4CPHB

Trans-divalent streptavidin with love-hate ligand 4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Love-Hate Ligands for High Resolution Analysis of Strain in Ultra-Stable Protein/Small Molecule Interaction.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin binding protein
total genus 24
structure length 120
sequence length 120
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4cphB00
5IRAA 5JD2A 1SRIA 1STSB 1NQMA 2FHLA 1SWEA 2RTEB 1LELA 4U46A 1LDOA 1IJ8A 1LCZA 1MOYA 2Y3EA 1SWJA 1HY2A 4JHQA 1SWKA 1SWTA 4BBOA 1VYOA 1DF8A 3WZNA 3VHHA 1SRHA 1KFFA 1NDJA 1NBXA 1SWAA 2IZJA 5IRUA 1SLGB 1SWBA 1SWUA 1Y55X 1SLEB 1SWLA 2CAMA 4JO6A 3RDMA 3RE5A 2FHNX 1SRFA 4GGTA 1RXHA 3T2XA 4CPEA 1N9YA 3PK2A 3EW1A 5F2BA 3RDQA 1VWQB 2IZDB 4GGZA 1SWOA 3X00A 4BX6B 1RAVA 1VWGB 4I60A 2Y3FA 1SLDB 1VWAB 2IZIA 2JGSA 2RTRB 4Z28A 1HXLA 2IZAA 4CPFA 2A8GA 1SWSA 4GJSA 1VWDB 5B5GA 4Z2OA 1RSTB 1KL3A 2RTJA 3T2WA 3WYPA 2RTHB 4Z27A 4BX5B 1PTSA 1Y53X 4BX6A 1HQQA 4Y59A 3VHIA 2RTPB 2IZCB 5CHKA 2WPUA 3RDXA 4BJ8A 4Z6JA 4IRWA 1RSUB 1SWRA 2QCBA 1KL5A 1RXKA 1SRJA 2OFBA 4GD9A 1AVDA 1LCVA 1MK5A 3RDSA 1VWKB 4Z2VA 1VWOB 1VWHB 2RTAA 2IZGB 3RDUA 2RTCB 3MM0A 4Z2PA 2UYWA 4CPHB 1VWPB 4BX5A 3FDCA 2IZBA 2OF8A 3T6FA 1I9HA 4CPIA 1N43A 4Y5DA 1SRGA 2GH7A 3SZIA 2A5BA 5CSEA 1RXJA 3SZJA 3RY2A 2OFAA 3MG5A 3RDOA 4BCSA 2C4IA 2G5LA 2RTQB 2RTKA 1NQNA 4CPHA 2RTBB 2RTLA 4BX7A 1N7YA 1SREA 1VWCB 3T6LA 2MF6A 2C1QA 1SLFB 3WYQA 2RTMA 1VWIB 3WZPA 1KL4A 1SWPA 2RTFB 3WZQA 2A5CA 2AVIA 1N9MA 1SWGA 2RTOB 1LDQA 3VHMA 1VWMB 2RTNB 3SZHA 1SWDA 1VWJB 1SWNA 1AVEA 1VWLB 1VWRB 2RTGB 4EKVA 2C1SA 2RTIB 4YVBA 4BX7B 1N4JA 3WZOA 5K68A 1VWNB 1LUQA 2IZEB 4GJVA 1MEPA 1LCWA 3RE6A 1STRB 1HXZA 1NC9A 4GGRA 4DNEA 2BC3A 3VGWA 2ZSCA 1VWEB 1MM9A 5K67A 1VWFB 1SWFA 1Y52X 4OKAA 2RTDB 2OF9A 2IZLB 4GDAA 4JNJA 3RY1A 2IZKA 3EW2A 2IZFB 1SWHA 1STPA 2UZ2A 5IRWA 1SWQA 1SWCA 2F01A 2Y32A 1VWBB 1WBIA 5B5FA 5L3YA 2IZHB
