4CO8A

Structure of the dna binding ets domain of human etv4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
MRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS TRANSLOCATION VARIANT 4
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4co8A00
4MTDA 5HLGA 3DXJF 1FWZA 2FEZA 5CLSA 1S7AA 3WTTC 5D8LB 3RKYA 2BV6A 2NYXA 1BC7C 3FXUA 3WTZA 5LEJA 1FBSA 2XAFA 1LEAA 1I1GA 3P9CA 3BZ6A 4FX4A 2O8XA 3BJAA 4FT8A 1H9TA 2WC2A 2YX4A 1BI2A 4EM0B 1MJ9A 2ISZA 2XASA 3LA2A 1XGMA 2L4MA 4G6DA 1HSTA 3HTUA 5AIQA 2J5OA 3V8LA 4U0YA 2M87A 2NAZA 1BJAA 3EYIA 3U1DA 5F1RA 4MEXF 3F8FA 3O6BB 2ZJ2A 4BHPA 3ZMVA 4Q5SF 1IZ1A 3I5UA 4G8XA 2DK8A 2HTJA 2ETHA 1YW7A 2LNBA 1UHWA 3F22A 1S6LA 1YW9A 2Z99A 4KFCA 4WXHA 2KIUA 2ZMEA 2DAOA 3M8FA 2H09A 4GGGA 2UWMA 1KQ9A 2YR2A 2FNPA 2NNNA 3LFKA 2EV0A 4LJZF 5HLHA 1BIBA 2EFOA 3QU6A 1Y0UA 4M9XA 1F9NA 4LB6B 2ZKZA 2QBYB 5IT9Z 2E1CA 1JHFA 1BIAA 3K1NA 3I4PA 1P4AA 2CSOA 4L9VA 1RI7A 2XKOA 4RB3C 3U9GA 4OIQF 1LDKB 2KKOA 2EFQA 4ZYEA 1H0MA 4U7BA 2HEOA 4HZFA 2XGXA 3NEUA 3L2CA 5BS6A 2R3SA 3GW2A 3N97A 2IP2A 2K4JA 1B9NA 4U0WA 3FMQA 4O5VA 3HRTA 3O2PE 5HLIA 2DI3A 5LHGA 1ZYRF 1EH7A 1MKMA 3TDZC 5LGNA 2OZ6A 1L3LA 4A6EA 3I64A 4A2UA 2HQRA 4QWQA 3T8RA 1ULYA 3T0YA 1PP7U 3ZMSA 3T8TA 5TRDA 1XDSA 4RGRA 1QPMA 1TTYA 4HAMA 3OOPA 4EJWA 5DYMA 3R60A 1FC3A 3CUQA 4K2EA 4UV8A 4EGZA 1RZ4A 1WQ2A 3RJPA 5A2QK 4WX9A 2XV4S 5F6FA 5K5OA 2FQ3A 5CJ9A 3GFIA 2HS5A 1YG2A 4ZYDA 2PI0A 1VTNC 2UXNA 2VODA 3IRRA 1TLHB 4R1HA 2EWNA 4WCGA 3FXQA 5DDGA 4FX0A 2E7WA 2YX7A 1JGSA 5LEKA 4EJUA 2HFHA 4Q48A 2HKXA 2JSCA 1S7OA 1R1TA 1UB9A 2M45A 4RGXA 5D4RA 1B6AA 2UXXA 2ELHA 2KIFA 1GXQA 3F8BA 1MDMA 1D8JA 2JZYA 3JW4A 4IHSA 3WTWC 1R5GA 2IT0A 2O6GE 3ECHA 5ILUA 4HQEA 4TV7A 1IXRC 3K9TA 3HOSA 4M6XA 5L3DA 5HDGA 1ZGAA 3C3WA 4IF4A 2QM3A 5DCFA 2F5EA 1K6OA 4OOIA 3MCZA 4KNYA 1J0RA 2PQ8A 3R0AA 3P9KA 2LDUA 1T2KA 4P96A 2Z9OA 2DW4A 1SFEA 4UXNA 3F8MA 4YFXF 5JI6A 1IN7A 2JTVA 5CYVA 2GQQA 2EV5A 1R23A 2NNYA 1BM9A 2G7UA 4N9HA 2FXAA 4I02A 2LF7A 4YFKF 1Z6TA 2QENA 1XSVA 1U5TA 2C6YA 1ZLJA 5IT3A 2OQGA 3M1EA 2VC1A 2PN6A 2VT2A 1PUEE 5BPDA 4R79A 1MJAA 3KETA 1B4AA 4WK8F 4Z2YA 4KIGA 1K78B 2RDPA 4B09A 3WU0A 2R7FA 4M74A 3HRUA 1UFMA 3GFLA 2DO7A 2IPQX 4BNCA 3J7AO 1E2XA 1C0WA 1L0OC 3VEPA 3LSTA 4I2OA 5ICFA 3WTVC 1HW2A 4BYYA 3JTHA 1ON1A 1Z05A 2AXLA 2M5WA 3ABTA 3MEXA 1BI1A 1EH8A 1ON2A 1DPUA 2W57A 1B59A 4LG0B 2AS5F 4YG2F 2PLYA 1ZHFA 5DUKA 3WTXC 3E5QA 5FO5A 1TNTA 2HZTA 2Z3YA 1P2FA 1KU7A 2XAHA 2H6CA 3G73A 1O3SA 4CGZA 5EEGA 3J80K 5E1ZB 1CGPA 3M8EA 4P9FA 4EGYA 2D1HA 1B1BA 2FMLA 4LLLA 4AIHA 4KYWA 2A61A 5JHUA 2M8EA 4UUVA 4AVPA 1HKQA 1YW8A 3ZMZA 5DD8A 3E6BA 4KN7X 1ODDA 4P9UA 3K1MA 3E6CC 3RYPA 2M1BA 4RAZA 4ZZDA 4KDPA 1OYYA 4D0PA 2HR3A 1I1SA 4PCQA 3NQOA 2EB7A 2ZBKA 2ADUA 2FBHA 2GZWA 3HYIA 3FXRA 4PDKA 1S29A 3TOAA 3F23A 1IXSB 4HYEA 2KIMA 3E6MA 3JTGA 3DEUA 5FLXZ 3WGIA 2CO5A 4F7ZA 5HVQC 1HXDA 2G7HA 3PQJA 1G6NA 4KT5C 3F6VA 4BQAA 4HX4A 3EETA 5ICEA 3F72A 2E7XA 1FZPB 3Q9SA 2ESHA 2ZFWA 5D5UB 1KU3A 2PG4A 2EA4A 1QQIA 2XAQA 1TQPA 3FF5A 2FA5A 2K02A 3EDPA 1DUXC 2PFBA 3L09A 5HDKA 4L0YB 2P7CB 3TGNA 2DLLA 1JE8A 1USSA 4XLNF 1OYIA 2VXZA 2JPBA 2HQNA 3RIRA 2A3SA 1KQ8A 3CUOA 5FD6A 5LHHA 2PEXA 2P5KA 3TO9A 5D8KB 4AWXB 1SAXA 5D5XB 1Q1HA 2EJRA 2HKOA 1SD7A 2WWYA 1LQ1A 3ZQ7A 1T39A 3WTUC 2GXBA 3I0TA 3P7NA 1I6XA 2HGCA 3DP7A 3ZMUA 2VONA 3BY6A 2D45A 4G7ZF 3NRVA 1F5TA 2V79A 4DQ2A 4KA4A 3F6OA 2GIVA 2OQRA 1AWCA 2L54A 3O3KA 4HA8A 3HOTA 4OIOF 1P92A 1GXPA 3BROA 3I59A 3QP5A 1CF7B 2XKPA 3IL2A 2OZUA 5AIPA 3MWMA 5JFRA 1XCBA 3H3ZA 4R8HA 3S2WA 1FYMA 5ERIA 2FBIA 3ZN1A 3GYHX 4ZZLA 5ICGA 1FBQA 2F5FA 2X0LA 5LRRA 3V8KA 3T1BA 3RTRA 3B02A 1Z1DA 1BOAA 4PGGA 1SMYF 1ZAOA 4AIJA 1V3FA 2F5DA 4RS8A 3BWGA 1ZRCA 1LVAA 4HV6A 4I0BA 1TBXA 2V6CA 1ZH5A 2Z5UA 5D4SA 5DD4A 1KGSA 3V7SA 5K1YA 2FE3A 3R61A 3R4KA 3LQQA 2B0LA 3ZP5A 1HSJA 4EJTA 1FYKA 3OV8A 3TKYA 1RUOA 3GFJA 3IC7A 4G7HF 3TOBA 1QBJA 4XBFA 1MD0A 3M9AA 1XMKA 1XGOA 1YQAA 2V9VA 3G3ZA 1Z9CA 1O57A 5DCMB 2ACJA 4BHCA 3J81K 1H9GA 3I58A 1YIOA 1A04A 4A5MA 3TDUC 1R5HA 4CHUA 4M72A 3V7RA 2A6EF 3ULQB 1UHMA 2ESNA 3L00A 3I71A 3ZMTA 3ECOA 5ILVA 4YFNF 3FZVA 1V4RA 1FBUA 3P9IA 5TJJA 3BOQA 2BEOA 4ENJA 4O6JA 3KEOA 2BBYA 1FX7A 1REPC 4HLXA 2HDCA 4ZYHA 2H6BA 5ILSA 4A6DA 1XCVA 4CXFA 4A0XA 3RDIA 2FBKA 2QQBA 2H27A 2ZNZA 3KP3A 4UHTA 1WWXA 2J5PA 4DNCA 5K5RA 3FX3A 3WTSC 2KJCA 5HS9A 2CGPA 2P6TA 2O3FA 4U7DA 4XLPF 3C18A 1YFHA 2DPUA 1UCRA 4QLCU 1IF1A 3K0LA 2FRHA 4BAYA 2GA2A 1Z7UA 4YIFA 2L02A 1HQCA 4CZZA 3V8JA 3ZPLA 3D0SA 1KYWA 3Q5FA 1RUNA 4WF2A 2KRFA 4KUMA 5KK1A 4YIIA 5LBQA 2IW5A 1FSEA 4KN4X 2F5CA 2Y75A 1J5YA 2L4AA 2RVCA 2TDXA 1D3YA 4KMFA 1B9MA 1I27A 1FPQA 3IWFA 4EVIA 3RI4A 2ZMEB 2P8TA 2LF8A 5FGMA 1G3SA 3DPTA 4HLYA 5JVTA 3QRFF 2IA2A 1W7PB 1ZRDA 2VBZA 3KCCA 4OINF 1IN6A 2DFIA 3WE3A 3T5XA 1RNLA 1P6RA 2D2WA 2ZCWA 1BBYA 1WRJA 1XSXA 4B8XA 5ED4A 4RGUA 3L9FA 3HSRA 2JPCA 4L9JA 2XRNA 1JXSA 1MJBA 3C7JA 1PP8F 3I53A 3FMSA 3FMRA 4ON0A 2FOKA 4CO8A 4A12A 2RV8A 1ONVA 2RC4A 3EYYA 4MTEA 4IRHA 1WKMA 2HOEA 4EV0A 4MNUA 1W5SA 2W25A 2RQPA 4GYIA 4M9SA 1KYZA 4XSXF 2A5YB 2V1UA 4EJVA 3GUDA 2FSWA 3QPTA 5E1XA 3W6JB 4A0ZA 4RB1A 2PMHA 5E20A 3ML6A 5A2QZ 4HDUA 1WI9A 2O61A 5BMZA 3MZHA 3PFIA 3CUQB 5DUIA 3IKVA 2P6SA 1ZGJA 4I0AA 1OPCA 3DKWA 3HHHA 1LEBA 3BJ6A 2OAZA 4ENNA 3BPXA 1IXCA 4HF1A 1S8NA 4HV5A 4Y15A 3SFZA 3WE2A 4OIPF 2A69F 4RAYA 2VE9A 1T98A 2DT5A 4U0VA 5FFZA 2RKHA 3KZYA 4G9YA 4MEYF 1G3YA 4HOBA 2CYYA 1J59A 2DU9A 4ZYGA 1JHHA 2OU2A 2G9WA 1R00A 2BYVE 1MDMB 4GYGA 3H3UA 4S05A 4G7OF 4IXAA 2DPDA 2EFWA 4WXCA 4I98B 1U3EM 5EEHA 2VOPA 3CLOA 2PJPA 5CVIA 2W24A 1SFXA 5L3EA 2P5LC 3SHFA 3CTAA 3SQNA 5CVRA 5HS7A 3U2RA 3PQKA 4Q47A 3VODA 4P55A 4AIKA 3MQ0A 2HYFA 1LNWA 1ZRFA 4EM1A 5E17F 5E8GA 5LGUA 2A6HF 4N9IA 3F3XA 5J8FA 4S04A 3ERED 2BE5F 3FM5A 3GZ6A 3HTSB 3E5XA 3F8CA 1O7FA 1U5TB 2RGVA 2QUFA 3QAHA 4HF2A 3RYRA 1ZG1A 4ESBA 2QZ8A 2LKPA 4PGHA 3D5LA 2HWVA 4LK0F 1FP2A 2CWEA 2D1VA 1IN8A 1T0FA 2Z33A 4Q4ZF 3BPVA 2EFPA 3JAMZ 1IRFA 3RKXA 3CUQC 4I09A 4ESJA 2GA1A 4LK1F 2IA0A 4ENMA 2XUBA 1LDDA 3GEZA 4LFUA 1BC8C 4M9ZA 3HRSA 3IHUA 5J8CA 3MFKA 2W85A 3K2ZA 3LAJA 2STWA 3E6DA 3F21A 3GO5A 1J75A 1F1ZA 2QBYA 4IPAA 3TQNA 3MZYA 2PMUA 4OIRF 2V1XA 2A68F 4PZJA 5BQTA 5DCMA 2VBYA 4IRGA 5AONA 3ISPA 1ZARA 2DBBA 1YYVA 1YTYA 5K5QA 2LSOA 2VT3A 4L9NA 5IT9K 3JSOA 1QZZA 1XMAA 5D5WB 2XVCA 2W84A 4Y17A 2NS0A 2MC3A 1FLIA 1P4XA 4BH9A 1OMIA 2L3DA 1T6SA 1W4MA 2DQLA 3E3VA 1R22A 3BDDA 4EQQA 3H92A 1SFUA 4P5OA 3ZMDA 1K79A 3V7CA 1TW2A 3DFGA 4HDVA 1IAWA 2Y48A 4H0EA 3KLOA 1SD6A 2CW0F 1ZN2A 2GXGA 1ZG5A 1D8KA 2MBFA 1IN5A 2RN7A 4KMUX 2WV0A 4HW0A 1OR7A 3FWEA 2DTRA 1U5TC 1MZBA 3LAPA 3CO7C 1S3JA 3GWZA 2K4BA 3WGHA 4L0ZB 4LGWA 4BHBA 3HHGA 4IRIA 4NQWA 3FHZA 2V1DA 2F2EA 2QQ9A 3RPQA 3TO6A 3E5UA 3Q9VA 4AD9A 5D5VB 2GWRA 1IUYA 4IJAA 4HQMA 5L3CA 4RGSA 4L18B 1LDJA 1Z91A 2OA4A 4IVNA 5LRSA 3HIFA 4GO1A 4A5NA 1U2WA 2HTSA 3KP7A 1J9IA 4WWCA 1OKRA 3VOEA 3EQLF 4EMSA 3VB2A 2EK5A 2XHKA 4GCVA 1KU2A 3KP5A 5H20A 3GX4X 4OMYA 1O3TA 1W7PA 3CJNA 1TNSA 1W5TA 4G94A 2P4WA 1FSHA 3RKWA 4I01A 2XROA 3K1PA 3CO6C 3DF8A 3IWZA 1T38A 2IVMA 3LQRA 5BPIA 4A0YA 1WSUA 2BGCA 3BP8A 2M30A 5FFXA 1KA8A 4E70A 2GAUA 4MQ9F 1J2XA 4UVBA 3ELKA 3WGGA 4MQVA 5LHIA 5DV5A 5L3FA 4LD5A 1U6GA 1ZG3A 3COAC 2VBWA 3I54A 4JQFA 1R36A 4KIBA 2MH2A 5LLQA 1K78A 3I59B 2P5VA 2KJBA 1XSDA 2IJLA 2K27A 1YS6A 3E97A 2MLGA 2K7LA 4UV9A 1GHCA 5ICCA 5LGTA 4M73A 2QYOA 1HW5A 2Y0MA 3VFZA 2E1NA 2FF4A 4LLNA 4CYDA 4OMZA 2STTA 1KQ0A 5F64A 3IRQA 2XAJA 4GXOA 5J6XA 5JR3A 1D5VA 4LG0A 2MLKA 2EV6A 4CICA 1MGTA 1ZLKA 3KLNA 1TQIA 3KZZA 2MA3A 2MH9A 1K7AA 1DPRA 4NB5A 2R7DA 3N4MA 3WODF 2OBPA 3RPUA 4HX7A 2DQRA 1XGSA 2X4HA 3J81Z 5E1WA 3KE2A 1SD5A 1BI3A 3SZTA 1OYWA 1HW1A 1EH6A 1W7PD 1STZA 4ASNA 2JRTA 5BOXA 2P7VB 2FNAA 3AAFA 3F8NA 4ESFA 3KFWX 1I5ZA 3REOA 1FOKA 2A07F 2VE8A 4KICA 6PAXA 3IKTA 2IA1A 4LLGF 2EFNA 5HDNA 1SMTA 3QU3A 3GXOA 1J7KA 3C1DA 4MHGA 1KU9A 4BXUA 4U88A 3R6SA 4JBAA 3DQVC 2VOOA 2MD5A 5D6EA 2O03A 1U78A 1FNNA 3MAJA 4UNOA 2CG4A 4XRFA 1E17A 1IRGA 5FLXK 2JT1A 2K86A 2XIGA 1FY7A 3KP6A 3LA7A 4LMYA 2OD5A 2H94A 1FP1D 3HSFA 3QOPA 2QQAA 1LB2A 3DPLC 2YU3A 2QWWA 3HRMA 4UVCA 3BJOA 2Q2EA 4HX8A 1TW3A 1IW7F 1HKSA 1SD4A 1R1UA 3HUGA 3ABUA 1XGNA 3HSEA 3JAMK 3JSPA 3KEQA 3R0JA 4MGRA 1Z6RA 4O3MA 5L3GA 1QZYA 2YPRA 3SXYA 4L5JA 4IHTA 1DDNA 1QO0D 4KIFA 1LJ9A 4OU0A 2CQKA 5E8IA 3KP2A 5E18F 1FT9A 3GLXA 2HYGD 3QPHA 5H6QA 2NRAC 4LB5A 2EA2A 3ROUA 4L5IA 2VBXA 2DK5A 1XB4A 2CFXA 1O7LA 5D6FA 4EM2A 4HF0A 1G3TA 1ZREA 4WXDA 3GZ5A 1QNTA 1YS7A 2Q8KA 4JK1X 4Y13A 5KVRA 1FYLA 3B73A 5FB2A 5HOOA 1F4KA 5H6RA 4RB2C 4FHTA 3GFMA 3CDHA 2L01A 1G4DA 2YSRA 1R1VA 1QGPA 2O0YA 2WTEA 3L7WA 1CF7A 3K69A 4ENKA 1NHAA 1DP7P 2UZKA 1USTA 1YO5C 1R7JA 3ZN0A 2PBIA 1TQMA 1XN7A 5CVVA 4HBLA 1BI0A 1EV7A 3SZPA 3V4GA 2FMYA 4XSZF 4UVAA 3WG9A 1XD7A 1G3WA 2RNJA 2XAGA 3EUHA 1X3UA 4I7HA 2ISYA 2Q0OA 5FD5A 2ZNYA 5CVUA 2IRFG 3WU1B 2QLZA 1BN5A 1GVJA 3TO7A 4L9TA 1HBXG 2QVOA 1YLFA 4ZH4F 1AOYA 2VC0A 5DEQA 1XDUA 5L3BA 4CDGA 1IN4A 3M7GA 3W6KB 3GVAA 3QP6A 4N0BA 1O3RA 3DV8A 2VN2A 2FU4A 1U8RA 4EJOA 4M71A 1HKTA 3J80Z 3GF2A 1P4WA 1R58A 4M6YA 3LA3A 5HS8A 4G6QA 1RIOH 3KP4A 2ZXJA 3WTYC 1PDNC 3FM3A 4ETSA 2COMA 4RB0A 2ZO4A 3LWFA 1O3QA 4NHJA 5CVJA
chains in the Genus database with same CATH superfamily
4NNJA 2MC4A 1QVTA 4MTDA 2CUZA 5HLGA 3DXJF 1FWZA 2FEZA 3OYCA 5CLSA 1S7AA 3A4CA 1RC9A 2OPTA 2G0EA 3WTTC 5D8LB 3RKYA 1UJ8A 2K9NA 1E3HA 2BV6A 2NYXA 3HOXJ 4XORA 1YHQI 3FXUA 1BC7C 3CD6I 5BNGA 3WTZA 5LEJA 2R7QA 1FBSA 2XAFA 1LEAA 1I1GA 3P9CA 3BZ6A 1RRJA 1QVUA 4FX4A 2O8XA 3BJAA 2ECBA 4FT8A 3EUKL 1H9TA 2HXIA 2LLKA 2WC2A 2YX4A 1BI2A 4Y3OA 4EM0B 1MJ9A 4D7MA 2K9SA 1UAAA 3QPSA 1RESA 3W2AA 2ISZA 3IAS2 1Y8QB 2XASA 3IH4A 3U21A 3LA2A 1ENHA 1XGMA 2L4MA 2Z2SB 3FXJA 4G6DA 1HSTA 2ZXWH 3BR5A 3QPLA 3S1RJ 2O8KA 3HTUA 5AIQA 2RAEA 3OYLA 2J5OA 3V8LA 2MABA 4U0YA 2M87A 2NAZA 1BJAA 1XX5A 2DJNA 2WBMA 3RCOA 3EYIA 3U1DA 1JTYA 5F1RA 4MEXF 5K7ZA 2CV0A 2EIJH 2HU9A 3F8FA 3O6BB 2ZJ2A 1WJDA 4BHPA 2CQQA 1OCRH 3ZMVA 1A35A 4Q5SF 1IZ1A 3I5UA 1SVLA 3G1OA 1X3WB 1PUFA 1POGA 1ACIA 1S7EA 4G8XA 1X1BA 2DK8A 3VPRA 2HTJA 2ETHA 2VJ5A 1YW7A 2LNBA 1UHWA 2E2JJ 2DN0A 3F22A 1S6LA 1YW9A 2Z99A 3KYLA 4B43A 4KFCA 1JTXA 4WXHA 2KIUA 2ZMEA 2DAOA 3M8FA 2H09A 4GGGA 1MMSA 2UWMA 1KQ9A 2YR2A 2GXAA 2FNPA 2NNNA 3LFKA 3NWTA 2EV0A 5IYBJ 4LJZF 4HNVA 2BHYA 5HLHA 2WY7Q 1BIBA 2EFOA 3RSNA 3QU6A 2YU9J 1Y0UA 5GAGJ 1VQMI 4M9XA 1F9NA 3OL4A 4BQNA 1WJ5A 3SZGA 4LB6B 2LYCA 2ZKZA 2QBYB 5IT9Z 2E1CA 5M5YJ 1JHFA 3MKYB 1IO2A 1BIAA 4F52A 4BJ6C 3K1NA 2IXSA 3I4PA 1P4AA 4X0GA 2CSOA 2FOWA 1MMNA 2OCEA 4L9VA 1RI7A 3GTOJ 2IGNA 2XKOA 4RB3C 3U9GA 3OWTA 2R92J 3L2WA 4OIQF 2ZSIB 1UELB 1WJFA 1TWCJ 3BG7A 1HOMA 1LDKB 2VASA 3DTKA 2KKOA 3BZCA 1VQ6I 2EFQA 4ZYEA 1H0MA 4U7BA 1W5CC 2DFFA 2M34A 4F55A 2Y30A 2XGXA 4HZFA 3DU6A 3NEUA 3L2CA 5BS6A 2R3SA 3I4MJ 1X1CA 3GW2A 3M4OJ 3N97A 2IP2A 2K4JA 1B9NA 4U0WA 3FMQA 4O5VA 4E7SA 3GTJJ 1TWHJ 3HRTA 2XAUA 3O2PE 5HLIA 2DI3A 3HZJA 4FASD 3LSJA 5LHGA 1ZYRF 3LL7A 4B3AA 1EH7A 1MKMA 2BY1A 3TDZC 5LGNA 2JA7J 5FRNA 2OZ6A 2RQQA 1L3LA 4A6EA 3I64A 4A2UA 2HQRA 4QWQA 3T8RA 1SFOJ 2XPVA 2R7RA 3UKGA 5IP9J 1ETQA 1T56A 4FISA 1BR2A 4RAFA 1ULYA 3T0YA 1PP7U 3ZMSA 1WJCA 3IP4B 5F0CA 5IYDJ 3T8TA 2BOLA 4IOCF 1YJ9I 1QPIA 2ZB9A 1A6IA 5TRDA 3F9KA 2KHMA 1XDSA 4RGRA 1QPMA 1TTYA 1K4SA 4HAMA 3OOPA 4AUXA 4EJWA 4BDZA 4IO9F 5DYMA 3R60A 5EG0B 2XB0X 1FC3A 1OCPA 3CUQA 4K2EA 4UV8A 4EGZA 1RZ4A 3S3OA 3FXOA 5E3MA 3ZCOA 4UY8I 2L7MP 1WQ2A 2VKHA 3K70D 2NOJB 4FE4A 3RJPA 2M8GX 5A2QK 4WX9A 2XV4S 5F6FA 5FLMJ 4EATA 5K5OA 2W48A 2FQ3A 4PFPA 5CJ9A 3GFIA 2HS5A 2R5YA 1YG2A 5GP9A 2M9HA 2WAQN 3HGGA 1T95A 4AYBA 4ZYDA 2PI0A 1VTNC 4W1UA 2UXNA 1X58A 3OYBA 