYA 4X0GA 2KDZA 2QSGX 2JUCA 3CO6C 4M9SA 1P7JA 1Z1DA 4BE0A 2WB1A 3DPLC 4PJNA 3SZTA 5L3EA 4IRIA 4FTHA 2WAFA 5AIPA 3RCOA 2A3SA 1SD6A 4IKFA 4O3MA 2PMUA 1XX5A 2EBIA 3KYLA 5HVQC 1W4MA 4EJVA 4KT6A 5HOOA 5FJ8J 2K86A 3PQJA 5IT3A 5JHFA 4Q47A 1K4TA 2WWYA 3LOCA 1QPMA 2FNAA 3OV8A 2H1LA 1H89C 3HOUJ 4RDUA 2MLGA 1NK3P 1XMKA 2H8WA 2Y31A 2R4GA 3TO7A 2ZCWA 3BC8A 3LSPA 2W84A 5HS9A 3PQKA 5GADJ 1IXRC 4QSHA 2HDCA 2FXAA 1U9OA 4XK4A 4E7SA 4HQMA 1EH7A 3HUGB 3KZIC 2QLZA 4DZJA 6PAXA 2FX0A 2XAGA 3LAPA 3HSEA 1TZLA 3TO9A 3HOVJ 2JMWA 3FXRA 3KZYA 3FXJA 4CUGA 1G59A 3F6OA 5M5XJ 3VPRA 2J5OA 2CSOA 4UUSA 2LDUA 2LY2A 2FE3A 4HRIA 3ZQQA 1RR8C 1JUPA 2CQNA 1SMYF 2HQRA 4B47A 5E8IA 3HB9A 3ZQCA 4ZZDA 1FC3A 1GV5A 1U6GA 2MW8A 2F2EA 3ULQB 4AVZA 2M45A 3QP6A 1LVAA 5FKLA 3BZKA 1G4DA 3QRFF 5BNGA 2BHYA 2E2JJ 2EFQA 1TQPA 2VIXA 4WXCA 4L0YB 1SFOJ 3DEUA 3SHFA 3JSOA 3J7AO 1YITI 4G6QA 1T56A 2DODA 2DA7A 5IOYA 1KGSA 4ETSA 1FMWA 2EK5A 3M4OJ 1G3WA 3JRDA 2PMZN 2AXTC 5EZGA 2JT1A 4PSXA 3NAUA 4KN7X 3FIWA 4OMYA 4NQWA 4M3FA 3HPGA 3TMOA 5J8FA 2DA3A 2VQGA 2P4WA 3QPLA 1SMTA 1GVDA 2L54A 3KEOA 2LFBA 4DJAA 3MQ0A 4L9VA 3EUKL 3AG2H 2RQQA 2F5CA 4W1UA 1K6OA 2ZFWA 4CICA 2ZJQF 3A03A 2GM4A 4CXFA 3ZOBA 2R5YB 1GXPA 5JLXA 2N8GA 1BI3A 2HFHA 4LG3A 1R22A 1K6YA 3VYRB 1WJEA 2HR3A 1ERDA 3BDDA 4BBSJ 3FX3A 2JK3A 2JWTA 1ORKA 2OUMA 4BJ6C 1F9NA 3K6GA 3RKQA 1NTCA 1R36A 1LDDA 2DI3A 3K0LA 1D0YA 3H5RA 4NC6A 3GTQJ 1I6HJ 3PFYA 3HOZJ 3JRBA 2ZB9A 4LOCA 4CDGA 1R1TA 3ERED 1B72A 3E6DA 1YRNB 1FTZA 2L7MP 3RDIA 2JVGA 4BXUA 3ZQGA 3TEDA 4B8XA 2V6CA 2XF5A 4N4OB 2A05A 1OCZH 2AO9A 2K9SA 3ZCOA 2R5ZB 1K83J 4KYWA 2VBZA 4C2TA 1RETA 4D9JA 2Y2ZA 2EINH 2A6TA 1BW6A 3K7AJ 2OCCH 4Z2YA 1EJ9A 3WTSC 2HDWA 2PFBA 1XDUA 5M5YJ 1TT5B 2EH3A 2D1VA 2EV5A 2HPMA 1W5CC 5EYRA 2QBYB 3DTIA 3RKYA 2DA4A 4DGWB 2ZMEB 2ZJ2A 2VJ4A 3GWZA 4DBQA 2KIFA 2LRDA 2F5VA 4XN3A 5E18F 2QEXI 4TV7A 2DA2A 1WH5A 5DUIA 2GXGA 3K10A 1FTTA 2QENA 2QSHX 4U0YA 2HQNA 3HOWJ 3IWFA 4L5JA 1B1BA 1BIAA 2GXAA 5DDGA 2HQAA 5GP9A 3RYPA 5B5EC 1BBYA 2XPWA 1B6AA 2R92J 2EFWA 5FGMA 1G6NA 2CMPA 3LA7A 1FP1D 3D5LA 1HSJA 1WQ2A 1H9TA 2DFEA 3K4BA 1OCCH 1BL0A 3F8BA 2DFFA 3MFKA 3IH4A 2K9MA 4HQEA 2YU9J 2CQKA 2STTA 3I71A 2HPIA 3OS1A 2X48A 2EJRA 3A0HC 5H2FC 5B3SH 1TBXA 3H3ZA 1TC3C 5LHHA 5JLWA 4G7OF 2JUGA 5FLMJ 3DLLF 4C3JJ 1SEUA 4M6XA 4XLNF 1QZYA 1IGNA 2HDDA 3S1NJ 1WSUA 3CQZJ 3OYMA 2YX7A 3CCLI 1X3WB 1B72B 1HDDC 2XB0X 3S1MJ 2P5KA 1VQPI 5JR3A 2DA6A 2QGUA 2BY0A 2HYGD 4KJZA 1O3TA 1Y0UA 3B73A 3AAFA 1MJBA 3C2HA 3BPXA 1ETWA 3J81Z 5HLIA 3PIOF 1A5JA 1MMAA 4CCLA 1C0WA 5J47A 2VOPA 1TQIA 4BQQA 1RIOH 1MKMA 2OZ6A 4U0VA 2HNHA 3GVAA 1XC5A 4RAZA 5EZHA 1FOXA 3DWLE 2BY2A 3WU1B 4XLCA 3HM5A 2LKXA 2OJED 4YIIA 2EIKH 3L00A 4HOBA 4MHGA 2E5ZA 3WODF 1I50J 2WAEA 3F8CA 2X9DA 3ZQLA 2IA1A 1GHCA 4RB2C 3P9IA 4GCVA 1FLIA 1F36A 3K70D 3BJ6A 2JA6J 2YU3A 3TP3A 3WTVC 4IL6C 4PJ0C 4AC0A 1HBXG 4WCGA 3BTIA 3OSFA 4L5EA 1XSVA 2XDVA 3HRSA 2HOSA 2KT0A 2MD5A 2VE9A 2ZJPF 1Y39A 2B63J 3H35A 3RPUD 3BR3A 4LD5A 4BEHA 4RS8A 2J5PA 2VPRA 3ZP5A 2LR8A 5J1UA 4EJOA 4MNUA 2HVQA 3Q9VA 5LHIA 2VQHA 2R7TA 5E8GA 2BW3B 1A04A 2HS5A 3CLQA 3TW7A 4AU7A 5J4VA 1PP7U 3TGNA 5EEAA 2VODA 2QF7A 5LEJA 3B02A 4Q4ZF 2L7ZA 3V42A 4FX0A 1VQOI 2DMPA 1ZLKA 4AUXA 2RNGA 4X1EA 3JRIA 5FKKA 1SD7A 4BXXJ 4FE4A 4L9NA 1Z67A 2PEXA 2DMTA 2DK5A 3FXQA 1BIBA 3LSKA 3ONQA 1KQ8A 2LBFB 2LH9A 5EJCA 4LLNA 1TWCJ 2HQ5A 5ILSA 4RGUA 1R58A 2R5YA 4A12A 2H94A 1HQCA 2Y0SA 3FM5A 3LQQA 1X58A 4N0BA 5DYMA 3HRMA 2XC7A 3ISPA 1SAXA 2IBDA 3F23A 5HDGA 2NNYA 2L7KA 1DUXC 2R7XA 2V1UA 5FLXK 1R5ID 4WXHA 1YLFA 1W7PA 2QKMB 1R1VA 3W3CA 4IOCF 1EKEA 2KFDA 5KNLA 3C2BA 4A3IJ 2M0CA 3HTSB 1LUJB 1KQ0A 3N05A 1GLNA 1MH3A 3LFUA 4XR6A 1D1AA 1H88C 2MBFA 3VDXA 4Y15A 3Q3SA 2V7FA 1LEAA 3KP2A 4M9ZA 5GPCA 2Z99A 1HOMA 1FMVA 4AIHA 3VSLA 3VOEA 3MWMA 3TDZC 4WF2A 1FOKA 2VOOA 3PNVA 4LMYA 1LEBA 5F0FA 2WAQN 3BR5A 3W6JB 4NDLA 5FB2A 1F43A 3PO2J 2E1MB 1TLHB 4OMZA 1ZK8A 4AVPA 3I59B 3C18A 2D45A 1E3OC 1YFHA 2X0LA 1MGTA 2CUZA 2GLOA 2CYYA 3CUQB 2DYRH 4WK8F 2XAUA 2Z3YA 4D5FA 2IVMA 2KQRA 3WTZA 1HKTA 3BY6A 3ASOH 4MIMA 2EZIA 1YS6A 4LIVA 3QQAA 3CJNA 1VNDA 2JA7J 2H6CA 3V8LA 4AD9A 2UWMA 5J8CA 1MW7A 2R7FA 4LFUA 4ENMA 1H8AC 1N77A 3T0YA 1ZQ3P 1IRXA 3OY9A 1MMGA 1GDTA 2O8KA 4E7KA 2JTVA 1FPQA 1MZBA 5KCMA 4F55A 4LK1F 4BQAA 2P6SA 1UG2A 1LKXA 1ZGJA 4U87A 1X3UA 3SEQA 3L1PA 4B1RA 2L9SA 1FSEA 3W6VA 1P4XA 1XGSA 3RYRA 2QQ8A 1LB2A 2GAUA 4KIBA 1SVLA 1WKMA 2XAQA 3G4SI 4PFOA 3PL8A 3HJEA 3KEYA 4JYKA 4MFDA 4EMSA 1CF7A 3VYUB 3ZQFA 1PP8F 4V2GA 1VQ8I 1HA8A 5D5UB 4KN4X 1IV8A 4EJWA 4P9FA 2VT3A 2WC2A 5A2QZ 2LTPA 2L0KA 3DV8A 1BI1A 3MEXA 3E1SA 4N9HA 3ZQHA 3J80Z 4L18B 1Y0NA 9ANTA 2VXZA 4U0WA 4BBRJ 4BU2A 4DZPA 4RMNA 1S72I 3HOXJ 1ZG5A 2O61A 1HKSA 2Y48A 3K4CA 1XSDA 4ANJA 2P0WA 3ZMUA 4I6ZA 3F22A 2ZXHA 3ABUA 3DU5A 1YTYA 4KITB 4PJMA 4EEFG 2EIMH 3DP7A 4MGRA 5H20A 3WU2C 2VQLA 4BY7J 1T0FC 4KMUX 5GTIC 2JRMA 4PSWA 1MSFC 3M07A 3J81K 3FHNA 3H36A 2PI0A 1O3QA 5E1ZB 3QYBA 3HRUA 4AIKA 3ABLH 1Z05A 1DPUA 4OINF 1M1EB 1ETYA 1DGWY 4C3HJ 2M1BA 1ULYA 1USTA 1Z6TA 2HYFA 3LQRA 4HA8A 2Y0MA 5AONA 4V2FA 4PUSA 1X1BA 4IEJA 2MLKA 1XDSA 4XKVA 2BW3A 3OYFA 1IUFA 3HKZA 1USSA 2YSRA 4OU0A 3M8JA 5CJ9A 4B3AA 4NBQA 1P9QC 1R6RA 3A1YA 3DCFA 5F27A 5FO5A 1U8RA 2HEOA 3QU6A 4ZC3A 2EA4A 3OSGA 2DLLA 3T1BA 2KJCA 3P7NA 3UKGA 2TCTA 1O57A 3CMMA 4ZYHA 2I8DA 1T39A 2KKOA 2B7EA 2Z9OA 4OAZA 3L9FA 4EJUA 5E3NA 4CCNA 2H27A 2D2WA 3M9AA 4L9TA 4UVCA 1ZR4A 5J4YA 2QBYA 2R93J 2K9QA 3DBLB 5L3GA 4ZTFA 2JZYA 2ZXIA 4PFPA 2JPCA 1WJCA 3C7JA 2X51A 2BE5F 1DGRM 2YR2A 1SVMA 2XVCA 3OYJA 2DA5A 4QWQA 4PZJA 2LKPA 4DW6A 1BW5A 1IO2A 1YX5A 3GTLJ 1OCPA 4DYRA 4PGHA 4A3CJ 1QZEA 2KRFA 3D0SA 5E79C 5B1BH 3PFIA 5J40A 2Y69H 1YS7A 2X1CA 1OMIA 5FLXZ 3BQZA 2YUSA 4B3XA 3WHBA 1XG1A 3OIQA 1HLVA 3QP5A 3K1MA 3KETA 2ME0A 2QQBA 4HDUA 4XKCA 1HW1A 5D5XB 4KDPA 1B59A 2MGQA 5FRMA 2NVXJ 5BQTA 3ABMH 1Z77A 3IUOA 2VJJA 2L4MA 2M7BA 4XSZF 2Y9YA 3P9CA 4M6VA 4E4HA 1A36A 3DQVC 2MABA 4B43A 1RPWA 4E7HA 2CFOA 4A6EA 3CJQB 1RESA 2E34A 3E5QA 3S3MA 3F8MA 5KAIC 1JGGA 5FLVA 1W0TA 3REOA 4AIJA 3GTOJ 4EV0A 2V4JC 3IKTA 5CLSA 3AL0C 3K4LA 1WZ2A 4CO8A 3LA3A 1DQUA 1HW5A 3FF5A 1GXQA 1WCMJ 3KP3A 4ZH4F 1ZGWA 2OTJI 4XKBA 3ROUA 3CJTB 1U5TA 2A5WA 5GAEJ 1MIJA 3HC7A 3BZCA 3P5JA 4CZZA 5IY5H 1QVUA 1HDPA 3S3NA 2K85A 1D0ZA 3E5XA 2Y30A 5AIQA 1F1ZA 1TW2A 4OOIA 3U1KA 4M72A 4EATA 2NVUB 1MDMA 1Z0XA 2KIMA 3CF5F 4GFBA 4M73A 2Y75A 4MFEA 1A35A 1DP7P 3FBNB 3CLOA 4A0XA 1V55H 2ECCA 2MH9A 3DPUA 4M9XA 2HVSA 1FBSA 2IA0A 2NAZA 4XRSA 1JKOC 1ON2A 1WI9A 1P4WA 2ZFUA 5BMZA 1JKPC 2V1NA 3Q5FA 5J1RA 1LFPA 3BQYA 3NWTA 5IP9J 2DPDA 4JX6A 5C3EJ 1XGNA 4GO1A 4YFKF 1QBJA 4UHTA 4XLHA 3N4MA 4R79A 4S05A 3WTXC 3CESA 2XGXA 2COBA 4JQFA 4RB0A 2JA5J 3CCRI 2CGPA 2VN2A 3TP0A 2BVLA 2KL4A 4YRVA 1DP3A 2R7QA 1VTNC 4OIRF 3J80K 3I3LA 3H1CA 1OR7C 3GXOA 3ZXSA 5EDNA 3GZNB 4ENNA 1AKHA 1W1WE 2IS6A 3NEUA 3MZYA 1U8BA 4CYDA 3RIRA 4ENJA 4G6TB 5CKTA 3SZPA 3DKXA 2ISYA 3V7SA 1B9NA 2WY8Q 3ZN1A 3SEZA 4F3QA 4YELA 3ZMVA 2ISZA 2W82A 4LGWA 2DOAA 3DFGA 1L3LA 2F4IA 3OYNA 1IRFA 3E6MA 1IRZA 1MDMB 3HTUA 2RDPA 4GXOA 4HV5A 3S14J 3T8TA 1KYZA 3GTMJ 1RKWA 2M3AA 4RAYA 4C2MJ 1OLTA 2BGCA 4ABZA 3DXJF 2GWRA 1FNNA 3BOQA 5BOXA 5ICGA 1IJWC 1KZHA 4FETA 1YIJI 3OIOA 2ZC2A 2ELHA 1T6SA 3CP8A 3K4MA 2A6HF 3ECOA 2K9LA 4BH9A 3RZOJ 1GVJA 1OYWA 2IPQX 2CQQA 3O2PE 3H3VK 2C6YA 1W0UA 3RQIA 1IRGA 1JKQC 1VQ4I 1X1DA 1N75A 5TRDA 2M8EA 4LLGF 2R7DA 1XGOA 3OYDA 3A01B 3EUHA 3RZDJ 2JSCA 1GT0C 3EUAA 1QO0D 1T0FA 4FT8A 2IP2A 1FYKA 4K2EA 1QHGA 5BPIA 2KISA 5HDNA 2F5FA 4FHTA 5IYDJ 5E1XA 1IN6A 4EVIA 1YYVA 2M4GA 2FUG2 4S04A 5H6RA 1XN7A 1ETOA 4I76A 4D0PA 2WB1N 2AQFA 4HLXA 3KCCA 3KLNA 3TDUC 1UG0A 2Y9ZA 2G7UA 4XQFA 2CO5A 3EUHC 2FMLA 3QOPA 3W6KB 3BR1A 3GFIA 5LBQA 4IQJA 2XF7A 4OIQF 1ZYRF 5D6FA 4N4NB 3G1LA 4DQ2A 2HTJA 1YW9A 3K4KA 1J5YA 5HS8A 3BCBA 3I4PA 1FSHA 3KFWX 1SAUA 3CUOA 5LD2C 2PX9A 1TP4A 3CDHA 1QU3A 1NG6A 3E6CC 2Y0SN 2DJNA 4G7HF 3OS0A 2VKEA 2BY1A 3WU0A 4P96A 1BC7C 3FBIB 1B8IB 2A6EF 3FKJA 3Q0UA 3F21A 3DKYA 4IHXA 1IW7F 5DM6F 4D1QA 2R7SA 4A3LJ 2MG4A 2R7UA 2DA1A 1WFXA 2QVOA 1FP2A 2X4HA 1H0MA 3FDYA 2L02A 1OJLA 4BJTA 4M74A 1JT0A 1BC8C 4OWRB 5K7ZA 2CUFA 3CO7C 2I5UA 2VKHA 1STZA 2K40A 4A0ZA 3CC4I 3D5SC 2KHMA 1Z21A 3FK7A 4XKWA 4E7ZA 3JRGA 2H8RA 1SFUA 3MZ8A 1FEXA 1MH4A 3JAMZ 3OYKA 2VC1A 2VJ5A 4ZDLA 2HGCA 1UHSA 5L3DA 3U1DA 3UNGC 3HZJA 4FX4A 1UB9A 2HXIA 5ICCA 4Y33A 3LA2A 2EZKA 2VJIA 2B0LA 2YPRA 2Q2EB 3LL7A 1WJBA 1MNEA 2R0QC 3FMSA 1F4KA 3FMRA 4M3DA 4RBOA 1YHQI 2OTLI 1VF9A 2IGMA 5J1YA 1XGMA 3I56I 4A3JJ 2LBFA 2L9RA 3BG7A 1BA5A 2GIZA 2JA2A 5E3OA 2L3DA 5IPAA 2O3FA 1FJLA 4KT5C 3JSPA 3L09A 3S1QJ 2FMYA 3K2AA 4P1WA 3TBIA 4EM1A 4E7LA 2K4JA 4CCOA 3OYLA 2KP6A 3A02A 1O3SA 4PCQA 4L9JA 4A5NA 4U7DA 4A3DJ 3NWSA 2OF7A 2HU9A 3A0BC 2DTRA 1REPC 3ESWB 5CQEA 2QQAA 4GRIA 4Y13A 4BY1J 3C2GA 3IL2A 4KIGA 3LSIA 5E20A 5B66C 4HNTA 3B6AA 3VYSB 1OFCX 5K7HA 2KIQA 2PMZA 5C4XJ 4I0AA 3FXKA 2E71A 5ILVA 1W36C 5EEGA 2UZKA 1UFMA 4A3BJ 2GOMA 1TNTA 1WGXA 4IHVA 1FWZA 3BR2A 2PLYA 1S7AA 3SDBA
chains in the Genus database with same CATH topology
