4COOA

Crystal structure of human cystathionine beta-synthase (delta516-525) at 2.0 angstrom resolution
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
493
Chain Sequence
WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQMVFGVVTAIDLLNFVAAQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inter-Domain Communication of Human Cystathionine Beta Synthase: Structural Basis of S-Adenosyl-L-Methionine Activation.
pubmed doi rcsb
molecule keywords CYSTATHIONINE BETA-SYNTHASE
molecule tags Lyase
source organism Homo sapiens
total genus 175
structure length 493
sequence length 496
chains with identical sequence B
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4cooA03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cooA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cooA02
2J9YB 5B1HA 2JC3A 4WX2B 1O50A 2Q3BA 2CLFB 4COOA 2J9ZB 4NOCA 2RKBA 1D6SA 2QLVC 5D84A 1KFCB 3KPDA 2J9XB 2P9MA 5I7HA 2YVXA 3SPXA 2EF7A 1A5AB 1QOQB 4DQWA 3OCMA 5DW0A 2RIFA 3K2VA 3K6EA 1J0BA 3SS9X 3L6CA 4IY4A 3CEPB 5CGQB 2Q3CA 3VSDA 1WDWB 4KKXB 1C9DB 2Q3DA 1TZKA 2D4ZA 4OREX 5B55A 4ESYA 1O58A 4D96A 1KL7A 1BEUB 4GQYA 1PWEA 4ZU6X 4I1YA 5DW3A 1K8XB 3IQGX 2QRDE 2OUXA 3TBHA 1TTPB 4GQVA 1Z7WA 5CVCA 2UV6A 1K7EB 1UINA 3PC4A 1V7CA 4H27A 1OASA 1TZMA 2DH6A 2WSYB 5K24C 2GN1A 1Y5HA 3LFZA 1KFJB 4D92A 3TE5C 4O9KA 4LMBA 5HBGA 3LHHA 2CLOB 1FCJA 1A5BB 5D86A 3KPCA 4D9GA 5B36A 5K23C 2RH9B 5DBEX 4LI3X 4P1GA 3GBYA 4LMAA 4L27A 4OFXA 4HPXB 4ZU1X 4XUGB 3FNAA 5IW8A 1WBJB 4D9FA 2YVZA 1CX9B 1YAVA 3R0XA 3ZEIA 1JBQA 3FWRA 1X1QA 5E0KB 2CLHB 3IQIX 5B1IA 4IY0A 4HG0A 1KFBB 1UIMA 1C8VB 2YZIA 1J0AA 4L0DA 4FRYA 1CW2B 2O2EA 4Y6GB 1QOPB 5IIPA 3BM5A 1TTQB 4HT3B 4NU8X 3VSCA 5JJCA 2YZQA 3IAUA 2GN2A 3AEYA 2BHTA 1J0CA 3KPBA 2QRCE 4IYSA 5DBHX 5BW6B 2EFYA 4HPJB 2QH1A 2O16A 5I7OA 3RR2A 3X43A 4D9EA 2ZR8A 2PQMA 5KZMB 3FWSA 3OI8A 3FGPA 2C2BA 2CLMB 3LQNA 1Y7LA 3KXRA 3L6BA 3T4NC 5D87A 4L28A 4FXSA 2OOYE 5JISA 1KFKB 1F2DA 3DWIA 2GN0A 1K8YB 4D99A 4PCUA 1BKSB 5KINB 1K7XB 1K7FB 2UV7A 3OCOA 5K25C 2DH5A 4JBLA 2V03A 1K3UB 5J43A 3HMKA 3X44A 2UV5A 1TJPB 1VE1A 4D9MA 3VBEA 1A50B 1PWHA 2ECQA 1VE5A 2CLLB 3PC2A 4HO1X 4JBNA 4F4FA 1Z7YA 4D9KA 2TRSB 5I7RA 4P1OA 2C2GA 5J5VA 1E5XA 2D1FA 4D97A 2CLKB 5KS7A 3ORGA 2ECOA 4UUUA 1C29B 2TSYB 2UV4A 1J0DA 4D9NA 1PVMA 2O2JA 4NEGA 2ZPUA 5EY5B 3VSAA 3IQHX 3L31A 4D9CA 3PR2B 5B3AA 1V71A 5DVZA 2RIHA 2ZSJA 5IXJA 1UBSB 5B53A 4QYSA 4ZQCB 5I6DA 5C3UA 1TZ2A 3R0ZA 2BHSA 4AIRA 3L2BA 4D9IA 5T6MA 3I8NA 4IY2A 2RHGB 4IY3A 4D9BA 2ISQA 1XKFA 2RC3A 3SL7A 4GQWA 3SS7X 2YVYA 2CLIB 3T4PA 3FHMA 3DWGA 2EMQA 3VC3A 1M54A 1A5SB 4D8WA 2EGUA 3FCAA 1P5JA 5LXQA 5I7AA 2QREE 4IL5A 4HN4B 1FUYB 3HF7A 3PC3A 3FV6A 5K22B 2ZY9A 1PBJA 3KH5A 4L3VA 4D8UA 1J0EA 3V7NA 4AECA 2NYCA 2TYSB 1VB3A 1TDJA 5I7WA 4ESYB 1WTCA 3TDHC 2OOXE 3DKIA 2QR1E 5IWCA 1TYZA 1TZJA 3AEXA 1RQXA 2CLEB 3DDJA 1K8ZB 3L6RA 4D8TA 5D85A 3LV9A 1KFEB 1V8ZA 1WKVA 2NYEA 2PFIA 5MMZA
chains in the Genus database with same CATH superfamily
5AQEA 2QORA 5LJIA 1BEEA 1IHXA 2E1RA 5BQPA 4N0DA 1EK1A 4IVPA 2PBRA 4UTNA 5IT4A 1AZSC 1BRMA 3MTQA 1MB3A 3KHKA 3A36A 1PFVA 1G59A 4ON9A 4HXGA 1EBFA 1R4AA 2D5CA 3RVPA 4L07A 4C43A 1U3TA 1BE0A 1SG6A 4ITRC 1L1FA 4ZI3A 3MQFA 1TNDA 1WMEA 2FSIA 4IRMA 5JD4A 1Z08A 1JDPA 3ZC3A 4KTVE 4MV3A 4XVQA 3AVYA 3HSKA 1FEZA 1C8KA 4WXMA 5LQCA 1NKSA 2B1IA 5AHKA 1T6ZA 2VPTA 3TIXB 4IWNA 1H6AA 1ICIA 5HE9A 3I6ZA 3DBRB 4IH1A 1JEQA 1N9GB 5IMBA 2POCA 3UCFA 3AF4A 5TPWA 3ADKA 2G36A 1VCIA 2DB3A 4GQBA 4DJFC 3KKKA 2GPYA 4TN5A 2FWMX 1UEIA 4A7PA 1V1MA 1QIHA 3F9RA 4GYJA 4K3VA 4BIIA 4Z8YA 4UQLA 1ADYA 2VHTA 4Q3CA 4TPKA 1P29A 1A7UA 2BCJQ 1W9MA 4MUAA 4OXIA 4YXFA 4BFYA 2XECA 1ZGGA 2XD9A 1EX1A 3AUXA 3OPVA 4UUPA 3SLGA 1PEKE 2WG2A 4HZUB 3A26A 3K0AB 3PWKA 4JS0A 4YR9A 4B4WA 3DZGA 3HJGA 3PTLA 5B55A 3TD2A 3M70A 1O58A 3NHFA 4ZI7B 4GKAA 3A28A 3WXMA 2AOUB 421PA 3BDVA 1EBUA 1MAUA 4FYJA 5JI3E 4X1KB 1WLYA 4UPEA 3LRPA 1X92A 3ZHTA 6ABPA 3NBZC 4DV5B 3E9YA 2IQ5A 4MPJA 5F9FA 3N0WA 1NI5A 3WMGA 3DQQA 3KTFA 4FDUA 4EI7A 1CV2A 3AL0C 2OUXA 3FB1A 3KPVA 3HEMA 2AKAB 5H8WA 1R6UA 3WRXC 3GGSA 2HH9A 1TTPB 1X80A 4N12A 3GFQA 4J4HA 2BY4A 3DOUA 1MJ5A 3UJ6A 1IN6A 4WSOA 3UUEA 5LVAA 2VNAA 3FROA 1ZRNA 1ZEMA 5HK8A 5C5EA 3LFHA 2VF4X 4KAFA 4LPKA 4R40A 5AH0A 1QHGA 1HSZA 3PQEA 3D1LA 5DYNA 2QX7A 3NHBA 1QANA 3VNQA 2IEZA 1WMSA 4HV4A 3CWCA 4YJ2F 1ABEA 2JFPA 1XTUA 2OXRA 2RKWA 2ZCVA 3AJRA 3DEHA 1V3QE 4JXKA 1FLDA 1QFYA 1IHUA 4DANA 1M3SA 2J31A 2BMDA 1V7CA 2SHKA 1JI3A 4JB8A 1XBTA 2A35A 5TPZD 4EHBA 1DFGA 5AKIA 4BRSA 1ISPA 5ALDA 2OGSA 5HGXA 1P9LA 1EZZA 4U02A 4XB6B 2BGNA 1RQ7A 1UJCA 4XWOA 4IYJA 1ZWLA 3WGGA 3DVQX 1VJ5A 3KBBA 1R6BX 5HBGA 3R20A 4B4KA 1U0EA 5HSGA 3OG9A 4K9KA 4CG0A 3F7MA 3LIPA 3W05A 4BCCA 2XQVA 3U4IA 4N7RA 1M0WA 1G0NA 1IU9A 2B1JA 2G80A 3JS5A 2H7CA 3KD3A 2XMDA 1OB5A 5G0SA 3Q7TA 1TADA 2VT6A 2IYWA 3L7BA 1V4NA 5EMJA 2PUTA 4LOKA 1ORVA 3ZYZA 4DLPA 3H9UA 3AIMA 1VP3A 5FCDA 3DMFA 4OQNA 5CBKA 4PC6A 2FPPA 1SXJE 5BQ3A 1YQWA 3TD9A 3OQIA 5GVSA 3SHTA 1J09A 4MPDA 3QNUA 3K73O 1T5DX 4HQ0A 4J1QA 3D2AA 1XTJA 4MKZA 3WL3A 4NFSA 2ZZMA 2DJ5A 4QVKA 5CT5A 4F56A 5T3YA 3SC4A 1D2AA 