2VODA 1MMAA 3IRRA 1TLHB 1T0FC 2W4SA 4R1HA 1FOXA 1NTCA 2EWNA 4WCGA 2EIMH 1DU0A 3FXQA 5DDGA 3TW7A 4FX0A 2E7WA 5EZGA 3BQYA 2YX7A 1JGSA 1X2MA 5LEKA 4EJUA 2HFHA 4Q48A 1HDDC 1Y6IA 3PL8A 4BBRJ 2HKXA 2JSCA 1S7OA 2F5VA 4CSWA 3DU5A 1Y0NA 1R1TA 3F0CA 4C30A 1UB9A 2M45A 4RGXA 4M3FA 5D4RA 1B6AA 2UXXA 2Z1DA 4BS9A 1OFCX 4BQQA 4HNTA 2ELHA 2IAIA 4PUSA 3K10A 2QSGX 3AG3H 1MBKA 2KIFA 1GXQA 3F8BA 4BXFA 1MDMA 1ETWA 1D8JA 2JZYA 3JW4A 5EDNA 4IHSA 3WTWC 1R5GA 2IT0A 2LVSA 1LFBA 5J1UA 3A02A 3O8GA 2O6GE 3ECHA 4BY7J 3HL2A 5ILUA 4HQEA 4TV7A 1WZ2A 2KL4A 4ABZA 4CYCA 2HOTA 2L0KA 1IXRC 3K9TA 1NG7A 3HOSA 1A31A 4M6XA 4A3IJ 5L3DA 1GT0C 3ZOBA 5HDGA 1ZGAA 2K3PA 3C3WA 1VI0A 4IF4A 2QM3A 4Y7NJ 5DCFA 2F5EA 1Y1WJ 3L2QA 4OOIA 1K6OA 2HI3A 2DA2A 2A05A 3MCZA 3HJEA 4BDYA 4KNYA 4XN0A 1J0RA 1JT6A 1YITI 4DYQA 2PQ8A 3CMMA 3HPHA 1D5YA 2DA4A 3R0AA 3P9KA 2F6CA 1TWAJ 3OOUA 2OCCH 2LDUA 2GIZA 1T2KA 4J01A 4P96A 2Z9OA 2DW4A 3G71I 1SFEA 4UXNA 1U8BA 3F8MA 4YFXF 5JI6A 1IN7A 2JTVA 5CYVA 2GQQA 2EV5A 1R23A 5B1AH 3PO2J 1VNDA 2NNYA 1BM9A 2G7UA 4N9HA 2FXAA 3H35A 4I02A 2LF7A 4YFKF 4V19K 1Z6TA 3OIQA 3ZRGA 5IOYA 2QENA 1SFKA 1XSVA 1U5TA 2C6YA 1ZLJA 1FIPA 5IT3A 2DMPA 2PMZA 3GTPJ 2B63J 2OQGA 3M1EA 2VC1A 3LSRA 2PN6A 2VT2A 4XM3A 1PUEE 1LFPA 5BPDA 4R79A 1Z0XA 1MJAA 1AKHA 3KETA 1JGGA 1B4AA 2XC7A 3L1PA 1MNDA 4WK8F 4J19A 2W82A 4Z2YA 1Y56A 4KIGA 2L9NA 2LTPA 2BY2A 3OS2A 1I39A 2VQLA 2FUG2 3H5NA 1K78B 2DCEA 1GUUA 1OR7C 2RDPA 4L5EA 3BTIA 1SANA 4B09A 2PJRA 1SAUA 2R7WA 3H9GA 3CMAI 2QQ8A 4XLCA 2QA4I 3WU0A 2R7FA 4M74A 5KHDA 3HOWJ 5F08A 2F4IA 4E7ZA 3HRUA 4BEHB 3OYJA 1UFMA 3GFLA 2DO7A 2EZHA 2IPQX 4BNCA 1OQYA 5LFAA 1FMWA 3J7AO 1S9HA 1E2XA 1C0WA 1L0OC 2E5NA 3VEPA 3LSTA 4I2OA 5ICFA 3WTVC 1HW2A 3S3NA 5GADJ 4BYYA 3JTHA 1ON1A 1Z05A 2K40A 4F92B 2CU7A 2AXLA 2M5WA 3ABTA 2WA0A 3MEXA 4A93J 2Y0SN 5FKNA 1BI1A 2BXZA 2EBIA 1EH8A 1ON2A 2MGQA 3HDDA 1X2NA 2OV7A 1MBHA 2CW7A 1DPUA 5F0HA 2W57A 3CMEI 1K83J 1N25A 3OYMA 1B59A 2IS6A 4LG0B 2AS5F 4YG2F 2PLYA 1ZHFA 5DUKA 1IGNA 3OR2C 4QPOA 3E5QA 3OMYA 3WTXC 1TP4A 5FO5A 5IP6A 1TNTA 2HZTA 2Z3YA 1P2FA 3ZQHA 1WGXA 3RQ4A 1KU7A 2XAHA 4AC0A 2H6CA 3G73A 2GOMA 2V9PA 1O3SA 1VQ8I 4CGZA 5EEGA 3J80K 4HRIA 4OAYA 1HCRA 5E1ZB 1CGPA 2AO9A 3IH2A 2WV1A 4A3JJ 1W36C 3M8EA 2HEOA 4P9FA 4EGYA 2EILH 1B1BA 2D1HA 2FMLA 4LLLA 4AIHA 1XS9A 4KYWA 2A61A 3GMEA 3I9V2 5JHUA 2M8EA 4UUVA 4AVPA 5HNFA 5EF6A 3K4BA 1HKQA 1YW8A 4Y4RA 3TW6A 3ZMZA 4B44A 2NVXJ 3B6AA 5DD8A 3E6BA 4KN7X 2R5ZB 1ODDA 4E6KG 5DTDA 4P9UA 3K1MA 3FHNA 5JVGF 3E6CC 1RKWA 3RYPA 2EPFA 2WB1N 2M1BA 2NS8A 4RAZA 3AFHA 4OWRB 4ZZDA 4D7NA 4KDPA 2CJJA 3MKWB 1OYYA 4D0PA 2HR3A 3OR1C 3RKQA 1I1SA 3HKZN 4PK4A 4ZDPA 3VYSB 3W2VA 2M7BA 3ZQFA 5J40A 4BACA 3OIPA 1ZR2A 2DMUA 4PCQA 5GAHJ 3NQOA 4HG2A 1E3OC 2XGEA 1V5EA 2EB7A 2ZBKA 2E60A 1IDZA 4DJAA 1PJRA 2LP0A 2ADUA 2FBHA 2GZWA 3HYIA 3FXRA 2UUZA 4PDKA 1S29A 2Q1ZB 3TOAA 3F23A 3LFUA 1IXSB 4HYEA 2KIMA 3I4NJ 3TP0A 3E6MA 3JTGA 3DEUA 3BR6A 4QPQA 5FLXZ 2L7FP 3WGIA 2HVSA 2WAFA 2CO5A 3TBIA 4F7ZA 4PJMA 5HVQC 1HXDA 1R5ID 2G7HA 4E7HA 2GBYA 3PQJA 1G6NA 2KISA 4XNFA 5IPAA 4ZTFA 5GAEJ 4KT5C 2QKLB 3F6VA 2LH9A 1B8IB 4BQAA 2BW3B 4HX4A 3EETA 5EYRA 3DLLF 5ICEA 3F72A 4XKWA 2E7XA 2MG4A 3OIOA 3Q9SA 1FZPB 2ESHA 2ZFWA 5D5UB 2DTZA 3K6GA 1KU3A 2PG4A 2EA4A 1QQIA 2XAQA 4C9YA 2JVHA 1TQPA 3FF5A 1VQNI 3QYFA 1WI3A 2Q2EB 4B3XA 2CW8A 1D1CA 2FA5A 4XLEA 1X1DA 2CH0A 2K02A 3EDPA 4CA0A 1DUXC 2PFBA 3L09A 1CQTA 5HDKA 1ZELA 4L0YB 2P7CB 4X1EA 1BA5A 3TGNA 2DLLA 2LREA 3HUGB 5DM6F 4RLQA 3L2VA 4XQFA 4LITA 1W0TA 3Q0WA 1JE8A 1LE8B 1USSA 4XLNF 1TWFJ 1W1WE 3E0JB 3W3CA 1OYIA 2CMPA 3MKZA 4M3BA 1JUMA 3GLLA 1I3AA 2VXZA 4XMYA 3SEZA 3JRBA 2JPBA 1HLVA 3JRDA 2HQNA 4BJ5C 3RIRA 2A3SA 1KQ8A 3DPUA 3CUOA 1ETKA 3NAUA 3CP2A 4HSTA 4LG3A 5FD6A 4G6TB 5LHHA 2PEXA 1YIJI 1OCOH 2P5KA 1I6HJ 3WG7H 3TO9A 3BG9A 5D8KB 2E1OA 3JRFA 4AWXB 1SAXA 5D5XB 1Q1HA 2ZXIA 2EJRA 2HKOA 1SD7A 2WWYA 1LQ1A 3ZQ7A 1T39A 3WTUC 3BC8A 3LSKA 2GXBA 2KFDA 3I0TA 3QODA 3P7NA 1I6XA 2HGCA 3DP7A 2HXOA 4D5CA 4B1RA 3ZMUA 1S72I 2VONA 2B9SA 5E3LA 3BY6A 2D45A 4G7ZF 3NRVA 4DZJA 5HLTA 3CCRI 1F5TA 3CESA 2V79A 4DQ2A 4KA4A 3F6OA 2GIVA 2E2HJ 2ID3A 3H5RA 1IRZA 1N78A 2OQRA 1AWCA 2L54A 2YUSA 1FOWA 3H5AA 3O3KA 4HA8A 1JKOC 2WAEA 4XN3A 3HOTA 4OIOF 2XGCA 1P92A 1GXPA 2GOXB 3BROA 4DW6A 4A3CJ 3H9JA 3I59A 3QP5A 2DYSH 1CF7B 3BT9A 2TCTA 2XKPA 1YI2I 2COBA 3IL2A 2O5RA 2HOSA 3KX2A 2OZUA 1UZCA 3MWMA 5AIPA 1XCBA 5JFRA 3H3ZA 1LFUP 4R8HA 5IOZA 3S2WA 1FYMA 4BJTA 5ERIA 3C2BA 3FK6A 4N4OB 2FBIA 3ZN1A 3GYHX 4ZZLA 4AU7A 3A0HC 5K7HA 4PSWA 5ICGA 4IQJA 3BCBA 4CCNA 1FBQA 2F5FA 2X0LA 3RZOJ 3BCAA 5LRRA 3ZQLA 3BQZA 2BHZA 3T1BA 3V8KA 3RTRA 3B02A 1Z1DA 4C3IJ 1BOAA 4PGGA 1SMYF 1ZAOA 3UR3C 4AIJA 1V3FA 3FXKA 2F5DA 1Z7LA 4RS8A 3BWGA 2X1EA 1ZRCA 2D5VA 1LVAA 4HV6A 1EA3A 4I0BA 1TBXA 3ZXSA 3BLYA 1ERDA 2V6CA 3LOCA 2Z5UA 1ZH5A 5D4SA 5DD4A 1KGSA 3V7SA 3OYHA 5K1YA 2DJIA 2FE3A 5J1YA 3R61A 1NG6A 1MSEC 1XG1A 3R4KA 3LQQA 5M3FJ 1G8XA 1T08B 2B0LA 3ZP5A 3OL3A 1HSJA 4EJTA 3J7AY 1SVMA 1FYKA 3OV8A 4YRVA 3BTCA 3TKYA 1RUOA 3GFJA 1ETOA 3IC7A 2JA6J 4A3GJ 3K4CA 2NVUB 2FX0A 4G7HF 1XPXA 3TOBA 3GTQJ 3PO3J 1QBJA 4BE2A 1H88C 1OJLA 4XBFA 1MD0A 4Y52J 3HEFA 3M9AA 2OC6A 2O7OA 3IUOA 4AIDA 1XMKA 1XGOA 1YQAA 2KDOA 2V9VA 2V9KA 3DBLB 2JA2A 3G3ZA 1Z9CA 1O57A 1BOBA 1WH7A 5DCMB 1N77A 4IHXA 4V2GA 2ACJA 4FE7A 2M7AA 4DOZA 4BHCA 4LIUA 3J81K 1IJWC 1MNMC 2H1LA 1H9GA 5J4VA 1Y8RB 2DT6A 1B72A 3I58A 1YIOA 1A04A 2QSFX 2JQ7A 4A5MA 3M8JA 1OISA 3TDUC 5B3SH 1R5HA 3BZKA 2IGMA 2VLAA 1X19A 4CHUA 2CUJA 4M72A 3V7RA 2A6EF 1SEUA 3ULQB 4CH7A 1UHMA 2ESNA 2XDVA 2QSHX 3L00A 2HQ5A 2ID6A 4RMNA 5F1JA 1IRXA 3I71A 2K9LA 3ZMTA 3ECOA 5K7FA 1QHHD 5ILVA 4YFNF 3FZVA 1V4RA 1FBUA 5TGTA 1YRNB 2JMWA 3P9IA 5TJJA 1YE9A 2A5WA 2JK3A 3VYRB 3BOQA 2BEOA 4ENJA 1IC8A 1OCTC 2KLOA 3CJQB 1QHGA 2L9VA 4O6JA 4XKBA 4XICA 3KEOA 2BBYA 2AQFA 1FX7A 1REPC 2DA1A 4HLXA 1Z77A 3PNYA 5F0FA 2HDCA 4ZYHA 1V54H 1WHUA 3LSMA 2H6BA 5ILSA 4XONA 4A6DA 1XCVA 1R4MB 4CXFA 4A0XA 1D1BA 1VQ9I 1HDPA 3RDIA 4C3HJ 2FBKA 2QQBA 2H27A 2ZNZA 3KP3A 1TL8A 4E7KA 4UHTA 2W00A 1WWXA 4XLHA 4BUPA 3X2QH 2J5PA 4DNCA 4BQOA 5K5RA 2IS4A 3FX3A 3WTSC 5GTHC 3HC7A 2KJCA 2X6YA 3PNVA 2X1DA 2XGDA 5HS9A 3WHCA 2DODA 1GDTA 4DGWB 2CGPA 3Q0UA 3LNQA 2MYSA 4DYRA 2P6TA 2O3FA 4U7DA 4JX5A 4BU2A 4XLPF 3S8PA 1FMVA 3C18A 1YFHA 3DWLE 3HOVJ 4A3MJ 2DPUA 1UCRA 1I50J 4QLCU 1IF1A 3K0LA 3G1MA 2FRHA 4BAYA 5DM7F 2GA2A 5FKOA 2AQEA 1Z7UA 4RBOA 3E1SA 4NQWB 2LKXA 2Y0SA 4YIFA 3FDYA 2L02A 4HSRA 1HQCA 4B47A 1JKQC 4PSXA 3JRAA 2BVLA 3EUHC 3LMMA 4BL0B 4CZZA 2ZXHA 5B1BH 3V8JA 3ZPLA 2XSJC 3D0SA 1KYWA 2EH3A 2CQXA 4UUTA 3Q5FA 1PUFB 2R0QC 1RUNA 1UHSA 1J09A 4II2A 4JP0A 2JA5J 4WF2A 2KRFA 2KP6A 4KUMA 5KK1A 4YIIA 3VDXA 5LBQA 2IW5A 3CCLI 3A03A 1FSEA 5CQGA 4KN4X 2F5CA 2Y75A 4IZZA 4A3BJ 1J5YA 2L4AA 2RVCA 2E2IJ 2TDXA 1DQUA 3MMYB 1D3YA 4Y33A 4KMFA 1A36A 1B9MA 1I27A 4A3FJ 1VZ0A 1FPQA 3IWFA 4EVIA 4A3EJ 3RI4A 2ZMEB 1SC7A 2P8TA 3LSHA 4E4HA 2LF8A 5FGMA 1G3SA 2DFEA 2X6OA 3DPTA 4HLYA 2KRCA 2TRTA 5JVTA 3QRFF 2IA2A 1IV6A 3ABMH 3CDLA 5IYCJ 2VI6A 1W7PB 1ZRDA 2VBZA 3KCCA 1VQLI 4OINF 2CRGA 1H89C 4YELA 1IN6A 4UUSA 3S1NJ 4DBRA 1YX3A 4N4NB 5E3NA 2DFIA 3T5XA 1RNLA 3WE3A 1WH5A 2ZC2A 2D2WA 1P6RA 3HKZA 3K4MA 4OAZA 2P0WA 3FISA 2ZCWA 1BBYA 5EGOA 1HA8A 1WRJA 1XSXA 4B8XA 3CCQI 1UG0A 5ED4A 4RGUA 1KZHA 3L9FA 3HSRA 4UB6C 2JPCA 2HYJA 3PSIA 5B5EC 1MIJA 2LBFA 3FK7A 5M5WJ 3KPHA 2E35A 2GM4A 3KIOA 4MFEA 4H4KC 4L9JA 9ANTA 2XRNA 3ASNH 4DZPA 1JXSA 2M3AA 1YJWI 1MJBA 4FCYA 3G1LA 3C7JA 4KITB 1PP8F 1DU6A 3I53A 4MO7A 2BY3A 1X4OA 2Z16A 3FMSA 4BY1J 3FMRA 1IUFA 1XC5A 4X6AJ 2VKVA 4ON0A 2FOKA 4CO8A 1X3ZB 1EF4A 2I5UA 3PSFA 4KJZA 2RV8A 1ONVA 2RC4A 4ZYAA 3EYYA 4A12A 4MTEA 3A01A 1WJBA 3AL0C 2R7TA 2DOAA 3SDGA 4BE1A 4BGDA 4IRHA 4ZDLA 4XRSG 1WKMA 2HOEA 4EV0A 4MNUA 1W5SA 2W25A 2X9DA 3V42A 2RQPA 4GYIA 1VQOI 2OF7A 2DYRH 2NVTJ 4M9SA 1KYZA 3A1YA 4V2FA 4XSXF 1BL0A 3S2DJ 5C4XJ 2VXDA 2EZKA 2A5YB 2V1UA 3HXLA 4EJVA 3GUDA 2CV1A 2FSWA 3S15J 3QPTA 5E1XA 3W6JB 4A0ZA 1ZGWA 2JSPA 4RB1A 2PMHA 4M3GA 5E20A 3AG2H 2E1MC 5J1RA 2BZTA 3ML6A 5A2QZ 2JJ7A 3GZNB 2LY9A 3KYDB 1WI9A 3VSLA 3JREA 4HDUA 2O61A 3K70C 5BMZA 3CJRB 3MZHA 3PFIA 3CUQB 5DUIA 1ZQ3P 1RR7A 3H3VK 3IKVA 2OJED 2P6SA 1ZGJA 4I0AA 1OPCA 3TMOA 2LG4A 3HBLA 3DKWA 1MSFC 3HHHA 1LEBA 3BJ6A 3U1KA 2OAZA 2DT7B 2R5YB 4ENNA 1FEXA 1RKTA 3BPXA 1GLNA 5HODA 1IXCA 1IG7A 3PUFA 4HF1A 1S8NA 4C2MJ 2DOEA 4HV5A 2K9QA 4Y15A 3SFZA 3VYUB 4NHJA 3KZIC 3WE2A 3MD2A 4OIPF 3I55I 5EEAA 2A69F 4RAYA 2VE9A 3I3LA 1T98A 2DT5A 4U0VA 2AHQA 5FFZA 2RKHA 2ZMEC 4IHWA 2I10A 1R71A 1LVKA 4FTHA 2X51A 3KZYA 3QQAA 4G9YA 1G3YA 4MEYF 3AG1H 3S93A 3H0DA 4HOBA 2CYYA 3ZQIA 1J59A 2DU9A 5FLVA 4ZYGA 3CF2A 3KEYA 1FOYA 1JHHA 2E71A 2OU2A 2G9WA 4F93B 4XRSA 1R00A 2BYVE 4RLFA 3PIPF 1MDMB 4GYGA 3DKXA 3H3UA 4M3EA 4S05A 4G7OF 2OTJI 3OYEA 4IXAA 1PYVA 2DPDA 2EFWA 3C2GA 1U0JA 5EJCA 4WXCA 1U9NA 4DYCA 4I98B 4CYCB 3ERMA 1U3EM 5M5XJ 3CC7I 2VB6A 5EEHA 2LR8A 4CCMA 1TZLA 2VOPA 4II3A 3CLOA 2PJPA 4ITVA 5CVIA 2CUEA 1D0XA 2LFBA 4AM3A 4MIMA 4CCKA 2KMUA 4IHVA 2W24A 1SFXA 5L3EA 2P5LC 2ZSHB 2F4OB 3SHFA 2MSYA 3CTAA 3SFIA 1A5JA 3SQNA 5CVRA 4A3KJ 2V6EA 5HS7A 1VQ7I 1SVOA 3LSIA 1EKEA 3U2RA 3PQKA 4Q47A 3VODA 2W7NA 4P55A 4AIKA 3MQ0A 2HYFA 1LNWA 1XMXA 2DA3A 1ZRFA 4EM1A 3HPGA 5E17F 4LOCA 4A69C 4D9JA 5E8GA 5LGUA 2A6HF 4N9IA 4Z6YA 3F3XA 5J8FA 4S04A 3A2KA 2BE5F 3ERED 3CDIA 3FM5A 3GZ6A 3HTSB 4S0HB 1VQ4I 5KAFC 3E5XA 3ABKH 3F8CA 2CQ7A 3C2HA 1O7FA 1U9OA 1U5TB 2RGVA 2QUFA 3QAHA 1V5FA 4HF2A 3SJMA 3PNTA 3RYRA 1ZG1A 3FKJA 1VQKI 4ESBA 3I56I 2QZ8A 4ZC3A 3BG6A 2LKPA 2CS3A 3TEDA 1UG2A 2XF6A 5CKTA 4PGHA 4P1WA 1W0UA 3D5LA 2HWVA 4E7IA 4LK0F 1FP2A 1AKHB 2CWEA 2D1VA 1IN8A 1T0FA 2Z33A 4Q4ZF 3S1MJ 2Y9YA 4I6ZA 3H1CA 3DTEA 3BPVA 1BJZA 2EFPA 3JAMZ 1IRFA 3RKXA 3IAM2 3EUAA 3G2BA 3CUQC 3ZR8X 4I09A 4ESJA 2GA1A 1Z3XA 4LK1F 5FKLA 2R7OA 3ZGKA 2PJRB 5IP7J 2IA0A 5TISC 1NK3P 4ENMA 2XUBA 1LDDA 3GEZA 3Q0VA 1ITYA 4LFUA 1BC8C 2JVGA 4M9ZA 4GFBA 4BXXJ 4JYKA 5C4JJ 3HRSA 3NARA 3DLAA 3WU2C 3IHUA 5J8CA 3MFKA 2W85A 2V7FA 3SDBA 3K2ZA 2R7ZJ 2DA6A 2VPLA 2OTLI 3LAJA 3D5RC 3GBGA 2CUFA 2STWA 3E6DA 1I3QJ 1R6RA 3CCMI 2ECCA 1TWGJ 3K2AA 3OYFA 3F21A 3GO5A 1J75A 2EZLA 2NVQJ 1F1ZA 2LY2A 4BE0A 2QBYA 1M1EB 4IPAA 3TQNA 3MZYA 2PMUA 3OYAA 4OIRF 2V1XA 2A68F 4PZJA 1ZKGA 5BQTA 5DCMA 2VBYA 2R93J 4IRGA 5AONA 2EQRA 3ISPA 1ZARA 2DBBA 4KISA 1YYVA 1YTYA 2VIXA 5K5QA 5FJ8J 4PFOA 2LSOA 1HF0A 2L7KA 2M4KA 2VT3A 4L9NA 5IT9K 3JSOA 4RDUA 1QZZA 3CCUI 1XMAA 5D5WB 2M0MA 3DEWA 1HC8A 3JRIA 3G6EI 1OCZH 2W84A 2XVCA 5F04A 4Y17A 2NS0A 2MC3A 1FLIA 4XOTA 1P4XA 4IX7A 4BH9A 1TT0A 1MBJA 1WCMJ 2FJ1A 4BBSJ 1OMIA 2L3DA 1T6SA 2QEXI 2UV1A 1W4MA 2DQLA 3E3VA 1R22A 3BDDA 2LD5A 4M6VA 2V4JC 4EQQA 4F91B 4JX6A 3H92A 1SFUA 2K9MA 4IHYA 2VL8A 1YRNA 4IEJA 4PJLA 2R7SA 1GV5A 2W1OA 4P5OA 2DA7A 3TL4X 2FD5A 3ZMDA 1K79A 3V7CA 4IOAF 1TW2A 3DFGA 2DDBA 3QYBA 4HDVA 5F27A 2Y48A 4H0EA 1IAWA 1FIAA 2L9RA 3K4JA 3KLOA 1MMGA 1SD6A 2X6WA 1PVEA 2CW0F 4ZDOA 1ZN2A 2QKMB 2N8GA 2GXGA 1ZG5A 2MFZA 1D1AA 4QSHA 2WADA 1X1AA 4B4CA 1D8KA 2IGKA 4A3LJ 3O8HA 2MBFA 1FTZA 2JRMA 4XOPA 1IN5A 2RN7A 1QU3A 4KMUX 1Q1VA 2KDZA 5E79C 3G4SI 2BVMA 1OCCH 2WAQA 3A0BC 2WV0A 5EG0A 4B48A 3CMYA 2RREA 4HW0A 1OR7A 1GVDA 3FWEA 4W97A 2DTRA 1U5TC 2BXYA 1MZBA 4CCOA 3LAPA 2MW8A 5FKKA 3CO7C 1S3JA 3GWZA 3OSFA 2HDDA 2K4BA 3WGHA 2L5QA 4L0ZB 4LGWA 2LK2A 3SEQA 1Z21A 4BHBA 3HHGA 4ZJZA 2H8RA 2DFHA 4IRIA 2EINH 4NQWA 3JRGA 1YJNI 1JKPC 3HG9A 3FHZA 3J7ZI 3DKYA 2V1DA 4U87A 2F2EA 2QQ9A 4XL9A 3RPQA 3TO6A 2RNGA 3E5UA 3Q9VA 4AD9A 5D5VB 4JX4A 2GWRA 1IUYA 3SYTA 4IJAA 4HQMA 5L3CA 2OUMA 1XTAA 4I76A 4MLOA 2HOAA 4RGSA 1K61A 2IBDA 4L18B 1X4PA 1LDJA 1Z67A 1Z91A 2KQRA 2OA4A 4IVNA 5LRSA 5EZHA 3OYNA 3HIFA 1WVRA 3BTLA 