chains in the Genus database with same CATH superfamily
5IRAA 1VPRA 1NQMA 2ANSA 2JMBA 4U46A 1LELA 4HPDA 2Z4HA 1BJ7A 1IJ8A 1I04A 1UZ2X 3O19A 4OEMA 4ORYA 3AKMA 1T68X 2CBRA 4TKJA 3HWGA 2X45A 4ZHFA 1VYOA 2I5ZO 2DJGA 3BU1A 3VHHA 2XSTA 1B4MA 1LPJA 1SRHA 1UREA 1EPAA 4O4SA 1NDJA 4RUNA 4AZMA 2OY5O 2L68A 1NBXA 4INNA 4CV7A 4MVIA 1SLGB 2OY8A 4KT5A 2HKDA 2X8SA 3HPEA 1SWUA 4FQBB 1SWLA 2CAMA 5F6ZA 3RDMA 1HN2A 3RE5A 4TKBA 2FHNX 3JSQA 3EC5A 1DZPA 4O49A 3T2XA 3S5VA 2QM9A 3BSZE 5F7GA 3WJCA 3TGCA 5F2BA 1MX8A 3AKNA 4OELA 4GNYA 3FR4A 3FA8A 1RAVA 1MUPA 3WJBA 3WXQA 4Z28A 2JW1A 1XKIA 1ALBA 2Y3FA 4DNEA 4O4OA 1JZUA 1HXLA 3SAOA 3P6FA 2ALLX 1KT3A 3STMX 1IW2A 3U03A 5LJDA 1SY1A 3FMZA 1E02A 2CM4A 2FRSA 5F6BA 3TGAA 1BEBA 3HK1A 1G7NA 4O4UA 5H9AA 4GRJA 4Z27A 5B29A 4MISA 1E06A 1HQQA 1VYGA 4Y59A 2RTPB 2IZCB 4GU8A 5FQ7E 3RDXA 4BJ8A 4ML7B 3HOLA 4R0BA 2A13A 1VWOB 1VWHB 2LKKA 3HWDA 2IZGB 1W4TA 2RTCB 3MX7A 3JS1A 4Z2PA 3VU1A 1BWYA 3UEXA 1VWPB 2HMBA 4ZR2A 1HMSA 1CRBA 1I9HA 4CPIA 1N43A 4BOEA 1EQDA 2GH7A 4IB8A 1T0VA 2BLGA 2Q4NA 3S60A 3SZJA 3KZAA 3P6DA 2OFAA 1PEEA 4Y0SA 4XMFA 3RDOA 3SOTA 2YG2A 1B0OA 2DM5A 3FW4A 4IB9A 4D6AA 2RTLA 2POAA 2C1QA 2CZTA 3SLOA 4I3DA 1BRPA 2RTFB 3FEPA 2JOZA 3KFGA 4KC7A 3VHMA 3VPJE 2NNDA 3WZPA 2QMIA 3ZQ3A 2HYSA 3O2YA 1SWDA 4IAWA 1YWDA 3BY0A 4OS8A 3VG7A 2OL7A 3STNA 1HQPA 1CBRA 1SY0A 3EYCA 1VWRB 1JBHA 4YCHA 1KT7A 2C1SA 2RTIB 1MX7A 4GK9A 1N4JA 4ORXA 3RSWA 1NP1A 3S26A 3F9DA 4BX7B 4GJVA 4JGLA 5EPQA 1UYNX 1LCWA 4GGRA 1HXZA 1NC9A 4XMGA 5IO7A 2OFRX 5H9LA 