4L4XA 4OGKA 2N9UA 5TQ0A 3Q40A 1Z0AA 3AVWA 1J8VA 1XZDA 2WHPB 1W88A 3Q72A 3DTVD 4PHTA 3U1TA 3WIEA 2EBFX 4JJGA 4TV9F 5F1YA 1G8JA 1KRXA 1VJRA 4K6KA 1FSGA 3GLGE 3U7QB 3ZI4A 1JSLA 4E1AA 3ZEIA 4X61A 1FP4B 3WMEA 1XKXA 1VPTA 3W4IA 3FWRA 1B43A 1TYCA 2H2DA 4RV5A 3KLNA 4QSMA 5E0KB 4IV0A 2X3YA 5DHAA 3DOIA 4E2WA 5A71A 5JFOA 3CVXA 2X7HA 1DXQA 2IXEA 3COYA 3PFGA 1AJEA 5FNVF 3CC8A 3V80A 1JR6A 3LPCA 5CB0A 1PSWA 2Z8ZA 2F1KA 3LY7A 5CX1B 4FLMA 4L7QA 3DE7X 2NX2A 2ETVA 5EIBD 7AT1A 5IN4A 2JD0A 4U39A 1KVTA 2BL4A 2ZBRA 3D3QA 1MU0A 3RABA 4AF7A 4E3WA 3V97A 2BMFA 4OFBA 4ND8B 4L0DA 2N42A 3BQNB 5A2GA 2VDPB 5A9RA 3PJEA 3MOSA 4ZEMA 2IZ5A 4WLVA 4JCOA 4U6SA 4KPFC 1Z6YA 1X7GA 3V8MA 1K0FA 1DKPA 3F6BX 5F3DA 5B7GA 3BSWA 3PV0A 3GROA 4CIXA 3ZVLA 1DELA 5BMVF 2WYOA 2DWUA 1Z0DA 3F7OA 3DFFA 5E2IA 1LDBA 2NNWB 3KU4A 2MDTA 4IX1A 3ZIAD 3OP4A 5J2TF 1ONSA 3BM5A 4PQGA 5JFGA 3NBXX 5BV8A 2RD2A 1I3MA 3C43A 2W71A 2YIMA 3ICPA 3EIFA 3JQBC 4WJZA 4LDJA 5LYYA 2RHDA 1Q0UA 4CKCA 4LGYA 3OU6A 2K4MA 5AUNB 3ZJUA 1RC0A 2ZRGA 3MUFA 3VPDA 1G8AA 3UXEA 3N2EA 3AUKA 3WR5A 3ZJTA 4IYSA 1SKBA 1Q16A 2MSCB 2GN9A 3HR8A 3L8EA 1BE8A 2C03A 3LOUA 4RDIA 3TCKA 1LLFA 4DG5A 3A4NA 1YQUA 2YJ4A 3DLAA 4PAQA 4Q21A 3LQ2A 2IH2A 1IHDA 4KYVA 2OLKA 3M8KA 3DULA 1DADA 3QMPA 2P77A 2EJWA 3H04A 4LJ5A 2QJWA 3F1LA 1MEOA 4AJHA 3O21A 3IALA 3RYFA 1DIBA 3EK2A 3NCTA 3S55A 2AZ4A 3G2QA 4UVHA 2MINA 4DA6A 5ALWA 3ULKA 4X8HA 4YJ3B 4CL8A 3D3WB 4KNVA 3WGHA 4B6SA 1O97C 4DA4A 3BMOB 3UMSA 3JD1A 3T8YA 5IDWA 3VPFA 4C2UA 3VI4B 3WLKX 2W6NA 1WCIA 1OXBB 2O3RA 2YRFA 3LOQA 4CKWA 4Y9DA 3UK2A 3N74A 2VTEA 4L22A 5JRDS 2WRZA 1K98A 3PYMA 4KXYA 3RTCA 2GBLC 1MBZA 4EVSA 3SWWA 4P4TA 4A23A 5A62A 1NL3A 1L5FA 3RC8A 5ALUA 3MLBA 1YF3A 3BEOA 3WNBA 4BEJA 5G0VA 3D8SA 1SZDA 2ZAOA 4BUZA 5B12A 1P4RA 2I3BA 1MA0A 3GRFA 1GPUA 3GEEA 5DTQA 2BE9A 4CLRA 4MV9A 5SZIA 3VUFA 2P3OA 4LHXA 3ZHSA 5KYKA 2V03A 1D7OA 3MWDA 3QVGA 3WB9A 3ZD9A 5ED0A 1NGSA 3ZIUA 3GFPA 1ZXXA 4YALA 1KI4A 4DV4B 3KCNA 2B6NA 4I4TB 1MG5A 2BBSA 1TJNA 2GCOA 3HUFA 4RD0A 4PG7A 1YK0A 1JA0A 2OSBA 1JFTA 3BT7A 3CEJA 2YICA 3DH0A 1VE5A 1H4VB 2PKWA 1PSZA 1A27A 3T3MB 3PC2A 4M22A 4BVAA 5E6SA 3TEFA 2D4AA 2ECFA 3WMFA 4DSUA 9ATCA 3MRTA 4BXOB 2HPAA 5A9TA 3CX4A 5KTKA 2MWMA 3O8BA 3II6X 4FINA 3ANXA 2X0IA 2DFKB 5FADA 2QWXA 2CD7A 1VMEA 3QFTA 2V6FA 3LA8A 5CLIA 5IDVA 4RGVA 1YS9A 5CA1F 4HGNA 2C78A 3GNTA 4XCVA 1PZEA 2VOJA 5K0EA 4CN8A 4B7XA 5IKXA 3GLKA 3ADCA 4C4YA 4L5YA 1TT7A 5ALGA 1GRVA 1XB2A 2IYEA 3H8SA 1J9GA 1SUPA 3PWZA 4AS2A 4UEJA 4Y2TA 3UW1A 1J56A 1OF1A 4CEHB 3RW9A 2ORYA 3E82A 3O3CA 4FW9A 4NCNA 4XE5A 5KS7A 2J0UB 3QI7A 4CMIB 4QPNA 5BWMA 1UQUA 1LD3A 3IDSA 5E2BA 1B6SA 2R5NA 2CUNA 1Z88A 4HNQA 1P9RA 4G5RA 2R1TA 2HZBA 3JX9A 2GPWA 1O5IA 3ZV6A 3OM0A 3SJUA 2ZAMA 3HY3A 2YRXA 1R0BA 2J9LA 1E9CA 3BMQB 4WKBA 5TT1A 4B40A 3H11B 1T6BY 4J0IA 1EUCB 3PYLA 2EBUA 5AHOA 2LZ0A 4V2UA 4Z9BA 4U8GA 3KTAA 5A4MS 2WM2A 1NXOA 3LQRA 3R7DA 1EXVA 4UQOA 3GAMA 3V1NA 2ZBGA 1A9SA 1M2OA 2UVQA 2Y1OA 1FSPA 1UWLA 4I2VA 2BTOA 3MGGA 1KDRA 1YOBA 4TL7A 5EVJA 3U9SA 4KVZA 1V96A 5DX8A 5DVZA 4CE6A 2UXCB 1TK3A 2H8GA 1I10A 1V0JA 3TNYA 4W82A 1GCIA 4MP6A 5E9AA 3KM0A 3ZDZB 4BO4A 4GS5A 3IUYA 5HJEA 2IS2A 2UUAB 1ZPDA 1PR0A 1ZW1A 2HRQA 2GYUA 2P9JA 5AI8A 4CJXA 4O2AB 1MNAA 4EB6A 5ETJA 3QF7A 1B16A 221PA 4KDCA 3N7AA 4XWYA 3SG0A 2HNKA 2N75A 3F4LA 3IE2A 3PFHA 5KQSA 2Q27A 3HVJA 1KJIA 2W6JA 5HNKA 3I9MA 4TUYA 2C7GA 1SUSA 3FCSB 1J7JA 4KE7A 4XYMA 4IICA 1IH8A 3NC4A 1H93A 3GCGA 3OJOA 1SUBA 4D7AA 4YPFA 1I0IA 1K92A 2QR3A 2NYVA 1OT3A 4WTOA 4PO3X 4AWBA 5F12A 3ER8A 4DL9A 1UDRA 5F3RA 4L6IA 3EY4A 1B15A 3U17A 1MRSA 2JNWA 5IDQA 3RG2A 1RKXA 1Z8DA 5DYYA 1DDGA 1V5FA 2E4XA 2J3IA 2LBPA 4WDQA 2CZCA 2GNPA 3CZRA 4QJ3A 1RMQA 3JWIA 1JHMA 1OSNA 2D00A 2GASA 4RLFA 4XYBA 3H13A 3KEGA 3VO9A 3QU9A 4PAWA 2AOTB 3OOHA 4DNQA 1M0TA 2Y67A 2UV8A 3FWZA 4Q4AB 4BYGA 3UAWA 3CX7A 3GP5A 3BF7A 4MQBA 1GCGA 3NTXA 1QYRA 4U2CA 3S4YA 4L4ZA 2R65A 3DZBA 4CG3A 3L8HA 1GQSA 2VH2A 4MITA 1JS1X 3LQQA 5THQA 3DWGA 3M6MD 4K28A 3RC9A 4ZI7F 3FOEC 5B64A 1W8IA 1VG8A 2Z5LA 4PTZA 1A5TA 5HXAA 3I12A 1ZK0A 3O2QB 2YN4A 5B3LA 1QLWA 3HN7A 4REOA 3BXPA 3O8NA 3P1JA 1NLYA 3OE7A 1JKJB 1KAEA 1NW4A 4PWZA 5F23A 2IXFA 1BU5A 1PJRA 4ZVUA 1VCMA 2WTXA 3EQZA 3K9QO 4DLRA 1NSYA 1RAFA 2REBA 1QQ7A 4YEDA 5G0WA 4G4JA 4LJ7A 1W87A 3KFLA 3OZXA 1HF3A 1CUUA 3VOSA 3H3JA 4O5AA 4ZCPA 4QIHA 3CT6A 3EVCA 4QO8A 1ADBA 5FXMA 1Z28A 3A3NA 2XRMA 4ZK2A 4MVYA 3ZJVA 1N8TA 4EG0A 2WJAA 4GZ3A 1MX3A 1Y1LA 4EGFA 4HK4A 4ID3A 4L3VA 5KNDH 4UZSA 1HE2A 4Q93A 2FFJA 5K9ZA 1D5WA 3QUSA 1KYZA 3R5FA 5DM4A 4ALIA 2OXFA 2WF7A 3LUBA 3OWOA 3IP8A 4GGPA 2XMCA 4MGKR 3SYNA 2R97A 4AECA 1T6YA 2AI2A 3A9TA 1O5TA 1CVRA 3FOCA 3VU1A 4ZJUA 1BVYF 3ND6A 5HPYB 4OHFA 4UTVA 1GKYA 4IXNA 5DK4A 3FMIA 2C3UA 1JQBA 4GM0A 1O8CA 4QT0A 1M2NA 1XWFA 2OD7A 4LXHA 2Q4BA 3QKSB 5IZCC 2C3PA 1DAPA 3D3NA 1A9QA 3HR7A 4Y9TA 5CK5A 3ZBUA 1V5EA 1Z4KA 1TQHA 4KUGA 2WF8A 3H65A 1GTSA 2ERCA 3VU9A 4AMGA 2ZITA 5CW2A 1RW4A 4HDKB 3TSCA 1DC3A 4GPAA 4H1HA 3H99A 1QLJA 2I33A 3T54A 1E98A 4QAJA 1JEDA 2GA9A 4BJ6A 3RCBA 5LP6B 2UUCB 2P5YA 2Z3ZA 3O4JA 4OY3A 2WABA 3NATA 5G1PA 3C1AA 3ER6A 2AI3A 2PZ8A 3E0QA 1NPDA 2BBOA 3HKEB 5D5PA 