2DA5A 4GO1A 4A5NA 3IH3A 3PUBA 4XLAA 3FKIJ 2VQGA 2DXIA 1U2WA 3M3YJ 2HTSA 3KP7A 1JI8A 1MBFA 4E7JA 1J9IA 3BR1A 4CZCA 4WWCA 1OKRA 3VOEA 1QRYA 3EQLF 3OS0A 2A6TA 4EMSA 1VF9A 3VB2A 2EK5A 2XHKA 4GCVA 3PM1A 1KU2A 4XK4A 1VQPI 2VPRA 4FETA 4E7LA 3H0GJ 3KP5A 5H20A 3GX4X 4OMYA 1O3TA 1W7PA 1TT5B 1RETA 3CJNA 1TNSA 1W5TA 4G94A 5KNLA 2P4WA 2JA8J 1FSHA 3RKWA 1LUJB 4I01A 2XROA 1ZTRA 3K1PA 3CO6C 4HPQA 5IY5H 1BR1A 3DF8A 3IWZA 5J4YA 1T38A 3LSGA 2IVMA 3GTKJ 1WJEA 3LQRA 2GLOA 4DBQA 1YX5A 3CQZJ 5BPIA 3MN2A 1MH4A 2XRLA 2M2EA 3DTIA 4A0YA 1WSUA 2BGCA 2JUGA 1EJ9A 3K7AJ 3K4NA 2DOFA 3BP8A 2M30A 4NBQA 1MH3A 1Y39A 3CZ6A 2ME0A 5FFXA 3S16J 1KA8A 4E70A 1X1PA 2H8WA 2GAUA 4JOMA 3P5JA 4MQ9F 1J2XA 4UVBA 4XKVA 2ZJRF 3ELKA 2LC2A 3WGGA 4MQVA 2V1NA 5LHIA 1FJLA 1QZEA 4ANJA 3CF5F 5DV5A 5L3FA 2HDWA 4LD5A 3AL0B 1U6GA 4UB8C 1P7IA 1ZG3A 3S1QJ 3COAC 3HM5A 3S14J 2VBWA 3J7YJ 3Q3SA 3ZQGA 3I54A 4JQFA 1JUSA 1R36A 4KIBA 2MH2A 5LLQA 1D0YA 1VFCA 3JRCA 3N05A 4XIDA 1K78A 3MKLA 2Y31A 3I59B 2P5VA 3GTMJ 2XPUA 2NXNB 3DBHB 2KJBA 1DP3A 2DMNA 2ZFUA 3DBRB 2JWTA 4NUBA 1XSDA 5B66C 2E1MB 2IJLA 2K27A 1YS6A 3E97A 2MLGA 1NH3A 4BEHA 2K7LA 5J3LA 3FXLA 4UV9A 1GHCA 5ICCA 1GV2A 2ELJA 5LGTA 3BR0A 4G12A 2IEKA 2DMTA 4XR6A 4M73A 1NK2P 2QYOA 1HW5A 2Y0MA 1R49A 4C3JJ 3CCVI 1Y1VJ 3VFZA 2E1NA 2XF7A 2L7ZA 2FF4A 1WFXA 4LLNA 3EPZA 3MVPA 4CYDA 2E34A 4OMZA 2STTA 2HPIA 1KQ0A 5F64A 1E0EA 2CFOA 3IRQA 2XB5A 2XAJA 4GXOA 5J6XA 5JR3A 1D5VA 4D1QA 3GTLJ 3OYDA 4C2TA 4LG0A 2LKSA 2MLKA 2EV6A 2I8DA 4CICA 5KCMA 1MGTA 2HNHA 3KLNA 3OYKA 1ZLKA 5C3EJ 1TQIA 3KZZA 2MA3A 2MH9A 1K7AA 1DPRA 1MNEA 4NB5A 2R7DA 1V55H 3DEEA 1G59A 3N4MA 3WODF 2OBPA 5HNHA 5FKMA 2ELKA 3RPUA 4HX7A 2Y2ZA 2DQRA 1XGSA 3HOZJ 4D5FA 5FRMA 2X48A 3L2RA 3CC4I 2X4HA 3J81Z 2NS7A 2WB1A 5E1WA 3D1NI 2LRDA 4NC6A 3CCSI 2K85A 1W36D 3KE2A 1SD5A 1BI3A 2L2OA 3SZTA 1OYWA 2X1CA 1HW1A 1EH6A 1W7PD 3HGYA 1STZA 3AKZA 3L2UA 1AA7A 4ASNA 2JRTA 2R5ZA 2VJ4A 1JUPA 5BOXA 2VKEA 2P7VB 2FNAA 3DCFA 1AU7A 3IV5A 1Z3YA 2LY1A 3AAFA 3LSPA 1B72B 3F8NA 4ESFA 4IQ4A 1A6QA 3KFWX 1I5ZA 3REOA 4NC7A 1FOKA 2A07F 1WPKA 2VE8A 4KICA 6PAXA 2IS2A 4C2UA 3IKTA 2IA1A 3CP8A 4LLGF 3CC2I 1VQ5I 2VJJA 2EFNA 4PJJA 3FIWA 1RPWA 5HDNA 2H1KA 2F48A 3ESWB 2O9LA 1SMTA 3ASOH 3QU3A 3BG3A 3JCUC 4PJNA 3GXOA 1K6YA 2X85A 3PIOF 4A3DJ 4CCJA 1JKRC 5M3MJ 2IS1A 1J7KA 3C1DA 4MHGA 1KU9A 5H2FC 1FTTA 4BXUA 2NOGA 4U88A 3R6SA 4JBAA 2B7EA 3DQVC 2VOOA 2MD5A 5D6EA 2O03A 5KAIC 1FNNA 1U78A 3MAJA 2Y9ZA 4UNOA 2CG4A 2V26A 1B8IA 2NVYJ 4XRFA 2BW3A 2IGOA 1E17A 1IRGA 5FLXK 2JUCA 2JT1A 2K86A 4NC8A 2XIGA 1FY7A 3KP6A 3LA7A 5J47A 1F36A 4LMYA 2OD5A 3RZDJ 2H94A 2FQ4A 5LD2C 1FP1D 3HSFA 3QOPA 2QQAA 2E5ZA 3AG4H 1LB2A 3DPLC 1H8AC 2P81A 2YS9A 2VJIA 3H36A 2YU3A 3QWLA 2XSDC 2QWWA 3HRMA 1JJ6C 4UVCA 1ORKA 3BJOA 2Q2EA 4HX8A 1TW3A 1IW7F 1D0ZA 1HKSA 3GCMA 2HZDA 5DS9A 3NWSA 1K4TA 1SD4A 2VKDA 1R1UA 4BKXA 4QTRA 3HUGA 3ABUA 4RA2A 1XGNA 3HSEA 3JAMK 1LE8A 3JSPA 3KEQA 3R0JA 3ONQA 2Y69H 3VSKA 4MGRA 2X6XA 3W2WA 1Z6RA 2R7VA 4O3MA 1DGRM 3HB9A 5L3GA 3S17J 1QZYA 2YPRA 3SXYA 3BG5A 2DMQA 4L5JA 4IHTA 1DDNA 1QO0D 4KIFA 1LJ9A 4OU0A 4AYBN 3HOYJ 2CQKA 3MZ8A 1N75A 3S32A 4AVZA 5E8IA 1RR8C 3KP2A 4YIRX 5E18F 3UNGC 1FT9A 3GLXA 2LMDA 2VQHA 2VUMJ 2HYGD 4HEA2 4KT6A 3QPHA 5H6QA 1TC3C 2NRAC 1F43A 4LB5A 2VQCA 5C44J 3M1CA 3PFYA 2EA2A 2EZIA 3ROUA 2XPWA 4L5IA 1JT0A 2VBXA 2DK5A 1XB4A 3RPUD 2CFXA 5GPAA 1O7LA 5D6FA 1MBGA 3CCYA 4EM2A 3OYGA 1ETXA 4HF0A 3S2HJ 1ETVA 4MFDA 1G3TA 1ZREA 4WXDA 3GZ5A 4M3DA 1QNTA 3B6CA 5JHFA 2R7XA 1YS7A 2Q8KA 3JRHA 2R4GA 5GPCA 4JK1X 1P9QC 4Y13A 5KVRA 1G2HA 5FROA 1FYLA 3B73A 5FB2A 5HOOA 1F4KA 5H6RA 4RB2C 4FHTA 3OSGA 2KT0A 3GFMA 2ICWG 1R9TJ 2XF5A 3GTGJ 3CDHA 4UUSB 3OYIA 4QIWN 2AXTC 3E7LA 4RAGA 4FQGA 2L01A 1G4DA 2YSRA 2K5CA 1R1VA 2L9SA 1AHDP 3VWBA 1QGPA 2O0YA 5EGOB 1WJAA 2WTEA 3L7WA 3FBIB 1APLC 4XRMA 1CF7A 2MD0A 3K69A 4ENKA 3CCJI 2KZGA 3M07A 1NHAA 2WY8Q 1DP7P 2LBFB 5GTIC 2UZKA 4IL6C 1USTA 1YO5C 5JLXA 1R7JA 2KZVA 4YEJA 1E3PA 2R7UA 3ZN0A 1IDYA 2PBIA 1TQMA 1LKXA 1IV8A 4DIQA 3BR3A 2KIQA 3FBNB 3BR2A 3W6VA 1XN7A 4I99C 3BTJA 1R4NB 1T33A 2QF7A 2ZJQF 5CVVA 4HNUA 4HBLA 2M4GA 3A01B 1BI0A 1EV7A 1OLTA 1BW5A 3SZPA 3V4GA 3CLQA 3K4LA 3K4KA 3VYTB 2FMYA 4XSZF 4UVAA 4GDFA 1DGWY 3WG9A 1XD7A 3KYCB 1G3WA 2RNJA 1S5LC 2KPMA 2K3FA 2PMZN 1MMDA 2XAGA 3EUHA 1P7JA 4ZTJA 3WHBA 3ABLH 1X3UA 4I7HA 3S3MA 2JN6A 2ZJPF 2EIKH 2ISYA 2Q0OA 5FD5A 3JR9A 2ZNYA 5CVUA 2IRFG 3WU1B 3QYEA 2QLZA 1BN5A 1GVJA 2ME6A 3TO7A 2HVRA 4IKFA 3FXMA 1ZK8A 2BY0A 3RQIA 3OY9A 3D5SC 1ZR4A 1ETYA 4L9TA 4LIVA 3OS1A 1HBXG 4PJ0C 2QVOA 1YLFA 4ZH4F 1JJ8C 1QA6A 5CQEA 2QGUA 1AOYA 2E19A 5CPRB 2VC0A 3QOEA 1BR4A 1KONA 2KRHA 5DEQA 1BW6A 1XDUA 3ZQQA 4NDLA 3ZQCA 5L3BA 4EEFG 4CDGA 1MW7A 1IN4A 2M0CA 1O4XA 4RM2A 3TP3A 3M7GA 3H9QA 3W6KB 1UMQA 2E36A 2HQAA 1V5GA 3CJTB 4CUGA 3GVAA 3QP6A 2DDAA 4N0BA 1MBEA 1O3RA 3DV8A 4XKCA 2VN2A 1YOVB 4J00A 2FU4A 1U8RA 4RM3A 4EJOA 4M71A 1HKTA 2PX9A 3J80Z 4GRIA 1T8IA 3GF2A 1P4WA 1R58A 4M6YA 5JLWA 3LA3A 1LPQA 2LOOA 5HS8A 4XLFA 4G6QA 4F3QA 2CV2A 1RIOH 3KP4A 2F4MB 2QCOA 2ZXJA 3WTYC 2HPMA 1PDNC 2HVQA 3FM3A 3PJRA 4ETSA 2COMA 4RB0A 2ZO4A 3LWFA 4CCLA 2CQNA 3HOUJ 1O3QA 3CCEI 5E3OA 5CVJA
chains in the Genus database with same CATH topology
4MTDA 5HLGA 3DXJF 1FWZA 2FEZA 5CLSA 1S7AA 3WTTC 5D8LB 3RKYA 2BV6A 2NYXA 1BC7C 3FXUA 3WTZA 5LEJA 1FBSA 2XAFA 1LEAA 1I1GA 3P9CA 3BZ6A 4FX4A 2O8XA 3BJAA 4FT8A 1H9TA 2WC2A 2YX4A 1BI2A 4EM0B 1MJ9A 2ISZA 2XASA 3LA2A 1XGMA 2L4MA 4G6DA 1HSTA 3HTUA 5AIQA 2J5OA 3V8LA 4U0YA 2M87A 2NAZA 1BJAA 3EYIA 3U1DA 5F1RA 4MEXF 3F8FA 3O6BB 2ZJ2A 4BHPA 3ZMVA 4Q5SF 1IZ1A 3I5UA 4G8XA 2DK8A 2HTJA 2ETHA 1YW7A 2LNBA 1UHWA 3F22A 1S6LA 1YW9A 2Z99A 4KFCA 4WXHA 2KIUA 2ZMEA 2DAOA 3M8FA 2H09A 4GGGA 2UWMA 1KQ9A 2YR2A 2FNPA 2NNNA 3LFKA 2EV0A 4LJZF 5HLHA 1BIBA 2EFOA 3QU6A 1Y0UA 4M9XA 1F9NA 4LB6B 2ZKZA 2QBYB 5IT9Z 2E1CA 1JHFA 1BIAA 3K1NA 3I4PA 1P4AA 2CSOA 4L9VA 1RI7A 2XKOA 4RB3C 3U9GA 4OIQF 1LDKB 2KKOA 2EFQA 4ZYEA 1H0MA 4U7BA 2HEOA 4HZFA 2XGXA 3NEUA 3L2CA 5BS6A 2R3SA 3GW2A 3N97A 2IP2A 2K4JA 1B9NA 4U0WA 3FMQA 4O5VA 3HRTA 3O2PE 5HLIA 2DI3A 5LHGA 1ZYRF 1EH7A 1MKMA 3TDZC 5LGNA 2OZ6A 1L3LA 4A6EA 3I64A 4A2UA 2HQRA 4QWQA 3T8RA 1ULYA 3T0YA 1PP7U 3ZMSA 3T8TA 5TRDA 1XDSA 4RGRA 1QPMA 1TTYA 4HAMA 3OOPA 4EJWA 5DYMA 3R60A 1FC3A 3CUQA 4K2EA 4UV8A 4EGZA 1RZ4A 1WQ2A 3RJPA 5A2QK 4WX9A 2XV4S 5F6FA 5K5OA 2FQ3A 5CJ9A 3GFIA 2HS5A 1YG2A 4ZYDA 2PI0A 1VTNC 2UXNA 2VODA 3IRRA 1TLHB 4R1HA 2EWNA 4WCGA 3FXQA 5DDGA 4FX0A 2E7WA 2YX7A 1JGSA 5LEKA 4EJUA 2HFHA 4Q48A 2HKXA 2JSCA 1S7OA 1R1TA 1UB9A 2M45A 4RGXA 5D4RA 1B6AA 2UXXA 2ELHA 2KIFA 1GXQA 3F8BA 1MDMA 1D8JA 2JZYA 3JW4A 4IHSA 3WTWC 1R5GA 2IT0A 2O6GE 3ECHA 5ILUA 4HQEA 4TV7A 1IXRC 3K9TA 3HOSA 4M6XA 5L3DA 5HDGA 1ZGAA 3C3WA 4IF4A 2QM3A 5DCFA 2F5EA 1K6OA 4OOIA 3MCZA 4KNYA 1J0RA 2PQ8A 3R0AA 3P9KA 2LDUA 1T2KA 4P96A 2Z9OA 2DW4A 1SFEA 4UXNA 3F8MA 4YFXF 5JI6A 1IN7A 2JTVA 5CYVA 2GQQA 2EV5A 1R23A 2NNYA 1BM9A 2G7UA 4N9HA 2FXAA 4I02A 2LF7A 4YFKF 1Z6TA 2QENA 1XSVA 1U5TA 2C6YA 1ZLJA 5IT3A 2OQGA 3M1EA 2VC1A 2PN6A 2VT2A 1PUEE 5BPDA 4R79A 1MJAA 3KETA 1B4AA 4WK8F 4Z2YA 4KIGA 1K78B 2RDPA 4B09A 3WU0A 2R7FA 4M74A 3HRUA 1UFMA 3GFLA 2DO7A 2IPQX 4BNCA 3J7AO 1E2XA 1C0WA 1L0OC 3VEPA 3LSTA 4I2OA 5ICFA 3WTVC 1HW2A 4BYYA 3JTHA 1ON1A 1Z05A 2AXLA 2M5WA 3ABTA 3MEXA 1BI1A 1EH8A 1ON2A 1DPUA 2W57A 1B59A 4LG0B 2AS5F 4YG2F 2PLYA 1ZHFA 5DUKA 3WTXC 3E5QA 5FO5A 1TNTA 2HZTA 2Z3YA 1P2FA 1KU7A 2XAHA 2H6CA 3G73A 1O3SA 4CGZA 5EEGA 3J80K 5E1ZB 1CGPA 3M8EA 4P9FA 4EGYA 2D1HA 1B1BA 2FMLA 4LLLA 4AIHA 4KYWA 2A61A 5JHUA 2M8EA 4UUVA 4AVPA 1HKQA 1YW8A 3ZMZA 5DD8A 3E6BA 4KN7X 1ODDA 4P9UA 3K1MA 3E6CC 3RYPA 2M1BA 4RAZA 4ZZDA 4KDPA 1OYYA 4D0PA 2HR3A 1I1SA 4PCQA 3NQOA 2EB7A 2ZBKA 2ADUA 2FBHA 2GZWA 3HYIA 3FXRA 4PDKA 1S29A 3TOAA 3F23A 1IXSB 4HYEA 2KIMA 3E6MA 3JTGA 3DEUA 5FLXZ 3WGIA 2CO5A 4F7ZA 5HVQC 1HXDA 2G7HA 3PQJA 1G6NA 4KT5C 3F6VA 4BQAA 4HX4A 3EETA 5ICEA 3F72A 2E7XA 1FZPB 3Q9SA 2ESHA 2ZFWA 5D5UB 1KU3A 2PG4A 2EA4A 1QQIA 2XAQA 1TQPA 3FF5A 2FA5A 2K02A 3EDPA 1DUXC 2PFBA 3L09A 5HDKA 4L0YB 2P7CB 3TGNA 2DLLA 1JE8A 1USSA 4XLNF 1OYIA 2VXZA 2JPBA 2HQNA 3RIRA 2A3SA 1KQ8A 3CUOA 5FD6A 5LHHA 2PEXA 2P5KA 3TO9A 5D8KB 4AWXB 1SAXA 5D5XB 1Q1HA 2EJRA 2HKOA 1SD7A 2WWYA 1LQ1A 3ZQ7A 1T39A 3WTUC 2GXBA 3I0TA 3P7NA 1I6XA 2HGCA 3DP7A 3ZMUA 2VONA 3BY6A 2D45A 4G7ZF 3NRVA 1F5TA 2V79A 4DQ2A 4KA4A 3F6OA 2GIVA 2OQRA 1AWCA 2L54A 3O3KA 4HA8A 3HOTA 4OIOF 1P92A 1GXPA 3BROA 3I59A 3QP5A 1CF7B 2XKPA 3IL2A 2OZUA 5AIPA 3MWMA 5JFRA 1XCBA 3H3ZA 4R8HA 3S2WA 1FYMA 5ERIA 2FBIA 3ZN1A 3GYHX 4ZZLA 5ICGA 1FBQA 2F5FA 2X0LA 5LRRA 3V8KA 3T1BA 3RTRA 3B02A 1Z1DA 1BOAA 4PGGA 1SMYF 1ZAOA 4AIJA 1V3FA 2F5DA 4RS8A 3BWGA 1ZRCA 1LVAA 4HV6A 4I0BA 1TBXA 2V6CA 1ZH5A 2Z5UA 5D4SA 5DD4A 1KGSA 3V7SA 5K1YA 2FE3A 3R61A 3R4KA 3LQQA 2B0LA 3ZP5A 1HSJA 4EJTA 1FYKA 3OV8A 3TKYA 1RUOA 3GFJA 3IC7A 4G7HF 3TOBA 1QBJA 4XBFA 1MD0A 3M9AA 1XMKA 1XGOA 1YQAA 2V9VA 3G3ZA 1Z9CA 1O57A 5DCMB 2ACJA 4BHCA 3J81K 1H9GA 3I58A 1YIOA 1A04A 4A5MA 3TDUC 1R5HA 4CHUA 4M72A 3V7RA 2A6EF 3ULQB 1UHMA 2ESNA 3L00A 3I71A 3ZMTA 3ECOA 5ILVA 4YFNF 3FZVA 1V4RA 1FBUA 3P9IA 5TJJA 3BOQA 2BEOA 4ENJA 4O6JA 3KEOA 2BBYA 1FX7A 1REPC 4HLXA 2HDCA 4ZYHA 2H6BA 5ILSA 4A6DA 1XCVA 4CXFA 4A0XA 3RDIA 2FBKA 2QQBA 2H27A 2ZNZA 3KP3A 4UHTA 1WWXA 2J5PA 4DNCA 5K5RA 3FX3A 3WTSC 2KJCA 5HS9A 2CGPA 2P6TA 2O3FA 4U7DA 4XLPF 3C18A 1YFHA 2DPUA 1UCRA 4QLCU 1IF1A 3K0LA 2FRHA 4BAYA 2GA2A 1Z7UA 4YIFA 2L02A 1HQCA 4CZZA 3V8JA 3ZPLA 3D0SA 1KYWA 3Q5FA 1RUNA 4WF2A 2KRFA 4KUMA 5KK1A 4YIIA 5LBQA 2IW5A 1FSEA 4KN4X 2F5CA 2Y75A 1J5YA 2L4AA 2RVCA 2TDXA 1D3YA 4KMFA 1B9MA 1I27A 1FPQA 3IWFA 4EVIA 3RI4A 2ZMEB 2P8TA 2LF8A 5FGMA 1G3SA 3DPTA 4HLYA 5JVTA 3QRFF 2IA2A 1W7PB 1ZRDA 2VBZA 3KCCA 4OINF 1IN6A 2DFIA 3WE3A 3T5XA 1RNLA 1P6RA 2D2WA 2ZCWA 1BBYA 1WRJA 1XSXA 4B8XA 5ED4A 4RGUA 3L9FA 3HSRA 2JPCA 4L9JA 2XRNA 1JXSA 1MJBA 3C7JA 1PP8F 3I53A 3FMSA 3FMRA 4ON0A 2FOKA 4CO8A 4A12A 2RV8A 1ONVA 2RC4A 3EYYA 4MTEA 4IRHA 1WKMA 2HOEA 4EV0A 4MNUA 1W5SA 2W25A 2RQPA 4GYIA 4M9SA 1KYZA 4XSXF 2A5YB 2V1UA 4EJVA 3GUDA 2FSWA 3QPTA 5E1XA 3W6JB 4A0ZA 4RB1A 2PMHA 5E20A 3ML6A 5A2QZ 4HDUA 1WI9A 2O61A 5BMZA 3MZHA 3PFIA 3CUQB 5DUIA 3IKVA 2P6SA 1ZGJA 4I0AA 1OPCA 3DKWA 3HHHA 1LEBA 3BJ6A 2OAZA 4ENNA 3BPXA 1IXCA 4HF1A 1S8NA 4HV5A 4Y15A 3SFZA 3WE2A 4OIPF 2A69F 4RAYA 2VE9A 1T98A 2DT5A 4U0VA 5FFZA 2RKHA 3KZYA 4G9YA 4MEYF 1G3YA 4HOBA 2CYYA 1J59A 2DU9A 4ZYGA 1JHHA 2OU2A 2G9WA 1R00A 2BYVE 1MDMB 4GYGA 3H3UA 4S05A 4G7OF 4IXAA 2DPDA 2EFWA 4WXCA 4I98B 1U3EM 5EEHA 2VOPA 3CLOA 2PJPA 5CVIA 2W24A 1SFXA 5L3EA 2P5LC 3SHFA 3CTAA 3SQNA 5CVRA 5HS7A 3U2RA 3PQKA 4Q47A 3VODA 4P55A 4AIKA 3MQ0A 2HYFA 1LNWA 1ZRFA 4EM1A 5E17F 5E8GA 5LGUA 2A6HF 4N9IA 3F3XA 5J8FA 4S04A 3ERED 2BE5F 3FM5A 3GZ6A 3HTSB 3E5XA 3F8CA 1O7FA 1U5TB 2RGVA 2QUFA 3QAHA 4HF2A 3RYRA 1ZG1A 4ESBA 2QZ8A 2LKPA 4PGHA 3D5LA 2HWVA 4LK0F 1FP2A 2CWEA 2D1VA 1IN8A 1T0FA 2Z33A 4Q4ZF 3BPVA 2EFPA 3JAMZ 1IRFA 3RKXA 3CUQC 4I09A 4ESJA 2GA1A 4LK1F 2IA0A 4ENMA 2XUBA 1LDDA 3GEZA 4LFUA 1BC8C 4M9ZA 3HRSA 3IHUA 5J8CA 3MFKA 2W85A 3K2ZA 3LAJA 2STWA 3E6DA 3F21A 3GO5A 1J75A 1F1ZA 2QBYA 4IPAA 3TQNA 3MZYA 2PMUA 4OIRF 2V1XA 2A68F 4PZJA 5BQTA 5DCMA 2VBYA 4IRGA 5AONA 3ISPA 1ZARA 2DBBA 1YYVA 1YTYA 5K5QA 2LSOA 2VT3A 4L9NA 5IT9K 3JSOA 1QZZA 1XMAA 5D5WB 2XVCA 2W84A 4Y17A 2NS0A 2MC3A 1FLIA 1P4XA 4BH9A 1OMIA 2L3DA 1T6SA 1W4MA 2DQLA 3E3VA 1R22A 3BDDA 4EQQA 3H92A 1SFUA 4P5OA 3ZMDA 1K79A 3V7CA 1TW2A 3DFGA 4HDVA 1IAWA 2Y48A 4H0EA 3KLOA 1SD6A 2CW0F 1ZN2A 2GXGA 1ZG5A 1D8KA 2MBFA 1IN5A 2RN7A 4KMUX 2WV0A 4HW0A 1OR7A 3FWEA 2DTRA 1U5TC 1MZBA 3LAPA 3CO7C 1S3JA 3GWZA 2K4BA 3WGHA 4L0ZB 4LGWA 4BHBA 3HHGA 4IRIA 4NQWA 3FHZA 2V1DA 2F2EA 2QQ9A 