2ZXJA 4B09A 3C1DA 2VT2A 5E1WA 2F5EA 3EYYA 3KE2A 2DQRA 3HSFA 2UXXA 2XAJA 3HIFA 4UV9A 2RVCA 2DBBA 2P5VA 3K2ZA 5CVRA 2OBPA 2DK8A 3WG9A 1S8NA 2CWEA 2P7VB 1XCVA 3JAMK 3M1EA 1YG2A 5F1RA 4MQVA 3EYIA 1KYWA 1ON1A 4IHSA 2QUFA 2E1CA 3T5XA 5HLHA 1W7PD 2FBKA 4O6JA 3RTRA 1OPCA 2DAOA 1EH6A 4HX7A 2QZ8A 3GF2A 4ON0A 4RB1A 2PQ8A 5FD5A 2F5DA 4ZYEA 5BPDA 1WWXA 3HRTA 4EGYA 4L5IA 3H3UA 1J7KA 3BROA 4IRHA 3K9TA 4G9YA 1JHFA 1B4AA 2IA2A 5JHUA 1FYLA 3HHHA 1D8KA 1UHWA 1AWCA 5ED4A 3VB2A 1I1GA 2DQLA 2K27A 2L4AA 2CG4A 4Y17A 2A07F 4ZYGA 1JE8A 4LB5A 3V8KA 2Q8KA 3NQOA 1E2XA 1U2WA 1I1SA 1BOAA 1W7PB 2FNPA 4MTDA 2YX4A 2OQGA 4UUVA 3G73A 3U2RA 1J0RA 2XAFA 3M8EA 1Z6RA 5LEKA 2K4BA 2GIVA 2XASA 1R00A 2PN6A 1QQIA 2LNBA 2QYOA 5CVJA 1OKRA 3HOSA 4ESBA 4WXDA 4HF0A 3IKVA 3ZMZA 2ADUA 3I0TA 2AXLA 3KP7A 4L0ZB 4U7BA 4I2OA 1ODDA 1XD7A 3EDPA 2NS0A 3LFKA 4JBAA 2RQPA 2RKHA 2A61A 5K5RA 4UXNA 2RNJA 1SFEA 2GA1A 2STWA 4Q48A 4LG0B 1FBUA 5D4RA 4P55A 1R23A 4IVNA 3N97A 2XIGA 1QNTA 3DKWA 1K78A 3I54A 2XKOA 3H92A 3JTHA 2JRTA 3I64A 5FFXA 1ONVA 3QPHA 2JPBA 5D8LB 3FZVA 1JXSA 3E6BA 2EA2A 3HUGA 1IN7A 4CGZA 2FA5A 2G7HA 3TOBA 2BEOA 5LGUA 2XV4S 4A0YA 2M5WA 3F8FA 2Q0OA 2LSOA 1D3YA 4G8XA 1R5HA 1SD5A 5TJJA 5EEHA 2HTSA 5LLQA 3VODA 2QQ9A 1SD4A 4HDVA 3ZQ7A 3IC7A 1D8JA 2LF7A 2NNNA 3DF8A 3KP5A 2HZTA 1G3YA 4BYYA 3R0JA 5K5QA 1ZN2A 3O3KA 4UVAA 4LJZF 4ZZLA 1IN4A 3IHUA 5JFRA 5E17F 3V7RA 1W5TA 5DUKA 5K5OA 2BBYA 2ZNZA 3ZN0A 2ZKZA 1CGPA 2EV6A 2DW4A 3I59A 1P6RA 1NHAA 2XRNA 1Z7UA 2VONA 4I09A 5H6QA 4EJTA 3FM3A 2UXNA 1E17A 1RI7A 2HKXA 1UHMA 2HOEA 1R5GA 3GLXA 2Z5UA 2O0YA 3ZMDA 4A6DA 1ZG1A 3COAC 2RV8A 2IRFG 1BI0A 1JHHA 1U3EM 5D5VB 3K69A 1EH8A 1HKQA 2VBXA 3WGHA 1J9IA 1HSTA 4XBFA 2HWVA 1KA8A 1ZGAA 1V4RA 1ZRDA 3KP4A 3BPVA 1AOYA 2BYVE 1LNWA 1S7OA 5IT9Z 3SFZA 2OQRA 1CF7B 3SQNA 4BNCA 1J59A 1BM9A 1TW3A 4XSXF 2Z33A 1XCBA 5ILUA 3K1PA 3KLOA 4KA4A 1G3SA 4G6DA 4ASNA 1D5VA 3GUDA 2OA4A 2OD5A 1O3RA 2EV0A 5DCMB 1Z9CA 2P8TA 1FX7A 1TTYA 3QAHA 3I5UA 2FRHA 1ZRCA 3TO6A 1B9MA 1J75A 4LB6B 3F3XA 2M30A 3L2CA 2R3SA 2PG4A 4YFXF 2M87A 3ZPLA 3WTWC 5DCFA 3GFMA 3QPTA 2IJLA 1IN5A 2GA2A 3GW2A 1TQMA 2FF4A 3E3VA 2KJBA 3NRVA 3GZ5A 3RKWA 2DU9A 1YW7A 1Z91A 5DD4A 1MJAA 4HV6A 4GYGA 3F8NA 2ZO4A 2IW5A 5ERIA 1BJAA 4EM2A 4P9UA 3LWFA 2L01A 2W57A 3RJPA 1ZLJA 3TOAA 2ZNYA 1YW8A 1ZHFA 4HF2A 1FBQA 4MEXF 1FT9A 4E70A 3GX4X 5ICEA 2VBYA 4F7ZA 4HYEA 1KU7A 4YG2F 2LF8A 1K79A 5LGTA 1ZG3A 4HLYA 2DFIA 3T8RA 4N9IA 4YFNF 4Q5SF 4I0BA 2V1DA 2FBHA 3HOTA 1K7AA 3ECHA 2XKPA 2ETHA 3O6BB 1ZH5A 3R61A 5LRSA 2FOKA 3U9GA 3V8JA 3TKYA 5L3FA 2A69F 2FQ3A 2COMA 2O8XA 1IUYA 3E97A 3L7WA 3MCZA 1QZZA 1P92A 2BV6A 1LJ9A 4ZYDA 3RKXA 1XMAA 2P5LC 4KFCA 5L3CA 2VBWA 4KUMA 5KVRA 1U5TB 2EFNA 2A5YB 5DV5A 3GFJA 5BS6A 5D8KB 1DPRA 4IJAA 3GFLA 1V3FA 2V9VA 1IXSB 3FWEA 3BJOA 1FZPB 3LAJA 3R60A 1S29A 1LQ1A 3K1NA 2K7LA 4R8HA 1KQ9A 5ICFA 3V4GA 5KK1A 1P2FA 2GQQA 4U88A 1H9GA 3WE2A 5JVTA 2EFOA 1RUNA 1KU2A 2FBIA 5CVUA 3G3ZA 2MH2A 4UNOA 1IXCA 4KMFA 4EQQA 5F64A 3M7GA 4I01A 1QGPA 3HYIA 3E5UA 2EB7A 1W5SA 2MC3A 1TNSA 1O7LA 1F5TA 2Q2EA 5FFZA 3OOPA 3WGGA 1I5ZA 5HDKA 1MD0A 1OR7A 3RPUA 1ZREA 1RNLA 3FMQA 2DPUA 1IZ1A 3I58A 4WX9A 2DT5A 4MEYF 3CTAA 4GGGA 4O5VA 1JGSA 3GYHX 3GO5A 5CVIA 1P4AA 2K02A 4IRGA 4NB5A 2V79A 4G94A 2VC0A 1IF1A 2HKOA 2ZMEA 1RZ4A 2EFPA 5FD6A 2RGVA 1KU9A 4BHPA 3WGIA 4UV8A 3EQLF 4BHCA 4NHJA 3WTTC 5LHGA 3KZZA 4JK1X 3RI4A 4RB3C 2A68F 2WTEA 1SFXA 2CFXA 4RGXA 3VFZA 3ML6A 1I6XA 2E1NA 5DEQA 1LDKB 1XSXA 2W85A 2P6TA 3RPQA 4LG0A 2GZWA 3FXUA 4M71A 3BZ6A 1ZAOA 2NYXA 4HF1A 2ACJA 4OIPF 2H6BA 5F6FA 2FSWA 1R1UA 4XRFA 3S2WA 4ESFA 1K78B 1L0OC 4PGGA 2QWWA 1LDJA 1XB4A 3CUQA 2DO7A 4IHTA 3HSRA 4KIFA 1RUOA 1FY7A 3ZMTA 4M6YA 2QM3A 1S6LA 2E7XA 4UVBA 4KICA 3QU3A 3KEQA 4KNYA 3V7CA 4BHBA 2PBIA 4XLPF 3CUQC 1ZARA 1HW2A 4HZFA 3VEPA 1MJ9A 3IRQA 5K1YA 4EGZA 3BP8A 1U5TC 3GEZA 1DDNA 3LSTA 1WRJA 4LLLA 1PDNC 1YO5C 1PUEE 1OYYA 3WE3A 4PDKA 4LK0F 1ZRFA 3ELKA 4AWXB 4HX4A 5CYVA 4ENKA 1IAWA 3HHGA 4R1HA 3R0AA 4H0EA 2XUBA 1I27A 3C3WA 3JW4A 1BN5A 2AS5F 3F6VA 4GYIA 2O03A 1FYMA 1O7FA 2PMHA 5JI6A 3ZMSA 4A2UA 2OAZA 2EWNA 3SXYA 4QLCU 5IT9K 2H09A 2OZUA 2FU4A 2CW0F 2NRAC 1YQAA 1R7JA 4A5MA 4HAMA 4IF4A 2GXBA 2RC4A 2XAHA 1UCRA 4DNCA 2O6GE 4EM0B 3I53A 1T98A 4BAYA 2ESHA 2P7CB 5DD8A 1KU3A 1IN8A 1G3TA 3EETA 4I98B 2VE8A 3Q9SA 1OYIA 4MQ9F 2E7WA 4RGRA 1S3JA 3BWGA 2FEZA 3F72A 5D5WB 5LRRA 1T2KA 2V1XA 2D1HA 2OU2A 3MZHA 3DPTA 3WTUC 3IRRA 3BJAA 5J6XA 2IT0A 5DCMA 5L3BA 2TDXA 1T38A 1U78A 1HXDA 3KP6A 2G9WA 3TQNA 4G7ZF 4MTEA 2KIUA 3R6SA 4YIFA 4HW0A 4HBLA 1J2XA 4CHUA 4HX8A 3ABTA 3GZ6A 3FHZA 2MA3A 5CVVA 4I02A 1Q1HA 4I7HA 1YIOA 3M8FA 5D4SA 3IWZA 3P9KA 3MAJA 2W24A 2RN7A 3WTYC 5A2QK 1BI2A 2WV0A 4ESJA 4IPAA 4WWCA 3JTGA 3R4KA 2XROA 4OIOF 2ESNA 2XHKA 1EV7A 2PJPA 4RGSA 5HLGA 2W25A 5LGNA 2ZBKA 4IXAA 4P5OA 5D6EA 5HS7A 3CO6C 4M9SA 1Z1DA 3DPLC 4IRIA 3SZTA 5L3EA 5AIPA 2A3SA 1SD6A 4O3MA 2PMUA 5HVQC 1W4MA 4EJVA 5HOOA 2K86A 3PQJA 5IT3A 4Q47A 2WWYA 1QPMA 2FNAA 3OV8A 2MLGA 1XMKA 3TO7A 2ZCWA 2W84A 5HS9A 3PQKA 1IXRC 2HDCA 2FXAA 4HQMA 1EH7A 2QLZA 6PAXA 2XAGA 3LAPA 3HSEA 3TO9A 3FXRA 3KZYA 3F6OA 2J5OA 2CSOA 2LDUA 2FE3A 1SMYF 2HQRA 5E8IA 4ZZDA 1FC3A 1U6GA 3ULQB 2F2EA 2M45A 3QP6A 1LVAA 1G4DA 3QRFF 2EFQA 1TQPA 4WXCA 4L0YB 3DEUA 3SHFA 3JSOA 3J7AO 4G6QA 1KGSA 4ETSA 2EK5A 1G3WA 2JT1A 4KN7X 4OMYA 4NQWA 5J8FA 2P4WA 1SMTA 2L54A 3KEOA 3MQ0A 4L9VA 2F5CA 1K6OA 2ZFWA 4CICA 4CXFA 1GXPA 1BI3A 2HFHA 1R22A 2HR3A 3BDDA 3FX3A 1F9NA 1R36A 1LDDA 2DI3A 3K0LA 4CDGA 1R1TA 3ERED 3E6DA 3RDIA 4BXUA 4B8XA 2V6CA 4KYWA 2VBZA 4Z2YA 3WTSC 2PFBA 1XDUA 2EV5A 2D1VA 2QBYB 3RKYA 2ZMEB 2ZJ2A 3GWZA 2KIFA 5E18F 4TV7A 5DUIA 2GXGA 2QENA 4U0YA 2HQNA 3IWFA 4L5JA 1B1BA 1BIAA 5DDGA 3RYPA 1BBYA 1B6AA 2EFWA 5FGMA 1G6NA 3LA7A 1FP1D 3D5LA 1HSJA 1WQ2A 1H9TA 3F8BA 3MFKA 4HQEA 2CQKA 2STTA 3I71A 2EJRA 1TBXA 3H3ZA 5LHHA 4G7OF 4M6XA 4XLNF 1QZYA 1WSUA 2YX7A 2P5KA 5JR3A 2HYGD 1O3TA 1Y0UA 3AAFA 3B73A 1MJBA 3BPXA 3J81Z 5HLIA 1C0WA 2VOPA 1TQIA 1RIOH 1MKMA 2OZ6A 4U0VA 3GVAA 4RAZA 3WU1B 4YIIA 3L00A 4HOBA 4MHGA 3WODF 3F8CA 1GHCA 2IA1A 4RB2C 3P9IA 4GCVA 1FLIA 3BJ6A 2YU3A 3WTVC 1HBXG 4WCGA 1XSVA 3HRSA 2MD5A 2VE9A 4LD5A 4RS8A 2J5PA 3ZP5A 4EJOA 4MNUA 3Q9VA 5LHIA 5E8GA 1A04A 2HS5A 1PP7U 3TGNA 2VODA 5LEJA 3B02A 4Q4ZF 4FX0A 1ZLKA 1SD7A 4L9NA 2PEXA 2DK5A 3FXQA 1BIBA 1KQ8A 4LLNA 5ILSA 4RGUA 1R58A 4A12A 2H94A 1HQCA 3FM5A 3LQQA 4N0BA 5DYMA 3HRMA 3ISPA 1SAXA 2NNYA 3F23A 5HDGA 1DUXC 5FLXK 2V1UA 4WXHA 1YLFA 1W7PA 1R1VA 3HTSB 1KQ0A 2MBFA 4Y15A 1LEAA 3KP2A 4M9ZA 2Z99A 4AIHA 3VOEA 3MWMA 3TDZC 4WF2A 1FOKA 2VOOA 4LMYA 1LEBA 3W6JB 5FB2A 4OMZA 1TLHB 4AVPA 3I59B 3C18A 2D45A 1YFHA 2X0LA 1MGTA 2CYYA 3CUQB 4WK8F 2Z3YA 2IVMA 3WTZA 1HKTA 3BY6A 1YS6A 3CJNA 2H6CA 3V8LA 4AD9A 2UWMA 5J8CA 2R7FA 4LFUA 4ENMA 3T0YA 2JTVA 1FPQA 1MZBA 4LK1F 4BQAA 2P6SA 1ZGJA 1X3UA 1FSEA 1P4XA 1XGSA 3RYRA 1LB2A 2GAUA 4KIBA 1WKMA 2XAQA 4EMSA 1CF7A 1PP8F 5D5UB 4KN4X 4EJWA 4P9FA 2VT3A 2WC2A 5A2QZ 3DV8A 3MEXA 1BI1A 4N9HA 3J80Z 4L18B 2VXZA 4U0WA 1ZG5A 2O61A 1HKSA 2Y48A 1XSDA 3ZMUA 3F22A 3ABUA 1YTYA 3DP7A 4MGRA 5H20A 4KMUX 3J81K 2PI0A 1O3QA 5E1ZB 3HRUA 4AIKA 1DPUA 1Z05A 4OINF 2M1BA 1ULYA 1USTA 1Z6TA 2HYFA 3LQRA 4HA8A 2Y0MA 5AONA 2MLKA 1XDSA 1USSA 2YSRA 4OU0A 5CJ9A 5FO5A 1U8RA 2HEOA 3QU6A 2EA4A 2DLLA 3T1BA 2KJCA 3P7NA 1O57A 4ZYHA 1T39A 2KKOA 2Z9OA 3L9FA 4EJUA 2H27A 2D2WA 3M9AA 4L9TA 4UVCA 2QBYA 5L3GA 2JZYA 2JPCA 3C7JA 2BE5F 2YR2A 2XVCA 4QWQA 4PZJA 2LKPA 4PGHA 2KRFA 3D0SA 3PFIA 1YS7A 1OMIA 5FLXZ 3QP5A 3K1MA 3KETA 2QQBA 4HDUA 1HW1A 5D5XB 4KDPA 1B59A 5BQTA 2L4MA 4XSZF 3P9CA 3DQVC 4A6EA 3E5QA 3F8MA 3REOA 4AIJA 4EV0A 3IKTA 5CLSA 4CO8A 3LA3A 1HW5A 3FF5A 1GXQA 3KP3A 4ZH4F 3ROUA 1U5TA 4CZZA 3E5XA 5AIQA 1F1ZA 1TW2A 4OOIA 4M72A 1MDMA 2KIMA 4M73A 2Y75A 1DP7P 3CLOA 4A0XA 2MH9A 4M9XA 1FBSA 2IA0A 2NAZA 1ON2A 1WI9A 1P4WA 5BMZA 3Q5FA 2DPDA 1XGNA 4GO1A 4YFKF 1QBJA 4UHTA 3N4MA 4R79A 4S05A 3WTXC 2XGXA 4JQFA 4RB0A 2CGPA 2VN2A 1VTNC 4OIRF 3J80K 4ENNA 3GXOA 3NEUA 3MZYA 4CYDA 3RIRA 4ENJA 3SZPA 2ISYA 3V7SA 1B9NA 3ZN1A 2ISZA 3ZMVA 4LGWA 3DFGA 1L3LA 1IRFA 3E6MA 1MDMB 3HTUA 2RDPA 4GXOA 4HV5A 3T8TA 1KYZA 4RAYA 2BGCA 3DXJF 2GWRA 1FNNA 3BOQA 5BOXA 5ICGA 2ELHA 1T6SA 2A6HF 3ECOA 4BH9A 1GVJA 1OYWA 2IPQX 3O2PE 2C6YA 1IRGA 5TRDA 2M8EA 4LLGF 2R7DA 1XGOA 3EUHA 2JSCA 1QO0D 1T0FA 4FT8A 2IP2A 1FYKA 4K2EA 5BPIA 5HDNA 2F5FA 4FHTA 5E1XA 1IN6A 4EVIA 1YYVA 4S04A 5H6RA 1XN7A 4D0PA 4HLXA 3KCCA 3KLNA 3TDUC 2G7UA 2CO5A 3QOPA 2FMLA 3W6KB 3GFIA 5LBQA 4OIQF 1ZYRF 5D6FA 4DQ2A 2HTJA 1YW9A 1J5YA 5HS8A 3I4PA 1FSHA 3KFWX 3CUOA 3CDHA 3E6CC 4G7HF 3WU0A 4P96A 1BC7C 2A6EF 3F21A 1IW7F 2QVOA 1FP2A 2X4HA 1H0MA 2L02A 4M74A 1BC8C 3CO7C 1STZA 4A0ZA 1SFUA 3JAMZ 2VC1A 2HGCA 5L3DA 3U1DA 4FX4A 1UB9A 5ICCA 3LA2A 2B0LA 2YPRA 3FMSA 1F4KA 3FMRA 1XGMA 2L3DA 2O3FA 4KT5C 3JSPA 3L09A 2FMYA 4EM1A 2K4JA 1O3SA 4PCQA 4L9JA 4A5NA 4U7DA 2DTRA 1REPC 2QQAA 4Y13A 3IL2A 4KIGA 5E20A 4I0AA 5ILVA 5EEGA 2UZKA 1UFMA 1TNTA 1FWZA 2PLYA 1S7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXJ A;  4B09 A;  3C1D A;  2VT2 A;  5E1W A;  2F5E A;  3EYY A;  3KE2 A;  2DQR A;  3HSF A;  2UXX A;  2XAJ A;  3HIF A;  4UV9 A;  2RVC A;  2DBB A;  2P5V A;  3K2Z A;  5CVR A;  2OBP A;  2DK8 A;  3WG9 A;  1S8N A;  2CWE A;  2P7V B;  1XCV A;  3JAM K;  3M1E A;  1YG2 A;  5F1R A;  4MQV A;  3EYI A;  1KYW A;  1ON1 A;  4IHS A;  2QUF A;  2E1C A;  3T5X A;  5HLH A;  1W7P D;  2FBK A;  4O6J A;  3RTR A;  1OPC A;  2DAO