1ISFA 4HR7A 4OXQA 5A3RA 4LYJA 1I14A 1V95A 2TMKA 3VRHA 1RYFA 1MOPA 2F64A 1XO1A 2VA8A 2WWTA 3BXZA 5K51A 1JTFA 3T3EA 3W6ZA 3VYUB 1JPJA 4C0LA 2OGZA 4QUEA 3AP3A 1YA4A 3I61A 1KI1A 3LLUA 2YVLA 1JR3A 1Z4NA 1V11B 1J2UA 3QKTA 3LJKA 1D6SA 2PUWA 3ZUGA 3JVVA 4BMVA 2QRLA 1L3CA 4M0KA 3U3DA 2YNMC 1I6WA 1YJ5A 4KZKA 1TEZA 4F2HA 3WOHA 5GY7A 1H9CA 4L9WA 4M4SA 4G01B 3QKWA 3WV5A 4KIWA 4P7JA 3ZHZA 2VL7A 3ROTA 1PLJA 2GJAA 2CUZA 4ZAWA 2AD1A 1JBEA 4O4HF 3HZZA 3ABZA 4GOKA 3OCWA 3FYUB 1G2IA 4UEWA 1F5SA 4CBVA 1LA2A 5AKZA 2G5TA 3ZX4A 5K6AC 3TBFA 5KX5F 3U39A 1NC1A 3QVMA 3H5OA 2YFYA 3HXKA 1PD0A 3LVQE 4PC3A 3K2VA 4YAJA 1X86B 3QE2A 3HVRA 2YIJA 1O54A 1KJJA 2O8FB 2EKQA 1IBSA 2B4YA 2C9MA 2ZRLA 3D6MA 4QU0A 5I9TA 5SYAA 3STXA 4NEQA 5AW4A 1XYVA 3PHIA 4MYUA 1L7QA 3NUZA 2ZE5A 3OD5A 1Y8AA 1MG0A 1YUMA 3ORQA 3OO1A 4D79A 3ER9A 3DBOB 4D2IA 4IIDA 4ENWA 3AP1A 1DUVG 1GEEA 4EZEA 5KQLA 1RD4A 3TQSA 3I92A 4WDRA 1U8UA 2W93A 1TXGA 1PLKA 4DV1B 3GFRA 2FAXA 4CF6A 3IP5A 1CDEA 3TTYA 2QX8A 3FF4A 1QV6A 3KPYA 4BX2A 3WTBA 3CXUA 1GUFA 1OI4A 3GEGA 5BN5A 1D4AA 4GC5A 3D59A 1X8XA 5HJ5A 3I01M 1CB0A 3QNWA 3FDZA 4V1CA 4BEBA 1S7GA 3DOOA 1LQUA 5IAEA 3VPAA 1IYZA 1VMAA 1DRKA 2V97A 4C4RA 4OLFA 4O4LF 1ODJA 2G76A 3GD5A 4JL8A 3NNNA 4I08A 4OBXA 3PWTA 4Q03A 4CF3A 4JZYA 3LO5A 1KBZA 2EDAA 1JJVA 4FNMA 4BC1A 5M2QA 5U1PA 3B6ZA 1VL1A 2O6HA 4YGYA 3AOGA 1OLSA 1UBJS 5P21A 5L4LA 3ELWA 4ER3A 2P78A 2H06A 5GV8A 1AKYA 1GUAA 1TM1E 2X8WA 5EQFA 2FFRA 2J5XA 4L9SA 4FZVA 1NA5A 1YRLA 1UM9B 2XXJA 1QGDA 2O8DA 1PGOA 5EIEA 2CDCA 3V3KA 2KSQA 5AI0A 2PMKA 3OIVA 3R40A 1Z2DA 3BMXA 4DPMA 1W34A 1OHHA 3ZHBA 1E1DA 2B8EA 5FBWB 4DLWA 3FPKA 3CV3A 3D8UA 1XZJA 4I9GA 3U1BA 2CBZA 4EUEA 3KVVA 1FDSA 4YJ3F 3VU3A 3RTDA 4A8JC 4C05A 1FS6A 2PX5A 4JVMA 4P08A 1ZIPA 1V5GA 2O8FA 4L4YA 2HF8A 2Z1NA 2QX6A 5K8IA 3OJWA 4YBRA 2C82A 4K6FA 3INRA 5JAHA 4LZLA 1QP4A 4NF2A 4DMRA 3F3MA 3W1WA 2JI8A 4QPJC 1E1RA 1FMLA 3TNJA 1DEAA 2A8YA 3WDSA 2WFZA 1CDDA 1AGRA 1MHTA 4PGFA 4BBAA 4IV8A 4BNZA 3I01A 2GTPA 4K0RA 4RA6A 4QPPA 4EKEA 3TUJC 1EMDA 2P5TB 5KKNB 1P9OA 1AF4A 2NZJA 4DUYB 5KQMA 2VLBA 3U7RA 3Q6IA 3UQZA 5KMGB 3DC7A 1MRZA 1ZUWA 1I30A 3OQJA 4TLEA 4AC9A 1UDXA 3THXA 4S1PA 3P71T 2E2WA 1MIOB 1U3WA 3ISVA 1PJ2A 3QTBA 4J90A 3TJMA 3WKAA 2QAIA 4C3OB 2QL6A 2IT1A 1RHRA 3P0IA 4MQ4A 5DX1A 5B4UA 4LV5B 4I4TF 3O74A 4XFDA 1WL8A 1ZGBA 4ZO4A 1KE2A 4LJAA 2BBWA 5KQRA 2VDJA 2ZWIA 4A5SA 1U5BB 2I99A 1B73A 3W8DA 5IAJA 1X1QA 3JYOA 3T3IA 2I66A 3CRMA 4G9EA 4BUCA 4A2PA 3BIWA 1K8QA 4RDCA 2KW5A 1BW9B 3GO4A 3V8VA 4JLDA 5B6PA 3BGIA 1BQ4A 4DDVA 4I1VA 3TI9A 4DWOA 3CX3A 4WQMA 2IHNA 1SMKA 2IBSA 1E5DA 1NF3A 1C8VB 2GCIA 3H3XA 3LBIA 4OI1A 1C1DB 2WWRA 1GDTA 1RADA 3PPXA 4CN9A 2B37A 2X86A 1JU4A 3NBMA 3N7UA 1QGAA 1UFQA 4R8KA 1OLOA 3SC2B 1SUEA 1U2DA 4PC2A 3KJNA 1MB0A 3KKQA 4NFYA 4IQ4A 4ZT5A 1EFHA 4QYIA 4ML3A 5K09A 4AWAA 3ROXA 1ODCA 1H4QA 1OXVA 2PT9A 1TF2A 3OT5A 4GZLA 1A9XA 3RHFA 2ZJYA 4G5FA 3LTNC 4HSGA 1TC2A 3NDIA 4TWZA 1RI1A 4ZV9A 3F3KA 2IHUA 5SV2A 1XLTA 1Y1QA 2PYZA 1KO5A 3G85A 3TPFA 1C3LA 2GCPA 4XIJA 2GM9A 1UZUA 4M7WA 2WG1A 1TUEA 4U7WA 4YJFB 1P0QA 3NAZA 3BKWA 4MUYA 1PDVA 4YO7A 3R2JA 4IJWA 3JARA 3R44A 1XZGA 3GGJA 1T2AA 2V96A 1KR2A 3SFZA 1YSCA 4RDHA 4UULA 3BIOA 2HMVA 4QBHA 1AHNA 3BIFA 4BNLA 1Y89A 3NWEA 2OFOA 1LPNA 4MLPA 3CVJA 3LHFA 5IWAB 2QPAA 5JXIA 1YGPA 4C29A 4ZZ3A 3SOPA 1SD2A 3H5WA 1UP4A 2DR3A 3DCYA 4HGZA 4J4TA 2OC4A 4KFTA 4RKRA 4NE2A 4Y2YA 3UF0A 3GT3A 5CCXA 4AURA 3UM9A 5BW6B 1LPPA 2QRPA 1ZAYA 2HRRA 3ZVMA 3CRVA 1Z2OX 4FMCB 2R8EA 4WGFA 4E7PA 1EWTA 2FUCA 3ESAA 3I6YA 3NHUA 4LY3A 5ALKA 3EC7A 5CG2A 4I8IA 2Z6VA 1NW3A 1OFIA 3MWEB 4HEQA 4TMTA 4YR7A 4K9DA 4BFSA 1GNLA 1LSUA 3ZWMA 1EFTA 1T1SA 4CQLA 4O2AF 4EVQA 1E2MA 4UCFA 3CNOA 3TIFA 3QRWA 5LQUA 3M6AA 1PR3A 3AR2A 1FVHA 4MMZB 1JMKC 1E1LA 2KPOA 1KDOA 1NQOA 2VPPA 3HB4X 1KK1A 4JU9A 4NYIQ 5CH8A 3VC1A 5IXSA 2FG7C 2HR1A 2CLMB 3P4UA 4TYYA 2J9FB 2LD4A 3K6KA 3O4GA 4R6WA 2BD0A 3WWYA 3FVVA 4M7PA 3PJRA 4N41A 3L7AA 2PSFA 2PR7A 1E9BA 4EB3A 4PPQA 2C84A 4LZOA 4DNXA 2P30A 3OZTA 4KRYA 1NUPA 3I9LA 4H6XA 1U28A 2RK6A 3SZMA 3EULA 3NJ8A 1T0IA 5EZYF 2P8SA 3AKDA 2RH5A 3TZKA 3L8MA 1YHZA 5A6SB 3E70C 1I7SB 1PYDA 5H9VA 5C51B 4TQGA 2RAVA 4DR4B 5EFZA 1THMA 3OT4A 1FTSA 2W6ID 3L02A 4Z4GA 4HXEB 3V6LA 3C7DB 3OZCA 2I9KA 2C88A 1NJ2A 3LUGA 4C0AC 1KZ9A 1JNYA 3UBMA 2DWCA 10MHA 2IS6A 4FE4A 4MR8A 3VHXA 2HSGA 4WIAA 2MYPA 2RGGA 3RU9A 3FLEA 1YRWA 1NT4A 3P2OA 5TMDA 5EQDA 5C37A 2ZRNA 4YTEA 4ETIA 4AJ1A 3QXGA 3B52X 1N8KA 2FX3A 4RD2A 4GLLA 4ENRA 4G1UC 1FXUA 1TAQA 1U0HC 1X9GA 3NAGA 5EIFA 3WWZA 1SXQA 4J1SA 1UL1X 1V3UA 2O0LA 4L16A 1KHTA 4MVJG 4AYWA 3ADDA 3H17A 1YR2A 1GCUA 3PUHA 5BT9A 3CPEA 2G0NA 4UEKA 3CZ4A 4YRDA 5TR9A 5EPOA 4C3UA 4WHMA 4RORA 1KRWA 3KOUA 2WE8A 1SB9A 1W1IA 2PM8A 2V0CA 4I5GA 5C5DA 1HNXB 3LI2A 4WCFC 3KJGA 1H2HA 2IYPA 2W43A 4FEAA 1JHQA 4V39A 5EJEA 2W4QA 3CBGA 1XD2B 5DT9A 3SNKA 3WKDA 4TKUA 5JSKA 4Q1AA 1CJSA 1J06A 4W6ZA 5J47A 1Y8QA 3ED1A 3UT6A 1C4WA 5DNUA 3LTEA 1K6MA 4KQEA 4F2WA 1YIDA 1XD9A 3EGOA 3SFTA 3EXHA 3GFTA 3JAWA 5AVVA 3GLIB 2QTHA 5CA0A 3D0RA 3LYUA 3FM9A 3T5DA 3W3AD 2Y77A 4PO9A 1S2IA 4QAQA 2ZXUA 2ECOA 1L4KA 2D3TA 2I6QA 5CHYA 2WW8A 4N82A 2X40A 4OG2A 3BUSA 