3RPQA 3TO6A 3E5UA 3Q9VA 4AD9A 5D5VB 2GWRA 1IUYA 4IJAA 4HQMA 5L3CA 4RGSA 4L18B 1LDJA 1Z91A 2OA4A 4IVNA 5LRSA 3HIFA 4GO1A 4A5NA 1U2WA 2HTSA 3KP7A 1J9IA 4WWCA 1OKRA 3VOEA 3EQLF 4EMSA 3VB2A 2EK5A 2XHKA 4GCVA 1KU2A 3KP5A 5H20A 3GX4X 4OMYA 1O3TA 1W7PA 3CJNA 1TNSA 1W5TA 4G94A 2P4WA 1FSHA 3RKWA 4I01A 2XROA 3K1PA 3CO6C 3DF8A 3IWZA 1T38A 2IVMA 3LQRA 5BPIA 4A0YA 1WSUA 2BGCA 3BP8A 2M30A 5FFXA 1KA8A 4E70A 2GAUA 4MQ9F 1J2XA 4UVBA 3ELKA 3WGGA 4MQVA 5LHIA 5DV5A 5L3FA 4LD5A 1U6GA 1ZG3A 3COAC 2VBWA 3I54A 4JQFA 1R36A 4KIBA 2MH2A 5LLQA 1K78A 3I59B 2P5VA 2KJBA 1XSDA 2IJLA 2K27A 1YS6A 3E97A 2MLGA 2K7LA 4UV9A 1GHCA 5ICCA 5LGTA 4M73A 2QYOA 1HW5A 2Y0MA 3VFZA 2E1NA 2FF4A 4LLNA 4CYDA 4OMZA 2STTA 1KQ0A 5F64A 3IRQA 2XAJA 4GXOA 5J6XA 5JR3A 1D5VA 4LG0A 2MLKA 2EV6A 4CICA 1MGTA 1ZLKA 3KLNA 1TQIA 3KZZA 2MA3A 2MH9A 1K7AA 1DPRA 4NB5A 2R7DA 3N4MA 3WODF 2OBPA 3RPUA 4HX7A 2DQRA 1XGSA 2X4HA 3J81Z 5E1WA 3KE2A 1SD5A 1BI3A 3SZTA 1OYWA 1HW1A 1EH6A 1W7PD 1STZA 4ASNA 2JRTA 5BOXA 2P7VB 2FNAA 3AAFA 3F8NA 4ESFA 3KFWX 1I5ZA 3REOA 1FOKA 2A07F 2VE8A 4KICA 6PAXA 3IKTA 2IA1A 4LLGF 2EFNA 5HDNA 1SMTA 3QU3A 3GXOA 1J7KA 3C1DA 4MHGA 1KU9A 4BXUA 4U88A 3R6SA 4JBAA 3DQVC 2VOOA 2MD5A 5D6EA 2O03A 1U78A 1FNNA 3MAJA 4UNOA 2CG4A 4XRFA 1E17A 1IRGA 5FLXK 2JT1A 2K86A 2XIGA 1FY7A 3KP6A 3LA7A 4LMYA 2OD5A 2H94A 1FP1D 3HSFA 3QOPA 2QQAA 1LB2A 3DPLC 2YU3A 2QWWA 3HRMA 4UVCA 3BJOA 2Q2EA 4HX8A 1TW3A 1IW7F 1HKSA 1SD4A 1R1UA 3HUGA 3ABUA 1XGNA 3HSEA 3JAMK 3JSPA 3KEQA 3R0JA 4MGRA 1Z6RA 4O3MA 5L3GA 1QZYA 2YPRA 3SXYA 4L5JA 4IHTA 1DDNA 1QO0D 4KIFA 1LJ9A 4OU0A 2CQKA 5E8IA 3KP2A 5E18F 1FT9A 3GLXA 2HYGD 3QPHA 5H6QA 2NRAC 4LB5A 2EA2A 3ROUA 4L5IA 2VBXA 2DK5A 1XB4A 2CFXA 1O7LA 5D6FA 4EM2A 4HF0A 1G3TA 1ZREA 4WXDA 3GZ5A 1QNTA 1YS7A 2Q8KA 4JK1X 4Y13A 5KVRA 1FYLA 3B73A 5FB2A 5HOOA 1F4KA 5H6RA 4RB2C 4FHTA 3GFMA 3CDHA 2L01A 1G4DA 2YSRA 1R1VA 1QGPA 2O0YA 2WTEA 3L7WA 1CF7A 3K69A 4ENKA 1NHAA 1DP7P 2UZKA 1USTA 1YO5C 1R7JA 3ZN0A 2PBIA 1TQMA 1XN7A 5CVVA 4HBLA 1BI0A 1EV7A 3SZPA 3V4GA 2FMYA 4XSZF 4UVAA 3WG9A 1XD7A 1G3WA 2RNJA 2XAGA 3EUHA 1X3UA 4I7HA 2ISYA 2Q0OA 5FD5A 2ZNYA 5CVUA 2IRFG 3WU1B 2QLZA 1BN5A 1GVJA 3TO7A 4L9TA 1HBXG 2QVOA 1YLFA 4ZH4F 1AOYA 2VC0A 5DEQA 1XDUA 5L3BA 4CDGA 1IN4A 3M7GA 3W6KB 3GVAA 3QP6A 4N0BA 1O3RA 3DV8A 2VN2A 2FU4A 1U8RA 4EJOA 4M71A 1HKTA 3J80Z 3GF2A 1P4WA 1R58A 4M6YA 3LA3A 5HS8A 4G6QA 1RIOH 3KP4A 2ZXJA 3WTYC 1PDNC 3FM3A 4ETSA 2COMA 4RB0A 2ZO4A 3LWFA 1O3QA 4NHJA 5CVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTD A;  5HLG A;  3DXJ F;  1FWZ A;  2FEZ A;  5CLS A;  1S7A A;  3WTT C;  5D8L B;  3RKY A;  2BV6 A;  2NYX A;  1BC7 C;  3FXU A;  3WTZ A;  5LEJ A;  1FBS A;  2XAF A;  1LEA A;  1I1G A;  3P9C A;  3BZ6 A;  4FX4 A;  2O8X A;  3BJA A;  4FT8 A;  1H9T A;  2WC2 A;  2YX4 A;  1BI2 A;  4EM0 B;  1MJ9 A;  2ISZ A;  2XAS A;  3LA2 A;  1XGM A;  2L4M A;  4G6D A;  1HST A;  3HTU A;  5AIQ A;  2J5O A;  3V8L A;  4U0Y A;  2M87 A;  2NAZ A;  1BJA A;  3EYI A;  3U1D A;  5F1R A;  4MEX F;  3F8F A;  3O6B B;  2ZJ2 A;  4BHP A;  3ZMV A;  4Q5S F;  1IZ1 A;  3I5U A;  4G8X A;  2DK8 A;  2HTJ A;  2ETH A;  1YW7 A;  2LNB A;  1UHW A;  3F22 A;  1S6L A;  1YW9 A;  2Z99 A;  4KFC A;  4WXH A;  2KIU A;  2ZME A;  2DAO A;  3M8F A;  2H09 A;  4GGG A;  2UWM A;  1KQ9 A;  2YR2 A;  2FNP A;  2NNN A;  3LFK A;  2EV0 A;  4LJZ F;  5HLH A;  1BIB A;  2EFO A;  3QU6 A;  1Y0U A;  4M9X A;  1F9N A;  4LB6 B;  2ZKZ A;  2QBY B;  5IT9 Z;  2E1C A;  1JHF A;  1BIA A;  3K1N A;  3I4P A;  1P4A A;  2CSO A;  4L9V A;  1RI7 A;  2XKO A;  4RB3 C;  3U9G A;  4OIQ F;  1LDK B;  2KKO A;  2EFQ A;  4ZYE A;  1H0M A;  4U7B A;  2HEO A;  4HZF A;  2XGX A;  3NEU A;  3L2C A;  5BS6 A;  2R3S A;  3GW2 A;  3N97 A;  2IP2 A;  2K4J A;  1B9N A;  4U0W A;  3FMQ A;  4O5V A;  3HRT A;  3O2P E;  5HLI A;  2DI3 A;  5LHG A;  1ZYR F;  1EH7 A;  1MKM A;  3TDZ C;  5LGN A;  2OZ6 A;  1L3L A;  4A6E A;  3I64 A;  4A2U A;  2HQR A;  4QWQ A;  3T8R A;  1ULY A;  3T0Y A;  1PP7 U;  3ZMS A;  3T8T A;  5TRD A;  1XDS A;  4RGR A;  1QPM A;  1TTY A;  4HAM A;  3OOP A;  4EJW A;  5DYM A;  3R60 A;  1FC3 A;  3CUQ A;  4K2E A;  4UV8 A;  4EGZ A;  1RZ4 A;  1WQ2 A;  3RJP A;  5A2Q K;  4WX9 A;  2XV4 S;  5F6F A;  5K5O A;  2FQ3 A;  5CJ9 A;  3GFI A;  2HS5 A;  1YG2 A;  4ZYD A;  2PI0 A;  1VTN C;  2UXN A;  2VOD A;  3IRR A;  1TLH B;  4R1H A;  2EWN A;  4WCG A;  3FXQ A;  5DDG A;  4FX0 A;  2E7W A;  2YX7 A;  1JGS A;  5LEK A;  4EJU A;  2HFH A;  4Q48 A;  2HKX A;  2JSC A;  1S7O A;  1R1T A;  1UB9 A;  2M45 A;  4RGX A;  5D4R A;  1B6A A;  2UXX A;  2ELH A;  2KIF A;  1GXQ A;  3F8B A;  1MDM A;  1D8J A;  2JZY A;  3JW4 A;  4IHS A;  3WTW C;  1R5G A;  2IT0 A;  2O6G E;  3ECH A;  5ILU A;  4HQE A;  4TV7 A;  1IXR C;  3K9T A;  3HOS A;  4M6X A;  5L3D A;  5HDG A;  1ZGA A;  3C3W A;  4IF4 A;  2QM3 A;  5DCF A;  2F5E A;  1K6O A;  4OOI A;  3MCZ A;  4KNY A;  1J0R A;  2PQ8 A;  3R0A A;  3P9K A;  2LDU A;  1T2K A;  4P96 A;  2Z9O A;  2DW4 A;  1SFE A;  4UXN A;  3F8M A;  4YFX F;  5JI6 A;  1IN7 A;  2JTV A;  5CYV A;  2GQQ A;  2EV5 A;  1R23 A;  2NNY A;  1BM9 A;  2G7U A;  4N9H A;  2FXA A;  4I02 A;  2LF7 A;  4YFK F;  1Z6T A;  2QEN A;  1XSV A;  1U5T A;  2C6Y A;  1ZLJ A;  5IT3 A;  2OQG A;  3M1E A;  2VC1 A;  2PN6 A;  2VT2 A;  1PUE E;  5BPD A;  4R79 A;  1MJA A;  3KET A;  1B4A A;  4WK8 F;  4Z2Y A;  4KIG A;  1K78 B;  2RDP A;  4B09 A;  3WU0 A;  2R7F A;  4M74 A;  3HRU A;  1UFM A;  3GFL A;  2DO7 A;  2IPQ X;  4BNC A;  3J7A O;  1E2X A;  1C0W A;  1L0O C;  3VEP A;  3LST A;  4I2O A;  5ICF A;  3WTV C;  1HW2 A;  4BYY A;  3JTH A;  1ON1 A;  1Z05 A;  2AXL A;  2M5W A;  3ABT A;  3MEX A;  1BI1 A;  1EH8 A;  1ON2 A;  1DPU A;  2W57 A;  1B59 A;  4LG0 B;  2AS5 F;  4YG2 F;  2PLY A;  1ZHF A;  5DUK A;  3WTX C;  3E5Q A;  5FO5 A;  1TNT A;  2HZT A;  2Z3Y A;  1P2F A;  1KU7 A;  2XAH A;  2H6C A;  3G73 A;  1O3S A;  4CGZ A;  5EEG A;  3J80 K;  5E1Z B;  1CGP A;  3M8E A;  4P9F A;  4EGY A;  2D1H A;  1B1B A;  2FML A;  4LLL A;  4AIH A;  4KYW A;  2A61 A;  5JHU A;  2M8E A;  4UUV A;  4AVP A;  1HKQ A;  1YW8 A;  3ZMZ A;  5DD8 A;  3E6B A;  4KN7 X;  1ODD A;  4P9U A;  3K1M A;  3E6C C;  3RYP A;  2M1B A;  4RAZ A;  4ZZD A;  4KDP A;  1OYY A;  4D0P A;  2HR3 A;  1I1S A;  4PCQ A;  3NQO A;  2EB7 A;  2ZBK A;  2ADU A;  2FBH A;  2GZW A;  3HYI A;  3FXR A;  4PDK A;  1S29 A;  3TOA A;  3F23 A;  1IXS B;  4HYE A;  2KIM A;  3E6M A;  3JTG A;  3DEU A;  5FLX Z;  3WGI A;  2CO5 A;  4F7Z A;  5HVQ C;  1HXD A;  2G7H A;  3PQJ A;  1G6N A;  4KT5 C;  3F6V A;  4BQA A;  4HX4 A;  3EET A;  5ICE A;  3F72 A;  2E7X A;  1FZP B;  3Q9S A;  2ESH A;  2ZFW A;  5D5U B;  1KU3 A;  2PG4 A;  2EA4 A;  1QQI A;  2XAQ A;  1TQP A;  3FF5 A;  2FA5 A;  2K02 A;  3EDP A;  1DUX C;  2PFB A;  3L09 A;  5HDK A;  4L0Y B;  2P7C B;  3TGN A;  2DLL A;  1JE8 A;  1USS A;  4XLN F;  1OYI A;  2VXZ A;  2JPB A;  2HQN A;  3RIR A;  2A3S A;  1KQ8 A;  3CUO A;  5FD6 A;  5LHH A;  2PEX A;  2P5K A;  3TO9 A;  5D8K B;  4AWX B;  1SAX A;  5D5X B;  1Q1H A;  2EJR A;  2HKO A;  1SD7 A;  2WWY A;  1LQ1 A;  3ZQ7 A;  1T39 A;  3WTU C;  2GXB A;  3I0T A;  3P7N A;  1I6X A;  2HGC A;  3DP7 A;  3ZMU A;  2VON A;  3BY6 A;  2D45 A;  4G7Z F;  3NRV A;  1F5T A;  2V79 A;  4DQ2 A;  4KA4 A;  3F6O A;  2GIV A;  2OQR A;  1AWC A;  2L54 A;  3O3K A;  4HA8 A;  3HOT A;  4OIO F;  1P92 A;  1GXP A;  3BRO A;  3I59 A;  3QP5 A;  1CF7 B;  2XKP A;  3IL2 A;  2OZU A;  5AIP A;  3MWM A;  5JFR A;  1XCB A;  3H3Z A;  4R8H A;  3S2W A;  1FYM A;  5ERI A;  2FBI A;  3ZN1 A;  3GYH X;  4ZZL A;  5ICG A;  1FBQ A;  2F5F A;  2X0L A;  5LRR A;  3V8K A;  3T1B A;  3RTR A;  3B02 A;  1Z1D A;  1BOA A;  4PGG A;  1SMY F;  1ZAO A;  4AIJ A;  1V3F A;  2F5D A;  4RS8 A;  3BWG A;  1ZRC A;  1LVA A;  4HV6 A;  4I0B A;  1TBX A;  2V6C A;  1ZH5 A;  2Z5U A;  5D4S A;  5DD4 A;  1KGS A;  3V7S A;  5K1Y A;  2FE3 A;  3R61 A;  3R4K A;  3LQQ A;  2B0L A;  3ZP5 A;  1HSJ A;  4EJT A;  1FYK A;  3OV8 A;  3TKY A;  1RUO A;  3GFJ A;  3IC7 A;  4G7H F;  3TOB A;  1QBJ A;  4XBF A;  1MD0 A;  3M9A A;  1XMK A;  1XGO A;  1YQA A;  2V9V A;  3G3Z A;  1Z9C A;  1O57 A;  5DCM B;  2ACJ A;  4BHC A;  3J81 K;  1H9G A;  3I58 A;  1YIO A;  1A04 A;  4A5M A;  3TDU C;  1R5H A;  4CHU A;  4M72 A;  3V7R A;  2A6E F;  3ULQ B;  1UHM A;  2ESN A;  3L00 A;  3I71 A;  3ZMT A;  3ECO A;  5ILV A;  4YFN F;  3FZV A;  1V4R A;  1FBU A;  3P9I A;  5TJJ A;  3BOQ A;  2BEO A;  4ENJ A;  4O6J A;  3KEO A;  2BBY A;  1FX7 A;  1REP C;  4HLX A;  2HDC A;  4ZYH A;  2H6B A;  5ILS A;  4A6D A;  1XCV A;  4CXF A;  4A0X A;  3RDI A;  2FBK A;  2QQB A;  2H27 A;  2ZNZ A;  3KP3 A;  4UHT A;  1WWX A;  2J5P A;  4DNC A;  5K5R A;  3FX3 A;  3WTS C;  2KJC A;  5HS9 A;  2CGP A;  2P6T A;  2O3F A;  4U7D A;  4XLP F;  3C18 A;  1YFH A;  2DPU A;  1UCR A;  4QLC U;  1IF1 A;  3K0L A;  2FRH A;  4BAY A;  2GA2 A;  1Z7U A;  4YIF A;  2L02 A;  1HQC A;  4CZZ A;  3V8J A;  3ZPL A;  3D0S A;  1KYW A;  3Q5F A;  1RUN A;  4WF2 A;  2KRF A;  4KUM A;  5KK1 A;  4YII A;  5LBQ A;  2IW5 A;  1FSE A;  4KN4 X;  2F5C A;  2Y75 A;  1J5Y A;  2L4A A;  2RVC A;  2TDX A;  1D3Y A;  4KMF A;  1B9M A;  1I27 A;  1FPQ A;  3IWF A;  4EVI A;  3RI4 A;  2ZME B;  2P8T A;  2LF8 A;  5FGM A;  1G3S A;  3DPT A;  4HLY A;  5JVT A;  3QRF F;  2IA2 A;  1W7P B;  1ZRD A;  2VBZ A;  3KCC A;  4OIN F;  1IN6 A;  2DFI A;  3WE3 A;  3T5X A;  1RNL A;  1P6R A;  2D2W A;  2ZCW A;  1BBY A;  1WRJ A;  1XSX A;  4B8X A;  5ED4 A;  4RGU A;  3L9F A;  3HSR A;  2JPC A;  4L9J A;  2XRN A;  1JXS A;  1MJB A;  3C7J A;  1PP8 F;  3I53 A;  3FMS A;  3FMR A;  4ON0 A;  2FOK A;  4CO8 A;  4A12 A;  2RV8 A;  1ONV A;  2RC4 A;  3EYY A;  4MTE A;  4IRH A;  1WKM A;  2HOE A;  4EV0 A;  4MNU A;  1W5S A;  2W25 A;  2RQP A;  4GYI A;  4M9S A;  1KYZ A;  4XSX F;  2A5Y B;  2V1U A;  4EJV A;  3GUD A;  2FSW A;  3QPT A;  5E1X A;  3W6J B;  4A0Z A;  4RB1 A;  2PMH A;  5E20 A;  3ML6 A;  5A2Q Z;  4HDU A;  1WI9 A;  2O61 A;  5BMZ A;  3MZH A;  3PFI A;  3CUQ B;  5DUI A;  3IKV A;  2P6S A;  1ZGJ A;  4I0A A;  1OPC A;  3DKW A;  3HHH A;  1LEB A;  3BJ6 A;  2OAZ A;  4ENN A;  3BPX A;  1IXC A;  4HF1 A;  1S8N A;  4HV5 A;  4Y15 A;  3SFZ A;  3WE2 A;  4OIP F;  2A69 F;  4RAY A;  2VE9 A;  1T98 A;  2DT5 A;  4U0V A;  5FFZ A;  2RKH A;  3KZY A;  4G9Y A;  4MEY F;  1G3Y A;  4HOB A;  2CYY A;  1J59 A;  2DU9 A;  4ZYG A;  1JHH A;  2OU2 A;  2G9W A;  1R00 A;  2BYV E;  1MDM B;  4GYG A;  3H3U A;  4S05 A;  4G7O F;  4IXA A;  2DPD A;  2EFW A;  4WXC A;  4I98 B;  1U3E M;  5EEH A;  2VOP A;  3CLO A;  2PJP A;  5CVI A;  2W24 A;  1SFX A;  5L3E A;  2P5L C;  3SHF A;  3CTA A;  3SQN A;  5CVR A;  5HS7 A;  3U2R A;  3PQK A;  4Q47 A;  3VOD A;  4P55 A;  4AIK A;  3MQ0 A;  2HYF A;  1LNW A;  1ZRF A;  4EM1 A;  5E17 F;  5E8G A;  5LGU A;  2A6H F;  4N9I A;  3F3X A;  5J8F A;  4S04 A;  3ERE D;  2BE5 F;  3FM5 A;  3GZ6 A;  3HTS B;  3E5X A;  3F8C A;  1O7F A;  1U5T B;  2RGV A;  2QUF A;  3QAH A;  4HF2 A;  3RYR A;  1ZG1 A;  4ESB A;  2QZ8 A;  2LKP A;  4PGH A;  3D5L A;  2HWV A;  4LK0 F;  1FP2 A;  2CWE A;  2D1V A;  1IN8 A;  1T0F A;  2Z33 A;  4Q4Z F;  3BPV A;  2EFP A;  3JAM Z;  1IRF A;  3RKX A;  3CUQ C;  4I09 A;  4ESJ A;  2GA1 A;  4LK1 F;  2IA0 A;  4ENM A;  2XUB A;  1LDD A;  3GEZ A;  4LFU A;  1BC8 C;  4M9Z A;  3HRS A;  3IHU A;  5J8C A;  3MFK A;  2W85 A;  3K2Z A;  3LAJ A;  2STW A;  3E6D A;  3F21 A;  3GO5 A;  1J75 A;  1F1Z A;  2QBY A;  4IPA A;  3TQN A;  3MZY A;  2PMU A;  4OIR F;  2V1X A;  2A68 F;  4PZJ A;  5BQT A;  5DCM A;  2VBY A;  4IRG A;  5AON A;  3ISP A;  1ZAR A;  2DBB A;  1YYV A;  1YTY A;  5K5Q A;  2LSO A;  2VT3 A;  4L9N A;  5IT9 K;  3JSO A;  1QZZ A;  1XMA A;  5D5W B;  2XVC A;  2W84 A;  4Y17 A;  2NS0 A;  2MC3 A;  1FLI