3PP6A 2F73A 4O3WA 1MM9A 4COTA 5KICA 5K67A 5D8JA 1JYDA 3NX2A 3EMMA 4K19A 5LJEA 3PPTA 4JNJA 4EFGA 3DTQA 2OZQA 2OYBO 1SWHA 2KD2A 1DFVA 3B2IA 3FR5A 1I06A 3PH5A 4MVKA 4QYPA 2RCQA 2OVAA 3NBXX 5AEOA 5B5FA 1X8QA 1QY2A 1OBQA 5FQ6E 5FAZA 4ZHGA 4CDEA 4YGHA 2YMSA 1PMPA 1SXWA 2AF5A 2FHLA 1JJUA 2RD7C 2K23A 5H9NA 4ZH9A 1AB0A 1GKAB 3VG5A 1JQPA 4IBAA 3LTWA 2Y3EA 1SWJA 3C78X 4O3XB 1Y0GA 4DQ3A 1YIVA 1LF7A 1LIEA 1SWTA 1ZNGA 2Q2MA 3HTYA 4GE1A 4TNNA 4A1YA 4AYHA 1KZXA 3B2LA 1DF8A 4MVEA 3ZW0B 5BYPA 1MDCA 2G78A 4CDDA 3CQNA 4WBKA 3T1DA 4WHIA 2MO5A 2WUTA 2R73A 5AJCA 5IRUA 1SWBA 3WVMA 1DC9A 2WQAE 1SLEB 1U0XA 1IFBA 1OSPO 2AT6X 4JO6A 2GTFX 1ZNDA 1RXHA 2NNQA 3VG2A 4ORUA 1N9YA 1LNMA 4ZGFA 3EW1A 1GT4A 5AJBA 4PSQA 4YCEA 4GUZA 3SLJA 3WJDA 2KTDA 2X8TA 1OBPA 1SWOA 1YWCA 2PI3O 3ELZA 3X00A 3H3IA 4ARHA 2PY1A 1LIDA 2IZIA 2FWVA 2JGSA 3BRNA 5C0NA 2A8GA 3MBTA 1SWSA 3OE3A 1JIWI 1FELA 2OVEA 2AT0X 2OVSA 4QAEA 4YKOA 3EM0A 3U9PC 2VFCA 1G74A 2E4JA 2LBAA 3FLLA 2RTJA 3TF6A 2KT4B 2R74A 4Y0PA 4GDZA 2XKLA 1PTSA 1QY0A 1RBPA 5L8NA 2HLVA 3Q34A 3IA8A 5LJKA 1LKEA 5IO5A 4XMHA 3RDSA 1CBIA 4ES7A 1AELA 4Z2VA 1BM5A 3N91A 1ICMA 1YWAA 5H8TA 3RDUA 4YGZA 4EDEA 2I5VO 3CQRA 5L8OA 1LFOA 2R56A 4BVMA 4CPHB 1A57A 4KH8A 4QRLA 1JYJA 5HZQA 1OBUA 2WWPA 2OF8A 5HAEA 4NV7A 1P6PA 2A5BA 3PEDA 4I95A 1RXJA 5B2AO 4IABA 3RY2A 2RQ0A 4I9SA 3RWXA 2FR2A 4YBUA 4QGXA 3MG5A 3APVA 4OMWA 3FR2A 2C4IA 2G5LA 5F58A 3BX7A 3LHNA 5BVSA 1OEKA 1KT5A 1TOWA 4GNWA 2A2UA 4RUUA 4CPHA 3NX1A 2FTBA 1SREA 2Z4IA 2WSJA 4I6SA 5AQ6A 4U8UN 2RTMA 1JJJA 5KIDA 1KL4A 1SWPA 2OVDA 2RTOB 1SWGA 1IKJA 1SA8A 1VWMB 2JU8A 1SXUA 1AVEA 1QG5A 2JN3A 3LV4A 1L6MA 2RTGB 3D96A 4GZVA 3SLTA 2LA7A 4EKVA 1OPBA 1SY2A 4FGIB 4HPBA 4HWMA 3CMPA 1VWNB 4LZVA 3PECA 