1GN8A 2RHHA 5DT2A 5L6MB 4O4JF 2R6DA 1QE3A 2V7TA 4DR7B 2QD4A 2C9OA 4PGAA 3I9KA 5KAPA 4D9NA 2VHQA 3GEDA 5LP6F 3F9CA 1X0VA 2ZRQA 2X7XA 2OPBA 4UC0A 1IBLB 5JDIA 3HV0A 3GJTA 2P6UA 3NM6B 3TQTA 4KP7A 2X23A 4YT8A 2ZRFA 1MNQA 3FZEA 4A0FA 4NEGA 3TXAA 2AG5A 2JARA 1O94C 1N7HA 1Q1GA 2PZLA 2QE6A 2PKXA 2ZPUA 3M6WA 4ILKA 4MUMA 1YS7A 1F51E 1Z29A 5CDFA 1UXIA 5JU6A 3GRCA 3K0CC 3PIDA 3JCZA 1R8SA 5AW9A 4EA9A 1VYHA 5BW8A 1CRZA 5KVVA 5JS6A 5BRNA 2IA5A 3MQ4A 2ZVJA 4LWOA 5CFMA 4FWIB 4GEGA 1SBCA 4IOLA 1Z5VA 1E3LA 3EEFA 1ZOLA 3AUSA 1KOGA 4CM8B 1EUYA 4LDPA 4B1FA 4O2LA 4OYYA 1ZCAA 2ABWA 3UAGA 1QYWA 4OK3A 3EGEA 2O2CA 3G13A 4YP1A 3TECE 4N3BA 4GMGA 2I80A 3NG1A 2OCYC 3VO8A 5J2TA 1PS8A 1OU0A 3UK0A 3W2FA 2I4OA 5K5EA 2M1ZA 1E1YA 3ICOA 2E21A 4MWDA 5T6BA 2OAEA 3RSGA 2E18A 2BR3A 4NK4A 5IEBA 1H8EA 1ATIA 1DAIA 3SHOA 2ACKA 4HB0A 3U4CA 1R12A 5CMLA 1QHEA 4POAA 4RMHA 4RSMA 4M86A 3FPBA 2IXTA 1JUDA 1R74A 4RLSA 3SBEA 1FFSA 3EA5A 1NVEA 4LRSB 4KX3A 5T67A 5DM70 4KE6A 2QBYB 4TS4A 2P2YA 5FUVA 5FX2A 2CXNA 3KIPA 3N2ZB 2WJJA 1LLCA 4YAGA 1I0ZA 3ZWKA 2O2SA 2ZI5A 4JASB 3RYCB 2FWNA 2O5VA 1OXXK 1KZ4A 1GIAA 1UBEA 2IGBA 3IOEA 3IYLW 3RSFA 4Z4CA 1BXGA 1Y7PA 1GT6A 2AN5A 3AT1A 2VBIA 4MIEA 2PQ0A 2L42A 4B3BA 4CNBA 2CL0X 2ZTLA 3GDFA 1FX0A 4KLRA 2IVFA 3DMTC 3E5HA 3HB7A 5HBRA 3PIIA 1FRQA 2R8BA 1Y3FE 4MRPA 2DY1A 3T5TA 3VR5A 1QH1B 2AOXA 3L05A 1P7WA 4HH1A 3A14A 2XT9A 4KLCA 1QRUA 2A9RA 2RFLA 2VJMB 1WUKS 1NOJA 3IO5A 3ANSA 1C9YA 1WXEA 3BTOA 1K9SA 1WHSA 4QOGA 4UOEA 3K70D 1QRAA 1PNRA 3T7CA 3GCZA 3PFNA 4M0MA 2XMPA 4J0KA 5DNEA 1ZHHA 2HLDA 3BCHA 5DHFA 4AJOA 1N1DA 2WWIA 5D00A 1LW7A 2ZY9A 4F85A 2OORC 1Z45A 1SURA 2BKLA 2QRHA 1X1AA 4J3NA 2ZIUB 4S1NA 3L4JA 1ARZA 1DKNA 1KMMA 3RT1A 2ZIVB 5DGTA 5JHGB 3ST7A 4MI3A 2JHFA 2CK3A 3PKZA 2B8JA 1IRIA 1FK8A 1P3JA 4Q02A 4B31A 5A5DA 4OOFA 5DASA 3WIDA 4E32A 3BE5A 1TDJA 5KQGA 2QRMA 4U7HA 1VC2A 3ZDYB 4EBFA 4J94A 5HFJA 1BVHA 1SU4A 1VDZA 4Q4JA 1E8MA 5JH7B 1UXGA 5EHQA 3RANA 1IOWA 3PXAA 2PZJA 2QR1E 4JEHA 2CV1A 1NLFA 5IWCA 1G2QA 1JXAA 3F3YA 1AQLA 3KP1A 4RY9A 3TB4A 3CSUA 3T9CA 4E15A 4C7XA 3DBLA 4LJ9A 1ZIYA 3I42A 2NM0A 1UMDB 4GQIA 5K8TA 4M2LA 1B1AA 2QD2A 2PG3A 4GVPA 4QOFA 4J4BA 4M99A 5PNTA 3V46A 2IHZA 1G2PA 4YJ2A 3WL6A 3MEQA 1GGFA 5FPYA 4AKSA 3UHJA 3PX3A 5ILQA 4C6SA 3T7KA 1T9ZA 1G1MA 2NU8B 1FFDA 1CUXA 2ORED 3TLZA 2AZDA 5DP2A 3VYRB 5COBA 3QWAA 2WTEA 1T35A 4IDHA 3ETGA 1RSZA 2NT3A 4FR2A 4J07A 4D8YA 1G21B 5IZCA 2P40A 2VRWA 1IY9A 3D64A 5L53A 4O2RA 2A9VA 4DLUA 1MXHA 2R4TA 2ZWPA 1HDCA 2ZXFA 1XKQA 3Q3EA 2XVXA 5C34B 2IYAA 3U13A 1TMOA 2CSUA 3IR5A 3TI7A 4BVKA 1C0LA 3M49A 4WADA 3ICCA 4I0WB 3PF8A 2YZMA 5DK6A 5CPFA 4I1PA 4RS3A 2IK8A 1U9CA 1OH7A 2FZVA 1A82A 1GRNA 2WSMA 1OY1A 2X5KO 3B5IA 5T8KA 3E9ZA 1HDXA 3FHJA 3E23A 3ENQA 1FMCA 1MB4A 2O19A 3ZCVA 3IIKA 3LO8A 2XCIA 2ZYWX 3M33A 4EY6A 2A9QA 2WY2D 5DW0A 1N6OA 2V4ZA 2XNHA 1CFJA 2C5HA 4BJ5A 2ZUFA 1PVVA 3IR7A 1YDGA 3KUDA 5CDUA 1FYWA 3TGPA 3O92A 4LRQA 1CY0A 5EJGA 2BWJA 4ZYTA 3NRBA 3H7AA 4JLVA 1LU9A 3QWFA 1QPZA 2HWKA 3O31A 1JVNA 5C8YA 1YVDA 3WAKA 4A0RA 4DYVA 1U3DA 1F2UB 3OAAD 1SCUA 4GR9A 4C5BA 2F1OA 3FOFC 1ICEA 1W35A 4KFCA 4MMYB 1U8CB 2ALJA 4TV9A 1ZJYA 3EGDA 3KZOA 2PSEA 1DG3A 3PNSA 2BE7A 3SQDA 4QJBA 4YUYA 2AW5A 1A4UA 1MGPA 2D1YA 1L5ZA 3DUFA 3G8YA 2UZ4A 3PLAE 2AJTA 1ILEA 1LRJA 3GB9A 4RH0A 1I6LA 5AJYA 2B3DA 2C9DA 3ZD7A 5KKCA 3WYDA 2C94A 2QI9F 2VR1A 1BEUB 3OECA 4ZICA 1IEWA 2ONCA 3D6HA 2ZANA 1KF0A 2MSLA 4JAVC 4CCYA 4XDHA 2NYRA 4FT2A 1D4FA 2GPJA 4BN4A 2F6RA 4BWYA 4ZAXA 2GK4A 1JNXX 1R6AA 1WY5A 2HK7A 1YDWA 2NTYC 3IQGX 4XTCS 3VVLA 1Q0TA 1RPTA 1ZX1A 3LOPA 2LCQA 1V47A 4XI9A 1JMVA 1P1JA 5JXWA 1E3IA 2XUIA 3EZXA 3TOZA 4DYHA 4AZ0A 4RFSA 2HRDA 4X60A 5HFNA 3W5HA 5BMVA 3UBTA 4M0FA 1N0WA 1P77A 2RHOA 1A9RA 4LXTA 4HX2A 1T9CA 2C2XA 2UV6A 1F2TB 4FMCF 5E7MA 3BTVA 3VISA 1PWYE 4HNTA 4AI6A 4HAZA 3QE4A 3I30X 1V8BA 4EG1A 1CKEA 1II9A 1YDMA 4X1YA 2B34A 2IDKA 3FKQA 3FNRA 4ZODA 5J63A 4E94A 2HWUA 4FGJA 2FSFA 4RETA 4JKOA 3F3SA 4YPVA 5EJ4A 1PGQA 1Y7TA 1K6JA 1T3TA 2B92A 3SYMA 3WKBA 4ER0A 5C5IA 4B73A 1IZYA 4RADA 2FP4A 4CLXA 2B35A 2O7RA 3HY4A 4LTNA 1VL8A 2ZCUA 3HU5A 2ZSBA 3V2IA 2G06A 1WO8A 3ZWXA 1N7JA 3CLHA 1QGOA 3HR4A 3LKVA 4Z3DA 5T5QA 2ZIAA 3CRQA 4FYKA 4C6RA 3KPCA 1D0SA 1M0EA 2G1KA 1RFLA 3KDPA 2EQAA 4O1MA 4RD1A 4F3TA 4KC0A 4IJMA 2OC9A 3DV2A 4MRNA 2JAQA 1A9TA 3WGMA 5C7OO 1YCDA 3SDSA 3IIMA 1I01A 2J08A 5K23C 3NW9A 5SYMA 4YONB 3ZHCA 4BMCA 1U1FA 2X1MA 4BMXA 1E3WA 1OTXA 4ZP1A 5JSYA 3BIJA 1V4VA 5DRTA 5TPZA 3TRKA 4TXNA 4FFDA 1RXSA 3TW6A 4AU1A 3ZHRA 5KNBA 4WKNA 4QEKA 3P5SA 1CHDA 1XZNA 1T1JA 3OJLA 3PDIA 4OFXA 1K7YA 4U2EA 3USCS 4DTIA 3FBTA 4DW8A 5CT6A 4EPWA 3O9VA 3KSAC 4K81B 1KTIA 1I9CA 3QELB 3DKVA 1G6KA 3B1JA 3ZXXA 1G8KA 4C76A 1BNCA 2R2GA 2OBYA 3UJ7A 1YA6A 1VZ3A 1K89A 2OD9A 4M53A 1J8MF 4NENA 4AO8A 4JLNA 2WWXA 5SY6A 5EKXA 1Q1NA 1VLJA 5JRJA 3FBWA 1M75A 1NYTA 4KN8A 4ZT6A 1LZLA 1VI6A 2L2QA 2JRLA 3DTTA 1RP1A 3KHUA 3ICWA 1NR7A 2O7NA 4QBTA 4Y6PA 2ENUA 4KMSA 4LHZA 4FLEA 4AZWA 2HJHA 1U0OC 2V7BA 2XUKA 3F5MA 4MCHA 5H59A 1CQXA 4QXMA 4U2GA 1FDVA 1JI0A 2X14A 1Z0ZA 1C9EA 1E4OA 1JPNA 2X42A 4IDCA 4HVLA 3KQWA 1OV4A 4FW8A 4Y9UA 2XMZA 3LBNA 1RJGA 2B20A 2FPXA 3DTVA 4RVNA 4YNBA 4F4UA 2R96A 4FRYA 3SZGA 1Z0KA 4H7JA 1LPAB 3EUFA 1C8LA 1ZNYA 4DLAA 4DMUB 4QECA 5I4KA 2W6PA 5FV4A 4AUEA 1N5KA 1XL0A 1R4ZA 3AONB 1VE3A 2VYVD 3CEAA 3A4IA 1YAHA 3BX1A 4DPLA 2P2LA 4WNCA 1P1RA 1V8DA 4KV7A 3V4LA 2Q4DA 4YMIA 3X0DA 4BE9A 4HTAA 5ELLA 4PLGA 4ACAA 4PYJA 1ZRSA 2H0AA 1K97A 2JZOA 4LQDA 4QBIA 4TLCA 3G9XA 5KC8A 1KQGA 3ORHA 2IH4A 2QMHA 2I2DA 1BD3A 5CA1A 3IAHA 4QUGA 1W0JA 1SOMA 4J16C 3NWPA 1Z4PX 2OV3A 1XALA 4E0BA 3D0OA 4Y2SA 2D8AA 3VYTB 1ISRA 4OYHA 1IPFA 2J48A 3FPSA 3MTJA 5BVHB 4OMCA 4GKJB 3HV2A 4Q66C 2NQ2C 3IQFA 1IEQA 4FKZA 4JT2A 4NZMA 4X24A 3AB8A 1VJDA 2R7LA 1F8XA 4X6XA 4KO2S 2ZI9A 2QSYA 1OAKA 4ZN6A 2CFIA 2ZUWA 5KTOA 2LNDA 4RCVA 1WG8A 2NZ2A 3KBOA 3NOQA 3OQ1A 2BUCA 3L84A 2YJ5A 3TR6A 2AA3A 3ETHA 3MTAA 3VSBA 4M9RA 5BYKA 3H9GA 5LOVB 5I9MA 4F2PA 4O1IA 1A76A 3PXXA 4Q5IA 2ZR8A 4UHDA 4X95A 4BASA 3SQLA 4HQRA 2CUTA 2Q4OA 2OHOA 5KCMA 1N6IA 2NVUB 1M74A 4AN0A 1Y4UA 3LP8A 2J9GA 4KKVA 2C2BA 4ETWA 2QUAA 4Y1GA 3QE0A 5FWDA 4B35A 4IS2A 1NPYA 1GKLA 4B2YA 1EDDA 5FBRB 1G0OA 3PTZA 1TAUA 2CCKA 1GPJA 2P1ZA 4AW9A 3R5HA 3AY7A 2EQBA 3MCWA 3QH4A 2O20A 5C46F 3H42B 3KUCA 4GBMA 3F5FA 1SUIA 2B0CA 1OBCA 2HTEA 3RVNA 3E22B 4ARZB 1KFKB 3DHEA 1B74A 1XAJA 4IDBA 5EG5A 4E2XA 2ODEA 4BLTA 1VBKA 2BFMA 4QDJA 1PDOA 3FWHA 1NKTA 2X19A 4BO3A 2Q99A 3H1AA 4LHSA 3WYNA 4A6PA 1VB5A 5A3JA 5JNTA 4YK7A 2PXCA 3PPWA 2I91A 1CF9A 3D6JA 4FR5A 3GYGA 1EM6A 4GW3A 4HDQB 1RLMA 1LNSA 2C99A 4LA4A 3VXKA 3ADOA 3B82A 3DBRA 1B1CA 4G67A 5EE3A 3Q3GE 3P9PA 2JCGA 3TR0A 1JR3E 1N9GA 2Q62A 1E89A 3VNUA 4CQMD 4O33A 1IL0A 1E2JA 3QA3E 3QM1A 1IE3A 5GM1A 2QRVB 1QGYA 5ILOA 5DP1A 2HC9A 3H4IA 1KMCA 3UMVA 1CE8B 4D9MA 3DE4X 4IQ8A 2OWDA 3QVVA 3V3TA 1LTHR 2IYTA 1HK7A 2R6AA 1Z6PA 2XAAA 2PX2A 2WVAA 4WXPA 3HXPA 4IFIA 3ANNA 1GO2A 1JXOA 3V9PA 1NJ1A 1HX7A 4JBXA 4YRNA 4Z1MA 4CV1A 3D8RA 3RAFC 2AX3A 1SA0B 2QN9A 2ZSIA 5HM8A 5ICSA 2PZFA 4HZUA 4RTMA 3BXFA 1ZU5A 1B3BA 1SC9A 5K0FA 5BOSB 4ZI7A 4OU5A 5EZ6B 1IY2A 4EQZA 2ZIXB 2QLBA 3IA7A 2AOUA 5BV2P 1CUDA 5DNAA 3DMPA 5PGMA 1SM4A 3TIGA 3Q41A 2IOHA 1ENPA 1QZZA 2AR9A 2QRJA 2XKAA 3OQHA 2ZYRA 4ZVMA 3WGYA 1RQRA 1RYEA 3TXYA 2I2XB 3JWJA 3NEYA 5IFLA 3L2OB 5JH7F 3Q0EA 3V8BA 1FYVA 1R64A 2D0OB 1TW2A 5FULA 2GFIA 1ZUNB 3AJ8A 4YJHB 1P62B 3GLSA 5HJ2A 3QMMA 1C29B 1J2TA 3LQ4A 3NFRA 1IXYA 5CM8B 3TLMA 2RAPA 3X1WA 1Z2CA 2JJYA 3ODGA 4BJHB 4DSTA 3P26A 3HKBB 3QXCA 2H92A 3TRHA 3UMFA 2RGNC 4KIFA 4R98A 1E6CA 2NP6A 4FC7A 3OT1B 1ORTA 4OMUA 4XVRA 3IQHX 5TARA 1DXHA 1FFCA 1PHPA 2QN6A 3MXOA 4MLZA 3L31A 3RJTA 3PLRA 1QO0D 1X15A 4JUBA 1JHAA 2MIIA 4N3NA 3UFBA 3H2IA 4OSPA 2WM8A 4RXUA 4B4OA 4XKJA 2WLSA 1H05A 1X9IA 3S0JA 1JHXA 1OLXB 1NI4A 4PSCA 4QXQA 1W52X 4DBLE 4EAQA 2VDQB 3FDXA 2B7BA 4H7KA 4BX3A 4MQEB 4DEXA 4I50B 3AR7A 1Z34A 2EP7A 2G28A 2WM9B 3IRVA 1DAGA 5ECDA 4IO1A 2JK1A 2ZRHA 4ZQCB 3B89A 1W47A 5BWLA 1KZ7B 4CKYA 1Z75A 1BA2A 3V7FA 1ZOPA 4LRTB 3ONDA 3QE3A 4D0NA 4LTMA 4KQFA 5KOHB 2C59A 3MMSA 1QTQA 5H9WA 2IW1A 4WY5A 4RQBA 3L0OA 1BRTA 2YWHA 3NTQA 4UBLA 1SULA 1TA4A 1SFRA 2G40A 2IEAA 1DDOA 2PMFA 4MKIA 5UKDA 2G88A 1AS0A 2VF8A 3QPVA 4N3AA 3OX2A 3PZRA 2XJ9A 4P31A 3O3NB 3SBXA 4QM7A 3NI2A 2QP4A 5DYIA 3P7MA 4A2CA 3EOAI 1YZKA 1E1NA 1Z56C 2FVYA 1PBNA 2DSNA 3FDFA 3G2NA 1LKZA 1DINA 1MABB 4OB8A 4OQZA 1E3DA 3GBVA 4P80A 5JE8A 2VJOA 3PZBA 3IPAA 3V42A 3IULA 5AK0A 3ZBPA 4BNHA 3SL7A 1ZONA 1QG2A 2I87A 3AHHA 4RACA 5JQGB 3FPLA 4E21A 3WDLA 3FLMA 5MGNA 1X8JA 1AB5A 1C41A 2WHPA 4ZCQA 2QZSA 1MJNA 3DO6A 4FIDA 1AH2A 1A2BA 1U8TA 3DAFA 3NT5A 3C4QA 3F8SA 1N8NA 3K0FB 5C8VA 3U7QA 1MO6A 3OIUA 5I45A 3OI7A 2VDNB 1TCAA 2I6TA 3L7MA 5HRAA 1CLEA 4D3FA 5K3SA 1YV9A 3NORA 4FB5A 4Z6KA 2D59A 2Z5FA 2QI9C 1P7YA 3IUBA 4ESHA 3V4RA 5CX1A 2AE2A 1UJMA 1QDEA 2AC2A 2D8MA 1CLUA 2K7ZA 3ENZA 3HH8A 3T9BA 3TUIC 2C20A 2ZVDA 3GPDG 4OHOA 1KY2A 2J30A 3N8HA 4PN3A 3ZHXA 3STHA 1VFNA 3UWPA 3VO2A 4YQEA 3O4RA 2PWPA 3SM9A 1QHXA 2CXHA 4JGBA 4ND8A 1DZ3A 2F3QA 4GYWA 1XK6A 1GR1A 2Y0DA 3AVQA 1UEJA 3BMCB 3AVPA 1F7UA 1U7OA 4B74A 2QLMA 5K22B 1HURA 1PJZA 3EEOA 1NUQA 4JJ8A 1PIWA 5CXUA 1IHPA 4RLQA 1Q1ZA 3O94A 2OV4A 4WZAB 2KLBA 3RRXA 4DGQA 5C0OE 1THTA 2SECE 1MAVA 4UBJA 4GR5A 3TDMA 4KPUB 5AHWA 3D7LA 4H6WA 1Z4IA 1EQ2A 5F1OA 4X65B 4MLCA 1JQKA 5AJUA 3T0IA 3TQOA 1HDRA 4CFYA 4IKEA 3N59A 3LUHA 3E27A 1YE5A 3DMTA 1IPHA 4ESYB 1HEIA 3LMKA 1L4FA 3F49S 5FWYB 3VJMA 4BO9A 2X3FA 3F74A 4XIYA 3ZVRA 4C9BA 1UK7A 1LBHA 1M5TA 1OBVA 1FRZA 2OOXE 3PC8A 3FCOA 4LWPA 5HOEA 3P19A 3PEWA 1VFPA 2WIGA 5LA6B 3RUFA 2D5AA 2PKEA 3V7UA 1EWKA 2UUPA 3TQFA 5LQKA 4I3GA 5JO0A 3FYHA 2V8BA 4NNOA 2XUPA 4R2WA 2A0WA 1M2VB 2QUHA 4L78A 2P67A 1O0CA 2PX6A 3CSDA 1EP9A 1KJ8A 5A9SB 3PNBA 1YB4A 4DG8A 3QY0A 4NABA 4G84A 1XR3A 2CLCX 2KE5A 2YN2A 3CRZA 3M9WA 4G1CA 4KOEC 3TSAA 1WUTA 3FA2A 4DV2B 3BWMA 2DM6A 2BFOA 5AJTA 3CG0A 3I4LA 4JMPA 4MHOA 4INPA 1Z13A 3Q3JB 1MEJA 1WKVA 1WM1A 5DTMA 3K8YA 1G6Q1 2GD6A 2ZJZA 4DN6A 3BK1A 4FZ5A 4QLBA 3EPJA 2C5LA 1ZM7A 1MT0A 8ABPA 5EESA 2J9YB 1MT3A 1FQJA 1QIMA 1Z9BA 3ICEA 2Q3BA 3NYIA 4KR3A 2W2KB 2QSUA 1ZH0A 3QUQA 3D3WA 4E11A 4BQRA 1RM4A 2PA3A 4BNTA 4NYMR 4G86A 3QEBZ 1EP2B 4MPPA 1TTHA 5BYAA 5HM6A 4Q4DA 3ES9A 5JATA 3B2EA 2G9VA 2Q6OA 4DLSA 1L5GB 4CTKA 4JNCA 4S12A 