A;  1P4X A;  4BH9 A;  1OMI A;  2L3D A;  1T6S A;  1W4M A;  2DQL A;  3E3V A;  1R22 A;  3BDD A;  4EQQ A;  3H92 A;  1SFU A;  4P5O A;  3ZMD A;  1K79 A;  3V7C A;  1TW2 A;  3DFG A;  4HDV A;  1IAW A;  2Y48 A;  4H0E A;  3KLO A;  1SD6 A;  2CW0 F;  1ZN2 A;  2GXG A;  1ZG5 A;  1D8K A;  2MBF A;  1IN5 A;  2RN7 A;  4KMU X;  2WV0 A;  4HW0 A;  1OR7 A;  3FWE A;  2DTR A;  1U5T C;  1MZB A;  3LAP A;  3CO7 C;  1S3J A;  3GWZ A;  2K4B A;  3WGH A;  4L0Z B;  4LGW A;  4BHB A;  3HHG A;  4IRI A;  4NQW A;  3FHZ A;  2V1D A;  2F2E A;  2QQ9 A;  3RPQ A;  3TO6 A;  3E5U A;  3Q9V A;  4AD9 A;  5D5V B;  2GWR A;  1IUY A;  4IJA A;  4HQM A;  5L3C A;  4RGS A;  4L18 B;  1LDJ A;  1Z91 A;  2OA4 A;  4IVN A;  5LRS A;  3HIF A;  4GO1 A;  4A5N A;  1U2W A;  2HTS A;  3KP7 A;  1J9I A;  4WWC A;  1OKR A;  3VOE A;  3EQL F;  4EMS A;  3VB2 A;  2EK5 A;  2XHK A;  4GCV A;  1KU2 A;  3KP5 A;  5H20 A;  3GX4 X;  4OMY A;  1O3T A;  1W7P A;  3CJN A;  1TNS A;  1W5T A;  4G94 A;  2P4W A;  1FSH A;  3RKW A;  4I01 A;  2XRO A;  3K1P A;  3CO6 C;  3DF8 A;  3IWZ A;  1T38 A;  2IVM A;  3LQR A;  5BPI A;  4A0Y A;  1WSU A;  2BGC A;  3BP8 A;  2M30 A;  5FFX A;  1KA8 A;  4E70 A;  2GAU A;  4MQ9 F;  1J2X A;  4UVB A;  3ELK A;  3WGG A;  4MQV A;  5LHI A;  5DV5 A;  5L3F A;  4LD5 A;  1U6G A;  1ZG3 A;  3COA C;  2VBW A;  3I54 A;  4JQF A;  1R36 A;  4KIB A;  2MH2 A;  5LLQ A;  1K78 A;  3I59 B;  2P5V A;  2KJB A;  1XSD A;  2IJL A;  2K27 A;  1YS6 A;  3E97 A;  2MLG A;  2K7L A;  4UV9 A;  1GHC A;  5ICC A;  5LGT A;  4M73 A;  2QYO A;  1HW5 A;  2Y0M A;  3VFZ A;  2E1N A;  2FF4 A;  4LLN A;  4CYD A;  4OMZ A;  2STT A;  1KQ0 A;  5F64 A;  3IRQ A;  2XAJ A;  4GXO A;  5J6X A;  5JR3 A;  1D5V A;  4LG0 A;  2MLK A;  2EV6 A;  4CIC A;  1MGT A;  1ZLK A;  3KLN A;  1TQI A;  3KZZ A;  2MA3 A;  2MH9 A;  1K7A A;  1DPR A;  4NB5 A;  2R7D A;  3N4M A;  3WOD F;  2OBP A;  3RPU A;  4HX7 A;  2DQR A;  1XGS A;  2X4H A;  3J81 Z;  5E1W A;  3KE2 A;  1SD5 A;  1BI3 A;  3SZT A;  1OYW A;  1HW1 A;  1EH6 A;  1W7P D;  1STZ A;  4ASN A;  2JRT A;  5BOX A;  2P7V B;  2FNA A;  3AAF A;  3F8N A;  4ESF A;  3KFW X;  1I5Z A;  3REO A;  1FOK A;  2A07 F;  2VE8 A;  4KIC A;  6PAX A;  3IKT A;  2IA1 A;  4LLG F;  2EFN A;  5HDN A;  1SMT A;  3QU3 A;  3GXO A;  1J7K A;  3C1D A;  4MHG A;  1KU9 A;  4BXU A;  4U88 A;  3R6S A;  4JBA A;  3DQV C;  2VOO A;  2MD5 A;  5D6E A;  2O03 A;  1U78 A;  1FNN A;  3MAJ A;  4UNO A;  2CG4 A;  4XRF A;  1E17 A;  1IRG A;  5FLX K;  2JT1 A;  2K86 A;  2XIG A;  1FY7 A;  3KP6 A;  3LA7 A;  4LMY A;  2OD5 A;  2H94 A;  1FP1 D;  3HSF A;  3QOP A;  2QQA A;  1LB2 A;  3DPL C;  2YU3 A;  2QWW A;  3HRM A;  4UVC A;  3BJO A;  2Q2E A;  4HX8 A;  1TW3 A;  1IW7 F;  1HKS A;  1SD4 A;  1R1U A;  3HUG A;  3ABU A;  1XGN A;  3HSE A;  3JAM K;  3JSP A;  3KEQ A;  3R0J A;  4MGR A;  1Z6R A;  4O3M A;  5L3G A;  1QZY A;  2YPR A;  3SXY A;  4L5J A;  4IHT A;  1DDN A;  1QO0 D;  4KIF A;  1LJ9 A;  4OU0 A;  2CQK A;  5E8I A;  3KP2 A;  5E18 F;  1FT9 A;  3GLX A;  2HYG D;  3QPH A;  5H6Q A;  2NRA C;  4LB5 A;  2EA2 A;  3ROU A;  4L5I A;  2VBX A;  2DK5 A;  1XB4 A;  2CFX A;  1O7L A;  5D6F A;  4EM2 A;  4HF0 A;  1G3T A;  1ZRE A;  4WXD A;  3GZ5 A;  1QNT A;  1YS7 A;  2Q8K A;  4JK1 X;  4Y13 A;  5KVR A;  1FYL A;  3B73 A;  5FB2 A;  5HOO A;  1F4K A;  5H6R A;  4RB2 C;  4FHT A;  3GFM A;  3CDH A;  2L01 A;  1G4D A;  2YSR A;  1R1V A;  1QGP A;  2O0Y A;  2WTE A;  3L7W A;  1CF7 A;  3K69 A;  4ENK A;  1NHA A;  1DP7 P;  2UZK A;  1UST A;  1YO5 C;  1R7J A;  3ZN0 A;  2PBI A;  1TQM A;  1XN7 A;  5CVV A;  4HBL A;  1BI0 A;  1EV7 A;  3SZP A;  3V4G A;  2FMY A;  4XSZ F;  4UVA A;  3WG9 A;  1XD7 A;  1G3W A;  2RNJ A;  2XAG A;  3EUH A;  1X3U A;  4I7H A;  2ISY A;  2Q0O A;  5FD5 A;  2ZNY A;  5CVU A;  2IRF G;  3WU1 B;  2QLZ A;  1BN5 A;  1GVJ A;  3TO7 A;  4L9T A;  1HBX G;  2QVO A;  1YLF A;  4ZH4 F;  1AOY A;  2VC0 A;  5DEQ A;  1XDU A;  5L3B A;  4CDG A;  1IN4 A;  3M7G A;  3W6K B;  3GVA A;  3QP6 A;  4N0B A;  1O3R A;  3DV8 A;  2VN2 A;  2FU4 A;  1U8R A;  4EJO A;  4M71 A;  1HKT A;  3J80 Z;  3GF2 A;  1P4W A;  1R58 A;  4M6Y A;  3LA3 A;  5HS8 A;  4G6Q A;  1RIO H;  3KP4 A;  2ZXJ A;  3WTY C;  1PDN C;  3FM3 A;  4ETS A;  2COM A;  4RB0 A;  2ZO4 A;  3LWF A;  1O3Q A;  4NHJ A;  5CVJ A; 
#chains in the Genus database with same CATH topology
 4NNJ A;  2MC4 A;  1QVT A;  4MTD A;  2CUZ A;  5HLG A;  3DXJ F;  1FWZ A;  2FEZ A;  3OYC A;  5CLS A;  1S7A A;  3A4C A;  1RC9 A;  2OPT A;  2G0E A;  3WTT C;  5D8L B;  3RKY A;  1UJ8 A;  2K9N A;  1E3H A;  2BV6 A;  2NYX A;  3HOX J;  4XOR A;  1YHQ I;  3FXU A;  1BC7 C;  3CD6 I;  5BNG A;  3WTZ A;  5LEJ A;  2R7Q A;  1FBS A;  2XAF A;  1LEA A;  1I1G A;  3P9C A;  3BZ6 A;  1RRJ A;  1QVU A;  4FX4 A;  2O8X A;  3BJA A;  2ECB A;  4FT8 A;  3EUK L;  1H9T A;  2HXI A;  2LLK A;  2WC2 A;  2YX4 A;  1BI2 A;  4Y3O A;  4EM0 B;  1MJ9 A;  4D7M A;  2K9S A;  1UAA A;  3QPS A;  1RES A;  3W2A A;  2ISZ A;  3IAS 2;  1Y8Q B;  2XAS A;  3IH4 A;  3U21 A;  3LA2 A;  1ENH A;  1XGM A;  2L4M A;  2Z2S B;  3FXJ A;  4G6D A;  1HST A;  2ZXW H;  3BR5 A;  3QPL A;  3S1R J;  2O8K A;  3HTU A;  5AIQ A;  2RAE A;  3OYL A;  2J5O A;  3V8L A;  2MAB A;  4U0Y A;  2M87 A;  2NAZ A;  1BJA A;  1XX5 A;  2DJN A;  2WBM A;  3RCO A;  3EYI A;  3U1D A;  1JTY A;  5F1R A;  4MEX F;  5K7Z A;  2CV0 A;  2EIJ H;  2HU9 A;  3F8F A;  3O6B B;  2ZJ2 A;  1WJD A;  4BHP A;  2CQQ A;  1OCR H;  3ZMV A;  1A35 A;  4Q5S F;  1IZ1 A;  3I5U A;  1SVL A;  3G1O A;  1X3W B;  1PUF A;  1POG A;  1ACI A;  1S7E A;  4G8X A;  1X1B A;  2DK8 A;  3VPR A;  2HTJ A;  2ETH A;  2VJ5 A;  1YW7 A;  2LNB A;  1UHW A;  2E2J J;  2DN0 A;  3F22 A;  1S6L A;  1YW9 A;  2Z99 A;  3KYL A;  4B43 A;  4KFC A;  1JTX A;  4WXH A;  2KIU A;  2ZME A;  2DAO A;  3M8F A;  2H09 A;  4GGG A;  1MMS A;  2UWM A;  1KQ9 A;  2YR2 A;  2GXA A;  2FNP A;  2NNN A;  3LFK A;  3NWT A;  2EV0 A;  5IYB J;  4LJZ F;  4HNV A;  2BHY A;  5HLH A;  2WY7 Q;  1BIB A;  2EFO A;  3RSN A;  3QU6 A;  2YU9 J;  1Y0U A;  5GAG J;  1VQM I;  4M9X A;  1F9N A;  3OL4 A;  4BQN A;  1WJ5 A;  3SZG A;  4LB6 B;  2LYC A;  2ZKZ A;  2QBY B;  5IT9 Z;  2E1C A;  5M5Y J;  1JHF A;  3MKY B;  1IO2 A;  1BIA A;  4F52 A;  4BJ6 C;  3K1N A;  2IXS A;  3I4P A;  1P4A A;  4X0G A;  2CSO A;  2FOW A;  1MMN A;  2OCE A;  4L9V A;  1RI7 A;  3GTO J;  2IGN A;  2XKO A;  4RB3 C;  3U9G A;  3OWT A;  2R92 J;  3L2W A;  4OIQ F;  2ZSI B;  1UEL B;  1WJF A;  1TWC J;  3BG7 A;  1HOM A;  1LDK B;  2VAS A;  3DTK A;  2KKO A;  3BZC A;  1VQ6 I;  2EFQ A;  4ZYE A;  1H0M A;  4U7B A;  1W5C C;  2DFF A;  2M34 A;  4F55 A;  2Y30 A;  2XGX A;  4HZF A;  3DU6 A;  3NEU A;  3L2C A;  5BS6 A;  2R3S A;  3I4M J;  1X1C A;  3GW2 A;  3M4O J;  3N97 A;  2IP2 A;  2K4J A;  1B9N A;  4U0W A;  3FMQ A;  4O5V A;  4E7S A;  3GTJ J;  1TWH J;  3HRT A;  2XAU A;  3O2P E;  5HLI A;  2DI3 A;  3HZJ A;  4FAS D;  3LSJ A;  5LHG A;  1ZYR F;  3LL7 A;  4B3A A;  1EH7 A;  1MKM A;  2BY1 A;  3TDZ C;  5LGN A;  2JA7 J;  5FRN A;  2OZ6 A;  2RQQ A;  1L3L A;  4A6E A;  3I64 A;  4A2U A;  2HQR A;  4QWQ A;  3T8R A;  1SFO J;  2XPV A;  2R7R A;  3UKG A;  5IP9 J;  1ETQ A;  1T56 A;  4FIS A;  1BR2 A;  4RAF A;  1ULY A;  3T0Y A;  1PP7 U;  3ZMS A;  1WJC A;  3IP4 B;  5F0C A;  5IYD J;  3T8T A;  2BOL A;  4IOC F;  1YJ9 I;  1QPI A;  2ZB9 A;  1A6I A;  5TRD A;  3F9K A;  2KHM A;  1XDS A;  4RGR A;  1QPM A;  1TTY A;  1K4S A;  4HAM A;  3OOP A;  4AUX A;  4EJW A;  4BDZ A;  4IO9 F;  5DYM A;  3R60 A;  5EG0 B;  2XB0 X;  1FC3 A;  1OCP A;  3CUQ A;  4K2E A;  4UV8 A;  4EGZ A;  1RZ4 A;  3S3O A;  3FXO A;  5E3M A;  3ZCO A;  4UY8 I;  2L7M P;  1WQ2 A;  2VKH A;  3K70 D;  2NOJ B;  4FE4 A;  3RJP A;  2M8G X;  5A2Q K;  4WX9 A;  2XV4 S;  5F6F A;  5FLM J;  4EAT A;  5K5O A;  2W48 A;  2FQ3 A;  4PFP A;  5CJ9 A;  3GFI A;  2HS5 A;  2R5Y A;  1YG2 A;  5GP9 A;  2M9H A;  2WAQ N;  3HGG A;  1T95 A;  4AYB A;  4ZYD A;  2PI0 A;  1VTN C;  4W1U A;  2UXN A;  1X58 A;  3OYB A;  2VOD A;  1MMA A;  3IRR A;  1TLH B;  1T0F C;  2W4S A;  4R1H A;  1FOX A;  1NTC A;  2EWN A;  4WCG A;  2EIM H;  1DU0 A;  3FXQ A;  5DDG A;  3TW7 A;  4FX0 A;  2E7W A;  5EZG A;  3BQY A;  2YX7 A;  1JGS A;  1X2M A;  5LEK A;  4EJU A;  2HFH A;  4Q48 A;  1HDD C;  1Y6I A;  3PL8 A;  4BBR J;  2HKX A;  2JSC A;  1S7O A;  2F5V A;  4CSW A;  3DU5 A;  1Y0N A;  1R1T A;  3F0C A;  4C30 A;  1UB9 A;  2M45 A;  4RGX A;  4M3F A;  5D4R A;  1B6A A;  2UXX A;  2Z1D A;  4BS9 A;  1OFC X;  4BQQ A;  4HNT A;  2ELH A;  2IAI A;  4PUS A;  3K10 A;  2QSG X;  3AG3 H;  1MBK A;  2KIF A;  1GXQ A;  3F8B A;  4BXF A;  1MDM A;  1ETW A;  1D8J A;  2JZY A;  3JW4 A;  5EDN A;  4IHS A;  3WTW C;  1R5G A;  2IT0 A;  2LVS A;  1LFB A;  5J1U A;  3A02 A;  3O8G A;  2O6G E;  3ECH A;  4BY7 J;  3HL2 A;  5ILU A;  4HQE A;  4TV7 A;  1WZ2 A;  2KL4 A;  4ABZ A;  4CYC A;  2HOT A;  2L0K A;  1IXR C;  3K9T A;  1NG7 A;  3HOS A;  1A31 A;  4M6X A;  4A3I J;  5L3D A;  1GT0 C;  3ZOB A;  5HDG A;  1ZGA A;  2K3P A;  3C3W A;  1VI0 A;  4IF4 A;  2QM3 A;  4Y7N J;  5DCF A;  2F5E A;  1Y1W J;  3L2Q A;  4OOI A;  1K6O A;  2HI3 A;  2DA2 A;  2A05 A;  3MCZ A;  3HJE A;  4BDY A;  4KNY A;  4XN0 A;  1J0R A;  1JT6 A;  1YIT I;  4DYQ A;  2PQ8 A;  3CMM A;  3HPH A;  1D5Y A;  2DA4 A;  3R0A A;  3P9K A;  2F6C A;  1TWA J;  3OOU A;  2OCC H;  2LDU A;  2GIZ A;  1T2K A;  4J01 A;  4P96 A;  2Z9O A;  2DW4 A;  3G71 I;  1SFE A;  4UXN A;  1U8B A;  3F8M A;  4YFX F;  5JI6 A;  1IN7 A;  2JTV A;  5CYV A;  2GQQ A;  2EV5 A;  1R23 A;  5B1A H;  3PO2 J;  1VND A;  2NNY A;  1BM9 A;  2G7U A;  4N9H A;  2FXA A;  3H35 A;  4I02 A;  2LF7 A;  4YFK F;  4V19 K;  1Z6T A;  3OIQ A;  3ZRG A;  5IOY A;  2QEN A;  1SFK A;  1XSV A;  1U5T A;  2C6Y A;  1ZLJ A;  1FIP A;  5IT3 A;  2DMP A;  2PMZ A;  3GTP J;  2B63 J;  2OQG A;  3M1E A;  2VC1 A;  3LSR A;  2PN6 A;  2VT2 A;  4XM3 A;  1PUE E;  1LFP A;  5BPD A;  4R79 A;  1Z0X A;  1MJA A;  1AKH A;  3KET A;  1JGG A;  1B4A A;  2XC7 A;  3L1P A;  1MND A;  4WK8 F;  4J19 A;  2W82 A;  4Z2Y A;  1Y56 A;  4KIG A;  2L9N A;  2LTP A;  2BY2 A;  3OS2 A;  1I39 A;  2VQL A;  2FUG 2;  3H5N A;  1K78 B;  2DCE A;  1GUU A;  1OR7 C;  2RDP A;  4L5E A;  3BTI A;  1SAN A;  4B09 A;  2PJR A;  1SAU A;  2R7W A;  3H9G A;  3CMA I;  2QQ8 A;  4XLC A;  2QA4 I;  3WU0 A;  2R7F A;  4M74 A;  5KHD A;  3HOW J;  5F08 A;  2F4I A;  4E7Z A;  3HRU A;  4BEH B;  3OYJ A;  1UFM A;  3GFL A;  2DO7 A;  2EZH A;  2IPQ X;  4BNC A;  1OQY A;  5LFA A;  1FMW A;  3J7A O;  1S9H A;  1E2X A;  1C0W A;  1L0O C;  2E5N A;  3VEP A;  3LST A;  4I2O A;  5ICF A;  3WTV C;  1HW2 A;  3S3N A;  5GAD J;  4BYY A;  3JTH A;  1ON1 A;  1Z05 A;  2K40 A;  4F92 B;  2CU7 A;  2AXL A;  2M5W A;  3ABT A;  2WA0 A;  3MEX A;  4A93 J;  2Y0S N;  5FKN A;  1BI1 A;  2BXZ A;  2EBI A;  1EH8 A;  1ON2 A;  2MGQ A;  3HDD A;  1X2N A;  2OV7 A;  1MBH A;  2CW7 A;  1DPU A;  5F0H A;  2W57 A;  3CME I;  1K83 J;  1N25 A;  3OYM A;  1B59 A;  2IS6 A;  4LG0 B;  2AS5 F;  4YG2 F;  2PLY A;  1ZHF A;  5DUK A;  1IGN A;  3OR2 C;  4QPO A;  3E5Q A;  3OMY A;  3WTX C;  1TP4 A;  5FO5 A;  5IP6 A;  1TNT A;  2HZT A;  2Z3Y A;  1P2F A;  3ZQH A;  1WGX A;  3RQ4 A;  1KU7 A;  2XAH A;  4AC0 A;  2H6C A;  3G73 A;  2GOM A;  2V9P A;  1O3S A;  1VQ8 I;  4CGZ A;  5EEG A;  3J80 K;  4HRI A;  4OAY A;  1HCR A;  5E1Z B;  1CGP A;  2AO9 A;  3IH2 A;  2WV1 A;  4A3J J;  1W36 C;  3M8E A;  2HEO A;  4P9F A;  4EGY A;  2EIL H;  1B1B A;  2D1H A;  2FML A;  4LLL A;  4AIH A;  1XS9 A;  4KYW A;  2A61 A;  3GME A;  3I9V 2;  5JHU A;  2M8E A;  4UUV A;  4AVP A;  5HNF A;  5EF6 A;  3K4B A;  1HKQ A;  1YW8 A;  4Y4R A;  3TW6 A;  3ZMZ A;  4B44 A;  2NVX J;  3B6A A;  5DD8 A;  3E6B A;  4KN7 X;  2R5Z B;  1ODD A;  4E6K G;  5DTD A;  4P9U A;  3K1M