A;  1EH6 A;  4HX7 A;  2QZ8 A;  3GF2 A;  4ON0 A;  4RB1 A;  2PQ8 A;  5FD5 A;  2F5D A;  4ZYE A;  5BPD A;  1WWX A;  3HRT A;  4EGY A;  4L5I A;  3H3U A;  1J7K A;  3BRO A;  4IRH A;  3K9T A;  4G9Y A;  1JHF A;  1B4A A;  2IA2 A;  5JHU A;  1FYL A;  3HHH A;  1D8K A;  1UHW A;  1AWC A;  5ED4 A;  3VB2 A;  1I1G A;  2DQL A;  2K27 A;  2L4A A;  2CG4 A;  4Y17 A;  2A07 F;  4ZYG A;  1JE8 A;  4LB5 A;  3V8K A;  2Q8K A;  3NQO A;  1E2X A;  1U2W A;  1I1S A;  1BOA A;  1W7P B;  2FNP A;  4MTD A;  2YX4 A;  2OQG A;  4UUV A;  3G73 A;  3U2R A;  1J0R A;  2XAF A;  3M8E A;  1Z6R A;  5LEK A;  2K4B A;  2GIV A;  2XAS A;  1R00 A;  2PN6 A;  1QQI A;  2LNB A;  2QYO A;  5CVJ A;  1OKR A;  3HOS A;  4ESB A;  4WXD A;  4HF0 A;  3IKV A;  3ZMZ A;  2ADU A;  3I0T A;  2AXL A;  3KP7 A;  4L0Z B;  4U7B A;  4I2O A;  1ODD A;  1XD7 A;  3EDP A;  2NS0 A;  3LFK A;  4JBA A;  2RQP A;  2RKH A;  2A61 A;  5K5R A;  4UXN A;  2RNJ A;  1SFE A;  2GA1 A;  2STW A;  4Q48 A;  4LG0 B;  1FBU A;  5D4R A;  4P55 A;  1R23 A;  4IVN A;  3N97 A;  2XIG A;  1QNT A;  3DKW A;  1K78 A;  3I54 A;  2XKO A;  3H92 A;  3JTH A;  2JRT A;  3I64 A;  5FFX A;  1ONV A;  3QPH A;  2JPB A;  5D8L B;  3FZV A;  1JXS A;  3E6B A;  2EA2 A;  3HUG A;  1IN7 A;  4CGZ A;  2FA5 A;  2G7H A;  3TOB A;  2BEO A;  5LGU A;  2XV4 S;  4A0Y A;  2M5W A;  3F8F A;  2Q0O A;  2LSO A;  1D3Y A;  4G8X A;  1R5H A;  1SD5 A;  5TJJ A;  5EEH A;  2HTS A;  5LLQ A;  3VOD A;  2QQ9 A;  1SD4 A;  4HDV A;  3ZQ7 A;  3IC7 A;  1D8J A;  2LF7 A;  2NNN A;  3DF8 A;  3KP5 A;  2HZT A;  1G3Y A;  4BYY A;  3R0J A;  5K5Q A;  1ZN2 A;  3O3K A;  4UVA A;  4LJZ F;  4ZZL A;  1IN4 A;  3IHU A;  5JFR A;  5E17 F;  3V7R A;  1W5T A;  5DUK A;  5K5O A;  2BBY A;  2ZNZ A;  3ZN0 A;  2ZKZ A;  1CGP A;  2EV6 A;  2DW4 A;  3I59 A;  1P6R A;  1NHA A;  2XRN A;  1Z7U A;  2VON A;  4I09 A;  5H6Q A;  4EJT A;  3FM3 A;  2UXN A;  1E17 A;  1RI7 A;  2HKX A;  1UHM A;  2HOE A;  1R5G A;  3GLX A;  2Z5U A;  2O0Y A;  3ZMD A;  4A6D A;  1ZG1 A;  3COA C;  2RV8 A;  2IRF G;  1BI0 A;  1JHH A;  1U3E M;  5D5V B;  3K69 A;  1EH8 A;  1HKQ A;  2VBX A;  3WGH A;  1J9I A;  1HST A;  4XBF A;  2HWV A;  1KA8 A;  1ZGA A;  1V4R A;  1ZRD A;  3KP4 A;  3BPV A;  1AOY A;  2BYV E;  1LNW A;  1S7O A;  5IT9 Z;  3SFZ A;  2OQR A;  1CF7 B;  3SQN A;  4BNC A;  1J59 A;  1BM9 A;  1TW3 A;  4XSX F;  2Z33 A;  1XCB A;  5ILU A;  3K1P A;  3KLO A;  4KA4 A;  1G3S A;  4G6D A;  4ASN A;  1D5V A;  3GUD A;  2OA4 A;  2OD5 A;  1O3R A;  2EV0 A;  5DCM B;  1Z9C A;  2P8T A;  1FX7 A;  1TTY A;  3QAH A;  3I5U A;  2FRH A;  1ZRC A;  3TO6 A;  1B9M A;  1J75 A;  4LB6 B;  3F3X A;  2M30 A;  3L2C A;  2R3S A;  2PG4 A;  4YFX F;  2M87 A;  3ZPL A;  3WTW C;  5DCF A;  3GFM A;  3QPT A;  2IJL A;  1IN5 A;  2GA2 A;  3GW2 A;  1TQM A;  2FF4 A;  3E3V A;  2KJB A;  3NRV A;  3GZ5 A;  3RKW A;  2DU9 A;  1YW7 A;  1Z91 A;  5DD4 A;  1MJA A;  4HV6 A;  4GYG A;  3F8N A;  2ZO4 A;  2IW5 A;  5ERI A;  1BJA A;  4EM2 A;  4P9U A;  3LWF A;  2L01 A;  2W57 A;  3RJP A;  1ZLJ A;  3TOA A;  2ZNY A;  1YW8 A;  1ZHF A;  4HF2 A;  1FBQ A;  4MEX F;  1FT9 A;  4E70 A;  3GX4 X;  5ICE A;  2VBY A;  4F7Z A;  4HYE A;  1KU7 A;  4YG2 F;  2LF8 A;  1K79 A;  5LGT A;  1ZG3 A;  4HLY A;  2DFI A;  3T8R A;  4N9I A;  4YFN F;  4Q5S F;  4I0B A;  2V1D A;  2FBH A;  3HOT A;  1K7A A;  3ECH A;  2XKP A;  2ETH A;  3O6B B;  1ZH5 A;  3R61 A;  5LRS A;  2FOK A;  3U9G A;  3V8J A;  3TKY A;  5L3F A;  2A69 F;  2FQ3 A;  2COM A;  2O8X A;  1IUY A;  3E97 A;  3L7W A;  3MCZ A;  1QZZ A;  1P92 A;  2BV6 A;  1LJ9 A;  4ZYD A;  3RKX A;  1XMA A;  2P5L C;  4KFC A;  5L3C A;  2VBW A;  4KUM A;  5KVR A;  1U5T B;  2EFN A;  2A5Y B;  5DV5 A;  3GFJ A;  5BS6 A;  5D8K B;  1DPR A;  4IJA A;  3GFL A;  1V3F A;  2V9V A;  1IXS B;  3FWE A;  3BJO A;  1FZP B;  3LAJ A;  3R60 A;  1S29 A;  1LQ1 A;  3K1N A;  2K7L A;  4R8H A;  1KQ9 A;  5ICF A;  3V4G A;  5KK1 A;  1P2F A;  2GQQ A;  4U88 A;  1H9G A;  3WE2 A;  5JVT A;  2EFO A;  1RUN A;  1KU2 A;  2FBI A;  5CVU A;  3G3Z A;  2MH2 A;  4UNO A;  1IXC A;  4KMF A;  4EQQ A;  5F64 A;  3M7G A;  4I01 A;  1QGP A;  3HYI A;  3E5U A;  2EB7 A;  1W5S A;  2MC3 A;  1TNS A;  1O7L A;  1F5T A;  2Q2E A;  5FFZ A;  3OOP A;  3WGG A;  1I5Z A;  5HDK A;  1MD0 A;  1OR7 A;  3RPU A;  1ZRE A;  1RNL A;  3FMQ A;  2DPU A;  1IZ1 A;  3I58 A;  4WX9 A;  2DT5 A;  4MEY F;  3CTA A;  4GGG A;  4O5V A;  1JGS A;  3GYH X;  3GO5 A;  5CVI A;  1P4A A;  2K02 A;  4IRG A;  4NB5 A;  2V79 A;  4G94 A;  2VC0 A;  1IF1 A;  2HKO A;  2ZME A;  1RZ4 A;  2EFP A;  5FD6 A;  2RGV A;  1KU9 A;  4BHP A;  3WGI A;  4UV8 A;  3EQL F;  4BHC A;  4NHJ A;  3WTT C;  5LHG A;  3KZZ A;  4JK1 X;  3RI4 A;  4RB3 C;  2A68 F;  2WTE A;  1SFX A;  2CFX A;  4RGX A;  3VFZ A;  3ML6 A;  1I6X A;  2E1N A;  5DEQ A;  1LDK B;  1XSX A;  2W85 A;  2P6T A;  3RPQ A;  4LG0 A;  2GZW A;  3FXU A;  4M71 A;  3BZ6 A;  1ZAO A;  2NYX A;  4HF1 A;  2ACJ A;  4OIP F;  2H6B A;  5F6F A;  2FSW A;  1R1U A;  4XRF A;  3S2W A;  4ESF A;  1K78 B;  1L0O C;  4PGG A;  2QWW A;  1LDJ A;  1XB4 A;  3CUQ A;  2DO7 A;  4IHT A;  3HSR A;  4KIF A;  1RUO A;  1FY7 A;  3ZMT A;  4M6Y A;  2QM3 A;  1S6L A;  2E7X A;  4UVB A;  4KIC A;  3QU3 A;  3KEQ A;  4KNY A;  3V7C A;  4BHB A;  2PBI A;  4XLP F;  3CUQ C;  1ZAR A;  1HW2 A;  4HZF A;  3VEP A;  1MJ9 A;  3IRQ A;  5K1Y A;  4EGZ A;  3BP8 A;  1U5T C;  3GEZ A;  1DDN A;  3LST A;  1WRJ A;  4LLL A;  1PDN C;  1YO5 C;  1PUE E;  1OYY A;  3WE3 A;  4PDK A;  4LK0 F;  1ZRF A;  3ELK A;  4AWX B;  4HX4 A;  5CYV A;  4ENK A;  1IAW A;  3HHG A;  4R1H A;  3R0A A;  4H0E A;  2XUB A;  1I27 A;  3C3W A;  3JW4 A;  1BN5 A;  2AS5 F;  3F6V A;  4GYI A;  2O03 A;  1FYM A;  1O7F A;  2PMH A;  5JI6 A;  3ZMS A;  4A2U A;  2OAZ A;  2EWN A;  3SXY A;  4QLC U;  5IT9 K;  2H09 A;  2OZU A;  2FU4 A;  2CW0 F;  2NRA C;  1YQA A;  1R7J A;  4A5M A;  4HAM A;  4IF4 A;  2GXB A;  2RC4 A;  2XAH A;  1UCR A;  4DNC A;  2O6G E;  4EM0 B;  3I53 A;  1T98 A;  4BAY A;  2ESH A;  2P7C B;  5DD8 A;  1KU3 A;  1IN8 A;  1G3T A;  3EET A;  4I98 B;  2VE8 A;  3Q9S A;  1OYI A;  4MQ9 F;  2E7W A;  4RGR A;  1S3J A;  3BWG A;  2FEZ A;  3F72 A;  5D5W B;  5LRR A;  1T2K A;  2V1X A;  2D1H A;  2OU2 A;  3MZH A;  3DPT A;  3WTU C;  3IRR A;  3BJA A;  5J6X A;  2IT0 A;  5DCM A;  5L3B A;  2TDX A;  1T38 A;  1U78 A;  1HXD A;  3KP6 A;  2G9W A;  3TQN A;  4G7Z F;  4MTE A;  2KIU A;  3R6S A;  4YIF A;  4HW0 A;  4HBL A;  1J2X A;  4CHU A;  4HX8 A;  3ABT A;  3GZ6 A;  3FHZ A;  2MA3 A;  5CVV A;  4I02 A;  1Q1H A;  4I7H A;  1YIO A;  3M8F A;  5D4S A;  3IWZ A;  3P9K A;  3MAJ A;  2W24 A;  2RN7 A;  3WTY C;  5A2Q K;  1BI2 A;  2WV0 A;  4ESJ A;  4IPA A;  4WWC A;  3JTG A;  3R4K A;  2XRO A;  4OIO F;  2ESN A;  2XHK A;  1EV7 A;  2PJP A;  4RGS A;  5HLG A;  2W25 A;  5LGN A;  2ZBK A;  4IXA A;  4P5O A;  5D6E A;  5HS7 A;  3CO6 C;  4M9S A;  1Z1D A;  3DPL C;  4IRI A;  3SZT A;  5L3E A;  5AIP A;  2A3S A;  1SD6 A;  4O3M A;  2PMU A;  5HVQ C;  1W4M A;  4EJV A;  5HOO A;  2K86 A;  3PQJ A;  5IT3 A;  4Q47 A;  2WWY A;  1QPM A;  2FNA A;  3OV8 A;  2MLG A;  1XMK A;  3TO7 A;  2ZCW A;  2W84 A;  5HS9 A;  3PQK A;  1IXR C;  2HDC A;  2FXA A;  4HQM A;  1EH7 A;  2QLZ A;  6PAX A;  2XAG A;  3LAP A;  3HSE A;  3TO9 A;  3FXR A;  3KZY A;  3F6O A;  2J5O A;  2CSO A;  2LDU A;  2FE3 A;  1SMY F;  2HQR A;  5E8I A;  4ZZD A;  1FC3 A;  1U6G A;  3ULQ B;  2F2E A;  2M45 A;  3QP6 A;  1LVA A;  1G4D A;  3QRF F;  2EFQ A;  1TQP A;  4WXC A;  4L0Y B;  3DEU A;  3SHF A;  3JSO A;  3J7A O;  4G6Q A;  1KGS A;  4ETS A;  2EK5 A;  1G3W A;  2JT1 A;  4KN7 X;  4OMY A;  4NQW A;  5J8F A;  2P4W A;  1SMT A;  2L54 A;  3KEO A;  3MQ0 A;  4L9V A;  2F5C A;  1K6O A;  2ZFW A;  4CIC A;  4CXF A;  1GXP A;  1BI3 A;  2HFH A;  1R22 A;  2HR3 A;  3BDD A;  3FX3 A;  1F9N A;  1R36 A;  1LDD A;  2DI3 A;  3K0L A;  4CDG A;  1R1T A;  3ERE D;  3E6D A;  3RDI A;  4BXU A;  4B8X A;  2V6C A;  4KYW A;  2VBZ A;  4Z2Y A;  3WTS C;  2PFB A;  1XDU A;  2EV5 A;  2D1V A;  2QBY B;  3RKY A;  2ZME B;  2ZJ2 A;  3GWZ A;  2KIF A;  5E18 F;  4TV7 A;  5DUI A;  2GXG A;  2QEN A;  4U0Y A;  2HQN A;  3IWF A;  4L5J A;  1B1B A;  1BIA A;  5DDG A;  3RYP A;  1BBY A;  1B6A A;  2EFW A;  5FGM A;  1G6N A;  3LA7 A;  1FP1 D;  3D5L A;  1HSJ A;  1WQ2 A;  1H9T A;  3F8B A;  3MFK A;  4HQE A;  2CQK A;  2STT A;  3I71 A;  2EJR A;  1TBX A;  3H3Z A;  5LHH A;  4G7O F;  4M6X A;  4XLN F;  1QZY A;  1WSU A;  2YX7 A;  2P5K A;  5JR3 A;  2HYG D;  1O3T A;  1Y0U A;  3AAF A;  3B73 A;  1MJB A;  3BPX A;  3J81 Z;  5HLI A;  1C0W A;  2VOP A;  1TQI A;  1RIO H;  1MKM A;  2OZ6 A;  4U0V A;  3GVA A;  4RAZ A;  3WU1 B;  4YII A;  3L00 A;  4HOB A;  4MHG A;  3WOD F;  3F8C A;  1GHC A;  2IA1 A;  4RB2 C;  3P9I A;  4GCV A;  1FLI A;  3BJ6 A;  2YU3 A;  3WTV C;  1HBX G;  4WCG A;  1XSV A;  3HRS A;  2MD5 A;  2VE9 A;  4LD5 A;  4RS8 A;  2J5P A;  3ZP5 A;  4EJO A;  4MNU A;  3Q9V A;  5LHI A;  5E8G A;  1A04 A;  2HS5 A;  1PP7 U;  3TGN A;  2VOD A;  5LEJ A;  3B02 A;  4Q4Z F;  4FX0 A;  1ZLK A;  1SD7 A;  4L9N A;  2PEX A;  2DK5 A;  3FXQ A;  1BIB A;  1KQ8 A;  4LLN A;  5ILS A;  4RGU A;  1R58 A;  4A12 A;  2H94 A;  1HQC A;  3FM5 A;  3LQQ A;  4N0B A;  5DYM A;  3HRM A;  3ISP A;  1SAX A;  2NNY A;  3F23 A;  5HDG A;  1DUX C;  5FLX K;  2V1U A;  4WXH A;  