1JZSA 4F96A 4BTLA 1U2GC 3K94A 4CIWA 3QYAA 4EDHA 1JAHA 1ZA1A 4YRZA 4EFNA 3IDQA 1BCSB 1GSIA 1RFGE 1YR6A 2CFCA 2QD3A 2X2OA 3HKDB 4PXSA 4QOJA 4N9WA 2IGTA 2DZDA 4PPFA 1GP2A 4AZVA 4URHA 1CR1A 2DPMA 2D2XA 4QD3A 1VHLA 4YRQA 3V8EA 4QNNA 2C2YA 4YIKA 1DOHA 2OPHA 3OOJA 5JTUA 3V8NA 3OOYA 3L6CA 1AGYA 4R3NA 3T3GA 4BQPA 2OHXA 4XRRA 4ZKEA 3VR5H 1P39A 4TQ9A 2Z2JA 5IFKA 5F3WB 3C7CB 3DZIA 3DFZA 3RQIA 3K9CA 1G5HA 5GGXA 5EMNA 4B75A 3S99A 1G8SA 4PXAA 2WA1A 4Q3LA 1YRQA 1X7XB 2W2PA 3SKVA 1A8UA 4RSRA 4ZK6A 4R0MA 3DXFA 3JZIA 2FMHA 1DAEA 2BUAA 2JFOA 3RKSA 3VDQA 3AIIA 5H02A 1E9AA 3B78A 4BXOA 1P74A 1AV7A 2AF4C 1CEYA 1QMPA 1ZD1A 3CCBA 4RZXA 4XEHA 3N1UA 2NU6B 1WB4A 5KNLA 1DAOA 4JJAA 4HSEA 1ULAA 1YS4A 1BO6A 4BGEA 4B2PA 1YE8A 5L3SB 2XOKD 3KQOA 4M9SA 2DAPA 5F21A 3GLVA 3NBFA 2YIVX 3C3MA 3IJEB 4GOND 4DRXB 4EP1A 2F8SA 3H83A 3QOFA 4AYXA 4ZIRB 1HQYE 1MAHA 4I55F 5DH9A 1HE5A 2G5PA 3EMBA 3TWOA 4B2LA 4C7KA 5CVCA 4CEHA 3THRA 5I7SA 3F5QA 1L8LA 3HCOA 5GZ6A 4D0RA 1RVV1 1TQ2A 2J0UA 4CMIA 2DY0A 3U6BA 1ZN7A 4NG5A 3WA6A 2DLNA 5DN9A 4B3CA 2AK3A 2XQIA 2BFFB 1A9YA 5LOVF 3CLTD 4ZEVA 5KUTA 1OH6A 1YR7A 4IDFA 2RHLA 5AVJA 3PGJA 3ZGZA 1PK7A 3BMQA 2O1XA 4ZAFA 2E3JA 3H11A 2VP5A 4B3MB 1EUCA 3DHYA 1VKOA 3QBDA 3BZBA 3DJFA 5EQTA 4AMBA 1RYBA 5JMPA 2DQKA 3HCBA 4X41A 1SZPA 4Z5XA 2R6FA 3P97A 1E3SA 4PNZA 4FVTA 2AOWA 1XLWA 2JW5A 1DG9A 1YQXA 1CYEA 2B61A 1RWKA 2F2TA 4R1TA 4J0EA 4TRRA 2P9QA 4KODA 3FZYA 1DIRA 1L6IA 1XRLA 2JB9A 1QF6A 2F3RA 2FFHA 2ISSD 4Z4FA 4C04A 1JFSA 4CKBB 2ANBA 4NCBA 1T2DA 2HUPA 4KQ9A 1Y34E 2CYBA 1RAEA 3KZNA 2Z1DA 4O2AA 4XPZA 3IX7A 5K0NA 1MX5A 1Q84A 1E7SA 4MX8A 3QUBA 4M0UA 2RAFA 4LRWA 1IM2A 3A6ZA 4F4IA 1ABFA 2P35A 2H2HA 2VHJA 3A6EA 2Q4TA 3DE5X 4HUQB 4D3SA 1O6FA 1R18A 1KMHB 2H4JA 2YRWA 4WOBA 2EP5A 5CDFE 1WBJB 5HKKD 3MW8A 4IH9A 4EKNB 3FF1A 3NOVA 1VQ1A 2E87A 2NXCA 3GRAA 1OIWA 3EBOA 4X7RA 5KSOA 1XTIA 1GPYA 2JFYA 5F5LA 2P4UA 4N3CA 3R7SA 3JR7A 4GYYA 4IUDS 1P2SA 3FLAA 4OO3A 1A8SA 3G0HA 5J4VA 3K1AA 1YACA 5D7BA 1GNSA 1Q11A 5L3VA 3V2HA 4L76A 1RT9A 3WMRA 4JX9A 4CEJB 4R8SA 1TEXA 1XQXA 2AOTA 2WU8A 5DBGA 2RK4A 4Q4AA 1LK5A 2WE7A 1SKAA 4BQEA 1PUXA 5LUAA 3KNZA 4DLLA 4LX8A 1P3Y1 5DTIA 2J6CA 2PSJA 2OZEA 3G0OA 3K1ZA 3L5KA 1UIMA 4HDSB 2W42A 4N3GA 3L7LA 4Q1EA 3MWJA 1TEVA 3O0DA 3DT8A 2EZTA 1OX5A 3S28A 4YAKA 1T6XA 1J0AA 1YIAA 1T3LA 3FUWA 3B1KA 4R05A 4CTMA 1KAOA 4EY3A 4JFRA 5IM4F 2WLTA 5D01A 2GJ8A 4G97A 1MO4A 2QJFA 4HAVA 5LSAA 3RSQA 3UN1A 1JKJA 1YA8A 1XNRB 2BH2A 1DBIA 3EASA 4K6CA 2HIGA 3WLIA 1FRNA 1NRWA 4P6VF 4QOSA 1E8NA 3G0CA 1GZSA 1GKUB 4ZMRA 1R9MA 5A0TA 5CYOA 4V0KA 3GVXA 3A27A 5SY9A 3B51X 1LSOA 4PNPA 4OATA 2WVJA 2Q3LA 1I80A 1UT5A 2IZ6A 4F3YA 3N28A 3VFDA 3IT0A 5CLLA 1DUSA 4PG4A 3W77A 1QR2A 3QF4B 1YS1X 2NO1A 1EJ0A 1XCGB 5HQJA 2WEKA 3COVA 3GRVA 1ZYUA 4MMXB 3RUIA 3S1LA 4CCSA 5JLJA 3G5TA 2XIJA 4JKYA 3S2IA 1W7AA 3AETB 4HWTA 1QAQA 2I3GA 4IMIB 1NTOA 4YV2A 3N53A 3SXUB 2QXTA 4GICA 4NMLA 2QTTA 3I2YX 3K2BA 1ZVJA 1XMIA 4LJ4A 5AM0A 5D5HA 3T1NA 3ZGLA 1HKUA 2DOKA 2XTNA 3QKSA 3ELUA 2B83A 5FR2A 2D4HA 2OXEA 4JROA 2GUGA 1UBHS 4I50F 4ZVPA 4TL6A 1LTKA 1XV5A 1TVMA 1KYXA 3A1WA 2NVBA 1TVKB 3OETA 4LKOA 1YO6A 3DR5A 5FTMA 1JT2A 1C1XA 2XNSA 5LP6A 2AUTA 1G3RA 2EWMA 1CUIA 1V4BA 1XU9A 4NOLA 5DGDA 1NP6A 4LBWA 5KZMB 3KXPA 4UCWA 5KIAA 4GNRA 1ZQ9A 1ETUA 3ZNPA 4YFVA 1HNZB 3HKEA 3OCCA 2NSLA 2DPLA 2QTBA 2P9YA 2QB5A 2PRIA 4EI9A 5KNBH 4WOKA 1EESA 2OK8A 4HFMA 1PVDA 3NEAA 2P4SA 4OU4A 1M34B 1NJFA 3M2PA 3EXEB 3LC7O 1NZDA 8ATCA 1I1NA 1P17A 2HDWA 3OZUA 3P5BA 3QBJA 4YAFA 3AL3A 4QBKA 5LCXA 4HNVA 1R9NA 2QM3A 1V11A 1U0LA 2BKVA 1UBOS 2JFFA 3GX1A 1MOSA 3PBKA 4RE6A 3SOZA 2L82A 4LE2A 2H4HA 4AXXA 4Z2AA 3B9BA 2OOYE 3RJMA 4OLJA 4OI0A 1UPCA 1FDWA 1SCQA 4X66B 1BJRE 1F2DA 3GLTA 4YC7A 4YQZA 5ADUS 4W5NA 1POWA 4BZWA 2WU0A 4Q4CA 2BOVA 5KTRA 4PFSA 2QOEA 1XZAA 1T2VA 2ZQ5A 2Q5FA 3VR1A 3C3XA 3LQFA 4FFSA 6REQB 1EAYA 5JV5A 4CR7A 2IYYA 3ASYA 3NASA 2VJNA 3MRVA 1JVBA 2P69A 3OPNA 4FDMA 4N0QA 3RRNA 3ZLVA 3FTEA 1TCVA 1OZHA 3FYUA 4MI1A 4QA9A 4ECEA 4JY7A 1ADJA 3DYBA 2PH1A 5ITSA 2MU1A 2Q9BA 5FP0A 5BSRA 3AUFA 4BNNA 1P4HA 1ZG3A 1G8HA 1GGJA 4MDFA 1Z6QA 1SCDA 2PUHA 4DCJA 4GWLA 3K09A 5LZ4A 2HIMA 4JLOA 5J2UA 2D62A 2K7FA 3GLQA 2X5XA 3E53A 4RJIA 3LK7A 3CNEA 1IY1A 3Q10A 4JB0A 1CR0A 2QYOA 1G66A 1TB4A 2D2IA 2MTBA 4HJRA 4HWSA 2X4LA 5CRIA 2O54A 1L9XA 1SUFA 4H1UA 4NYJR 3UAOA 2B1QA 3QY9A 4A8TA 3M6FA 4JBNA 4ZV7A 4KWCA 4RELA 5CYFA 3TKAA 2V7EA 2FH5B 3AXTA 4WFKA 1ONBA 1NYRA 1ITZA 4F4FA 3Q3IA 4PX3A 2NZXA 4AF6A 1SWWA 1NONA 2Q8QA 1ZC4A 4HGRA 1E5QA 1H4TA 2FW1A 4L8LA 1RTKA 5BSVA 4QQFA 4PQRA 1ZOOA 2RGYA 3QYJA 1Q91A 2XE8A 4FE7A 2Q9CA 4JZKA 1PW7A 3OLZA 1U1IA 2WIAA 3HI6A 4R1PA 2A0UA 2CFTA 5IT9A 5FWNA 1REQA 1I6KA 3PITA 4GP9A 3GUYA 1VKHA 1YONA 4NE7A 2HF9A 3SEFA 3KQKA 5GZ3A 2XHZA 4PZZA 1CULC 3FI0A 4ID9A 3CUSA 2REXB 2XADA 3PXEA 1GXSB 1TQ6A 2YDXA 4G8JA 4LC9A 2C0CA 3KWLA 3VZDA 2O8BB 2UV4A 3HS3A 3HXTA 3NFYA 4WKCA 5EZ5A 2ZT5A 3W8RA 1KJYA 2QT9A 2PXXA 3RYIB 2YVUA 1FY2A 1DBSA 4M54A 1FTGA 1KYWA 2H9AA 2JGDB 3NONA 1J4AA 3AFNA 3FUVA 5JVDF 1UM9A 1SBQA 1NOIA 4HEA1 4KJZA 1N78A 3ROKA 1CETA 1Z15A 4HNAA 2HJVA 4C7MA 1BQEA 2F9MA 4LQCA 4HBZA 5BPHA 1XZPA 2AEJA 4PRZA 