2IZEB 3WZOA 3IFBA 1MEPA 2G79A 1GT1A 2QOMA 5HCEC 1LIFA 5EDCA 3RE6A 1STRB 2OFMX 4A60A 4B55A 3VGWA 2ZSCA 5HBSA 3BX8A 5HA1A 4HPCA 1X89A 5B10O 1Y52X 4XMEA 3WOVA 4DQ4A 5CE4A 3ZUOA 2IZFB 3NR3A 3B2KA 1BSOA 2F09A 2UZ2A 3P6EA 1O1VA 3FA9A 5EEDA 1O1UA 5IRWA 1EXSA 4AZQA 2F01A 2Y32A 4O3ZA 1H91A 1JV4A 1BLRA 2ACPX 1EIIA 4M6SA 4I3CA 2IZHB 2GTLN 3VE1A 1K3BA 4YGGA 1STSB 2RTEB 1SWEA 4N7CA 1KQXA 2FS6A 3OD9A 1BBPA 1LDOA 1LCZA 1S44A 2W2AA 1D2UA 2X56A 2Q39A 3G7XA 2W2BA 1HY2A 2DJFA 2L9CA 4JHQA 4KCAA 2RCTA 2X55A 4MIRA 5BVTA 3P6HA 1TVQA 1GX3A 4CK4A 1JMXA 3UEVA 1EPBA 5LKEA 1GGLA 4FBVA 2BHVA 2BS5A 4YMYA 5LJBA 1CBSA 5B11O 1DV9A 5LJGA 3FA7A 1BSYA 1QQSA 1KFFA 3VG3A 2LFOA 2X8FA 5B27A 4IB7A 4ZHDA 1SWAA 1EUOA 2QOSC 2G8CO 1Y55X 1E5PA 3D97A 4NW4A 1EIOA 1EI5A 5HCCC 1ZNLA 2BSZA 4GGTA 4I3BA 3ZWEA 3BDRA 5HZ5A 3KFHA 4O9SA 3RZYA 3RDQA 4MEEA 2HZQA 4TKHA 1OEJA 2N93A 2IZDB 4CSBA 5FENA 1IIUA 3NP1A 3FYFA 4I60A 1U17A 4IAXA 4QGWA 3JQOA 4UU2A 4IMNA 4CPFA 4BGFA 3P24A 3OBLA 2HNXA 4GJSA 3FIDA 2K62A 3PDFA 5B5GA 2Q2PA 2L5PA 1A2DA 1HBQA 1N0SA 3PH6A 5HTEA 3EBWA 4OS0A 1VYFA 3T2WA 3WYPA 5HTDA 3I17A 3P02A 3CKGA 2FT9A 1GXAA 1Y53X 1YWBA 2OY1O 3L4RA 1B8EA 4EQAC 5CHKA 2ZAIA 3E3CA 1G85A 2WPUA 2QO5A 3HWEA 4PJ2A 1EALA 2WR6A 2X4MA 4Z6JA 2IFBA 3WBGA 5FQ8E 1DZMA 2QCBA 1ADLA 1HBPA 1MK5A 1LCVA 2OFBA 3F8AA 1X8NA 3FA6A 4GD9A 3ELXA 4M7MA 4ZFXA 1QABE 4I9RA 4ID2A 3MM0A 2A0AA 4U3QA 5D47A 3ZW2A 2UYWA 5DPQA 1XCAA 3B2HA 1I05A 1B56A 2X32A 3FDCA 3FW5A 2IZBA 1HMRA 2BT9A 4WFVA 4Y5DA 1SRGA 1S2PA 3F6ZB 2KW1A 3D95A 5CSEA 4WFUA 4ALOA 2ACOA 4XMDA 4ZJ0A 3TZSA 3DSZA 1AQBA 5LJHA 4YFRA 2GJ5A 4BCSA 3B2JA 4YBPA 2RTQB 4QYNA 1G5WA 1FJ1E 1GX8A 1NQNA 1KZWA 1NP4A 2RTBB 1UYOX 2AT8X 1N7YA 3T6LA 5HWZA 2OL6O 2MF6A 3WYQA 