A;  3FHN A;  5JVG F;  3E6C C;  1RKW A;  3RYP A;  2EPF A;  2WB1 N;  2M1B A;  2NS8 A;  4RAZ A;  3AFH A;  4OWR B;  4ZZD A;  4D7N A;  4KDP A;  2CJJ A;  3MKW B;  1OYY A;  4D0P A;  2HR3 A;  3OR1 C;  3RKQ A;  1I1S A;  3HKZ N;  4PK4 A;  4ZDP A;  3VYS B;  3W2V A;  2M7B A;  3ZQF A;  5J40 A;  4BAC A;  3OIP A;  1ZR2 A;  2DMU A;  4PCQ A;  5GAH J;  3NQO A;  4HG2 A;  1E3O C;  2XGE A;  1V5E A;  2EB7 A;  2ZBK A;  2E60 A;  1IDZ A;  4DJA A;  1PJR A;  2LP0 A;  2ADU A;  2FBH A;  2GZW A;  3HYI A;  3FXR A;  2UUZ A;  4PDK A;  1S29 A;  2Q1Z B;  3TOA A;  3F23 A;  3LFU A;  1IXS B;  4HYE A;  2KIM A;  3I4N J;  3TP0 A;  3E6M A;  3JTG A;  3DEU A;  3BR6 A;  4QPQ A;  5FLX Z;  2L7F P;  3WGI A;  2HVS A;  2WAF A;  2CO5 A;  3TBI A;  4F7Z A;  4PJM A;  5HVQ C;  1HXD A;  1R5I D;  2G7H A;  4E7H A;  2GBY A;  3PQJ A;  1G6N A;  2KIS A;  4XNF A;  5IPA A;  4ZTF A;  5GAE J;  4KT5 C;  2QKL B;  3F6V A;  2LH9 A;  1B8I B;  4BQA A;  2BW3 B;  4HX4 A;  3EET A;  5EYR A;  3DLL F;  5ICE A;  3F72 A;  4XKW A;  2E7X A;  2MG4 A;  3OIO A;  3Q9S A;  1FZP B;  2ESH A;  2ZFW A;  5D5U B;  2DTZ A;  3K6G A;  1KU3 A;  2PG4 A;  2EA4 A;  1QQI A;  2XAQ A;  4C9Y A;  2JVH A;  1TQP A;  3FF5 A;  1VQN I;  3QYF A;  1WI3 A;  2Q2E B;  4B3X A;  2CW8 A;  1D1C A;  2FA5 A;  4XLE A;  1X1D A;  2CH0 A;  2K02 A;  3EDP A;  4CA0 A;  1DUX C;  2PFB A;  3L09 A;  1CQT A;  5HDK A;  1ZEL A;  4L0Y B;  2P7C B;  4X1E A;  1BA5 A;  3TGN A;  2DLL A;  2LRE A;  3HUG B;  5DM6 F;  4RLQ A;  3L2V A;  4XQF A;  4LIT A;  1W0T A;  3Q0W A;  1JE8 A;  1LE8 B;  1USS A;  4XLN F;  1TWF J;  1W1W E;  3E0J B;  3W3C A;  1OYI A;  2CMP A;  3MKZ A;  4M3B A;  1JUM A;  3GLL A;  1I3A A;  2VXZ A;  4XMY A;  3SEZ A;  3JRB A;  2JPB A;  1HLV A;  3JRD A;  2HQN A;  4BJ5 C;  3RIR A;  2A3S A;  1KQ8 A;  3DPU A;  3CUO A;  1ETK A;  3NAU A;  3CP2 A;  4HST A;  4LG3 A;  5FD6 A;  4G6T B;  5LHH A;  2PEX A;  1YIJ I;  1OCO H;  2P5K A;  1I6H J;  3WG7 H;  3TO9 A;  3BG9 A;  5D8K B;  2E1O A;  3JRF A;  4AWX B;  1SAX A;  5D5X B;  1Q1H A;  2ZXI A;  2EJR A;  2HKO A;  1SD7 A;  2WWY A;  1LQ1 A;  3ZQ7 A;  1T39 A;  3WTU C;  3BC8 A;  3LSK A;  2GXB A;  2KFD A;  3I0T A;  3QOD A;  3P7N A;  1I6X A;  2HGC A;  3DP7 A;  2HXO A;  4D5C A;  4B1R A;  3ZMU A;  1S72 I;  2VON A;  2B9S A;  5E3L A;  3BY6 A;  2D45 A;  4G7Z F;  3NRV A;  4DZJ A;  5HLT A;  3CCR I;  1F5T A;  3CES A;  2V79 A;  4DQ2 A;  4KA4 A;  3F6O A;  2GIV A;  2E2H J;  2ID3 A;  3H5R A;  1IRZ A;  1N78 A;  2OQR A;  1AWC A;  2L54 A;  2YUS A;  1FOW A;  3H5A A;  3O3K A;  4HA8 A;  1JKO C;  2WAE A;  4XN3 A;  3HOT A;  4OIO F;  2XGC A;  1P92 A;  1GXP A;  2GOX B;  3BRO A;  4DW6 A;  4A3C J;  3H9J A;  3I59 A;  3QP5 A;  2DYS H;  1CF7 B;  3BT9 A;  2TCT A;  2XKP A;  1YI2 I;  2COB A;  3IL2 A;  2O5R A;  2HOS A;  3KX2 A;  2OZU A;  1UZC A;  3MWM A;  5AIP A;  1XCB A;  5JFR A;  3H3Z A;  1LFU P;  4R8H A;  5IOZ A;  3S2W A;  1FYM A;  4BJT A;  5ERI A;  3C2B A;  3FK6 A;  4N4O B;  2FBI A;  3ZN1 A;  3GYH X;  4ZZL A;  4AU7 A;  3A0H C;  5K7H A;  4PSW A;  5ICG A;  4IQJ A;  3BCB A;  4CCN A;  1FBQ A;  2F5F A;  2X0L A;  3RZO J;  3BCA A;  5LRR A;  3ZQL A;  3BQZ A;  2BHZ A;  3T1B A;  3V8K A;  3RTR A;  3B02 A;  1Z1D A;  4C3I J;  1BOA A;  4PGG A;  1SMY F;  1ZAO A;  3UR3 C;  4AIJ A;  1V3F A;  3FXK A;  2F5D A;  1Z7L A;  4RS8 A;  3BWG A;  2X1E A;  1ZRC A;  2D5V A;  1LVA A;  4HV6 A;  1EA3 A;  4I0B A;  1TBX A;  3ZXS A;  3BLY A;  1ERD A;  2V6C A;  3LOC A;  2Z5U A;  1ZH5 A;  5D4S A;  5DD4 A;  1KGS A;  3V7S A;  3OYH A;  5K1Y A;  2DJI A;  2FE3 A;  5J1Y A;  3R61 A;  1NG6 A;  1MSE C;  1XG1 A;  3R4K A;  3LQQ A;  5M3F J;  1G8X A;  1T08 B;  2B0L A;  3ZP5 A;  3OL3 A;  1HSJ A;  4EJT A;  3J7A Y;  1SVM A;  1FYK A;  3OV8 A;  4YRV A;  3BTC A;  3TKY A;  1RUO A;  3GFJ A;  1ETO A;  3IC7 A;  2JA6 J;  4A3G J;  3K4C A;  2NVU B;  2FX0 A;  4G7H F;  1XPX A;  3TOB A;  3GTQ J;  3PO3 J;  1QBJ A;  4BE2 A;  1H88 C;  1OJL A;  4XBF A;  1MD0 A;  4Y52 J;  3HEF A;  3M9A A;  2OC6 A;  2O7O A;  3IUO A;  4AID A;  1XMK A;  1XGO A;  1YQA A;  2KDO A;  2V9V A;  2V9K A;  3DBL B;  2JA2 A;  3G3Z A;  1Z9C A;  1O57 A;  1BOB A;  1WH7 A;  5DCM B;  1N77 A;  4IHX A;  4V2G A;  2ACJ A;  4FE7 A;  2M7A A;  4DOZ A;  4BHC A;  4LIU A;  3J81 K;  1IJW C;  1MNM C;  2H1L A;  1H9G A;  5J4V A;  1Y8R B;  2DT6 A;  1B72 A;  3I58 A;  1YIO A;  1A04 A;  2QSF X;  2JQ7 A;  4A5M A;  3M8J A;  1OIS A;  3TDU C;  5B3S H;  1R5H A;  3BZK A;  2IGM A;  2VLA A;  1X19 A;  4CHU A;  2CUJ A;  4M72 A;  3V7R A;  2A6E F;  1SEU A;  3ULQ B;  4CH7 A;  1UHM A;  2ESN A;  2XDV A;  2QSH X;  3L00 A;  2HQ5 A;  2ID6 A;  4RMN A;  5F1J A;  1IRX A;  3I71 A;  2K9L A;  3ZMT A;  3ECO A;  5K7F A;  1QHH D;  5ILV A;  4YFN F;  3FZV A;  1V4R A;  1FBU A;  5TGT A;  1YRN B;  2JMW A;  3P9I A;  5TJJ A;  1YE9 A;  2A5W A;  2JK3 A;  3VYR B;  3BOQ A;  2BEO A;  4ENJ A;  1IC8 A;  1OCT C;  2KLO A;  3CJQ B;  1QHG A;  2L9V A;  4O6J A;  4XKB A;  4XIC A;  3KEO A;  2BBY A;  2AQF A;  1FX7 A;  1REP C;  2DA1 A;  4HLX A;  1Z77 A;  3PNY A;  5F0F A;  2HDC A;  4ZYH A;  1V54 H;  1WHU A;  3LSM A;  2H6B A;  5ILS A;  4XON A;  4A6D A;  1XCV A;  1R4M B;  4CXF A;  4A0X A;  1D1B A;  1VQ9 I;  1HDP A;  3RDI A;  4C3H J;  2FBK A;  2QQB A;  2H27 A;  2ZNZ A;  3KP3 A;  1TL8 A;  4E7K A;  4UHT A;  2W00 A;  1WWX A;  4XLH A;  4BUP A;  3X2Q H;  2J5P A;  4DNC A;  4BQO A;  5K5R A;  2IS4 A;  3FX3 A;  3WTS C;  5GTH C;  3HC7 A;  2KJC A;  2X6Y A;  3PNV A;  2X1D A;  2XGD A;  5HS9 A;  3WHC A;  2DOD A;  1GDT A;  4DGW B;  2CGP A;  3Q0U A;  3LNQ A;  2MYS A;  4DYR A;  2P6T A;  2O3F A;  4U7D A;  4JX5 A;  4BU2 A;  4XLP F;  3S8P A;  1FMV A;  3C18 A;  1YFH A;  3DWL E;  3HOV J;  4A3M J;  2DPU A;  1UCR A;  1I50 J;  4QLC U;  1IF1 A;  3K0L A;  3G1M A;  2FRH A;  4BAY A;  5DM7 F;  2GA2 A;  5FKO A;  2AQE A;  1Z7U A;  4RBO A;  3E1S A;  4NQW B;  2LKX A;  2Y0S A;  4YIF A;  3FDY A;  2L02 A;  4HSR A;  1HQC A;  4B47 A;  1JKQ C;  4PSX A;  3JRA A;  2BVL A;  3EUH C;  3LMM A;  4BL0 B;  4CZZ A;  2ZXH A;  5B1B H;  3V8J A;  3ZPL A;  2XSJ C;  3D0S A;  1KYW A;  2EH3 A;  2CQX A;  4UUT A;  3Q5F A;  1PUF B;  2R0Q C;  1RUN A;  1UHS A;  1J09 A;  4II2 A;  4JP0 A;  2JA5 J;  4WF2 A;  2KRF A;  2KP6 A;  4KUM A;  5KK1 A;  4YII A;  3VDX A;  5LBQ A;  2IW5 A;  3CCL I;  3A03 A;  1FSE A;  5CQG A;  4KN4 X;  2F5C A;  2Y75 A;  4IZZ A;  4A3B J;  1J5Y A;  2L4A A;  2RVC A;  2E2I J;  2TDX A;  1DQU A;  3MMY B;  1D3Y A;  4Y33 A;  4KMF A;  1A36 A;  1B9M A;  1I27 A;  4A3F J;  1VZ0 A;  1FPQ A;  3IWF A;  4EVI A;  4A3E J;  3RI4 A;  2ZME B;  1SC7 A;  2P8T A;  3LSH A;  4E4H A;  2LF8 A;  5FGM A;  1G3S A;  2DFE A;  2X6O A;  3DPT A;  4HLY A;  2KRC A;  2TRT A;  5JVT A;  3QRF F;  2IA2 A;  1IV6 A;  3ABM H;  3CDL A;  5IYC J;  2VI6 A;  1W7P B;  1ZRD A;  2VBZ A;  3KCC A;  1VQL I;  4OIN F;  2CRG A;  1H89 C;  4YEL A;  1IN6 A;  4UUS A;  3S1N J;  4DBR A;  1YX3 A;  4N4N B;  5E3N A;  2DFI A;  3T5X A;  1RNL A;  3WE3 A;  1WH5 A;  2ZC2 A;  2D2W A;  1P6R A;  3HKZ A;  3K4M A;  4OAZ A;  2P0W A;  3FIS A;  2ZCW A;  1BBY A;  5EGO A;  1HA8 A;  1WRJ A;  1XSX A;  4B8X A;  3CCQ I;  1UG0 A;  5ED4 A;  4RGU A;  1KZH A;  3L9F A;  3HSR A;  4UB6 C;  2JPC A;  2HYJ A;  3PSI A;  5B5E C;  1MIJ A;  2LBF A;  3FK7 A;  5M5W J;  3KPH A;  2E35 A;  2GM4 A;  3KIO A;  4MFE A;  4H4K C;  4L9J A;  9ANT A;  2XRN A;  3ASN H;  4DZP A;  1JXS A;  2M3A A;  1YJW I;  1MJB A;  4FCY A;  3G1L A;  3C7J A;  4KIT B;  1PP8 F;  1DU6 A;  3I53 A;  4MO7 A;  2BY3 A;  1X4O A;  2Z16 A;  3FMS A;  4BY1 J;  3FMR A;  1IUF A;  1XC5 A;  4X6A J;  2VKV A;  4ON0 A;  2FOK A;  4CO8 A;  1X3Z B;  1EF4 A;  2I5U A;  3PSF A;  4KJZ A;  2RV8 A;  1ONV A;  2RC4 A;  4ZYA A;  3EYY A;  4A12 A;  4MTE A;  3A01 A;  1WJB A;  3AL0 C;  2R7T A;  2DOA A;  3SDG A;  4BE1 A;  4BGD A;  4IRH A;  4ZDL A;  4XRS G;  1WKM A;  2HOE A;  4EV0 A;  4MNU A;  1W5S A;  2W25 A;  2X9D A;  3V42 A;  2RQP A;  4GYI A;  1VQO I;  2OF7 A;  2DYR H;  2NVT J;  4M9S A;  1KYZ A;  3A1Y A;  4V2F A;  4XSX F;  1BL0 A;  3S2D J;  5C4X J;  2VXD A;  2EZK A;  2A5Y B;  2V1U A;  3HXL A;  4EJV A;  3GUD A;  2CV1 A;  2FSW A;  3S15 J;  3QPT A;  5E1X A;  3W6J B;  4A0Z A;  1ZGW A;  2JSP A;  4RB1 A;  2PMH A;  4M3G A;  5E20 A;  3AG2 H;  2E1M C;  5J1R A;  2BZT A;  3ML6 A;  5A2Q Z;  2JJ7 A;  3GZN B;  2LY9 A;  3KYD B;  1WI9 A;  3VSL A;  3JRE A;  4HDU A;  2O61 A;  3K70 C;  5BMZ A;  3CJR B;  3MZH A;  3PFI A;  3CUQ B;  5DUI A;  1ZQ3 P;  1RR7 A;  3H3V K;  3IKV A;  2OJE D;  2P6S A;  1ZGJ A;  4I0A A;  1OPC A;  3TMO A;  2LG4 A;  3HBL A;  3DKW A;  1MSF C;  3HHH A;  1LEB A;  3BJ6 A;  3U1K A;  2OAZ A;  2DT7 B;  2R5Y B;  4ENN A;  1FEX A;  1RKT A;  3BPX A;  1GLN A;  5HOD A;  1IXC A;  1IG7 A;  3PUF A;  4HF1 A;  1S8N A;  4C2M J;  2DOE A;  4HV5 A;  2K9Q A;  4Y15 A;  3SFZ A;  3VYU B;  4NHJ A;  3KZI C;  3WE2 A;  3MD2 A;  4OIP F;  3I55 I;  5EEA A;  2A69 F;  4RAY A;  2VE9 A;  3I3L A;  1T98 A;  2DT5 A;  4U0V A;  2AHQ A;  5FFZ A;  2RKH A;  2ZME C;  4IHW A;  2I10 A;  1R71 A;  1LVK A;  4FTH A;  2X51 A;  3KZY A;  3QQA A;  4G9Y A;  1G3Y A;  4MEY F;  3AG1 H;  3S93 A;  3H0D A;  4HOB A;  2CYY A;  3ZQI A;  1J59 A;  2DU9 A;  5FLV A;  4ZYG A;  3CF2 A;  3KEY A;  1FOY A;  1JHH A;  2E71 A;  2OU2 A;  2G9W A;  4F93 B;  4XRS A;  1R00 A;  2BYV E;  4RLF A;  3PIP F;  1MDM B;  4GYG A;  3DKX A;  3H3U A;  4M3E A;  4S05 A;  4G7O F;  2OTJ I;  3OYE A;  4IXA A;  1PYV A;  2DPD A;  2EFW A;  3C2G A;  1U0J A;  5EJC A;  4WXC A;  1U9N A;  4DYC A;  4I98 B;  4CYC B;  3ERM A;  1U3E M;  5M5X J;  3CC7 I;  2VB6 A;  5EEH A;  2LR8 A;  4CCM A;  1TZL A;  2VOP A;  4II3 A;  3CLO A;  2PJP A;  4ITV A;  5CVI A;  2CUE A;  1D0X A;  2LFB A;  4AM3 A;  4MIM A;  4CCK A;  2KMU A;  4IHV A;  2W24 A;  1SFX A;  5L3E A;  2P5L C;  2ZSH B;  2F4O B;  3SHF A;  2MSY A;  3CTA A;  3SFI A;  1A5J A;  3SQN A;  5CVR A;  4A3K J;  2V6E A;  5HS7 A;  1VQ7 I;  1SVO A;  3LSI A;  1EKE A;  3U2R A;  3PQK A;  4Q47 A;  3VOD A;  2W7N A;  4P55 A;  4AIK A;  3MQ0 A;  2HYF A;  1LNW A;  1XMX A;  2DA3 A;  1ZRF A;  4EM1 A;  3HPG A;  5E17 F;  4LOC A;  4A69 C;  4D9J A;  5E8G A;  5LGU A;  2A6H F;  4N9I A;  4Z6Y A;  3F3X A;  5J8F A;  4S04 A;  3A2K A;  2BE5 F;  3ERE D;  3CDI A;  3FM5 A;  3GZ6 A;  3HTS B;  4S0H B;  1VQ4 I;  5KAF C;  3E5X A;  3ABK H;  3F8C A;  2CQ7 A;  3C2H A;  1O7F A;  1U9O A;  1U5T B;  2RGV A;  2QUF A;  3QAH A;  1V5F A;  4HF2 A;  3SJM A;  3PNT A;  3RYR A;  1ZG1 A;  3FKJ A;  1VQK I;  4ESB A;  3I56 I;  2QZ8 A;  4ZC3 A;  3BG6 A;  2LKP A;  2CS3 A;  3TED A;  1UG2 A;  2XF6 A;  5CKT A;  4PGH A;  4P1W A;  1W0U A;  3D5L A;  2HWV A;  4E7I A;  4LK0 F;  1FP2 A;  1AKH B;  2CWE A;  2D1V A;  1IN8 A;  1T0F A;  2Z33 A;  4Q4Z F;  3S1M J;  2Y9Y A;  4I6Z A;  3H1C A;  3DTE A;  3BPV A;  1BJZ A;  2EFP A;  3JAM Z;  1IRF A;  3RKX A;  3IAM 2;  3EUA A;  3G2B A;  3CUQ C;  3ZR8 X;  4I09 A;  4ESJ A;  2GA1 A;  1Z3X A;  4LK1 F;  5FKL A;  2R7O A;  3ZGK A;  2PJR B;  5IP7 J;  2IA0 A;  5TIS C;  1NK3 P;  4ENM A;  2XUB A;  1LDD A;  3GEZ A;  3Q0V A;  1ITY A;  4LFU A;  1BC8 C;  2JVG A;  4M9Z A;  4GFB A;  4BXX J;  4JYK A;  5C4J J;  3HRS A;  3NAR A;  3DLA A;  3WU2 C;  3IHU A;  5J8C A;  3MFK A;  2W85 A;  2V7F A;  3SDB A;  3K2Z A;  2R7Z J;  2DA6 A;  2VPL A;  2OTL I;  3LAJ A;  3D5R C;  3GBG A;  2CUF A;  2STW A;  3E6D A;  1I3Q J;  1R6R A;  3CCM I;  2ECC A;  1TWG J;  3K2A A;  3OYF A;  3F21 A;  3GO5 A;  1J75 A;  2EZL A;  2NVQ J;  1F1Z A;  2LY2 A;  4BE0 A;  2QBY A;  1M1E B;  4IPA A;  3TQN A;  3MZY A;  2PMU A;  3OYA A;  4OIR F;  2V1X A;  2A68 F;  4PZJ A;  1ZKG A;  5BQT A;  5DCM A;  2VBY A;  2R93 J;  4IRG A;  5AON A;  