5JNWA 3FPFA 4JLKA 3LCVB 5EKUA 4M3NA 2W83A 3COJA 2VJCA 3BL6A 4UVDA 2FEOA 5CXQA 3CNHA 4RK0A 3S7TA 2GXQA 1FBTA 5IXJA 2L69A 4C06A 4DSZA 4ESVA 1U3VA 4RL4A 4QYMA 1KZHA 2F4NA 3KVNA 2DUMA 4Y6RA 1N1EA 3KEOA 1XKTA 4HLUC 3QKRB 4W5WA 3RAGA 1Z5GA 3LP5A 2V98A 2JLXA 3S2GA 3K5IA 4IJQA 1OIVA 2V6GA 1LEHA 2BGTA 3QHQA 3HCRA 2IUUA 2JLAA 2ZYGA 4YT4A 5HUQA 3MTEA 1CEXA 3KWJA 1WD7A 1SKYE 1TQ4A 1F7VA 4EZIA 2P1RA 5CXSA 5K0LA 2O50A 4RZUA 4AIRA 2GK7A 2VSXA 1WSBA 3T5CA 5L3QB 2B1GA 5KMGA 2MSNA 1GLVA 3WHIA 2FPGB 1F8FA 1G1AA 3GNQA 2PZAA 2KM1A 3UAYA 1HDIA 5C5CA 1MIOA 2P7HA 3M2TA 1RTTA 1ULSA 1KIMA 1QQAA 3JWGA 1Q7GA 2E6UX 1G9XA 1O0SA 3OBBA 1L3IA 1BHSA 2JGFA 5SY4A 2C4MA 5TF4A 3I9V1 3ZEAA 4XWGA 3RHSA 1GU7A 3SS7X 1NZFA 1G7CA 3HQ4O 2KB0A 4S35A 1O6GA 4C3ZA 1SKUA 4DRYA 2J3MA 1IN8A 1D2GA 1YDHA 2PL1A 4NBKA 2WC1A 3FHMA 2HXGA 4V0LA 3WK8A 4WFJA 1A7AA 1BW9A 3FJOA 3LHIA 3J81k 1JKXA 4JQOA 1MQAA 4OJMX 3A10A 3UJHA 1KQ3A 3M6VA 5I7AA 1NNI1 2KBFA 5IABA 4UUNA 1G291 2PPLA 4G8BA 3IS3A 3HBLA 1KJWA 4IL5A 2AR7A 2OOSA 5AHXA 5HEKA 1C1DA 3S68A 2BGGA 4KGXA 3V6MA 5D3MB 1VXOA 1S2GA 3D1VA 3HF7A 4GVLA 3OC0A 4PG5A 4RD6A 2XW6A 3E58A 4MW1A 4AKEA 3BCRA 3SC2A 3WAJA 3D4BA 1UIRA 5H80A 4JVNA 4TMFA 4LF7B 4QC2A 3PUKA 4CMCA 1MC8A 2VO1A 4TTIA 2W98A 1DFIA 1PJAA 4IDDA 4P32A 2B9EA 4YAEA 4PZAA 3VR3D 1NBAA 5K2MA 2PIDA 1J07A 5KTTA 1T36B 1OA1A 4YRCA 3R9KA 4HDMB 4LZZA 1JRLA 4KLNA 3LDAA 3Q8KA 3ZNOA 2PUJA 5I7WA 3IAS1 1KETA 1XTKA 1XMVA 3OLVA 3P2YA 3PPIA 1DOZA 2YINC 3GEMA 3HLTA 1VGRA 2LDBA 3Q9SA 4YJFA 4BKUA 5K99A 4C0KA 1LDNA 3H3FA 2HB6A 4FUQA 2FNAA 4DE5A 4XDGA 3ZVNA 1BX1A 1N3LA 2J3HA 3I53A 2R6JA 3HL0A 1SU6A 3LPNA 5CFPA 1GVHA 3DEFA 5BSHA 4RTLA 3I6BA 4H60A 4EHIA 5IEJA 3KOYA 3H9JA 1N5JA 3A1CA 2XZLA 1RQXA 2Q5OA 3DDJA 2V45A 1EUZA 3ZG6A 1Q3KA 1DBWA 3VR4H 4LMRA 3P9KA 3BRSA 4Q9JA 2BDUA 3EZGA 1OE0A 4QDTA 1E2IA 1ULUA 1XPOA 3WLPA 1OT5A 3MWEA 1X7DA 2ORIA 4Q7QA 2HMSA 4ZU3A 4QXPA 3A32A 1W2GA 1EWVA 2CXRA 4QXOA 3TDKA 1TO2E 4ITUA 4I4CA 2ESRA 3VR2D 1D4ZA 3UMBA 1SD1A 1HA3A 2QLLA 4AK9A 1CDOA 2OLEA 3GELA 4P7BA 3VZBA 1NULA 4B9AA 2PIAA 1RXEA 2J9FA 2I71A 4NOCA 4OVKA 3MJRA 4ARAA 2I7DA 2GAAA 2YHSA 3OTWA 4AZSA 3NHPA 1J25A 1GTVA 5K8JB 3DAPA 4F38A 5D84A 2GI4A 2JAWA 1AGPA 3P52A 4RGBA 3PG5A 4ONEA 3IV7A 1D2RA 4Q6BA 5C7IO 3Q6MA 4CDGA 1CRPA 3RTGA 1QFJA 4JLBA 5TMBA 1K86A 3UK7A 3WHKA 4GPTA 4D3ZA 1R27A 1FS5A 1EINA 3SLRA 3UV3A 3DPIA 1AQJA 1DBQA 1FPMA 4MP8A 3H5IA 5A6SA 3GPLA 1H6CA 4CTOA 2YMQA 2HUNA 1WLSA 2QGFA 2Y71A 2ZUBA 3EZLA 2BMEA 4FLFA 2O6LA 4OYLA 3SVZA 2XGSA 3LV8A 4ES6A 2C8JA 1ANKA 2A9JA 3H6GA 1P9WA 4LF8B 1HYHA 5TEVA 2HA3A 2I4NA 3CEPB 1ZK1A 1LFDB 4JN6B 1S1MA 2WF5A 1CPYA 4UVEA 3T9EA 2I1VB 5DM0A 4CVNA 3B36A 3CW9A 3B7WA 4JJFA 1AO0A 2JFHA 4ZPXA 5B58T 1GM5A 4BKQA 4BJ1A 2I6GA 2HK9A 1U2GA 5DXAA 4G36A 4RSGA 4UM8B 3FSGD 1XEXB 4NTZA 4V3CA 3WGOA 2AKYA 2PFKA 1E3MA 2V7QA 5BUQA 2CXXA 1CUVA 1ZM2A 1I3NA 4XQGA 2I4RA 3AX6A 3P45A 5LFAA 2OCBA 4C4TA 3E3LA 4Q24A 3SZOA 1R7RA 1HKHA 1M5RA 1VBFA 1ZVKA 4FHGA 2PGOA 1BN7A 3IERA 4H15A 1CZOA 5TVKA 2IUFA 4DQXA 1XD2A 1P19A 2ZI3A 3OAAA 4ZZ0A 1BFUA 1JR2A 2PCJA 3GZNB 3VX3A 5ABPA 2PGIA 4LC0A 3VOTA 1TA9A 1SOUA 1XWIA 3QVXA 5HF9A 5K0CA 3OM8A 3A4YA 3GLIA 4DLZA 5KNCA 1L4BA 3PHCA 3NLLA 4MPTA 2OO3A 4E5NA 1LK0A 3A7EA 1MR3F 4PSAA 1GG8A 2V6JA 1EVYA 1SELA 1DJLA 3O91A 4DAOA 3Q11A 3RVKA 3MT7A 3LFUA 3IXLA 4EATA 2RAUA 3AFMA 1D04A 5A05A 4OJYA 1DWPA 3ANLA 1GKKA 1RLOA 1YWGO 2DUUA 3UZUA 2O1SA 3EPRA 2D54A 2VNJA 1C1YA 2A1UB 1RRFA 3KOXA 3ELBA 4Q7LA 3TL3A 1YKSA 3RS0A 2JASA 3PNLA 1QRSA 4M38A 1WEHA 2H2WA 4IQFA 1SJ9A 4S1TA 4R54A 2GTIA 1HFEL 3EEBA 2PHZA 4Z3KA 3DCIA 3JQPA 4HJXA 2A67A 2D74A 4DOMA 1PLLA 3H2KA 2NZYA 5JNVA 1V9LA 1NC3A 2IEBA 1LW6E 3N8IA 4GAEA 5P8WA 5ALLA 3HZRA 3R8CA 1KK2A 5DM2A 1RJFA 3ABOB 1KU0A 3M7IA 3WLHA 2XUQA 4DLKA 1OR8A 4LEIA 1ZGZA 3TUZC 1CJKC 4JQCA 2CCJA 4B6GA 1KYIA 3ESZA 1Y7IA 1XHFA 4GKBA 1K4KA 1OFVA 3QOYA 5CB6A 2UZ1B 3N0RA 4PQFA 1U8EA 3KL4A 3PC7A 4E2ZA 3R4CA 4FWTA 5L7TA 1FTWA 3EJWA 3LQKA 3TZLA 4MRAA 4L5IA 4OFZA 3K6SB 1JHDA 1Y1PA 2WVGA 2ZGVA 2BI4A 3Q7EA 5M7EA 5KNDD 4WWHA 2CHQA 3ONEA 5IH3A 5TIIA 1OWLA 4F3CA 4XQCA 4BQQA 1NSFA 3RB8A 5KTNA 4LWZA 2Q45A 5DTRA 1EG2A 8ADHA 3GGCA 3QV1A 1GGEA 3OH8A 1HQKA 3WGIA 1FLNA 1M6HA 2QBYA 2I2CA 1VKRA 4YLGA 3MJVA 1UBKS 1FFEA 2CLHB 4UMEA 5AHRA 1SC6A 1I5EA 3IVAA 5C1BA 2V9CA 4LY6A 4YDHB 3F4KA 3RIGA 1Q20A 3OCYA 3BSFA 2H31A 1Y3CE 3O1LA 3RYCA 2O14A 3FIUA 3BD8A 4RKYA 4OMFG 3BS4A 1EGAA 1VLQA 2I78A 2UDPA 1WXQA 1AT1A 2NVWA 4RJ2A 3GAZA 1YQTA 3X3HA 2VF5X 2YZIA 3ESYA 4UFPA 4E30A 3IUQA 1RC1A 3DG9A 3NC1C 3QFFA 5F2OA 3ZHVA 4B32A 4N40A 1WPRA 2JJQA 3MGKA 4JEUA 1A5ZA 1UXOA 3CISA 4OGLA 4ROSA 4AO7A 1JFVA 1WOMA 1XF1A 2I55A 3DDUA 4FYXA 4OGWA 2VJMA 2X0KA 3F98A 1RJDA 3A4TA 3TGWA 2I6XA 1NDQA 3NBYC 3HABA 2BMVA 2H7VA 5BN4B 1MPTA 4LDRA 3DNPA 1PYGA 4Q3EA 5AO9A 1LWOA 1QH8B 3S7ZA 1BZYA 4IO0A 5JARA 5JYCA 3C5VA 4KRGA 1I6MA 3Q1LA 2IZZA 3L1JA 3DEYX 1C14A 2PSHA 1Y9DA 3ZHUA 4NU8X 4BBJA 3KQNA 1JEYB 4OQDA 2FOLA 3GP3A 1Z2NX 1DEKA 4TGLA 1EVKA 1HC7A 1Z62A 3LH5A 3RVMA 3DEZA 3P0RA 4QDUA 4Y2HA 4DLVA 3AWDA 4II3A 3N87A 2O2HA 4TTTS 1X2EA 1DT5A 4QG7A 4ZPJA 2ECPA 4CIAA 3LA6A 4D4HA 3OQNA 1J0CA 3D2CA 3G6KA 