3V8UA 1X8OA 2RA6A 3WZQA 2A5CA 2AVIA 1LDQA 2Q9SA 3D4RA 3D9WA 4ORWA 5K06A 4AW8A 2RTNB 4NP1A 4FBRA 4LZUA 3SZHA 1KGLA 1VWJB 1SWNA 2M4LA 2FLJA 2ZAGA 2VDFA 5CYBA 3BS2A 1BSQA 4NLIA 2FS7A 4KIIA 4TLJA 4YDAA 4DCBA 1LUQA 4LKPA 4AZNA 4NLJA 1DZKA 4LKTA 3CBCA 1QFVA 3CBSA 4NYRA 1FENA 4NYQA 2BC3A 3PQSA 3RBYA 3ZW1B 4CDCA 4TQ2A 4MVLA 1GX9A 1ZRYA 1KT4A 1VWFB 1SWFA 2AT5X 3AUMO 4IB6A 4YFQA 3C77X 4NNSA 5HZ9A 4OKAA 5F1EA 1YUPA 4GDAA 4YFPA 3CWKA 3VE2A 5B3MO 1W5RA 1PBOA 2NNEA 2IZKA 1STPA 5HZ8A 1T8VA 2ASNX 4TJZA 4QQ1A 1ML7A 1SWQA 5D45A 1A18A 1X8UA 3ZW1A 1VWBB 1WBIA 3OJYC 5L3YA 2MHDA 2GTLO 3HWFA 3Q6LA 5JD2A 1QWDA 1OPAA 1SRIA 4YDBA 1KOIA 3KVNA 1ACDA 5D4AA 2W2FA 4HPAA 3P6CA 2QO4A 1GT5A 1MOYA 2LBVA 4ORSA 3UEUA 4AZRA 2MM3A 3CKFA 1SWKA 2G7BA 1ERBA 2EU7X 3U0DA 4BBOA 1LIBA 2NP1A 1FDQA 2OL8O 2P8GA 4A1HA 2GC9A 3WZNA 4ZHHA 1EW3A 5KHPA 4QZTA 2IZJA 2WQ9A 5DG4A 2L67A 1A3YA 5EDBA 4GKCA 2WEXA 4ORRA 1SRFA 1D3SA 1KQWA 1I78A 1R0UA 3KFIA 3P6GA 4CPEA 4U9CA 3NADA 3PK2A 4Y0QA 2O62A 4EXZA 1VWQB 2RN4A 1CBQA 1W6FA 1QFTA 4GETA 4GGZA 4IMOA 4BX6B 1VWGB 5IXGA 1CJ5A 3APXA 1SLDB 1VWAB 4U8UM 2RTRB 3QQ2A 2IZAA 1MVGA 3NQ3A 1NGLA 2CZUA 1VWDB 1AVGI 1K24A 4Z2OA 1YP6A 1O8VA 4D6BA 5FFHA 3ZI8A 4C5PA 4YKMA 3BLGA 4KC8A 1RSTB 3STKA 1KL3A 3WJGA 4NV8A 1KT6A 4XMCA 1FTPA 1IFCA 2JU7A 1DF3A 2RTHB 4BX5B 1Y9LA 3NPOA 4BX6A 3FELA 1FE3A 3VHIA 2MWHA 4IRWA 1RSUB 1SWRA 1Z24A 5EZ2A 1ZNHA 1KL5A 4YH0A 1GT3A 1RXKA 1SRJA 2CBSA 5H9KA 1AVDA 4NNTA 4ALBA 1VWKB 1OEEA 2RTAA 3GAQA 4QNIA 4ZGUA 3MVFA 4L3RA 4QZUA 1X8PA 5BVQA 3K3LA 1ICNA 3PQUA 2JU3A 1TOUA 4BX5A 3AEHA 5HZ6A 1RLBE 4L1NA 4OMXA 4ZHCA 3T6FA 1SXYA 5IO6A 2HZRA 3APWA 1S7DA 3SZIA 1GM6A 1SXXA 2AT3X 2LB6A 4OS3A 3S5XA 1QY1A 3BU9A 3WJEA 2FR3A 5JR8A 2GTLM 3FIQA 3QKGA 