1YLF A;  1W7P A;  1R1V A;  3HTS B;  1KQ0 A;  2MBF A;  4Y15 A;  1LEA A;  3KP2 A;  4M9Z A;  2Z99 A;  4AIH A;  3VOE A;  3MWM A;  3TDZ C;  4WF2 A;  1FOK A;  2VOO A;  4LMY A;  1LEB A;  3W6J B;  5FB2 A;  4OMZ A;  1TLH B;  4AVP A;  3I59 B;  3C18 A;  2D45 A;  1YFH A;  2X0L A;  1MGT A;  2CYY A;  3CUQ B;  4WK8 F;  2Z3Y A;  2IVM A;  3WTZ A;  1HKT A;  3BY6 A;  1YS6 A;  3CJN A;  2H6C A;  3V8L A;  4AD9 A;  2UWM A;  5J8C A;  2R7F A;  4LFU A;  4ENM A;  3T0Y A;  2JTV A;  1FPQ A;  1MZB A;  4LK1 F;  4BQA A;  2P6S A;  1ZGJ A;  1X3U A;  1FSE A;  1P4X A;  1XGS A;  3RYR A;  1LB2 A;  2GAU A;  4KIB A;  1WKM A;  2XAQ A;  4EMS A;  1CF7 A;  1PP8 F;  5D5U B;  4KN4 X;  4EJW A;  4P9F A;  2VT3 A;  2WC2 A;  5A2Q Z;  3DV8 A;  3MEX A;  1BI1 A;  4N9H A;  3J80 Z;  4L18 B;  2VXZ A;  4U0W A;  1ZG5 A;  2O61 A;  1HKS A;  2Y48 A;  1XSD A;  3ZMU A;  3F22 A;  3ABU A;  1YTY A;  3DP7 A;  4MGR A;  5H20 A;  4KMU X;  3J81 K;  2PI0 A;  1O3Q A;  5E1Z B;  3HRU A;  4AIK A;  1DPU A;  1Z05 A;  4OIN F;  2M1B A;  1ULY A;  1UST A;  1Z6T A;  2HYF A;  3LQR A;  4HA8 A;  2Y0M A;  5AON A;  2MLK A;  1XDS A;  1USS A;  2YSR A;  4OU0 A;  5CJ9 A;  5FO5 A;  1U8R A;  2HEO A;  3QU6 A;  2EA4 A;  2DLL A;  3T1B A;  2KJC A;  3P7N A;  1O57 A;  4ZYH A;  1T39 A;  2KKO A;  2Z9O A;  3L9F A;  4EJU A;  2H27 A;  2D2W A;  3M9A A;  4L9T A;  4UVC A;  2QBY A;  5L3G A;  2JZY A;  2JPC A;  3C7J A;  2BE5 F;  2YR2 A;  2XVC A;  4QWQ A;  4PZJ A;  2LKP A;  4PGH A;  2KRF A;  3D0S A;  3PFI A;  1YS7 A;  1OMI A;  5FLX Z;  3QP5 A;  3K1M A;  3KET A;  2QQB A;  4HDU A;  1HW1 A;  5D5X B;  4KDP A;  1B59 A;  5BQT A;  2L4M A;  4XSZ F;  3P9C A;  3DQV C;  4A6E A;  3E5Q A;  3F8M A;  3REO A;  4AIJ A;  4EV0 A;  3IKT A;  5CLS A;  4CO8 A;  3LA3 A;  1HW5 A;  3FF5 A;  1GXQ A;  3KP3 A;  4ZH4 F;  3ROU A;  1U5T A;  4CZZ A;  3E5X A;  5AIQ A;  1F1Z A;  1TW2 A;  4OOI A;  4M72 A;  1MDM A;  2KIM A;  4M73 A;  2Y75 A;  1DP7 P;  3CLO A;  4A0X A;  2MH9 A;  4M9X A;  1FBS A;  2IA0 A;  2NAZ A;  1ON2 A;  1WI9 A;  1P4W A;  5BMZ A;  3Q5F A;  2DPD A;  1XGN A;  4GO1 A;  4YFK F;  1QBJ A;  4UHT A;  3N4M A;  4R79 A;  4S05 A;  3WTX C;  2XGX A;  4JQF A;  4RB0 A;  2CGP A;  2VN2 A;  1VTN C;  4OIR F;  3J80 K;  4ENN A;  3GXO A;  3NEU A;  3MZY A;  4CYD A;  3RIR A;  4ENJ A;  3SZP A;  2ISY A;  3V7S A;  1B9N A;  3ZN1 A;  2ISZ A;  3ZMV A;  4LGW A;  3DFG A;  1L3L A;  1IRF A;  3E6M A;  1MDM B;  3HTU A;  2RDP A;  4GXO A;  4HV5 A;  3T8T A;  1KYZ A;  4RAY A;  2BGC A;  3DXJ F;  2GWR A;  1FNN A;  3BOQ A;  5BOX A;  5ICG A;  2ELH A;  1T6S A;  2A6H F;  3ECO A;  4BH9 A;  1GVJ A;  1OYW A;  2IPQ X;  3O2P E;  2C6Y A;  1IRG A;  5TRD A;  2M8E A;  4LLG F;  2R7D A;  1XGO A;  3EUH A;  2JSC A;  1QO0 D;  1T0F A;  4FT8 A;  2IP2 A;  1FYK A;  4K2E A;  5BPI A;  5HDN A;  2F5F A;  4FHT A;  5E1X A;  1IN6 A;  4EVI A;  1YYV A;  4S04 A;  5H6R A;  1XN7 A;  4D0P A;  4HLX A;  3KCC A;  3KLN A;  3TDU C;  2G7U A;  2CO5 A;  3QOP A;  2FML A;  3W6K B;  3GFI A;  5LBQ A;  4OIQ F;  1ZYR F;  5D6F A;  4DQ2 A;  2HTJ A;  1YW9 A;  1J5Y A;  5HS8 A;  3I4P A;  1FSH A;  3KFW X;  3CUO A;  3CDH A;  3E6C C;  4G7H F;  3WU0 A;  4P96 A;  1BC7 C;  2A6E F;  3F21 A;  1IW7 F;  2QVO A;  1FP2 A;  2X4H A;  1H0M A;  2L02 A;  4M74 A;  1BC8 C;  3CO7 C;  1STZ A;  4A0Z A;  1SFU A;  3JAM Z;  2VC1 A;  2HGC A;  5L3D A;  3U1D A;  4FX4 A;  1UB9 A;  5ICC A;  3LA2 A;  2B0L A;  2YPR A;  3FMS A;  1F4K A;  3FMR A;  1XGM A;  2L3D A;  2O3F A;  4KT5 C;  3JSP A;  3L09 A;  2FMY A;  4EM1 A;  2K4J A;  1O3S A;  4PCQ A;  4L9J A;  4A5N A;  4U7D A;  2DTR A;  1REP C;  2QQA A;  4Y13 A;  3IL2 A;  4KIG A;  5E20 A;  4I0A A;  5ILV A;  5EEG A;  2UZK A;  1UFM A;  1TNT A;  1FWZ A;  2PLY A;  1S7A A; 
#chains in the Genus database with same CATH topology
 2ZXJ A;  3CC7 I;  4B09 A;  2DYS H;  3C1D A;  2VT2 A;  4JOM A;  1BR1 A;  1ZEL A;  5E1W A;  2F5E A;  3EYY A;  3KE2 A;  2DQR A;  4BL0 B;  2X6W A;  3HSF A;  2UXX A;  1FOY A;  2VAS A;  2XAJ A;  3HIF A;  1Z7L A;  3SJM A;  1O4X A;  4UV9 A;  1ETX A;  2VUM J;  1WJ5 A;  2RVC A;  3AKZ A;  2DBB A;  2P5V A;  3K2Z A;  5CVR A;  2OBP A;  2DK8 A;  5IYB J;  3WG9 A;  1S8N A;  2HYJ A;  4II2 A;  3G2B A;  3H9J A;  2CWE A;  3J7A Y;  1DU6 A;  2P7V B;  5DTD A;  3OYG A;  1XCV A;  3O8H A;  3M1E A;  3JAM K;  4FAS D;  2XPU A;  1OIS A;  1YG2 A;  5F1R A;  5M3M J;  4MQV A;  2CH0 A;  3EYI A;  1RRJ A;  2ME6 A;  5FRN A;  1KYW A;  1ON1 A;  5M5W J;  4F91 B;  4IHS A;  3ZRG A;  2QUF A;  2E1C A;  1TL8 A;  3T5X A;  5HLH A;  2G0E A;  1W7P D;  2FBK A;  4O6J A;  3RTR A;  4B4C A;  2NOJ B;  1OPC A;  2DAO A;  4UB8 C;  3WG7 H;  1EH6 A;  4HX7 A;  1J09 A;  2QZ8 A;  3GF2 A;  4ON0 A;  1XMX A;  3CCU I;  1ETV A;  4RB1 A;  4BQN A;  3S2H J;  3K70 C;  2PQ8 A;  4X6A J;  5FD5 A;  4FQG A;  2F5D A;  2E35 A;  4ZYE A;  5BPD A;  1WWX A;  3HRT A;  3LSM A;  5FKM A;  4EGY A;  4NC7 A;  3BTJ A;  4L5I A;  2CUJ A;  1J7K A;  3H3U A;  2X6X A;  3BRO A;  4CCJ A;  4NUB A;  4IRH A;  3K9T A;  4G9Y A;  3OYB A;  1CQT A;  3RSN A;  1JHF A;  3QPS A;  1B4A A;  2IA2 A;  4CYC A;  2CRG A;  5JHU A;  1FYL A;  1UZC A;  3HHH A;  1D8K A;  3OYH A;  1UHW A;  2DCE A;  3PJR A;  1AWC A;  4J01 A;  5ED4 A;  3VB2 A;  1I1G A;  2DQL A;  2K27 A;  2L4A A;  2CG4 A;  4Y17 A;  2A07 F;  1IDY A;  4ZYG A;  2M34 A;  3PUB A;  1JE8 A;  1VQN I;  1MBJ A;  2BOL A;  4JX5 A;  4LB5 A;  4BJ5 C;  3DTE A;  2MFZ A;  4IZZ A;  3V8K A;  2Q8K A;  3NQO A;  1E2X A;  1U2W A;  2DTZ A;  1I1S A;  1BOA A;  1W7P B;  2FNP A;  4MTD A;  2YX4 A;  2BZT A;  2OQG A;  1WPK A;  4UUV A;  3G73 A;  3U2R A;  1J0R A;  2XAF A;  2D5V A;  3M8E A;  1Z6R A;  2FOW A;  5LEK A;  2K4B A;  3AFH A;  2GIV A;  2XAS A;  4IHY A;  4CCM A;  1R00 A;  2PN6 A;  3BR6 A;  3CF2 A;  4HNV A;  4A3G J;  1QQI A;  2LNB A;  2QYO A;  4IO9 F;  3I55 I;  5CVJ A;  1OKR A;  3HOS A;  1ETQ A;  3JRA A;  1LE8 A;  4ESB A;  3J7Z I;  4CCK A;  3OMY A;  1JUM A;  4XLA A;  4WXD A;  4HF0 A;  1I3A A;  4Z6Y A;  3IKV A;  3ZMZ A;  2DMQ A;  2ADU A;  3I0T A;  2AXL A;  3KP7 A;  4M3B A;  4U7B A;  2I10 A;  4L0Z B;  1X19 A;  1X1A A;  2M2E A;  3Q0W A;  2CW7 A;  1X4P A;  4HG2 A;  4I2O A;  1MBK A;  1ODD A;  1DU0 A;  3FXL A;  1XD7 A;  4E6K G;  1MMD A;  2O5R A;  1I3Q J;  2K5C A;  5IYC J;  3EDP A;  2NS0 A;  1V5F A;  3LFK A;  4JBA A;  2XF6 A;  2RQP A;  4A3K J;  2RKH A;  2A61 A;  1YJ9 I;  5K5R A;  4UB6 C;  3H0D A;  4UXN A;  1A6I A;  1BR2 A;  2ELK A;  2RNJ A;  2KZV A;  1SFE A;  4ZTJ A;  2GA1 A;  2STW A;  4Q48 A;  3S16 J;  3JRH A;  4LG0 B;  5F0C A;  2MD0 A;  1FBU A;  4IX7 A;  4NNJ A;  2DT7 B;  2CV0 A;  5D4R A;  4P55 A;  1R23 A;  4IVN A;  2VKV A;  4G12 A;  2IEK A;  1VQK I;  3G71 I;  3N97 A;  2MSY A;  3F0C A;  2XIG A;  3LMM A;  1QNT A;  2NVT J;  2VXD A;  3B6C A;  3DKW A;  3HEF A;  3CD6 I;  5EG0 A;  3MKZ A;  1V5E A;  1K78 A;  3ASN H;  1A6Q A;  3I54 A;  2XKO A;  3H92 A;  3JTH A;  2JRT A;  3E7L A;  3E0J B;  4UY8 I;  3ERM A;  3I64 A;  4RM2 A;  3CZ6 A;  1ACI A;  2DXI A;  2BY3 A;  5FFX A;  1ONV A;  3ZGK A;  3QPH A;  2CJJ A;  4D7N A;  2JPB A;  2B9S A;  2NOG A;  5D8L B;  5EF6 A;  3FZV A;  1JXS A;  3E6B A;  2EA2 A;  2R7W A;  4BUP A;  3HUG A;  1IN7 A;  4XL9 A;  1MBH A;  4CGZ A;  4Y52 J;  1UEL B;  2FA5 A;  3OS2 A;  2G7H A;  3TOB A;  1YE9 A;  2EQR A;  2BEO A;  3JRF A;  2BXY A;  4I99 C;  2GOX B;  3QOD A;  3AL0 B;  3LSH A;  5LGU A;  2XV4 S;  1PUF A;  2YS9 A;  4A0Y A;  2HOT A;  2M5W A;  3MKY B;  3F8F A;  3MMY B;  1UJ8 A;  5FKO A;  3I4M J;  1VQ9 I;  4BAC A;  1JTY A;  1Q1V A;  1WH7 A;  1VQ6 I;  2Q0O A;  2LSO A;  4CH7 A;  3BT9 A;  1D3Y A;  3MN2 A;  3KYC B;  4G8X A;  1R5H A;  1SD5 A;  5TJJ A;  5TIS C;  5EEH A;  2HTS A;  5LLQ A;  3VOD A;  2KMU A;  2QQ9 A;  1SD4 A;  4HDV A;  3ZQ7 A;  5F04 A;  2JVH A;  3IC7 A;  1D8J A;  2LF7 A;  2NNN A;  3DF8 A;  3KP5 A;  3FIS A;  2RRE A;  2HZT A;  1G3Y A;  2H1K A;  4BYY A;  3R0J A;  1V5G A;  5K5Q A;  1XTA A;  1ZN2 A;  2LKS A;  2JA8 J;  3FK6 A;  3LSR A;  3O3K A;  3JCU C;  4UVA A;  2LD5 A;  4LJZ F;  4ZZL A;  1IN4 A;  3ABK H;  3IHU A;  5JFR A;  5E17 F;  3V7R A;  3CJR B;  1W5T A;  1LFU P;  3IH3 A;  5DUK A;  3HKZ N;  4YIR X;  5K5O A;  2BBY A;  2ZNZ A;  3ZN0 A;  3ZR8 X;  2ZKZ A;  4XOT A;  1VQL I;  1CGP A;  2Z2S B;  3CCY A;  2EV6 A;  2XGE A;  5J3L A;  2OPT A;  2DW4 A;  3I59 A;  1P6R A;  1NHA A;  2XRN A;  3IAM 2;  1Z7U A;  2VON A;  4I09 A;  4NQW B;  5H6Q A;  4EJT A;  3FM3 A;  1D1B A;  3SDG A;  4RLF A;  2UXN A;  4XNF A;  1E17 A;  1RI7 A;  2HKX A;  1UHM A;  3H9Q A;  2HOE A;  1R5G A;  1OCT C;  3GLX A;  3W2V A;  2Z5U A;  2O0Y A;  5LFA A;  1T8I A;  3ZMD A;  4A6D A;  3L2R A;  2KPM A;  1ZG1 A;  1EA3 A;  2M7A A;  2RV8 A;  5FKN A;  3COA C;  1W36 D;  2IRF G;  2V26 A;  1BI0 A;  1JHH A;  2WV1 A;  1U3E M;  2ZSI B;  2R7R A;  2GBY A;  5D5V B;  3K69 A;  1EH8 A;  4UUT A;  2FJ1 A;  1HKQ A;  4C9Y A;  4E7J A;  3HOY J;  2VBX A;  3WGH A;  1J9I A;  1HST A;  2DMN A;  1N25 A;  4XBF A;  1TWF J;  2HWV A;  1KA8 A;  4ZDP A;  1T33 A;  1ZGA A;  5FRO A;  2Z1D A;  1V4R A;  1RR7 A;  4DBR A;  3DU6 A;  2HOA A;  1ZRD A;  3KP4 A;  3BPV A;  3LSG A;  2LOO A;  1AOY A;  2BYV E;  1IV6 A;  4AYB A;  1LNW A;  1S7O A;  5IT9 Z;  4HEA 2;  3SFZ A;  2OQR A;  