2EQR A;  3ISP A;  1ZAR A;  2DBB A;  4KIS A;  1YYV A;  1YTY A;  2VIX A;  5K5Q A;  5FJ8 J;  4PFO A;  2LSO A;  1HF0 A;  2L7K A;  2M4K A;  2VT3 A;  4L9N A;  5IT9 K;  3JSO A;  4RDU A;  1QZZ A;  3CCU I;  1XMA A;  5D5W B;  2M0M A;  3DEW A;  1HC8 A;  3JRI A;  3G6E I;  1OCZ H;  2W84 A;  2XVC A;  5F04 A;  4Y17 A;  2NS0 A;  2MC3 A;  1FLI A;  4XOT A;  1P4X A;  4IX7 A;  4BH9 A;  1TT0 A;  1MBJ A;  1WCM J;  2FJ1 A;  4BBS J;  1OMI A;  2L3D A;  1T6S A;  2QEX I;  2UV1 A;  1W4M A;  2DQL A;  3E3V A;  1R22 A;  3BDD A;  2LD5 A;  4M6V A;  2V4J C;  4EQQ A;  4F91 B;  4JX6 A;  3H92 A;  1SFU A;  2K9M A;  4IHY A;  2VL8 A;  1YRN A;  4IEJ A;  4PJL A;  2R7S A;  1GV5 A;  2W1O A;  4P5O A;  2DA7 A;  3TL4 X;  2FD5 A;  3ZMD A;  1K79 A;  3V7C A;  4IOA F;  1TW2 A;  3DFG A;  2DDB A;  3QYB A;  4HDV A;  5F27 A;  2Y48 A;  4H0E A;  1IAW A;  1FIA A;  2L9R A;  3K4J A;  3KLO A;  1MMG A;  1SD6 A;  2X6W A;  1PVE A;  2CW0 F;  4ZDO A;  1ZN2 A;  2QKM B;  2N8G A;  2GXG A;  1ZG5 A;  2MFZ A;  1D1A A;  4QSH A;  2WAD A;  1X1A A;  4B4C A;  1D8K A;  2IGK A;  4A3L J;  3O8H A;  2MBF A;  1FTZ A;  2JRM A;  4XOP A;  1IN5 A;  2RN7 A;  1QU3 A;  4KMU X;  1Q1V A;  2KDZ A;  5E79 C;  3G4S I;  2BVM A;  1OCC H;  2WAQ A;  3A0B C;  2WV0 A;  5EG0 A;  4B48 A;  3CMY A;  2RRE A;  4HW0 A;  1OR7 A;  1GVD A;  3FWE A;  4W97 A;  2DTR A;  1U5T C;  2BXY A;  1MZB A;  4CCO A;  3LAP A;  2MW8 A;  5FKK A;  3CO7 C;  1S3J A;  3GWZ A;  3OSF A;  2HDD A;  2K4B A;  3WGH A;  2L5Q A;  4L0Z B;  4LGW A;  2LK2 A;  3SEQ A;  1Z21 A;  4BHB A;  3HHG A;  4ZJZ A;  2H8R A;  2DFH A;  4IRI A;  2EIN H;  4NQW A;  3JRG A;  1YJN I;  1JKP C;  3HG9 A;  3FHZ A;  3J7Z I;  3DKY A;  2V1D A;  4U87 A;  2F2E A;  2QQ9 A;  4XL9 A;  3RPQ A;  3TO6 A;  2RNG A;  3E5U A;  3Q9V A;  4AD9 A;  5D5V B;  4JX4 A;  2GWR A;  1IUY A;  3SYT A;  4IJA A;  4HQM A;  5L3C A;  2OUM A;  1XTA A;  4I76 A;  4MLO A;  2HOA A;  4RGS A;  1K61 A;  2IBD A;  4L18 B;  1X4P A;  1LDJ A;  1Z67 A;  1Z91 A;  2KQR A;  2OA4 A;  4IVN A;  5LRS A;  5EZH A;  3OYN A;  3HIF A;  1WVR A;  3BTL A;  2DA5 A;  4GO1 A;  4A5N A;  3IH3 A;  3PUB A;  4XLA A;  3FKI J;  2VQG A;  2DXI A;  1U2W A;  3M3Y J;  2HTS A;  3KP7 A;  1JI8 A;  1MBF A;  4E7J A;  1J9I A;  3BR1 A;  4CZC A;  4WWC A;  1OKR A;  3VOE A;  1QRY A;  3EQL F;  3OS0 A;  2A6T A;  4EMS A;  1VF9 A;  3VB2 A;  2EK5 A;  2XHK A;  4GCV A;  3PM1 A;  1KU2 A;  4XK4 A;  1VQP I;  2VPR A;  4FET A;  4E7L A;  3H0G J;  3KP5 A;  5H20 A;  3GX4 X;  4OMY A;  1O3T A;  1W7P A;  1TT5 B;  1RET A;  3CJN A;  1TNS A;  1W5T A;  4G94 A;  5KNL A;  2P4W A;  2JA8 J;  1FSH A;  3RKW A;  1LUJ B;  4I01 A;  2XRO A;  1ZTR A;  3K1P A;  3CO6 C;  4HPQ A;  5IY5 H;  1BR1 A;  3DF8 A;  3IWZ A;  5J4Y A;  1T38 A;  3LSG A;  2IVM A;  3GTK J;  1WJE A;  3LQR A;  2GLO A;  4DBQ A;  1YX5 A;  3CQZ J;  5BPI A;  3MN2 A;  1MH4 A;  2XRL A;  2M2E A;  3DTI A;  4A0Y A;  1WSU A;  2BGC A;  2JUG A;  1EJ9 A;  3K7A J;  3K4N A;  2DOF A;  3BP8 A;  2M30 A;  4NBQ A;  1MH3 A;  1Y39 A;  3CZ6 A;  2ME0 A;  5FFX A;  3S16 J;  1KA8 A;  4E70 A;  1X1P A;  2H8W A;  2GAU A;  4JOM A;  3P5J A;  4MQ9 F;  1J2X A;  4UVB A;  4XKV A;  2ZJR F;  3ELK A;  2LC2 A;  3WGG A;  4MQV A;  2V1N A;  5LHI A;  1FJL A;  1QZE A;  4ANJ A;  3CF5 F;  5DV5 A;  5L3F A;  2HDW A;  4LD5 A;  3AL0 B;  1U6G A;  4UB8 C;  1P7I A;  1ZG3 A;  3S1Q J;  3COA C;  3HM5 A;  3S14 J;  2VBW A;  3J7Y J;  3Q3S A;  3ZQG A;  3I54 A;  4JQF A;  1JUS A;  1R36 A;  4KIB A;  2MH2 A;  5LLQ A;  1D0Y A;  1VFC A;  3JRC A;  3N05 A;  4XID A;  1K78 A;  3MKL A;  2Y31 A;  3I59 B;  2P5V A;  3GTM J;  2XPU A;  2NXN B;  3DBH B;  2KJB A;  1DP3 A;  2DMN A;  2ZFU A;  3DBR B;  2JWT A;  4NUB A;  1XSD A;  5B66 C;  2E1M B;  2IJL A;  2K27 A;  1YS6 A;  3E97 A;  2MLG A;  1NH3 A;  4BEH A;  2K7L A;  5J3L A;  3FXL A;  4UV9 A;  1GHC A;  5ICC A;  1GV2 A;  2ELJ A;  5LGT A;  3BR0 A;  4G12 A;  2IEK A;  2DMT A;  4XR6 A;  4M73 A;  1NK2 P;  2QYO A;  1HW5 A;  2Y0M A;  1R49 A;  4C3J J;  3CCV I;  1Y1V J;  3VFZ A;  2E1N A;  2XF7 A;  2L7Z A;  2FF4 A;  1WFX A;  4LLN A;  3EPZ A;  3MVP A;  4CYD A;  2E34 A;  4OMZ A;  2STT A;  2HPI A;  1KQ0 A;  5F64 A;  1E0E A;  2CFO A;  3IRQ A;  2XB5 A;  2XAJ A;  4GXO A;  5J6X A;  5JR3 A;  1D5V A;  4D1Q A;  3GTL J;  3OYD A;  4C2T A;  4LG0 A;  2LKS A;  2MLK A;  2EV6 A;  2I8D A;  4CIC A;  5KCM A;  1MGT A;  2HNH A;  3KLN A;  3OYK A;  1ZLK A;  5C3E J;  1TQI A;  3KZZ A;  2MA3 A;  2MH9 A;  1K7A A;  1DPR A;  1MNE A;  4NB5 A;  2R7D A;  1V55 H;  3DEE A;  1G59 A;  3N4M A;  3WOD F;  2OBP A;  5HNH A;  5FKM A;  2ELK A;  3RPU A;  4HX7 A;  2Y2Z A;  2DQR A;  1XGS A;  3HOZ J;  4D5F A;  5FRM A;  2X48 A;  3L2R A;  3CC4 I;  2X4H A;  3J81 Z;  2NS7 A;  2WB1 A;  5E1W A;  3D1N I;  2LRD A;  4NC6 A;  3CCS I;  2K85 A;  1W36 D;  3KE2 A;  1SD5 A;  1BI3 A;  2L2O A;  3SZT A;  1OYW A;  2X1C A;  1HW1 A;  1EH6 A;  1W7P D;  3HGY A;  1STZ A;  3AKZ A;  3L2U A;  1AA7 A;  4ASN A;  2JRT A;  2R5Z A;  2VJ4 A;  1JUP A;  5BOX A;  2VKE A;  2P7V B;  2FNA A;  3DCF A;  1AU7 A;  3IV5 A;  1Z3Y A;  2LY1 A;  3AAF A;  3LSP A;  1B72 B;  3F8N A;  4ESF A;  4IQ4 A;  1A6Q A;  3KFW X;  1I5Z A;  3REO A;  4NC7 A;  1FOK A;  2A07 F;  1WPK A;  2VE8 A;  4KIC A;  6PAX A;  2IS2 A;  4C2U A;  3IKT A;  2IA1 A;  3CP8 A;  4LLG F;  3CC2 I;  1VQ5 I;  2VJJ A;  2EFN A;  4PJJ A;  3FIW A;  1RPW A;  5HDN A;  2H1K A;  2F48 A;  3ESW B;  2O9L A;  1SMT A;  3ASO H;  3QU3 A;  3BG3 A;  3JCU C;  4PJN A;  3GXO A;  1K6Y A;  2X85 A;  3PIO F;  4A3D J;  4CCJ A;  1JKR C;  5M3M J;  2IS1 A;  1J7K A;  3C1D A;  4MHG A;  1KU9 A;  5H2F C;  1FTT A;  4BXU A;  2NOG A;  4U88 A;  3R6S A;  4JBA A;  2B7E A;  3DQV C;  2VOO A;  2MD5 A;  5D6E A;  2O03 A;  5KAI C;  1FNN A;  1U78 A;  3MAJ A;  2Y9Z A;  4UNO A;  2CG4 A;  2V26 A;  1B8I A;  2NVY J;  4XRF A;  2BW3 A;  2IGO A;  1E17 A;  1IRG A;  5FLX K;  2JUC A;  2JT1 A;  2K86 A;  4NC8 A;  2XIG A;  1FY7 A;  3KP6 A;  3LA7 A;  5J47 A;  1F36 A;  4LMY A;  2OD5 A;  3RZD J;  2H94 A;  2FQ4 A;  5LD2 C;  1FP1 D;  3HSF A;  3QOP A;  2QQA A;  2E5Z A;  3AG4 H;  1LB2 A;  3DPL C;  1H8A C;  2P81 A;  2YS9 A;  2VJI A;  3H36 A;  2YU3 A;  3QWL A;  2XSD C;  2QWW A;  3HRM A;  1JJ6 C;  4UVC A;  1ORK A;  3BJO A;  2Q2E A;  4HX8 A;  1TW3 A;  1IW7 F;  1D0Z A;  1HKS A;  3GCM A;  2HZD A;  5DS9 A;  3NWS A;  1K4T A;  1SD4 A;  2VKD A;  1R1U A;  4BKX A;  4QTR A;  3HUG A;  3ABU A;  4RA2 A;  1XGN A;  3HSE A;  3JAM K;  1LE8 A;  3JSP A;  3KEQ A;  3R0J A;  3ONQ A;  2Y69 H;  3VSK A;  4MGR A;  2X6X A;  3W2W A;  1Z6R A;  2R7V A;  4O3M A;  1DGR M;  3HB9 A;  5L3G A;  3S17 J;  1QZY A;  2YPR A;  3SXY A;  3BG5 A;  2DMQ A;  4L5J A;  4IHT A;  1DDN A;  1QO0 D;  4KIF A;  1LJ9 A;  4OU0 A;  4AYB N;  3HOY J;  2CQK A;  3MZ8 A;  1N75 A;  3S32 A;  4AVZ A;  5E8I A;  1RR8 C;  3KP2 A;  4YIR X;  5E18 F;  3UNG C;  1FT9 A;  3GLX A;  2LMD A;  2VQH A;  2VUM J;  2HYG D;  4HEA 2;  4KT6 A;  3QPH A;  5H6Q A;  1TC3 C;  2NRA C;  1F43 A;  4LB5 A;  2VQC A;  5C44 J;  3M1C A;  3PFY A;  2EA2 A;  2EZI A;  3ROU A;  2XPW A;  4L5I A;  1JT0 A;  2VBX A;  2DK5 A;  1XB4 A;  3RPU D;  2CFX A;  5GPA A;  1O7L A;  5D6F A;  1MBG A;  3CCY A;  4EM2 A;  3OYG A;  1ETX A;  4HF0 A;  3S2H J;  1ETV A;  4MFD A;  1G3T A;  1ZRE A;  4WXD A;  3GZ5 A;  4M3D A;  1QNT A;  3B6C A;  5JHF A;  2R7X A;  1YS7 A;  2Q8K A;  3JRH A;  2R4G A;  5GPC A;  4JK1 X;  1P9Q C;  4Y13 A;  5KVR A;  1G2H A;  5FRO A;  1FYL A;  3B73 A;  5FB2 A;  5HOO A;  1F4K A;  5H6R A;  4RB2 C;  4FHT A;  3OSG A;  2KT0 A;  3GFM A;  2ICW G;  1R9T J;  2XF5 A;  3GTG J;  3CDH A;  4UUS B;  3OYI A;  4QIW N;  2AXT C;  3E7L A;  4RAG A;  4FQG A;  2L01 A;  1G4D A;  2YSR A;  2K5C A;  1R1V A;  2L9S A;  1AHD P;  3VWB A;  1QGP A;  2O0Y A;  5EGO B;  1WJA A;  2WTE A;  3L7W A;  3FBI B;  1APL C;  4XRM A;  1CF7 A;  2MD0 A;  3K69 A;  4ENK A;  3CCJ I;  2KZG A;  3M07 A;  1NHA A;  2WY8 Q;  1DP7 P;  2LBF B;  5GTI C;  2UZK A;  4IL6 C;  1UST A;  1YO5 C;  5JLX A;  1R7J A;  2KZV A;  4YEJ A;  1E3P A;  2R7U A;  3ZN0 A;  1IDY A;  2PBI A;  1TQM A;  1LKX A;  1IV8 A;  4DIQ A;  3BR3 A;  2KIQ A;  3FBN B;  3BR2 A;  3W6V A;  1XN7 A;  4I99 C;  3BTJ A;  1R4N B;  1T33 A;  2QF7 A;  2ZJQ F;  5CVV A;  4HNU A;  4HBL A;  2M4G A;  3A01 B;  1BI0 A;  1EV7 A;  1OLT A;  1BW5 A;  3SZP A;  3V4G A;  3CLQ A;  3K4L A;  3K4K A;  3VYT B;  2FMY A;  4XSZ F;  4UVA A;  4GDF A;  1DGW Y;  3WG9 A;  1XD7 A;  3KYC B;  1G3W A;  2RNJ A;  1S5L C;  2KPM A;  2K3F A;  2PMZ N;  1MMD A;  2XAG A;  3EUH A;  1P7J A;  4ZTJ A;  3WHB A;  3ABL H;  1X3U A;  4I7H A;  3S3M A;  2JN6 A;  2ZJP F;  2EIK H;  2ISY A;  2Q0O A;  5FD5 A;  3JR9 A;  2ZNY A;  5CVU A;  2IRF G;  3WU1 B;  3QYE A;  2QLZ A;  1BN5 A;  1GVJ A;  2ME6 A;  3TO7 A;  2HVR A;  4IKF A;  3FXM A;  1ZK8 A;  2BY0 A;  3RQI A;  3OY9 A;  3D5S C;  1ZR4 A;  1ETY A;  4L9T A;  4LIV A;  3OS1 A;  1HBX G;  4PJ0 C;  2QVO A;  1YLF A;  4ZH4 F;  1JJ8 C;  1QA6 A;  5CQE A;  2QGU A;  1AOY A;  2E19 A;  5CPR B;  2VC0 A;  3QOE A;  1BR4 A;  1KON A;  2KRH A;  5DEQ A;  1BW6 A;  1XDU A;  3ZQQ A;  4NDL A;  3ZQC A;  5L3B A;  4EEF G;  4CDG A;  1MW7 A;  1IN4 A;  2M0C A;  1O4X A;  4RM2 A;  3TP3 A;  3M7G A;  3H9Q A;  3W6K B;  1UMQ A;  2E36 A;  2HQA A;  1V5G A;  3CJT B;  4CUG A;  3GVA A;  3QP6 A;  2DDA A;  4N0B A;  1MBE A;  1O3R A;  3DV8 A;  4XKC A;  2VN2 A;  1YOV B;  4J00 A;  2FU4 A;  1U8R A;  4RM3 A;  4EJO A;  4M71 A;  1HKT A;  2PX9 A;  3J80 Z;  4GRI A;  1T8I A;  3GF2 A;  1P4W A;  1R58 A;  4M6Y A;  5JLW A;  3LA3 A;  1LPQ A;  2LOO A;  5HS8 A;  4XLF A;  4G6Q A;  4F3Q A;  2CV2 A;  1RIO H;  3KP4 A;  2F4M B;  2QCO A;  2ZXJ A;  3WTY C;  2HPM A;  1PDN C;  2HVQ A;  3FM3 A;  3PJR A;  4ETS A;  2COM A;  4RB0 A;  2ZO4 A;  3LWF A;  4CCL A;  2CQN A;  3HOU J;  1O3Q A;  3CCE I;  5E3O A;  5CVJ A; 
#chains in the Genus database with same CATH homology
 4MTD A;  5HLG A;  3DXJ F;  1FWZ A;  2FEZ A;  5CLS A;  1S7A A;  3WTT C;  5D8L B;  3RKY A;  2BV6 A;  2NYX A;  1BC7 C;  3FXU A;  3WTZ A;  5LEJ A;  1FBS A;  2XAF A;  1LEA A;  1I1G A;  3P9C A;  3BZ6 A;  4FX4 A;  2O8X A;  3BJA A;  4FT8 A;  1H9T A;  2WC2 A;  2YX4 A;  1BI2 A;  4EM0 B;  1MJ9 A;  2ISZ A;  2XAS A;  3LA2 A;  1XGM A;  2L4M A;  4G6D A;  1HST A;  3HTU A;  5AIQ A;  2J5O A;  3V8L A;  4U0Y A;  2M87 A;  2NAZ A;  1BJA A;  3EYI A;  3U1D A;  5F1R A;  4MEX F;  3F8F A;  3O6B B;  2ZJ2 A;  4BHP A;  3ZMV A;  4Q5S F;  1IZ1 A;  3I5U A;  4G8X A;  2DK8 A;  2HTJ A;  2ETH A;  1YW7 A;  2LNB A;  1UHW A;  3F22 A;  1S6L A;  1YW9 A;  2Z99 A;  4KFC A;  4WXH A;  2KIU A;  2ZME A;  2DAO A;  3M8F A;  2H09 A;  4GGG A;  2UWM A;  1KQ9 A;  2YR2 A;  2FNP A;  2NNN A;  3LFK A;  2EV0 A;  4LJZ F;  5HLH A;  1BIB A;  2EFO A;  3QU6 A;  1Y0U A;  4M9X A;  1F9N A;  4LB6 B;  2ZKZ A;  2QBY B;  5IT9 Z;  2E1C A;  1JHF A;  1BIA A;  3K1N A;  3I4P A;  1P4A A;  2CSO A;  4L9V A;  1RI7 A;  2XKO A;  4RB3 C;  3U9G A;  4OIQ F;  1LDK B;  2KKO A;  2EFQ A;  4ZYE A;  1H0M A;  4U7B A;  2HEO A;  4HZF A;  2XGX A;  3NEU A;  3L2C A;  5BS6 A;  2R3S A;  3GW2 A;  3N97 A;  2IP2 A;  2K4J A;  1B9N A;  4U0W A;  3FMQ A;  4O5V A;  3HRT A;  3O2P E;  5HLI A;  2DI3 A;  5LHG A;  1ZYR F;  1EH7 A;  1MKM A;  3TDZ C;  5LGN A;  2OZ6 A;  1L3L A;  4A6E A;  3I64 A;  4A2U A;  2HQR A;  4QWQ A;  3T8R A;  1ULY A;  3T0Y A;  1PP7 U;  3ZMS A;  3T8T A;  5TRD A;  1XDS A;  4RGR A;  1QPM A;  1TTY A;  4HAM A;  3OOP A;  4EJW A;  5DYM A;  3R60 A;  1FC3 A;  3CUQ A;  4K2E A;  4UV8 A;  4EGZ A;  1RZ4 A;  1WQ2 A;  3RJP A;  5A2Q K;  4WX9 A;  2XV4 S;  5F6F A;  5K5O A;  2FQ3 A;  5CJ9 A;  3GFI A;  2HS5 A;  1YG2 A;  4ZYD A;  2PI0 A;  1VTN C;  2UXN A;  2VOD A;  