5LPNA 5DHPA 4H16A 4X1OA 3LG2A 5IJ9B 4UD6A 5JH7A 4NZ9A 2VYVA 4W8OA 2CL7X 4H17A 4JJIA 4MCJA 4CEIB 3FSEA 1RYYA 4DB2A 3B6KA 3NGXA 1V6AA 2AR0A 2RG7A 3RIXA 3JASB 3JWEA 4JIMA 5HDQA 3VGJA 5BT8A 2IEIA 2OCKA 3HJUA 4GUDA 4GMHA 2GILA 4H08A 1M2EA 5TJHA 2PUDA 1UT6A 4CU2A 3ZE1B 5KJ1A 2PRSA 1GNPA 1UMDA 4LJKA 4ZEWA 2NUAB 4A10A 3IUSA 4XD7D 1YJQA 4K46A 5A4FS 4LGMA 2CHGA 4MRMB 3C8MA 3K53A 2J3QA 1PQPA 1XRPA 1PK9A 5A03A 3SMVA 3I8XA 3FCXA 3ZDXB 4JYZA 2Y1KA 4Q7KA 2ZKIA 3W4KA 5I8ZA 3OZSA 4RVCA 4PHHA 1L7DA 1OROA 1M1ZA 2C97A 2IP2A 3C41J 3H5NA 4WKPA 5JBIA 1UK9A 3CRRA 3ZJ5A 2F17A 1SCKA 1G21A 3CEMA 3UC5A 1L8QA 2BGRA 4C2BA 3AQIA 2WQ7A 2D06A 2J09A 4WUTA 3MJDA 3RFUA 3IE1A 3TRIA 5HWSA 1BCRB 1PBTA 1EU1A 1F3LA 4Q16A 4XYLA 4W9MC 1TAHA 3AUTA 3DLBA 4PVCA 3HNPA 1L4NA 4OI4A 1Z17A 4TSRA 1NP7A 4N48A 5HDBB 1L8AA 2QZJA 3C5WP 4ZJYA 4IQ0A 4M0EA 3LL4A 3KDSE 2H7XA 2HHHB 3SKYA 2Q0QA 1EDOA 4R1LA 1P44A 5ITVA 3ABSB 3O82A 3HWX1 1XVUA 2WPDA 5FYQA 2E1PA 4A2WA 1EFLA 1ZZEA 4FD3A 3PNPA 4LJ8A 2Z6AA 2ET6A 2JCVA 2QT0A 3LX5A 4PGHA 2OHVA 1CY1A 1SG0A 3G5AA 4RABA 2OXIA 1G4AE 2JRCA 3KLBA 2UYGA 4FR0A 1U1CA 1I2CA 1XFDA 1O2DA 1TM3E 1M5UA 5CM9C 3TL6A 5BY2A 3PTAA 2V6MA 1B76A 1F2UA 3K7EA 2V8OA 3KE9A 4UVGA 1RCFA 1HMPA 3GNLA 5E3HA 2IPLA 1CYDA 4CQNA 1QIFA 2H5LA 2I7VA 2FZCA 3SGLA 3HNRA 4DM4A 2D5LA 4CXMA 1LX7A 1UXJA 1QFSA 2CF5A 2HMAA 1SQGA 2JEOA 3C16C 1NNSA 2EKLA 4FFRA 5JUWA 1S8OA 4P1OA 1FVXA 5BSKA 1IBMB 4F72A 3GBPA 3MRXA 5ARDA 2QMEA 3M4YA 4UDNA 1Q7EA 2LIPA 1QQTA 5ADVA 1LBEA 1G5PA 2QVBA 2R8ZA 3NX4A 3T38A 5DNCA 1S96A 1AQYA 3KYDB 1ZR4A 1AKQA 4P35A 2UYYA 3CLRC 3G59A 4GSKA 3PA6A 4KTTE 4TROA 3WP0A 4XRGA 2CFOA 3N39C 4ZALA 7REQB 2NO9A 2WJVA 2XBLA 3OA0A 4E33A 5E7QA 1E6KA 2CNKA 4QGAA 2H4WA 3KZXA 1WZNA 5EUCA 3P9CA 3QMWA 3HVHA 1GTMA 4PHGA 4YAIA 1BHO1 2AX4A 1NJ5A 3AYZB 4PZPA 5EI5A 2GBIA 3N05A 1IPEA 2WZCA 3OZDA 5JSHA 3FYSA 4HGOA 4XX0B 2HWXA 5KU1A 3UY4A 4P7GA 1J0DA 1SBIA 3OUZA 4YRSA 1JIIA 5BWBA 1F2TA 1XNHA 1LGYA 3D0KA 3FSRA 1OGJA 3RF6A 4EFLA 3CB2A 3R0QA 1K1EA 1Q44A 2VNSA 4GUAA 3E7FA 4ZD6A 1J21A 1YZGA 1DC4A 2HBYA 3AFOA 2PUVA 4KIUA 4G25A 3H5LA 3F6PA 4HAIA 5ECWA 1CS0A 1P2FA 1E1MA 3CJTA 4QELA 1QFMA 4IX9A 5ALRA 3K9LA 3CF4G 4GP7A 1T8YA 2Q0SA 4IJUA 4MDHA 3TB6A 4CODB 4DIMA 1GAXA 4B7AA 1GAEO 4LFBB 3L4KA 3U7FB 2RGUA 4D82A 4EGSA 1DC6A 3HCDA 1EFRD 1ETHA 1QE0A 4RK7A 5B4TA 4D0SA 4GKVA 4LQLA 3U3JA 2RHRA 1AQNA 2O1WA 3RUEA 2HSDA 5D1NA 4QFDA 3WLJA 4ALMA 2PKQO 3I6QA 1AK9A 4EITA 1V2HE 5A4AA 4XD2A 1KDVA 4C22A 3GZTB 3N58A 3OUTA 3WP1B 5C4IA 1JZQA 2PS3A 3PI6A 1E7MA 3R75A 1A98A 1YL7A 4QDXA 4RPHA 1G7SA 4E22A 1V35A 3ZWVA 4F4HA 3M5CA 4PX2A 1UH5A 5JD3A 1I94B 2C07A 3MT9A 2YVAA 1F0KA 1QWOA 3WZLA 2DULA 2I3ZA 4D5EA 2XXAA 1W36C 4L95C 1OPXA 4BNJA 4CWAA 1GNQA 2CDBA 2RHGB 3W8EA 2I67A 4ZO7A 1RRPA 4A27A 2O06A 3CTMA 1Z0IA 2B8WA 3QELA 3QEAZ 1C8BA 1AUPA 1SHTX 2EATA 3K20A 5DRYA 3VM6A 2FKNA 2TS1A 3VOAA 3ZE7A 2G7ZA 1WPGA 4BB0A 2HXYA 2AUNA 4ZWNA 3L77A 4KUEA 4BHTA 4EKYA 2VCHA 3NEJA 4YCLA 1QRTA 1BGWA 1GZ4A 2WYWA 1IY0A 4GOOD 4HLUA 1OJLA 4WBNF 1JECA 1WTAA 1Z4JA 2OGWA 3DB2A 3TMAA 5BNFA 4DMGA 4GQWA 4GX0A 2R8YA 1XNJA 4TMXA 4YRFA 4MDEA 4JI7B 2FX2A 2VUTA 1M1YA 4AJ9A 2EJCA 5AM1A 2HMUA 1T5HX 3RH0A 3GQBB 3E9DA 3Q2KA 4I66A 3WK4A 4LZNA 2PD3A 3SIPA 4PSKA 4PY2A 1Z5PA 1QKIA 1P4SA 1LZKA 2MYTA 5G1NA 5B6JA 3KZMA 4HN4B 2RARA 2ZLBA 1R0RE 4NOKA 1V5IA 4J9UE 3VMMA 5DEIA 1FUYB 4MUJA 4QVGA 4DQKA 4GZMA 1DX6A 3JQ9C 5A06A 2IP1A 3P32A 3EHEA 1JEJA 2P41A 1V8FA 4GPZA 1MORA 4LSZA 1VKZA 2QMYA 1YJ8A 1Y3BE 4PVDA 2JIMA 3RRZA 4E31A 4BP9A 4TYMA 2DRIA 3V8QA 5E0OA 1QORA 2GAOA 1CQIB 2ZR0A 3TLGA 4D5GA 3ODPA 1PTKA 2ZSHA 2E49A 1JAYA 1CF4A 3E8XA 5BRAA 2OD2A 2GKGA 2NTVA 3PSHA 1QC5B 3W9SA 1QQBA 2BONA 4ME6A 1E94E 4EG3A 3DAGA 1SU8A 5GQSA 2ATCA 5M34A 2IITA 1YKGA 5LKAA 1USIA 5EHIA 5JZVA 3L0SA 4EYSA 3EVDA 2O5RA 2I4MA 3QA9A 4R1QA 3BWVA 4Q47A 2AVNA 4R1NA 2ZT7A 4YV1A 2O05A 1UOOA 2ZDHA 3B3JA 1W581 3PSAA 4M6WB 4CUKA 1D8AA 2JGLA 4RPLA 3M5PA 1UC8A 1RPZA 3HKCB 4P1ZA 3ZOKA 5A02A 5AW1A 4DV7B 2Y68A 3A7DA 2OL4A 2CLEB 4BV3A 1K8ZB 1L7EA 1M10A 2ZM6B 1RYNA 1Z7EA 2DBVO 2RSLA 3R3HA 4L73A 4DBZA 4D8TA 1E6EA 5KOJB 2PS1A 3ZY6A 5BV0A 4MICA 3EEQA 1JDBC 1YU9A 1N5RA 4JNKA 4OAOA 2G6BA 4HADA 1WE2A 1X8KA 1KBQA 1SVLA 5LOVA 1YC5A 2FOIA 3BRQA 4NARA 2BI7A 2C2HA 2RONA 2WG0A 3RRBA 1TYEB 3SQOA 2FSVA 4RH1A 1GSHA 2A0XA 3I09A 5IS2A 1J8DA 5GVRA 2AD5A 2FWAA 3ICVA 4YP6A 3DMHA 3QKUA 1G17A 1GQRA 1AMUA 1FJGB 2FPIB 1WDLA 2LVBA 2G1PA 4JLWA 2IXDA 2YCLA 4UNNA 3H16A 4K9MA 3ELYA 5B30A 1KEPA 3CQ9A 4JQSA 5H3HA 1GYQA 3H1GA 1V7ZA 1KFCB 2HV9A 3I4FA 3VZRA 1A8HA 1B0AA 1E7YA 1W6UA 2DUNA 5DEOA 4A92A 3B2QA 1SHUX 4HAUA 1KI3A 2P8JA 4XWTA 1RZ3A 4JEIA 4DIOA 2GEJA 2VP0A 1S2NA 2QAGA 3D0QA 3E22A 3H0EA 1A5AB 2IE0A 3ZLBA 4ARZA 2EWWA 2X0NA 3WL4A 1AKNA 4PSVA 1IJKA 1QYVA 2ZJOA 4HEA6 4ZOLB 2HJWA 4O63O 3U9TA 1X7ZA 1ZLXA 3L1KA 3VTZA 2EFGA 3LX4A 3DEKA 5EEHA 4HNUA 1E2GA 1K3FA 1WXXA 2QL7A 4IEFB 1EQUA 5IJAA 4BCBA 1QKJA 1I5RA 5TGDA 4A6EA 1DEOA 3RE1A 4GSLA 1JIVA 4YMUA 1US8A 2HHJA 2PH3A 4DY4A 4R1UA 3CGWA 4RV4A 2IYNA 3TM5A 1AKRA 2R4QA 2EEPA 1T4BA 3T4UA 3M34A 3VSDA 3UJ3X 2CY0A 4NZZA 1C9DB 1CE8A 3BOSA 1KJ9A 1Y80A 3DKRA 3LLCA 5EIWA <