2DDB A;  3PSF A;  4W97 A;  4IHW A;  1CF7 B;  3SQN A;  1TWG J;  4BGD A;  2XRL A;  1E3P A;  2BVM A;  4FE7 A;  5IOZ A;  1IG7 A;  2AHQ A;  4BNC A;  3CDI A;  1J59 A;  1BM9 A;  1TW3 A;  4XSX F;  2Z33 A;  1XCB A;  5ILU A;  3K1P A;  3KLO A;  4KA4 A;  1G3S A;  2R7Z J;  3OYA A;  1VQM I;  1MNM C;  4YEJ A;  4G6D A;  4ASN A;  1D5V A;  1FIP A;  2NS8 A;  1P7I A;  3GUD A;  2OA4 A;  2OD5 A;  4DYQ A;  1O3R A;  4QIW N;  1WVR A;  3IV5 A;  1WI3 A;  2EV0 A;  5DCM B;  1Z9C A;  2P8T A;  1FX7 A;  3OWT A;  1TTY A;  3QAH A;  3I5U A;  2FRH A;  5C4J J;  1ZRC A;  3TO6 A;  4BXF A;  1HC8 A;  1B9M A;  4XLE A;  1BR4 A;  1J75 A;  4LB6 B;  3F3X A;  2M30 A;  3L2C A;  3GTK J;  2R3S A;  5EG0 B;  4J19 A;  2PG4 A;  3K4J A;  4YFX F;  5HNH A;  2M87 A;  1IC8 A;  3ZPL A;  3WTW C;  3CC2 I;  2IAI A;  3PM1 A;  5DCF A;  1U0J A;  3CMA I;  1OCO H;  5GAG J;  3GFM A;  3QPT A;  2IJL A;  1IN5 A;  4QPO A;  3HGG A;  2GA2 A;  3GW2 A;  1TQM A;  3E3V A;  2FF4 A;  2KJB A;  3NRV A;  2LRE A;  4DOZ A;  3GZ5 A;  1FIA A;  1X2N A;  4RM3 A;  3QYF A;  2IXS A;  2WY7 Q;  3RKW A;  2DU9 A;  1YW7 A;  1Z91 A;  1X1C A;  5CQG A;  5DD4 A;  4B48 A;  4F93 B;  2X6Y A;  2W7N A;  3W2A A;  2R7O A;  1JKR C;  1MJA A;  3PNY A;  4ITV A;  2DDA A;  4HV6 A;  3DBH B;  4GYG A;  2MC4 A;  4QPQ A;  1WJA A;  3GBG A;  3F8N A;  2K3P A;  1VZ0 A;  2ZO4 A;  2IW5 A;  2WA0 A;  5ERI A;  1BJA A;  4EM2 A;  4P9U A;  2UUZ A;  4E7I A;  1R4N B;  2M8G X;  3LWF A;  2L01 A;  4DYC A;  2W57 A;  3HG9 A;  2OC6 A;  4NC8 A;  1QRY A;  5GPA A;  3RJP A;  1R71 A;  1ZLJ A;  3TOA A;  2ZNY A;  3WHC A;  3S17 J;  1YW8 A;  4A69 C;  5F1J A;  1ZHF A;  4HF2 A;  4XON A;  1FBQ A;  2XB5 A;  3G6E I;  4MEX F;  1FT9 A;  2M0M A;  4E70 A;  2X6O A;  3GX4 X;  5ICE A;  1QVT A;  2VBY A;  3VSK A;  4F7Z A;  2IS4 A;  4HYE A;  5IP7 J;  1KU7 A;  1ITY A;  4JX4 A;  4YG2 F;  4BDY A;  1HF0 A;  3S8P A;  5KHD A;  2LF8 A;  4XRS G;  3L2U A;  1K79 A;  3S2D J;  3GME A;  5LGT A;  2L7F P;  4M3E A;  1ZG3 A;  4V19 K;  2KRC A;  4HLY A;  2F6C A;  2DFI A;  3T8R A;  4N9I A;  5HOD A;  4AM3 A;  4HPQ A;  4YFN F;  4Q5S F;  3L2V A;  4I0B A;  1R9T J;  1AU7 A;  2V1D A;  2FBH A;  3HOT A;  3H0G J;  1K7A A;  3ECH A;  2LMD A;  2XKP A;  2V6E A;  2ETH A;  2WAD A;  1TT0 A;  2LG4 A;  3O6B B;  4C3I J;  1K61 A;  1LFB A;  4A93 J;  4RAF A;  1D0X A;  3K4N A;  3R61 A;  1ZH5 A;  2KDO A;  1KON A;  5LRS A;  2FOK A;  3U9G A;  3V8J A;  3TKY A;  5L3F A;  2JQ7 A;  2A69 F;  2COM A;  2FQ3 A;  2HXO A;  1A31 A;  2O8X A;  1IUY A;  1ZKG A;  3I4N J;  3E97 A;  3L7W A;  2UV1 A;  3TL4 X;  3M3Y J;  2IGN A;  2LP0 A;  3MCZ A;  1QZZ A;  5IP6 A;  1P92 A;  2EZL A;  2BV6 A;  1LJ9 A;  4ZYD A;  3H5N A;  1X1P A;  3RKX A;  3SFI A;  3JR9 A;  2NXN B;  3CCS I;  1BJZ A;  1XMA A;  2P5L C;  2DFH A;  4KFC A;  3L2W A;  1JTX A;  5L3C A;  2VBW A;  4CA0 A;  3CMY A;  4KUM A;  4UUS B;  1WHU A;  5KVR A;  1U5T B;  2EFN A;  3IH2 A;  3FKI J;  1IDZ A;  2OV7 A;  3GTP J;  3DTK A;  4JP0 A;  5K7F A;  1WJD A;  2A5Y B;  5DV5 A;  3GFJ A;  5BS6 A;  4XOR A;  5D8K B;  4BE1 A;  1DPR A;  4IJA A;  3GFL A;  1V3F A;  2V9V A;  1IXS B;  1FOW A;  3DEE A;  3FWE A;  3BJO A;  1Y8Q B;  1FZP B;  3LAJ A;  3R60 A;  1S29 A;  2L2O A;  2HVR A;  1LQ1 A;  3KIO A;  3K1N A;  4QTR A;  2K7L A;  1ZTR A;  5C44 J;  2W1O A;  3J7Y J;  1X3Z B;  4R8H A;  1KQ9 A;  5ICF A;  3V4G A;  5KK1 A;  1P2F A;  1K4S A;  2DJI A;  2GQQ A;  4U88 A;  1H9G A;  3CCM I;  3WE2 A;  1E3H A;  5JVT A;  2EFO A;  1Z3X A;  1RUN A;  1KU2 A;  2FBI A;  5CVU A;  3G3Z A;  2MH2 A;  1Z3Y A;  4UNO A;  3F9K A;  2LY9 A;  2NS7 A;  3D5R C;  1IXC A;  4D7M A;  4CYC B;  4KMF A;  3KX2 A;  4MLO A;  1S9H A;  4EQQ A;  1JT6 A;  5F64 A;  2P81 A;  3PO3 J;  2IS2 A;  3M7G A;  2ZSH B;  2XSJ C;  4I01 A;  3JRC A;  2E1M C;  1QGP A;  2ID3 A;  3HYI A;  3E5U A;  2EB7 A;  2CU7 A;  1W5S A;  2MC3 A;  1TNS A;  2FQ4 A;  3KYD B;  5HLT A;  1VQ7 I;  3CME I;  1O7L A;  2CUE A;  4XLF A;  1F5T A;  2L9V A;  2Q2E A;  5FFZ A;  3HXL A;  3OOP A;  3WGG A;  2L5Q A;  5E3L A;  1YJW I;  1PUF B;  2EIL H;  1I5Z A;  4XID A;  3OYE A;  5HDK A;  1MD0 A;  1OR7 A;  4B44 A;  3RPU A;  1ZRE A;  1RNL A;  3FMQ A;  4CZC A;  2DPU A;  3CP2 A;  2XPV A;  1IZ1 A;  3TW6 A;  3I58 A;  4WX9 A;  2ZME C;  2R7V A;  2DT5 A;  2JJ7 A;  4OAY A;  1MBE A;  4MEY F;  3CTA A;  4GGG A;  4O5V A;  1JGS A;  3OOU A;  3GYH X;  2EPF A;  3FXO A;  4IOA F;  3GO5 A;  1UAA A;  1AA7 A;  5CVI A;  2TRT A;  1P4A A;  2QA4 I;  2K02 A;  4IRG A;  4NB5 A;  1LE8 B;  3PSI A;  3BCA A;  2XGC A;  2Q1Z B;  2V79 A;  4G94 A;  3G1M A;  4XN0 A;  4MO7 A;  1MBF A;  1AHD P;  2KZG A;  1YRN A;  2E60 A;  2VC0 A;  2F4M B;  1IF1 A;  2F48 A;  2HKO A;  2BXZ A;  2F4O B;  2E1O A;  2ZME A;  3BTC A;  1RZ4 A;  2EFP A;  1U9N A;  5FD6 A;  2RGV A;  1YJN I;  1KU9 A;  4BHP A;  2IGK A;  4C30 A;  2ICW G;  1X4O A;  2M4K A;  4XIC A;  3WGI A;  1Y8R B;  2QKL B;  2K9N A;  2VKD A;  2CQX A;  4UV8 A;  3ZQI A;  1SVO A;  2QCO A;  3M1C A;  3EQL F;  4BHC A;  4NHJ A;  2DOE A;  2CQ7 A;  1D1C A;  3WTT C;  3HPH A;  5LHG A;  1I39 A;  3OL3 A;  3KZZ A;  4JK1 X;  3FXM A;  3RI4 A;  1PVE A;  1OCR H;  2KLO A;  3OR2 C;  2VLA A;  1R4M B;  3BTL A;  3QYE A;  1XS9 A;  4RB3 C;  2A68 F;  2K3F A;  1SFX A;  2CFX A;  2WTE A;  4RGX A;  1EF4 A;  1SFK A;  3VFZ A;  4A3E J;  3ML6 A;  1I6X A;  3S3O A;  2E1N A;  4ZYA A;  2LLK A;  5DEQ A;  1LDK B;  1XSX A;  2XGD A;  2W85 A;  2P6T A;  3RPQ A;  4LG0 A;  1S5L C;  2GZW A;  3PIP F;  2PJR A;  2E36 A;  3FXU A;  4M71 A;  2IGO A;  3MKL A;  3BLY A;  3BZ6 A;  4II3 A;  4Y7N J;  3VWB A;  5DS9 A;  1ZAO A;  1MSE C;  1HCR A;  2NYX A;  4HF1 A;  1B8I A;  3BR0 A;  2ACJ A;  3LSJ A;  2Z16 A;  4OIP F;  2H6B A;  4XM3 A;  3OR1 C;  5JVG F;  3Q0V A;  5F6F A;  3UR3 C;  2FSW A;  1R1U A;  5KAF C;  4XRF A;  3S2W A;  4ESF A;  1K78 B;  1G8X A;  1L0O C;  4PGG A;  2QWW A;  1MMS A;  1LDJ A;  1XB4 A;  3CUQ A;  2DO7 A;  3OYI A;  4IHT A;  3HSR A;  4KIF A;  3CCV I;  2V9K A;  3HDD A;  1RUO A;  1FY7 A;  3ZMT A;  4M6Y A;  3SYT A;  2WAQ A;  5CPR B;  1Y56 A;  2QM3 A;  1S6L A;  2E7X A;  3DBR B;  4UVB A;  5GAH J;  3BG5 A;  1SC7 A;  4KIC A;  3QU3 A;  3KEQ A;  1ETK A;  3PUF A;  1MND A;  4KNY A;  4HNU A;  3V7C A;  1JJ8 C;  4BHB A;  2PBI A;  4XLP F;  1YX3 A;  3CUQ C;  4PJL A;  2E2H J;  4BEH B;  1VFC A;  3BG6 A;  1QHH D;  3IAS 2;  4BKX A;  1TWH J;  3CCE I;  1ZAR A;  1HW2 A;  4HZF A;  2EZH A;  3VEP A;  1MJ9 A;  3O8G A;  5EGO B;  3IRQ A;  3OYC A;  4J00 A;  1YOV B;  3LNQ A;  1SAN A;  4BQO A;  5K1Y A;  3W2W A;  2PJR B;  4EGZ A;  3BP8 A;  1U5T C;  3GCM A;  1JUS A;  2R5Z A;  3GEZ A;  1DDN A;  3LST A;  1WRJ A;  2CV2 A;  4HSR A;  4LLL A;  1PDN C;  3OIP A;  1YO5 C;  1PUE E;  1OYY A;  3WE3 A;  5F08 A;  2NVQ J;  2JN6 A;  1RC9 A;  4PDK A;  4LK0 F;  1GUU A;  2WBM A;  1ZRF A;  3ELK A;  4FIS A;  4AWX B;  4HX4 A;  5CYV A;  4LIT A;  3MKW B;  4ENK A;  2LC2 A;  1IAW A;  3HHG A;  1UMQ A;  4R1H A;  2W4S A;  3R0A A;  4H0E A;  2XUB A;  3MD2 A;  1I27 A;  3C3W A;  1YI2 I;  3KPH A;  2E2I J;  1JI8 A;  3JW4 A;  1BN5 A;  4AID A;  3F6V A;  4RLQ A;  2AS5 F;  4GYI A;  2O03 A;  3SZG A;  2W00 A;  3GTG J;  2LY1 A;  2ZXW H;  1FYM A;  1O7F A;  4PK4 A;  4A3F J;  2FD5 A;  3GLL A;  2PMH A;  1VQ5 I;  4RAG A;  5JI6 A;  3MVP A;  3ZMS A;  3HBL A;  2X85 A;  4H4K C;  4A2U A;  3AG1 H;  2OAZ A;  3G1O A;  3PNT A;  3JRE A;  2BHZ A;  2EWN A;  3SXY A;  1NH3 A;  3BG9 A;  1POG A;  2O7O A;  3X2Q H;  4QLC U;  5IT9 K;  2H09 A;  1MMN A;  3S1R J;  2OZU A;  2FU4 A;  2CW0 F;  2NRA C;  1YQA A;  3VYT B;  1R7J A;  2DT6 A;  1APL C;  4A5M A;  2VQC A;  4HAM A;  4IF4 A;  2ELJ A;  1PJR A;  2E19 A;  2RC4 A;  2GXB A;  4XRM A;  2XAH A;  1UCR A;  5E3M A;  2V9P A;  4DNC A;  2O6G E;  1LVK A;  2L9N A;  5EGO A;  2CS3 A;  3DLA A;  1ENH A;  4EM0 B;  3I53 A;  1TWA J;  4Y4R A;  3S93 A;  1T98 A;  4BAY A;  2ESH A;  4D5C A;  2P7C B;  5DD8 A;  1KU3 A;  1IN8 A;  1G3T A;  3EET A;  1VI0 A;  4I98 B;  2NVY J;  4A3M J;  3A2K A;  2VE8 A;  3Q9S A;  1OYI A;  4S0H B;  2ZJR F;  4MQ9 F;  2CV1 A;  3S32 A;  4BE2 A;  4PJJ A;  2E7W A;  4RGR A;  3EPZ A;  1S3J A;  1X2M A;  3BWG A;  1AKH B;  4C2U A;  2ID6 A;  2FEZ A;  2JSP A;  1PYV A;  1GV2 A;  3F72 A;  1T08 B;  2X1E A;  4IQ4 A;  5LRR A;  5D5W B;  1XPX A;  4ZJZ A;  1RKT A;  3NAR A;  1T2K A;  2DN0 A;  2V1X A;  2D1H A;  1ZR2 A;  2OU2 A;  3MZH A;  3DPT A;  3BG3 A;  3WTU C;  3BJA A;  3OL4 A;  5J6X A;  3IRR A;  2IT0 A;  4CSW A;  5DCM A;  5L3B A;  2TDX A;  4FCY A;  3D1N I;  1T38 A;  1NK2 P;  3HL2 A;  1U78 A;  1HXD A;  3GTJ J;  1V54 H;  4GDF A;  3RQ4 A;  3I9V 2;  2LVS A;  4BDZ A;  2CW8 A;  3KP6 A;  2G9W A;  3HGY A;  3TQN A;  4G7Z F;  3H9G A;  1S7E A;  2KIU A;  2W48 A;  4MTE A;  3R6S A;  4YIF A;  4HW0 A;  5F0H A;  4HBL A;  1NG7 A;  3AG3 H;  4F52 A;  2AQE A;  5M3F J;  4KIS A;  1J2X A;  4BS9 A;  4CHU A;  1Y1W J;  4ZDO A;  1JJ6 C;  4HX8 A;  3DEW A;  3QWL A;  3ABT A;  3GZ6 A;  2VB6 A;  2IS1 A;  5DM7 F;  3FHZ A;  2MA3 A;  5CVV A;  3CDL A;  3A4C A;  2LK2 A;  1MBG A;  2QSF X;  3A01 A;  2HZD A;  4F92 B;  3H5A A;  2O9L A;  4I02 A;  1Q1H A;  2DOF A;  1E0E A;  4I7H A;  4AYB N;  5GTH C;  1Y1V J;  1YIO A;  1D5Y A;  3M8F A;  1BOB A;  5D4S A;  1G2H A;  3CCJ I;  2VPL A;  3CCQ I;  3IWZ A;  2LYC A;  4Y3O A;  3P9K A;  5HNF A;  2VL8 A;  3MAJ A;  5TGT A;  2W24 A;  4DIQ A;  2EIJ H;  2XSD C;  2OCE A;  2RN7 A;  3WTY C;  4RA2 A;  2DMU A;  1BI2 A;  5A2Q K;  2WV0 A;  2MYS A;  3U21 A;  1WJF A;  4ESJ A;  1OQY A;  4IPA A;  4WWC A;  3JTG A;  1N78 A;  3QOE A;  3R4K A;  2XRO A;  1R49 A;  2KRH A;  3IP4 B;  4OIO F;  3S15 J;  2ESN A;  1LPQ A;  2RAE A;  4HST A;  2ECB A;  4XOP A;  1T95 A;  3L2Q A;  2X1D A;  2XHK A;  2HI3 A;  2M9H A;  1EV7 A;  2PJP A;  2VI6 A;  1QPI A;  4RGS A;  4LIU A;  5HLG A;  2E5N A;  5B1A H;  2W25 A;  5LGN A;  4M3G A;  2ZBK A;  1Y6I A;  4IXA A;  1QA6 A;  4P5O A;  5D6E A;  3AG4 H;  5HS7 A;  4XMY A;  4X0G A;  2KDZ A;  2QSG X;  2JUC A;  3CO6 C;  4M9S A;  1P7J A;  1Z1D A;  4BE0 A;  2WB1 A;  3DPL C;  4PJN A;  3SZT A;  5L3E A;  4IRI A;  4FTH A;  2WAF A;  5AIP A;  3RCO A;  2A3S A;  1SD6 A;  4IKF A;  4O3M A;  2PMU A;  1XX5 A;  2EBI A;  3KYL A;  5HVQ C;  1W4M A;  4EJV A;  4KT6 A;  5HOO A;  5FJ8 J;  2K86 A;  3PQJ A;  5IT3 A;  5JHF A;  4Q47 A;  1K4T A;  2WWY A;  3LOC A;  1QPM A;  2FNA A;  3OV8 A;  2H1L A;  1H89 C;  3HOU J;  4RDU A;  2MLG A;  1NK3 P;  1XMK A;  2H8W A;  2Y31 A;  2R4G A;  3TO7 A;  2ZCW A;  3BC8 A;  3LSP A;  2W84 A;  5HS9 A;  3PQK A;  5GAD J;  1IXR C;  4QSH A;  2HDC A;  2FXA A;  1U9O A;  4XK4 A;  4E7S A;  4HQM A;  1EH7 A;  3HUG B;  3KZI C;  2QLZ A;  4DZJ A;  6PAX A;  2FX0 A;  2XAG A;  3LAP A;  3HSE A;  1TZL A;  3TO9 A;  3HOV J;  2JMW A;  3FXR A;  3KZY A;  3FXJ A;  4CUG A;  1G59 A;  3F6O A;  5M5X J;  3VPR A;  2J5O A;  2CSO A;  4UUS A;  2LDU A;  2LY2 A;  2FE3 A;  4HRI A;  3ZQQ A;  1RR8 C;  1JUP A;  2CQN A;  1SMY F;  2HQR A;  4B47 A;  5E8I A;  3HB9 A;  3ZQC A;  4ZZD A;  1FC3 A;  1GV5 A;  1U6G A;  2MW8 A;  2F2E A;  3ULQ B;  4AVZ A;  2M45 A;  3QP6 A;  1LVA A;  5FKL A;  3BZK A;  1G4D A;  3QRF F;  5BNG A;  2BHY A;  2E2J J;  2EFQ A;  1TQP A;  2VIX A;  4WXC A;  4L0Y B;  1SFO J;  3DEU A;  3SHF A;  3JSO A;  3J7A O;  1YIT I;  4G6Q A;  1T56 A;  2DOD A;  2DA7 A;  5IOY A;  1KGS A;  4ETS A;  1FMW A;  2EK5 A;  3M4O J;  1G3W A;  3JRD A;  2PMZ N;  2AXT C;  5EZG A;  2JT1 A;  4PSX A;  3NAU A;  4KN7 X;  3FIW A;  4OMY A;  4NQW A;  4M3F A;  3HPG A;  3TMO A;  5J8F A;  2DA3 A;  2VQG A;  2P4W A;  3QPL A;  1SMT A;  1GVD A;  2L54 A;  3KEO A;  2LFB A;  4DJA A;  3MQ0 A;  4L9V A;  3EUK L;  3AG2 H;  2RQQ A;  2F5C A;  4W1U A;  1K6O A;  2ZFW A;  4CIC A;  2ZJQ F;  3A03 A;  2GM4 A;  4CXF A;  3ZOB A;  2R5Y B;  1GXP A;  5JLX A;  2N8G A;  1BI3 A;  2HFH A;  4LG3 A;  1R22 A;  1K6Y A;  3VYR B;  1WJE A;  2HR3 A;  1ERD A;  3BDD A;  4BBS J;  3FX3 A;  2JK3 A;  2JWT A;  1ORK A;  2OUM A;  4BJ6 C;  1F9N A;  3K6G A;  3RKQ A;  1NTC A;  1R36 A;  1LDD A;  2DI3 A;  3K0L A;  1D0Y A;  3H5R A;  4NC6 A;  3GTQ J;  1I6H J;  3PFY A;  3HOZ J;  3JRB A;  2ZB9 A;  4LOC A;  4CDG A;  1R1T A;  3ERE D;  1B72 A;  3E6D A;  1YRN B;  1FTZ A;  2L7M P;  3RDI A;  2JVG A;  4BXU A;  3ZQG A;  3TED A;  4B8X A;  2V6C A;  2XF5 A;  4N4O B;  2A05 A;  1OCZ H;  2AO9 A;  2K9S A;  3ZCO A;  2R5Z B;  1K83 J;  4KYW A;  2VBZ A;  4C2T A;  1RET A;  4D9J A;  2Y2Z A;  2EIN H;  2A6T A;  1BW6 A;  3K7A J;  2OCC H;  4Z2Y A;  1EJ9 A;  3WTS C;  2HDW A;  2PFB A;  1XDU A;  5M5Y J;  1TT5 B;  2EH3 A;  2D1V A;  2EV5 A;  2HPM A;  1W5C C;  5EYR A;  2QBY B;  3DTI A;  3RKY A;  2DA4 A;  4DGW B;  2ZME B;  2ZJ2 A;  2VJ4 A;  3GWZ A;  4DBQ A;  2KIF A;  2LRD A;  2F5V A;  4XN3 A;  5E18 F;  2QEX I;  4TV7 A;  2DA2 A;  1WH5 A;  5DUI A;  2GXG A;  3K10 A;  1FTT A;  2QEN A;  2QSH X;  4U0Y A;  2HQN A;  3HOW J;  3IWF A;  4L5J A;  1B1B A;  1BIA A;  2GXA A;  5DDG A;  2HQA A;  5GP9 A;  3RYP A;  5B5E C;  1BBY A;  2XPW A;  1B6A A;  2R92 J;  2EFW A;  5FGM A;  1G6N A;  2CMP A;  3LA7 A;  1FP1 D;  3D5L A;  1HSJ A;  1WQ2 A;  1H9T A;  2DFE A;  3K4B A;  1OCC H;  1BL0 A;  3F8B A;  2DFF A;  3MFK A;  3IH4 A;  2K9M A;  4HQE A;  2YU9 J;  2CQK A;  2STT A;  3I71 A;  2HPI A;  3OS1 A;  2X48 A;  2EJR A;  3A0H C;  5H2F C;  5B3S H;  1TBX A;  3H3Z A;  1TC3 C;  5LHH A;  5JLW A;  4G7O F;  2JUG A;  5FLM J;  3DLL F;  4C3J J;  1SEU A;  4M6X A;  4XLN F;  1QZY A;  1IGN A;  2HDD A;  3S1N J;  1WSU A;  3CQZ J;  3OYM A;  2YX7 A;  3CCL I;  1X3W B;  1B72 B;  1HDD C;  2XB0 X;  3S1M J;  2P5K A;  1VQP I;  5JR3 A;  2DA6 A;  2QGU A;  2BY0 A;  2HYG D;  4KJZ A;  1O3T A;  1Y0U A;  3B73 A;  3AAF A;  1MJB A;  3C2H A;  3BPX A;  1ETW A;  3J81 Z;  5HLI A;  3PIO F;  1A5J A;  1MMA A;  4CCL A;  1C0W A;  5J47 A;  2VOP A;  1TQI A;  4BQQ A;  1RIO H;  1MKM A;  2OZ6 A;  4U0V A;  2HNH A;  3GVA A;  1XC5 A;  4RAZ A;  5EZH A;  1FOX A;  3DWL E;  2BY2 A;  3WU1 B;  4XLC A;  3HM5 A;  2LKX A;  2OJE D;  4YII A;  2EIK H;  3L00 A;  4HOB A;  4MHG A;  2E5Z A;  3WOD F;  1I50 J;  2WAE A;  3F8C A;  2X9D A;  3ZQL A;  2IA1 A;  1GHC A;  4RB2 C;  3P9I A;  4GCV A;  1FLI A;  1F36 A;  3K70 D;  3BJ6 A;  2JA6 J;  2YU3 A;  3TP3 A;  3WTV C;  4IL6 C;  4PJ0 C;  4AC0 A;  1HBX G;  4WCG A;  3BTI A;  3OSF A;  4L5E A;  1XSV A;  2XDV A;  3HRS A;  2HOS A;  2KT0 A;  2MD5 A;  2VE9 A;  2ZJP F;  1Y39 A;  2B63 J;  3H35 A;  3RPU D;  3BR3 A;  4LD5 A;  4BEH A;  4RS8 A;  2J5P A;  2VPR A;  3ZP5 A;  2LR8 A;  5J1U A;  4EJO A;  4MNU A;  2HVQ A;  3Q9V A;  5LHI A;  2VQH A;  2R7T A;  5E8G A;  2BW3 B;  1A04 A;  2HS5 A;  3CLQ A;  3TW7 A;  4AU7 A;  5J4V A;  1PP7 U;  3TGN A;  5EEA A;  2VOD A;  2QF7 A;  5LEJ A;  3B02 A;  4Q4Z F;  2L7Z A;  3V42 A;  4FX0 A;  1VQO I;  2DMP A;  1ZLK A;  4AUX A;  2RNG A;  4X1E A;  3JRI A;  5FKK A;  1SD7 A;  4BXX J;  4FE4 A;  4L9N A;  1Z67 A;  2PEX A;  2DMT A;  2DK5 A;  3FXQ A;  1BIB A;  3LSK A;  3ONQ A;  1KQ8 A;  2LBF B;  2LH9 A;  5EJC A;  4LLN A;  1TWC J;  2HQ5 A;  5ILS A;  4RGU A;  1R58 A;  2R5Y A;  4A12 A;  2H94 A;  1HQC A;  2Y0S A;  3FM5 A;  3LQQ A;  1X58 A;  4N0B A;  5DYM A;  3HRM A;  2XC7 A;  3ISP A;  1SAX A;  2IBD A;  3F23 A;  5HDG A;  2NNY A;  2L7K A;  1DUX C;  2R7X A;  2V1U A;  5FLX K;  1R5I D;  4WXH A;  1YLF A;  1W7P A;  2QKM B;  1R1V A;  3W3C A;  4IOC F;  1EKE A;  2KFD A;  5KNL A;  3C2B A;  4A3I J;  2M0C A;  3HTS B;  1LUJ B;  1KQ0 A;  3N05 A;  1GLN A;  1MH3 A;  3LFU A;  4XR6 A;  1D1A A;  1H88 C;  2MBF A;  3VDX A;  4Y15 A;  3Q3S A;  2V7F A;  1LEA A;  3KP2 A;  4M9Z A;  5GPC A;  2Z99 A;  1HOM A;  1FMV A;  4AIH A;  3VSL A;  3VOE A;  3MWM A;  3TDZ C;  4WF2 A;  1FOK A;  2VOO A;  3PNV A;  4LMY A;  1LEB A;  5F0F A;  2WAQ N;  3BR5 A;  3W6J B;  4NDL A;  5FB2 A;  1F43 A;  3PO2 J;  2E1M B;  1TLH B;  4OMZ A;  1ZK8 A;  4AVP A;  3I59 B;  3C18 A;  2D45 A;  1E3O C;  1YFH A;  2X0L A;  1MGT A;  2CUZ A;  2GLO A;  2CYY A;  3CUQ B;  2DYR H;  4WK8 F;  2XAU A;  2Z3Y A;  4D5F A;  2IVM A;  2KQR A;  3WTZ A;  1HKT A;  3BY6 A;  3ASO H;  4MIM A;  2EZI A;  1YS6 A;  4LIV A;  3QQA A;  3CJN A;  1VND A;  2JA7 J;  2H6C A;  3V8L A;  4AD9 A;  2UWM A;  5J8C A;  1MW7 A;  2R7F A;  4LFU A;  4ENM A;  1H8A C;  1N77 A;  3T0Y A;  1ZQ3 P;  1IRX A;  3OY9 A;  1MMG A;  1GDT A;  2O8K A;  4E7K A;  2JTV A;  1FPQ A;  1MZB A;  5KCM A;  4F55 A;  4LK1 F;  4BQA A;  2P6S A;  1UG2 A;  1LKX A;  1ZGJ A;  4U87 A;  1X3U A;  3SEQ A;  3L1P A;  4B1R A;  2L9S A;  1FSE A;  3W6V A;  1P4X A;  1XGS A;  3RYR A;  2QQ8 A;  1LB2 A;  2GAU A;  4KIB A;  1SVL A;  1WKM A;  2XAQ A;  3G4S I;  4PFO A;  3PL8 A;  3HJE A;  3KEY A;  4JYK A;  4MFD A;  4EMS A;  1CF7 A;  3VYU B;  3ZQF A;  1PP8 F;  4V2G A;  1VQ8 I;  1HA8 A;  5D5U B;  4KN4 X;  1IV8 A;  4EJW A;  4P9F A;  2VT3 A;  2WC2 A;  5A2Q Z;  2LTP A;  2L0K A;  3DV8 A;  1BI1 A;  3MEX A;  3E1S A;  4N9H A;  3ZQH A;  3J80 Z;  4L18 B;  1Y0N A;  9ANT A;  2VXZ A;  4U0W A;  4BBR J;  4BU2 A;  4DZP A;  4RMN A;  1S72 I;  3HOX J;  1ZG5 A;  2O61 A;  1HKS A;  2Y48 A;  3K4C A;  1XSD A;  4ANJ A;  2P0W A;  3ZMU A;  4I6Z A;  3F22 A;  2ZXH A;  3ABU A;  3DU5 A;  1YTY A;  4KIT B;  4PJM A;  4EEF G;  2EIM H;  3DP7 A;  4MGR A;  5H20 A;  3WU2 C;  2VQL A;  4BY7 J;  1T0F C;  4KMU X;  5GTI C;  2JRM A;  4PSW A;  1MSF C;  3M07 A;  3J81 K;  3FHN A;  3H36 A;  2PI0 A;  1O3Q A;  5E1Z B;  3QYB A;  3HRU A;  4AIK A;  3ABL H;  1Z05 A;  1DPU A;  4OIN F;  1M1E B;  1ETY A;  1DGW Y;  4C3H J;  2M1B A;  1ULY A;  1UST A;  1Z6T A;  2HYF A;  3LQR A;  4HA8 A;  2Y0M A;  5AON A;  4V2F A;  4PUS A;  1X1B A;  4IEJ A;  2MLK A;  1XDS A;  4XKV A;  2BW3 A;  3OYF A;  1IUF A;  3HKZ A;  1USS A;  2YSR A;  4OU0 A;  3M8J A;  5CJ9 A;  4B3A A;  4NBQ A;  1P9Q C;  1R6R A;  3A1Y A;  3DCF A;  5F27 A;  5FO5 A;  1U8R A;  2HEO A;  3QU6 A;  4ZC3 A;  2EA4 A;  3OSG A;  2DLL A;  3T1B A;  2KJC A;  3P7N A;  3UKG A;  2TCT A;  1O57 A;  3CMM A;  4ZYH A;  2I8D A;  1T39 A;  2KKO A;  2B7E A;  2Z9O A;  4OAZ A;  3L9F A;  4EJU A;  5E3N A;  4CCN A;  2H27 A;  2D2W A;  3M9A A;  4L9T A;  4UVC A;  1ZR4 A;  5J4Y A;  2QBY A;  2R93 J;  2K9Q A;  3DBL B;  5L3G A;  4ZTF A;  2JZY A;  2ZXI A;  4PFP A;  2JPC A;  1WJC A;  3C7J A;  2X51 A;  2BE5 F;  1DGR M;  2YR2 A;  1SVM A;  2XVC A;  3OYJ A;  2DA5 A;  4QWQ A;  4PZJ A;  2LKP A;  4DW6 A;  1BW5 A;  1IO2 A;  1YX5 A;  3GTL J;  1OCP A;  4DYR A;  4PGH A;  4A3C J;  1QZE A;  2KRF A;  3D0S A;  5E79 C;  5B1B H;  3PFI A;  5J40 A;  2Y69 H;  1YS7 A;  2X1C A;  