3IRR A;  1TLH B;  4R1H A;  2EWN A;  4WCG A;  3FXQ A;  5DDG A;  4FX0 A;  2E7W A;  2YX7 A;  1JGS A;  5LEK A;  4EJU A;  2HFH A;  4Q48 A;  2HKX A;  2JSC A;  1S7O A;  1R1T A;  1UB9 A;  2M45 A;  4RGX A;  5D4R A;  1B6A A;  2UXX A;  2ELH A;  2KIF A;  1GXQ A;  3F8B A;  1MDM A;  1D8J A;  2JZY A;  3JW4 A;  4IHS A;  3WTW C;  1R5G A;  2IT0 A;  2O6G E;  3ECH A;  5ILU A;  4HQE A;  4TV7 A;  1IXR C;  3K9T A;  3HOS A;  4M6X A;  5L3D A;  5HDG A;  1ZGA A;  3C3W A;  4IF4 A;  2QM3 A;  5DCF A;  2F5E A;  1K6O A;  4OOI A;  3MCZ A;  4KNY A;  1J0R A;  2PQ8 A;  3R0A A;  3P9K A;  2LDU A;  1T2K A;  4P96 A;  2Z9O A;  2DW4 A;  1SFE A;  4UXN A;  3F8M A;  4YFX F;  5JI6 A;  1IN7 A;  2JTV A;  5CYV A;  2GQQ A;  2EV5 A;  1R23 A;  2NNY A;  1BM9 A;  2G7U A;  4N9H A;  2FXA A;  4I02 A;  2LF7 A;  4YFK F;  1Z6T A;  2QEN A;  1XSV A;  1U5T A;  2C6Y A;  1ZLJ A;  5IT3 A;  2OQG A;  3M1E A;  2VC1 A;  2PN6 A;  2VT2 A;  1PUE E;  5BPD A;  4R79 A;  1MJA A;  3KET A;  1B4A A;  4WK8 F;  4Z2Y A;  4KIG A;  1K78 B;  2RDP A;  4B09 A;  3WU0 A;  2R7F A;  4M74 A;  3HRU A;  1UFM A;  3GFL A;  2DO7 A;  2IPQ X;  4BNC A;  3J7A O;  1E2X A;  1C0W A;  1L0O C;  3VEP A;  3LST A;  4I2O A;  5ICF A;  3WTV C;  1HW2 A;  4BYY A;  3JTH A;  1ON1 A;  1Z05 A;  2AXL A;  2M5W A;  3ABT A;  3MEX A;  1BI1 A;  1EH8 A;  1ON2 A;  1DPU A;  2W57 A;  1B59 A;  4LG0 B;  2AS5 F;  4YG2 F;  2PLY A;  1ZHF A;  5DUK A;  3WTX C;  3E5Q A;  5FO5 A;  1TNT A;  2HZT A;  2Z3Y A;  1P2F A;  1KU7 A;  2XAH A;  2H6C A;  3G73 A;  1O3S A;  4CGZ A;  5EEG A;  3J80 K;  5E1Z B;  1CGP A;  3M8E A;  4P9F A;  4EGY A;  2D1H A;  1B1B A;  2FML A;  4LLL A;  4AIH A;  4KYW A;  2A61 A;  5JHU A;  2M8E A;  4UUV A;  4AVP A;  1HKQ A;  1YW8 A;  3ZMZ A;  5DD8 A;  3E6B A;  4KN7 X;  1ODD A;  4P9U A;  3K1M A;  3E6C C;  3RYP A;  2M1B A;  4RAZ A;  4ZZD A;  4KDP A;  1OYY A;  4D0P A;  2HR3 A;  1I1S A;  4PCQ A;  3NQO A;  2EB7 A;  2ZBK A;  2ADU A;  2FBH A;  2GZW A;  3HYI A;  3FXR A;  4PDK A;  1S29 A;  3TOA A;  3F23 A;  1IXS B;  4HYE A;  2KIM A;  3E6M A;  3JTG A;  3DEU A;  5FLX Z;  3WGI A;  2CO5 A;  4F7Z A;  5HVQ C;  1HXD A;  2G7H A;  3PQJ A;  1G6N A;  4KT5 C;  3F6V A;  4BQA A;  4HX4 A;  3EET A;  5ICE A;  3F72 A;  2E7X A;  1FZP B;  3Q9S A;  2ESH A;  2ZFW A;  5D5U B;  1KU3 A;  2PG4 A;  2EA4 A;  1QQI A;  2XAQ A;  1TQP A;  3FF5 A;  2FA5 A;  2K02 A;  3EDP A;  1DUX C;  2PFB A;  3L09 A;  5HDK A;  4L0Y B;  2P7C B;  3TGN A;  2DLL A;  1JE8 A;  1USS A;  4XLN F;  1OYI A;  2VXZ A;  2JPB A;  2HQN A;  3RIR A;  2A3S A;  1KQ8 A;  3CUO A;  5FD6 A;  5LHH A;  2PEX A;  2P5K A;  3TO9 A;  5D8K B;  4AWX B;  1SAX A;  5D5X B;  1Q1H A;  2EJR A;  2HKO A;  1SD7 A;  2WWY A;  1LQ1 A;  3ZQ7 A;  1T39 A;  3WTU C;  2GXB A;  3I0T A;  3P7N A;  1I6X A;  2HGC A;  3DP7 A;  3ZMU A;  2VON A;  3BY6 A;  2D45 A;  4G7Z F;  3NRV A;  1F5T A;  2V79 A;  4DQ2 A;  4KA4 A;  3F6O A;  2GIV A;  2OQR A;  1AWC A;  2L54 A;  3O3K A;  4HA8 A;  3HOT A;  4OIO F;  1P92 A;  1GXP A;  3BRO A;  3I59 A;  3QP5 A;  1CF7 B;  2XKP A;  3IL2 A;  2OZU A;  5AIP A;  3MWM A;  5JFR A;  1XCB A;  3H3Z A;  4R8H A;  3S2W A;  1FYM A;  5ERI A;  2FBI A;  3ZN1 A;  3GYH X;  4ZZL A;  5ICG A;  1FBQ A;  2F5F A;  2X0L A;  5LRR A;  3V8K A;  3T1B A;  3RTR A;  3B02 A;  1Z1D A;  1BOA A;  4PGG A;  1SMY F;  1ZAO A;  4AIJ A;  1V3F A;  2F5D A;  4RS8 A;  3BWG A;  1ZRC A;  1LVA A;  4HV6 A;  4I0B A;  1TBX A;  2V6C A;  1ZH5 A;  2Z5U A;  5D4S A;  5DD4 A;  1KGS A;  3V7S A;  5K1Y A;  2FE3 A;  3R61 A;  3R4K A;  3LQQ A;  2B0L A;  3ZP5 A;  1HSJ A;  4EJT A;  1FYK A;  3OV8 A;  3TKY A;  1RUO A;  3GFJ A;  3IC7 A;  4G7H F;  3TOB A;  1QBJ A;  4XBF A;  1MD0 A;  3M9A A;  1XMK A;  1XGO A;  1YQA A;  2V9V A;  3G3Z A;  1Z9C A;  1O57 A;  5DCM B;  2ACJ A;  4BHC A;  3J81 K;  1H9G A;  3I58 A;  1YIO A;  1A04 A;  4A5M A;  3TDU C;  1R5H A;  4CHU A;  4M72 A;  3V7R A;  2A6E F;  3ULQ B;  1UHM A;  2ESN A;  3L00 A;  3I71 A;  3ZMT A;  3ECO A;  5ILV A;  4YFN F;  3FZV A;  1V4R A;  1FBU A;  3P9I A;  5TJJ A;  3BOQ A;  2BEO A;  4ENJ A;  4O6J A;  3KEO A;  2BBY A;  1FX7 A;  1REP C;  4HLX A;  2HDC A;  4ZYH A;  2H6B A;  5ILS A;  4A6D A;  1XCV A;  4CXF A;  4A0X A;  3RDI A;  2FBK A;  2QQB A;  2H27 A;  2ZNZ A;  3KP3 A;  4UHT A;  1WWX A;  2J5P A;  4DNC A;  5K5R A;  3FX3 A;  3WTS C;  2KJC A;  5HS9 A;  2CGP A;  2P6T A;  2O3F A;  4U7D A;  4XLP F;  3C18 A;  1YFH A;  2DPU A;  1UCR A;  4QLC U;  1IF1 A;  3K0L A;  2FRH A;  4BAY A;  2GA2 A;  1Z7U A;  4YIF A;  2L02 A;  1HQC A;  4CZZ A;  3V8J A;  3ZPL A;  3D0S A;  1KYW A;  3Q5F A;  1RUN A;  4WF2 A;  2KRF A;  4KUM A;  5KK1 A;  4YII A;  5LBQ A;  2IW5 A;  1FSE A;  4KN4 X;  2F5C A;  2Y75 A;  1J5Y A;  2L4A A;  2RVC A;  2TDX A;  1D3Y A;  4KMF A;  1B9M A;  1I27 A;  1FPQ A;  3IWF A;  4EVI A;  3RI4 A;  2ZME B;  2P8T A;  2LF8 A;  5FGM A;  1G3S A;  3DPT A;  4HLY A;  5JVT A;  3QRF F;  2IA2 A;  1W7P B;  1ZRD A;  2VBZ A;  3KCC A;  4OIN F;  1IN6 A;  2DFI A;  3WE3 A;  3T5X A;  1RNL A;  1P6R A;  2D2W A;  2ZCW A;  1BBY A;  1WRJ A;  1XSX A;  4B8X A;  5ED4 A;  4RGU A;  3L9F A;  3HSR A;  2JPC A;  4L9J A;  2XRN A;  1JXS A;  1MJB A;  3C7J A;  1PP8 F;  3I53 A;  3FMS A;  3FMR A;  4ON0 A;  2FOK A;  4CO8 A;  4A12 A;  2RV8 A;  1ONV A;  2RC4 A;  3EYY A;  4MTE A;  4IRH A;  1WKM A;  2HOE A;  4EV0 A;  4MNU A;  1W5S A;  2W25 A;  2RQP A;  4GYI A;  4M9S A;  1KYZ A;  4XSX F;  2A5Y B;  2V1U A;  4EJV A;  3GUD A;  2FSW A;  3QPT A;  5E1X A;  3W6J B;  4A0Z A;  4RB1 A;  2PMH A;  5E20 A;  3ML6 A;  5A2Q Z;  4HDU A;  1WI9 A;  2O61 A;  5BMZ A;  3MZH A;  3PFI A;  3CUQ B;  5DUI A;  3IKV A;  2P6S A;  1ZGJ A;  4I0A A;  1OPC A;  3DKW A;  3HHH A;  1LEB A;  3BJ6 A;  2OAZ A;  4ENN A;  3BPX A;  1IXC A;  4HF1 A;  1S8N A;  4HV5 A;  4Y15 A;  3SFZ A;  3WE2 A;  4OIP F;  2A69 F;  4RAY A;  2VE9 A;  1T98 A;  2DT5 A;  4U0V A;  5FFZ A;  2RKH A;  3KZY A;  4G9Y A;  4MEY F;  1G3Y A;  4HOB A;  2CYY A;  1J59 A;  2DU9 A;  4ZYG A;  1JHH A;  2OU2 A;  2G9W A;  1R00 A;  2BYV E;  1MDM B;  4GYG A;  3H3U A;  4S05 A;  4G7O F;  4IXA A;  2DPD A;  2EFW A;  4WXC A;  4I98 B;  1U3E M;  5EEH A;  2VOP A;  3CLO A;  2PJP A;  5CVI A;  2W24 A;  1SFX A;  5L3E A;  2P5L C;  3SHF A;  3CTA A;  3SQN A;  5CVR A;  5HS7 A;  3U2R A;  3PQK A;  4Q47 A;  3VOD A;  4P55 A;  4AIK A;  3MQ0 A;  2HYF A;  1LNW A;  1ZRF A;  4EM1 A;  5E17 F;  5E8G A;  5LGU A;  2A6H F;  4N9I A;  3F3X A;  5J8F A;  4S04 A;  3ERE D;  2BE5 F;  3FM5 A;  3GZ6 A;  3HTS B;  3E5X A;  3F8C A;  1O7F A;  1U5T B;  2RGV A;  2QUF A;  3QAH A;  4HF2 A;  3RYR A;  1ZG1 A;  4ESB A;  2QZ8 A;  2LKP A;  4PGH A;  3D5L A;  2HWV A;  4LK0 F;  1FP2 A;  2CWE A;  2D1V A;  1IN8 A;  1T0F A;  2Z33 A;  4Q4Z F;  3BPV A;  2EFP A;  3JAM Z;  1IRF A;  3RKX A;  3CUQ C;  4I09 A;  4ESJ A;  2GA1 A;  4LK1 F;  2IA0 A;  4ENM A;  2XUB A;  1LDD A;  3GEZ A;  4LFU A;  1BC8 C;  4M9Z A;  3HRS A;  3IHU A;  5J8C A;  3MFK A;  2W85 A;  3K2Z A;  3LAJ A;  2STW A;  3E6D A;  3F21 A;  3GO5 A;  1J75 A;  1F1Z A;  2QBY A;  4IPA A;  3TQN A;  3MZY A;  2PMU A;  4OIR F;  2V1X A;  2A68 F;  4PZJ A;  5BQT A;  5DCM A;  2VBY A;  4IRG A;  5AON A;  3ISP A;  1ZAR A;  2DBB A;  1YYV A;  1YTY A;  5K5Q A;  2LSO A;  2VT3 A;  4L9N A;  5IT9 K;  3JSO A;  1QZZ A;  1XMA A;  5D5W B;  2XVC A;  2W84 A;  4Y17 A;  2NS0 A;  2MC3 A;  1FLI A;  1P4X A;  4BH9 A;  1OMI A;  2L3D A;  1T6S A;  1W4M A;  2DQL A;  3E3V A;  1R22 A;  3BDD A;  4EQQ A;  3H92 A;  1SFU A;  4P5O A;  3ZMD A;  1K79 A;  3V7C A;  1TW2 A;  3DFG A;  4HDV A;  1IAW A;  2Y48 A;  4H0E A;  3KLO A;  1SD6 A;  2CW0 F;  1ZN2 A;  2GXG A;  1ZG5 A;  1D8K A;  2MBF A;  1IN5 A;  2RN7 A;  4KMU X;  2WV0 A;  4HW0 A;  1OR7 A;  3FWE A;  2DTR A;  1U5T C;  1MZB A;  3LAP A;  3CO7 C;  1S3J A;  3GWZ A;  2K4B A;  3WGH A;  4L0Z B;  4LGW A;  4BHB A;  3HHG A;  4IRI A;  4NQW A;  3FHZ A;  2V1D A;  2F2E A;  2QQ9 A;  3RPQ A;  3TO6 A;  3E5U A;  3Q9V A;  4AD9 A;  5D5V B;  2GWR A;  1IUY A;  4IJA A;  4HQM A;  5L3C A;  4RGS A;  4L18 B;  1LDJ A;  1Z91 A;  2OA4 A;  4IVN A;  5LRS A;  3HIF A;  4GO1 A;  4A5N A;  1U2W A;  2HTS A;  3KP7 A;  1J9I A;  4WWC A;  1OKR A;  3VOE A;  3EQL F;  4EMS A;  3VB2 A;  2EK5 A;  2XHK A;  4GCV A;  1KU2 A;  3KP5 A;  5H20 A;  3GX4 X;  4OMY A;  1O3T A;  1W7P A;  3CJN A;  1TNS A;  1W5T A;  4G94 A;  2P4W A;  1FSH A;  3RKW A;  4I01 A;  2XRO A;  3K1P A;  3CO6 C;  3DF8 A;  3IWZ A;  1T38 A;  2IVM A;  3LQR A;  5BPI A;  4A0Y A;  1WSU A;  2BGC A;  3BP8 A;  2M30 A;  5FFX A;  1KA8 A;  4E70 A;  2GAU A;  4MQ9 F;  1J2X A;  4UVB A;  3ELK A;  3WGG A;  4MQV A;  5LHI A;  5DV5 A;  5L3F A;  4LD5 A;  1U6G A;  1ZG3 A;  3COA C;  2VBW A;  3I54 A;  4JQF A;  1R36 A;  4KIB A;  2MH2 A;  5LLQ A;  1K78 A;  3I59 B;  2P5V A;  2KJB A;  1XSD A;  2IJL A;  2K27 A;  1YS6 A;  3E97 A;  2MLG A;  2K7L A;  4UV9 A;  1GHC A;  5ICC A;  5LGT A;  4M73 A;  2QYO A;  1HW5 A;  2Y0M A;  3VFZ A;  2E1N A;  2FF4 A;  4LLN A;  4CYD A;  4OMZ A;  2STT A;  1KQ0 A;  5F64 A;  3IRQ A;  2XAJ A;  4GXO A;  5J6X A;  5JR3 A;  1D5V A;  4LG0 A;  2MLK A;  2EV6 A;  4CIC A;  1MGT A;  1ZLK A;  3KLN A;  1TQI A;  3KZZ A;  2MA3 A;  2MH9 A;  1K7A A;  1DPR A;  4NB5 A;  2R7D A;  3N4M A;  3WOD F;  2OBP A;  3RPU A;  4HX7 A;  2DQR A;  1XGS A;  2X4H A;  3J81 Z;  5E1W A;  3KE2 A;  1SD5 A;  1BI3 A;  3SZT A;  1OYW A;  1HW1 A;  1EH6 A;  1W7P D;  1STZ A;  4ASN A;  2JRT A;  5BOX A;  2P7V B;  2FNA A;  3AAF A;  3F8N A;  4ESF A;  3KFW X;  1I5Z A;  3REO A;  1FOK A;  2A07 F;  2VE8 A;  4KIC A;  6PAX A;  3IKT A;  2IA1 A;  4LLG F;  2EFN A;  5HDN A;  1SMT A;  3QU3 A;  3GXO A;  1J7K A;  3C1D A;  4MHG A;  1KU9 A;  4BXU A;  4U88 A;  3R6S A;  4JBA A;  3DQV C;  2VOO A;  2MD5 A;  5D6E A;  2O03 A;  1U78 A;  1FNN A;  3MAJ A;  4UNO A;  2CG4 A;  4XRF A;  1E17 A;  1IRG A;  5FLX K;  2JT1 A;  2K86 A;  2XIG A;  1FY7 A;  3KP6 A;  3LA7 A;  4LMY A;  2OD5 A;  2H94 A;  1FP1 D;  3HSF A;  3QOP A;  2QQA A;  1LB2 A;  3DPL C;  2YU3 A;  2QWW A;  3HRM A;  4UVC A;  3BJO A;  2Q2E A;  4HX8 A;  1TW3 A;  1IW7 F;  1HKS A;  1SD4 A;  1R1U A;  3HUG A;  3ABU A;  1XGN A;  3HSE A;  3JAM K;  3JSP A;  3KEQ A;  3R0J A;  4MGR A;  1Z6R A;  4O3M A;  5L3G A;  1QZY A;  2YPR A;  3SXY A;  4L5J A;  4IHT A;  1DDN A;  1QO0 D;  4KIF A;  1LJ9 A;  4OU0 A;  2CQK A;  5E8I A;  3KP2 A;  5E18 F;  1FT9 A;  3GLX A;  2HYG D;  3QPH A;  5H6Q A;  2NRA C;  4LB5 A;  2EA2 A;  3ROU A;  4L5I A;  2VBX A;  2DK5 A;  1XB4 A;  2CFX A;  1O7L A;  5D6F A;  4EM2 A;  4HF0 A;  1G3T A;  1ZRE A;  4WXD A;  3GZ5 A;  1QNT A;  1YS7 A;  2Q8K A;  4JK1 X;  4Y13 A;  5KVR A;  1FYL A;  3B73 A;  5FB2 A;  5HOO A;  1F4K A;  5H6R A;  4RB2 C;  4FHT A;  3GFM A;  3CDH A;  2L01 A;  1G4D A;  2YSR A;  1R1V A;  1QGP A;  2O0Y A;  2WTE A;  3L7W A;  1CF7 A;  3K69 A;  4ENK A;  1NHA A;  1DP7 P;  2UZK A;  1UST A;  1YO5 C;  1R7J A;  3ZN0 A;  2PBI A;  1TQM A;  1XN7 A;  5CVV A;  4HBL A;  1BI0 A;  1EV7 A;  3SZP A;  3V4G A;  2FMY A;  4XSZ F;  4UVA A;  3WG9 A;  1XD7 A;  1G3W A;  2RNJ A;  2XAG A;  3EUH A;  1X3U A;  4I7H A;  2ISY A;  2Q0O A;  5FD5 A;  2ZNY A;  5CVU A;  2IRF G;  3WU1 B;  2QLZ A;  1BN5 A;  1GVJ A;  3TO7 A;  4L9T A;  1HBX G;  2QVO A;  1YLF A;  4ZH4 F;  1AOY A;  2VC0 A;  5DEQ A;  1XDU A;  5L3B A;  4CDG A;  1IN4 A;  3M7G A;  3W6K B;  3GVA A;  3QP6 A;  4N0B A;  1O3R A;  3DV8 A;  2VN2 A;  2FU4 A;  1U8R A;  4EJO A;  4M71 A;  1HKT A;  3J80 Z;  3GF2 A;  1P4W A;  1R58 A;  4M6Y A;  3LA3 A;  5HS8 A;  4G6Q A;  1RIO H;  3KP4 A;  2ZXJ A;  3WTY C;  1PDN C;  3FM3 A;  4ETS A;  2COM A;  4RB0 A;  2ZO4 A;  3LWF A;  1O3Q A;  4NHJ A;  5CVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...