1OMI A;  5FLX Z;  3BQZ A;  2YUS A;  4B3X A;  3WHB A;  1XG1 A;  3OIQ A;  1HLV A;  3QP5 A;  3K1M A;  3KET A;  2ME0 A;  2QQB A;  4HDU A;  4XKC A;  1HW1 A;  5D5X B;  4KDP A;  1B59 A;  2MGQ A;  5FRM A;  2NVX J;  5BQT A;  3ABM H;  1Z77 A;  3IUO A;  2VJJ A;  2L4M A;  2M7B A;  4XSZ F;  2Y9Y A;  3P9C A;  4M6V A;  4E4H A;  1A36 A;  3DQV C;  2MAB A;  4B43 A;  1RPW A;  4E7H A;  2CFO A;  4A6E A;  3CJQ B;  1RES A;  2E34 A;  3E5Q A;  3S3M A;  3F8M A;  5KAI C;  1JGG A;  5FLV A;  1W0T A;  3REO A;  4AIJ A;  3GTO J;  4EV0 A;  2V4J C;  3IKT A;  5CLS A;  3AL0 C;  3K4L A;  1WZ2 A;  4CO8 A;  3LA3 A;  1DQU A;  1HW5 A;  3FF5 A;  1GXQ A;  1WCM J;  3KP3 A;  4ZH4 F;  1ZGW A;  2OTJ I;  4XKB A;  3ROU A;  3CJT B;  1U5T A;  2A5W A;  5GAE J;  1MIJ A;  3HC7 A;  3BZC A;  3P5J A;  4CZZ A;  5IY5 H;  1QVU A;  1HDP A;  3S3N A;  2K85 A;  1D0Z A;  3E5X A;  2Y30 A;  5AIQ A;  1F1Z A;  1TW2 A;  4OOI A;  3U1K A;  4M72 A;  4EAT A;  2NVU B;  1MDM A;  1Z0X A;  2KIM A;  3CF5 F;  4GFB A;  4M73 A;  2Y75 A;  4MFE A;  1A35 A;  1DP7 P;  3FBN B;  3CLO A;  4A0X A;  1V55 H;  2ECC A;  2MH9 A;  3DPU A;  4M9X A;  2HVS A;  1FBS A;  2IA0 A;  2NAZ A;  4XRS A;  1JKO C;  1ON2 A;  1WI9 A;  1P4W A;  2ZFU A;  5BMZ A;  1JKP C;  2V1N A;  3Q5F A;  5J1R A;  1LFP A;  3BQY A;  3NWT A;  5IP9 J;  2DPD A;  4JX6 A;  5C3E J;  1XGN A;  4GO1 A;  4YFK F;  1QBJ A;  4UHT A;  4XLH A;  3N4M A;  4R79 A;  4S05 A;  3WTX C;  3CES A;  2XGX A;  2COB A;  4JQF A;  4RB0 A;  2JA5 J;  3CCR I;  2CGP A;  2VN2 A;  3TP0 A;  2BVL A;  2KL4 A;  4YRV A;  1DP3 A;  2R7Q A;  1VTN C;  4OIR F;  3J80 K;  3I3L A;  3H1C A;  1OR7 C;  3GXO A;  3ZXS A;  5EDN A;  3GZN B;  4ENN A;  1AKH A;  1W1W E;  2IS6 A;  3NEU A;  3MZY A;  1U8B A;  4CYD A;  3RIR A;  4ENJ A;  4G6T B;  5CKT A;  3SZP A;  3DKX A;  2ISY A;  3V7S A;  1B9N A;  2WY8 Q;  3ZN1 A;  3SEZ A;  4F3Q A;  4YEL A;  3ZMV A;  2ISZ A;  2W82 A;  4LGW A;  2DOA A;  3DFG A;  1L3L A;  2F4I A;  3OYN A;  1IRF A;  3E6M A;  1IRZ A;  1MDM B;  3HTU A;  2RDP A;  4GXO A;  4HV5 A;  3S14 J;  3T8T A;  1KYZ A;  3GTM J;  1RKW A;  2M3A A;  4RAY A;  4C2M J;  1OLT A;  2BGC A;  4ABZ A;  3DXJ F;  2GWR A;  1FNN A;  3BOQ A;  5BOX A;  5ICG A;  1IJW C;  1KZH A;  4FET A;  1YIJ I;  3OIO A;  2ZC2 A;  2ELH A;  1T6S A;  3CP8 A;  3K4M A;  2A6H F;  3ECO A;  2K9L A;  4BH9 A;  3RZO J;  1GVJ A;  1OYW A;  2IPQ X;  2CQQ A;  3O2P E;  3H3V K;  2C6Y A;  1W0U A;  3RQI A;  1IRG A;  1JKQ C;  1VQ4 I;  1X1D A;  1N75 A;  5TRD A;  2M8E A;  4LLG F;  2R7D A;  1XGO A;  3OYD A;  3A01 B;  3EUH A;  3RZD J;  2JSC A;  1GT0 C;  3EUA A;  1QO0 D;  1T0F A;  4FT8 A;  2IP2 A;  1FYK A;  4K2E A;  1QHG A;  5BPI A;  2KIS A;  5HDN A;  2F5F A;  4FHT A;  5IYD J;  5E1X A;  1IN6 A;  4EVI A;  1YYV A;  2M4G A;  2FUG 2;  4S04 A;  5H6R A;  1XN7 A;  1ETO A;  4I76 A;  4D0P A;  2WB1 N;  2AQF A;  4HLX A;  3KCC A;  3KLN A;  3TDU C;  1UG0 A;  2Y9Z A;  2G7U A;  4XQF A;  2CO5 A;  3EUH C;  2FML A;  3QOP A;  3W6K B;  3BR1 A;  3GFI A;  5LBQ A;  4IQJ A;  2XF7 A;  4OIQ F;  1ZYR F;  5D6F A;  4N4N B;  3G1L A;  4DQ2 A;  2HTJ A;  1YW9 A;  3K4K A;  1J5Y A;  5HS8 A;  3BCB A;  3I4P A;  1FSH A;  3KFW X;  1SAU A;  3CUO A;  5LD2 C;  2PX9 A;  1TP4 A;  3CDH A;  1QU3 A;  1NG6 A;  3E6C C;  2Y0S N;  2DJN A;  4G7H F;  3OS0 A;  2VKE A;  2BY1 A;  3WU0 A;  4P96 A;  1BC7 C;  3FBI B;  1B8I B;  2A6E F;  3FKJ A;  3Q0U A;  3F21 A;  3DKY A;  4IHX A;  1IW7 F;  5DM6 F;  4D1Q A;  2R7S A;  4A3L J;  2MG4 A;  2R7U A;  2DA1 A;  1WFX A;  2QVO A;  1FP2 A;  2X4H A;  1H0M A;  3FDY A;  2L02 A;  1OJL A;  4BJT A;  4M74 A;  1JT0 A;  1BC8 C;  4OWR B;  5K7Z A;  2CUF A;  3CO7 C;  2I5U A;  2VKH A;  1STZ A;  2K40 A;  4A0Z A;  3CC4 I;  3D5S C;  2KHM A;  1Z21 A;  3FK7 A;  4XKW A;  4E7Z A;  3JRG A;  2H8R A;  1SFU A;  3MZ8 A;  1FEX A;  1MH4 A;  3JAM Z;  3OYK A;  2VC1 A;  2VJ5 A;  4ZDL A;  2HGC A;  1UHS A;  5L3D A;  3U1D A;  3UNG C;  3HZJ A;  4FX4 A;  1UB9 A;  2HXI A;  5ICC A;  4Y33 A;  3LA2 A;  2EZK A;  2VJI A;  2B0L A;  2YPR A;  2Q2E B;  3LL7 A;  1WJB A;  1MNE A;  2R0Q C;  3FMS A;  1F4K A;  3FMR A;  4M3D A;  4RBO A;  1YHQ I;  2OTL I;  1VF9 A;  2IGM A;  5J1Y A;  1XGM A;  3I56 I;  4A3J J;  2LBF A;  2L9R A;  3BG7 A;  1BA5 A;  2GIZ A;  2JA2 A;  5E3O A;  2L3D A;  5IPA A;  2O3F A;  1FJL A;  4KT5 C;  3JSP A;  3L09 A;  3S1Q J;  2FMY A;  3K2A A;  4P1W A;  3TBI A;  4EM1 A;  4E7L A;  2K4J A;  4CCO A;  3OYL A;  2KP6 A;  3A02 A;  1O3S A;  4PCQ A;  4L9J A;  4A5N A;  4U7D A;  4A3D J;  3NWS A;  2OF7 A;  2HU9 A;  3A0B C;  2DTR A;  1REP C;  3ESW B;  5CQE A;  2QQA A;  4GRI A;  4Y13 A;  4BY1 J;  3C2G A;  3IL2 A;  4KIG A;  3LSI A;  5E20 A;  5B66 C;  4HNT A;  3B6A A;  3VYS B;  1OFC X;  5K7H A;  2KIQ A;  2PMZ A;  5C4X J;  4I0A A;  3FXK A;  2E71 A;  5ILV A;  1W36 C;  5EEG A;  2UZK A;  1UFM A;  4A3B J;  2GOM A;  1TNT A;  1WGX A;  4IHV A;  1FWZ A;  3BR2 A;  2PLY A;  1S7A A;  3SDB A; 
#chains in the Genus database with same CATH homology
 2ZXJ A;  4B09 A;  3C1D A;  2VT2 A;  5E1W A;  2F5E A;  3EYY A;  3KE2 A;  2DQR A;  3HSF A;  2UXX A;  2XAJ A;  3HIF A;  4UV9 A;  2RVC A;  2DBB A;  2P5V A;  3K2Z A;  5CVR A;  2OBP A;  2DK8 A;  3WG9 A;  1S8N A;  2CWE A;  2P7V B;  1XCV A;  3JAM K;  3M1E A;  1YG2 A;  5F1R A;  4MQV A;  3EYI A;  1KYW A;  1ON1 A;  4IHS A;  2QUF A;  2E1C A;  3T5X A;  5HLH A;  1W7P D;  2FBK A;  4O6J A;  3RTR A;  1OPC A;  2DAO A;  1EH6 A;  4HX7 A;  2QZ8 A;  3GF2 A;  4ON0 A;  4RB1 A;  2PQ8 A;  5FD5 A;  2F5D A;  4ZYE A;  5BPD A;  1WWX A;  3HRT A;  4EGY A;  4L5I A;  3H3U A;  1J7K A;  3BRO A;  4IRH A;  3K9T A;  4G9Y A;  1JHF A;  1B4A A;  2IA2 A;  5JHU A;  1FYL A;  3HHH A;  1D8K A;  1UHW A;  1AWC A;  5ED4 A;  3VB2 A;  1I1G A;  2DQL A;  2K27 A;  2L4A A;  2CG4 A;  4Y17 A;  2A07 F;  4ZYG A;  1JE8 A;  4LB5 A;  3V8K A;  2Q8K A;  3NQO A;  1E2X A;  1U2W A;  1I1S A;  1BOA A;  1W7P B;  2FNP A;  4MTD A;  2YX4 A;  2OQG A;  4UUV A;  3G73 A;  3U2R A;  1J0R A;  2XAF A;  3M8E A;  1Z6R A;  5LEK A;  2K4B A;  2GIV A;  2XAS A;  1R00 A;  2PN6 A;  1QQI A;  2LNB A;  2QYO A;  5CVJ A;  1OKR A;  3HOS A;  4ESB A;  4WXD A;  4HF0 A;  3IKV A;  3ZMZ A;  2ADU A;  3I0T A;  2AXL A;  3KP7 A;  4L0Z B;  4U7B A;  4I2O A;  1ODD A;  1XD7 A;  3EDP A;  2NS0 A;  3LFK A;  4JBA A;  2RQP A;  2RKH A;  2A61 A;  5K5R A;  4UXN A;  2RNJ A;  1SFE A;  2GA1 A;  2STW A;  4Q48 A;  4LG0 B;  1FBU A;  5D4R A;  4P55 A;  1R23 A;  4IVN A;  3N97 A;  2XIG A;  1QNT A;  3DKW A;  1K78 A;  3I54 A;  2XKO A;  3H92 A;  3JTH A;  2JRT A;  3I64 A;  5FFX A;  1ONV A;  3QPH A;  2JPB A;  5D8L B;  3FZV A;  1JXS A;  3E6B A;  2EA2 A;  3HUG A;  1IN7 A;  4CGZ A;  2FA5 A;  2G7H A;  3TOB A;  2BEO A;  5LGU A;  2XV4 S;  4A0Y A;  2M5W A;  3F8F A;  2Q0O A;  2LSO A;  1D3Y A;  4G8X A;  1R5H A;  1SD5 A;  5TJJ A;  5EEH A;  2HTS A;  5LLQ A;  3VOD A;  2QQ9 A;  1SD4 A;  4HDV A;  3ZQ7 A;  3IC7 A;  1D8J A;  2LF7 A;  2NNN A;  3DF8 A;  3KP5 A;  2HZT A;  1G3Y A;  4BYY A;  3R0J A;  5K5Q A;  1ZN2 A;  3O3K A;  4UVA A;  4LJZ F;  4ZZL A;  1IN4 A;  3IHU A;  5JFR A;  5E17 F;  3V7R A;  1W5T A;  5DUK A;  5K5O A;  2BBY A;  2ZNZ A;  3ZN0 A;  2ZKZ A;  1CGP A;  2EV6 A;  2DW4 A;  3I59 A;  1P6R A;  1NHA A;  2XRN A;  1Z7U A;  2VON A;  4I09 A;  5H6Q A;  4EJT A;  3FM3 A;  2UXN A;  1E17 A;  1RI7 A;  2HKX A;  1UHM A;  2HOE A;  1R5G A;  3GLX A;  2Z5U A;  2O0Y A;  3ZMD A;  4A6D A;  1ZG1 A;  3COA C;  2RV8 A;  2IRF G;  1BI0 A;  1JHH A;  1U3E M;  5D5V B;  3K69 A;  1EH8 A;  1HKQ A;  2VBX A;  3WGH A;  1J9I A;  1HST A;  4XBF A;  2HWV A;  1KA8 A;  1ZGA A;  1V4R A;  1ZRD A;  3KP4 A;  3BPV A;  1AOY A;  2BYV E;  1LNW A;  1S7O A;  5IT9 Z;  3SFZ A;  2OQR A;  1CF7 B;  3SQN A;  4BNC A;  1J59 A;  1BM9 A;  1TW3 A;  4XSX F;  2Z33 A;  1XCB A;  5ILU A;  3K1P A;  3KLO A;  4KA4 A;  1G3S A;  4G6D A;  4ASN A;  1D5V A;  3GUD A;  2OA4 A;  2OD5 A;  1O3R A;  2EV0 A;  5DCM B;  1Z9C A;  2P8T A;  1FX7 A;  1TTY A;  3QAH A;  3I5U A;  2FRH A;  1ZRC A;  3TO6 A;  1B9M A;  1J75 A;  4LB6 B;  3F3X A;  2M30 A;  3L2C A;  2R3S A;  2PG4 A;  4YFX F;  2M87 A;  3ZPL A;  3WTW C;  5DCF A;  3GFM A;  3QPT A;  2IJL A;  1IN5 A;  2GA2 A;  3GW2 A;  1TQM A;  2FF4 A;  3E3V A;  2KJB A;  3NRV A;  3GZ5 A;  3RKW A;  2DU9 A;  1YW7 A;  1Z91 A;  5DD4 A;  1MJA A;  4HV6 A;  4GYG A;  3F8N A;  2ZO4 A;  2IW5 A;  5ERI A;  1BJA A;  4EM2 A;  4P9U A;  3LWF A;  2L01 A;  2W57 A;  3RJP A;  1ZLJ A;  3TOA A;  2ZNY A;  1YW8 A;  1ZHF A;  4HF2 A;  1FBQ A;  4MEX F;  1FT9 A;  4E70 A;  3GX4 X;  5ICE A;  2VBY A;  4F7Z A;  4HYE A;  1KU7 A;  4YG2 F;  2LF8 A;  1K79 A;  5LGT A;  1ZG3 A;  4HLY A;  2DFI A;  3T8R A;  4N9I A;  4YFN F;  4Q5S F;  4I0B A;  2V1D A;  2FBH A;  3HOT A;  1K7A A;  3ECH A;  2XKP A;  2ETH A;  3O6B B;  1ZH5 A;  3R61 A;  5LRS A;  2FOK A;  3U9G A;  3V8J A;  3TKY A;  5L3F A;  2A69 F;  2FQ3 A;  2COM A;  2O8X A;  1IUY A;  3E97 A;  3L7W A;  3MCZ A;  1QZZ A;  1P92 A;  2BV6 A;  1LJ9 A;  4ZYD A;  3RKX A;  1XMA A;  2P5L C;  4KFC A;  5L3C A;  2VBW A;  4KUM A;  5KVR A;  1U5T B;  2EFN A;  2A5Y B;  5DV5 A;  3GFJ A;  5BS6 A;  5D8K B;  1DPR A;  4IJA A;  3GFL A;  1V3F A;  2V9V A;  1IXS B;  3FWE A;  3BJO A;  1FZP B;  3LAJ A;  3R60 A;  1S29 A;  1LQ1 A;  3K1N A;  2K7L A;  4R8H A;  1KQ9 A;  5ICF A;  3V4G A;  5KK1 A;  1P2F A;  2GQQ A;  4U88 A;  1H9G A;  3WE2 A;  5JVT A;  2EFO A;  1RUN A;  1KU2 A;  2FBI A;  5CVU A;  3G3Z A;  2MH2 A;  4UNO A;  1IXC A;  4KMF A;  4EQQ A;  5F64 A;  3M7G A;  4I01 A;  1QGP A;  3HYI A;  3E5U A;  2EB7 A;  1W5S A;  2MC3 A;  1TNS A;  1O7L A;  1F5T A;  2Q2E A;  5FFZ A;  3OOP A;  3WGG A;  1I5Z A;  5HDK A;  1MD0 A;  1OR7 A;  3RPU A;  1ZRE A;  1RNL A;  3FMQ A;  2DPU A;  1IZ1 A;  3I58 A;  4WX9 A;  2DT5 A;  4MEY F;  3CTA A;  4GGG A;  4O5V A;  1JGS A;  3GYH X;  3GO5 A;  5CVI A;  1P4A A;  2K02 A;  4IRG A;  4NB5 A;  2V79 A;  4G94 A;  2VC0 A;  1IF1 A;  2HKO A;  2ZME A;  1RZ4 A;  2EFP A;  5FD6 A;  2RGV A;  1KU9 A;  4BHP A;  3WGI A;  4UV8 A;  3EQL F;  4BHC A;  4NHJ A;  3WTT C;  5LHG A;  3KZZ A;  4JK1 X;  3RI4 A;  4RB3 C;  2A68 F;  2WTE A;  1SFX A;  2CFX A;  4RGX A;  3VFZ A;  3ML6 A;  1I6X A;  2E1N A;  5DEQ A;  1LDK B;  1XSX A;  2W85 A;  2P6T A;  3RPQ A;  4LG0 A;  2GZW A;  3FXU A;  4M71 A;  3BZ6 A;  1ZAO A;  2NYX A;  4HF1 A;  2ACJ A;  4OIP F;  2H6B A;  5F6F A;  2FSW A;  1R1U A;  4XRF A;  3S2W A;  4ESF A;  1K78 B;  1L0O C;  4PGG A;  2QWW A;  1LDJ A;  1XB4 A;  3CUQ A;  2DO7 A;  4IHT A;  3HSR A;  4KIF A;  1RUO A;  1FY7 A;  3ZMT A;  4M6Y A;  2QM3 A;  1S6L A;  2E7X A;  4UVB A;  4KIC A;  3QU3 A;  3KEQ A;  4KNY A;  3V7C A;  4BHB A;  2PBI A;  4XLP F;  3CUQ C;  1ZAR A;  1HW2 A;  4HZF A;  3VEP A;  1MJ9 A;  3IRQ A;  5K1Y A;  4EGZ A;  3BP8 A;  1U5T C;  3GEZ A;  1DDN A;  3LST A;  1WRJ A;  4LLL A;  1PDN C;  1YO5 C;  1PUE E;  1OYY A;  3WE3 A;  4PDK A;  4LK0 F;  1ZRF A;  3ELK A;  4AWX B;  4HX4 A;  5CYV A;  4ENK A;  1IAW A;  3HHG A;  4R1H A;  3R0A A;  4H0E A;  2XUB A;  1I27 A;  3C3W A;  3JW4 A;  1BN5 A;  2AS5 F;  3F6V A;  4GYI A;  2O03 A;  1FYM A;  1O7F A;  2PMH A;  5JI6 A;  3ZMS A;  4A2U A;  2OAZ A;  2EWN A;  3SXY A;  4QLC U;  5IT9 K;  2H09 A;  2OZU A;  2FU4 A;  2CW0 F;  2NRA C;  1YQA A;  1R7J A;  4A5M A;  4HAM A;  4IF4 A;  2GXB A;  2RC4 A;  2XAH A;  1UCR A;  4DNC A;  2O6G E;  4EM0 B;  3I53 A;  1T98 A;  4BAY A;  2ESH A;  2P7C B;  5DD8 A;  1KU3 A;  1IN8 A;  1G3T A;  3EET A;  4I98 B;  2VE8 A;  3Q9S A;  1OYI A;  4MQ9 F;  2E7W A;  4RGR A;  1S3J A;  3BWG A;  2FEZ A;  3F72 A;  5D5W B;  5LRR A;  1T2K A;  2V1X A;  2D1H A;  2OU2 A;  3MZH A;  3DPT A;  3WTU C;  3IRR A;  3BJA A;  5J6X A;  2IT0 A;  5DCM A;  5L3B A;  2TDX A;  1T38 A;  1U78 A;  1HXD A;  3KP6 A;  2G9W A;  3TQN A;  4G7Z F;  4MTE A;  2KIU A;  3R6S A;  4YIF A;  4HW0 A;  4HBL A;  1J2X A;  4CHU A;  4HX8 A;  3ABT A;  3GZ6 A;  3FHZ A;  2MA3 A;  5CVV A;  4I02 A;  1Q1H A;  4I7H A;  1YIO A;  3M8F A;  5D4S A;  3IWZ A;  3P9K A;  3MAJ A;  2W24 A;  2RN7 A;  3WTY C;  5A2Q K;  1BI2 A;  2WV0 A;  4ESJ A;  4IPA A;  4WWC A;  3JTG A;  3R4K A;  2XRO A;  4OIO F;  2ESN A;  2XHK A;  1EV7 A;  2PJP A;  4RGS A;  5HLG A;  2W25 A;  5LGN A;  2ZBK A;  4IXA A;  4P5O A;  5D6E A;  5HS7 A;  3CO6 C;  4M9S A;  1Z1D A;  3DPL C;  4IRI A;  3SZT A;  5L3E A;  5AIP A;  2A3S A;  1SD6 A;  4O3M A;  2PMU A;  5HVQ C;  1W4M A;  4EJV A;  5HOO A;  2K86 A;  3PQJ A;  5IT3 A;  4Q47 A;  2WWY A;  1QPM A;  2FNA A;  3OV8 A;  2MLG A;  1XMK A;  3TO7 A;  2ZCW A;  2W84 A;  5HS9 A;  3PQK A;  1IXR C;  2HDC A;  2FXA A;  4HQM A;  1EH7 A;  2QLZ A;  6PAX A;  2XAG A;  3LAP A;  3HSE A;  3TO9 A;  3FXR A;  3KZY A;  3F6O A;  2J5O A;  2CSO A;  2LDU A;  2FE3 A;  1SMY F;  2HQR A;  5E8I A;  4ZZD A;  1FC3 A;  1U6G A;  3ULQ B;  2F2E A;  2M45 A;  3QP6 A;  1LVA A;  1G4D A;  3QRF F;  2EFQ A;  1TQP A;  4WXC A;  4L0Y B;  3DEU A;  3SHF A;  3JSO A;  3J7A O;  4G6Q A;  1KGS A;  4ETS A;  2EK5 A;  1G3W A;  2JT1 A;  4KN7 X;  4OMY A;  4NQW A;  5J8F A;  2P4W A;  1SMT A;  2L54 A;  3KEO A;  3MQ0 A;  4L9V A;  2F5C A;  1K6O A;  2ZFW A;  4CIC A;  4CXF A;  1GXP A;  1BI3 A;  2HFH A;  1R22 A;  2HR3 A;  3BDD A;  3FX3 A;  1F9N A;  1R36 A;  1LDD A;  2DI3 A;  3K0L A;  4CDG A;  1R1T A;  3ERE D;  3E6D A;  3RDI A;  4BXU A;  4B8X A;  2V6C A;  4KYW A;  2VBZ A;  4Z2Y A;  3WTS C;  2PFB A;  1XDU A;  2EV5 A;  2D1V A;  2QBY B;  3RKY A;  2ZME B;  2ZJ2 A;  3GWZ A;  2KIF A;  5E18 F;  4TV7 A;  5DUI A;  2GXG A;  2QEN A;  4U0Y A;  2HQN A;  3IWF A;  4L5J A;  1B1B A;  1BIA A;  5DDG A;  3RYP A;  1BBY A;  1B6A A;  2EFW A;  5FGM A;  1G6N A;  3LA7 A;  1FP1 D;  3D5L A;  1HSJ A;  1WQ2 A;  1H9T A;  3F8B A;  3MFK A;  4HQE A;  2CQK A;  2STT A;  3I71 A;  2EJR A;  1TBX A;  3H3Z A;  5LHH A;  4G7O F;  4M6X A;  4XLN F;  1QZY A;  1WSU A;  2YX7 A;  2P5K A;  5JR3 A;  2HYG D;  1O3T A;  1Y0U A;  3AAF A;  3B73 A;  1MJB A;  3BPX A;  3J81 Z;  5HLI A;  1C0W A;  2VOP A;  1TQI A;  1RIO H;  1MKM A;  2OZ6 A;  4U0V A;  3GVA A;  4RAZ A;  3WU1 B;  4YII A;  3L00 A;  4HOB A;  4MHG A;  3WOD F;  3F8C A;  1GHC A;  2IA1 A;  4RB2 C;  3P9I A;  4GCV A;  1FLI A;  3BJ6 A;  2YU3 A;  3WTV C;  1HBX G;  4WCG A;  1XSV A;  3HRS A;  2MD5 A;  2VE9 A;  4LD5 A;  4RS8 A;  2J5P A;  3ZP5 A;  4EJO A;  4MNU A;  3Q9V A;  5LHI A;  5E8G A;  1A04 A;  2HS5 A;  1PP7 U;  3TGN A;  2VOD A;  5LEJ A;  3B02 A;  4Q4Z F;  4FX0 A;  1ZLK A;  1SD7 A;  4L9N A;  2PEX A;  2DK5 A;  3FXQ A;  1BIB A;  1KQ8 A;  4LLN A;  5ILS A;  4RGU A;  1R58 A;  4A12 A;  2H94 A;  1HQC A;  3FM5 A;  3LQQ A;  4N0B A;  5DYM A;  3HRM A;  3ISP A;  1SAX A;  2NNY A;  3F23 A;  5HDG A;  1DUX C;  5FLX K;  2V1U A;  4WXH A;  1YLF A;  1W7P A;  1R1V A;  3HTS B;  1KQ0 A;  2MBF A;  4Y15 A;  1LEA A;  3KP2 A;  4M9Z A;  2Z99 A;  4AIH A;  3VOE A;  3MWM A;  3TDZ C;  4WF2 A;  1FOK A;  2VOO A;  4LMY A;  1LEB A;  3W6J B;  5FB2 A;  4OMZ A;  1TLH B;  4AVP A;  3I59 B;  3C18 A;  2D45 A;  1YFH A;  2X0L A;  1MGT A;  2CYY A;  3CUQ B;  4WK8 F;  2Z3Y A;  2IVM A;  3WTZ A;  1HKT A;  3BY6 A;  1YS6 A;  3CJN A;  2H6C A;  3V8L A;  4AD9 A;  2UWM A;  5J8C A;  2R7F A;  4LFU A;  4ENM A;  3T0Y A;  2JTV A;  1FPQ A;  1MZB A;  4LK1 F;  4BQA A;  2P6S A;  1ZGJ A;  1X3U A;  1FSE A;  1P4X A;  1XGS A;  3RYR A;  1LB2 A;  2GAU A;  4KIB A;  1WKM A;  2XAQ A;  4EMS A;  1CF7 A;  1PP8 F;  5D5U B;  4KN4 X;  4EJW A;  4P9F A;  2VT3 A;  2WC2 A;  5A2Q Z;  3DV8 A;  3MEX A;  1BI1 A;  4N9H A;  3J80 Z;  4L18 B;  2VXZ A;  4U0W A;  1ZG5 A;  2O61 A;  1HKS A;  2Y48 A;  1XSD A;  3ZMU A;  3F22 A;  3ABU A;  1YTY A;  3DP7 A;  4MGR A;  5H20 A;  4KMU X;  3J81 K;  2PI0 A;  1O3Q A;  5E1Z B;  3HRU A;  4AIK A;  1DPU A;  1Z05 A;  4OIN F;  2M1B A;  1ULY A;  1UST A;  1Z6T A;  2HYF A;  3LQR A;  4HA8 A;  2Y0M A;  5AON A;  2MLK A;  1XDS A;  1USS A;  2YSR A;  4OU0 A;  5CJ9 A;  5FO5 A;  1U8R A;  2HEO A;  3QU6 A;  2EA4 A;  2DLL A;  3T1B A;  2KJC A;  3P7N A;  1O57 A;  4ZYH A;  1T39 A;  2KKO A;  2Z9O A;  3L9F A;  4EJU A;  2H27 A;  2D2W A;  3M9A A;  4L9T A;  4UVC A;  2QBY A;  5L3G A;  2JZY A;  2JPC A;  3C7J A;  2BE5 F;  2YR2 A;  2XVC A;  4QWQ A;  4PZJ A;  2LKP A;  4PGH A;  2KRF A;  3D0S A;  3PFI A;  1YS7 A;  1OMI A;  5FLX Z;  3QP5 A;  3K1M A;  3KET A;  2QQB A;  4HDU A;  1HW1 A;  5D5X B;  4KDP A;  1B59 A;  5BQT A;  2L4M A;  4XSZ F;  3P9C A;  3DQV C;  4A6E A;  3E5Q A;  3F8M A;  3REO A;  4AIJ A;  4EV0 A;  3IKT A;  5CLS A;  4CO8 A;  3LA3 A;  1HW5 A;  3FF5 A;  1GXQ A;  3KP3 A;  4ZH4 F;  3ROU A;  1U5T A;  4CZZ A;  3E5X A;  5AIQ A;  1F1Z A;  1TW2 A;  4OOI A;  4M72 A;  1MDM A;  2KIM A;  4M73 A;  2Y75 A;  1DP7 P;  3CLO A;  4A0X A;  2MH9 A;  4M9X A;  1FBS A;  2IA0 A;  2NAZ A;  1ON2 A;  1WI9 A;  1P4W A;  5BMZ A;  3Q5F A;  2DPD A;  1XGN A;  4GO1 A;  4YFK F;  1QBJ A;  4UHT A;  3N4M A;  4R79 A;  4S05 A;  3WTX C;  2XGX A;  4JQF A;  4RB0 A;  2CGP A;  2VN2 A;  1VTN C;  4OIR F;  3J80 K;  4ENN A;  3GXO A;  3NEU A;  3MZY A;  4CYD A;  3RIR A;  4ENJ A;  3SZP A;  2ISY A;  3V7S A;  1B9N A;  3ZN1 A;  2ISZ A;  3ZMV A;  4LGW A;  3DFG A;  1L3L A;  1IRF A;  3E6M A;  1MDM B;  3HTU A;  2RDP A;  4GXO A;  4HV5 A;  3T8T A;  1KYZ A;  4RAY A;  2BGC A;  3DXJ F;  2GWR A;  1FNN A;  3BOQ A;  5BOX A;  5ICG A;  2ELH A;  1T6S A;  2A6H F;  3ECO A;  4BH9 A;  1GVJ A;  1OYW A;  2IPQ X;  3O2P E;  2C6Y A;  1IRG A;  5TRD A;  2M8E A;  4LLG F;  2R7D A;  1XGO A;  3EUH A;  2JSC A;  1QO0 D;  1T0F A;  4FT8 A;  2IP2 A;  1FYK A;  4K2E A;  5BPI A;  5HDN A;  2F5F A;  4FHT A;  5E1X A;  1IN6 A;  4EVI A;  1YYV A;  4S04 A;  5H6R A;  1XN7 A;  4D0P A;  4HLX A;  3KCC A;  3KLN A;  3TDU C;  2G7U A;  2CO5 A;  3QOP A;  2FML A;  3W6K B;  3GFI A;  5LBQ A;  4OIQ F;  1ZYR F;  5D6F A;  4DQ2 A;  2HTJ A;  1YW9 A;  1J5Y A;  5HS8 A;  3I4P A;  1FSH A;  3KFW X;  3CUO A;  3CDH A;  3E6C C;  4G7H F;  3WU0 A;  4P96 A;  1BC7 C;  2A6E F;  3F21 A;  1IW7 F;  2QVO A;  1FP2 A;  2X4H A;  1H0M A;  2L02 A;  4M74 A;  1BC8 C;  3CO7 C;  1STZ A;  4A0Z A;  1SFU A;  3JAM Z;  2VC1 A;  2HGC A;  5L3D A;  3U1D A;  4FX4 A;  1UB9 A;  5ICC A;  3LA2 A;  2B0L A;  2YPR A;  3FMS A;  1F4K A;  3FMR A;  1XGM A;  2L3D A;  2O3F A;  4KT5 C;  3JSP A;  3L09 A;  2FMY A;  4EM1 A;  2K4J A;  1O3S A;  4PCQ A;  4L9J A;  4A5N A;  4U7D A;  2DTR A;  1REP C;  2QQA A;  4Y13 A;  3IL2 A;  4KIG A;  5E20 A;  4I0A A;  5ILV A;  5EEG A;  2UZK A;  1UFM A;  1TNT A;  1FWZ A;  2PLY A;  1S7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...