4ODDA 4EEJA 4QGVA 4AZOA 3WJFA 2FKGA 2RTKA 3GE2A 4FBOA 2FKJA 1TXLA 5L8IA 4GH7A 3RKGA 1SMPI 4BX7A 1VWCB 1U18A 1PM1X 3CR6A 1YP7A 3C76X 1SLFB 3I0AA 3NQKA 1VWIB 2KTSA 1HMTA 3FEKA 2BS6A 2OY7A 3ZUIA 4BQUA 1N9MA 4CDFA 1JJXA 1ERXA 2CM9A 4O3YA 1ZNEA 1KXOA 4N7DA 5LKFA 5EEEA 3KFFA 1BRQA 1VWLB 2FGSA 4UU3A 4A8ZA 2A3FX 3EBKA 3ZZVA 2AL0X 4AZPA 2WEWA 4YVBA 5HCDC 5K68A 4ZCBA 3UEWA 3TGBA 1IKEA 2VFBA 1PBYA 1Y9TA 2A2GA 2X46A 5LJCA 3FENA 3NQ9A 1TW4A 3O22A 4ZH6A 3VG4A 1VWEB 5HA0A 4ON1A 4LQZA 3HOEA 1SY3A 2AKQA 1E2TA 2RTDB 1FEMA 3UAQA 1I4UA 2IZLB 1GKAA 2OF9A 4Y0RA 3RY1A 5D48A 3EW2A 1DZJA 1E00A 1ZNKA 2MJIA 3APUA 3KQ0A 4U8UO 2AMMX 3VG6A 2QO6A 4O4XA 1SWCA 1WUBA 2X34A 2AH7X 3ZW0A 1JMZA 1LICA 4HFOA 1X71A
chains in the Genus database with same CATH topology
5IRAA 5JD2A 1SRIA 1STSB 1NQMA 2FHLA 1SWEA 2RTEB 1LELA 4U46A 1LDOA 1IJ8A 1LCZA 1MOYA 2Y3EA 1SWJA 1HY2A 4JHQA 1SWKA 1SWTA 4BBOA 1VYOA 1DF8A 3WZNA 3VHHA 1SRHA 1KFFA 1NDJA 1NBXA 1SWAA 2IZJA 5IRUA 1SLGB 1SWBA 1SWUA 1Y55X 1SLEB 1SWLA 2CAMA 4JO6A 3RDMA 3RE5A 2FHNX 1SRFA 4GGTA 1RXHA 3T2XA 4CPEA 1N9YA 3PK2A 3EW1A 5F2BA 3RDQA 1VWQB 2IZDB 4GGZA 1SWOA 3X00A 4BX6B 1RAVA 1VWGB 4I60A 2Y3FA 1SLDB 1VWAB 2IZIA 2JGSA 2RTRB 4Z28A 1HXLA 2IZAA 4CPFA 2A8GA 1SWSA 4GJSA 1VWDB 5B5GA 4Z2OA 1RSTB 1KL3A 2RTJA 3T2WA 3WYPA 2RTHB 4Z27A 4BX5B 1PTSA 1Y53X 4BX6A 1HQQA 4Y59A 3VHIA 2RTPB 2IZCB 5CHKA 2WPUA 3RDXA 4BJ8A 4Z6JA 4IRWA 1RSUB 1SWRA 2QCBA 1KL5A 1RXKA 1SRJA 2OFBA 4GD9A 1AVDA 1LCVA 1MK5A 3RDSA 1VWKB 4Z2VA 1VWOB 1VWHB 2RTAA 2IZGB 3RDUA 2RTCB 3MM0A 4Z2PA 2UYWA 4CPHB 1VWPB 4BX5A 3FDCA 2IZBA 2OF8A 3T6FA 1I9HA 4CPIA 1N43A 4Y5DA 1SRGA 2GH7A 3SZIA 2A5BA 5CSEA 1RXJA 3SZJA 3RY2A 2OFAA 3MG5A 3RDOA 4BCSA 2C4IA 2G5LA 2RTQB 2RTKA 1NQNA 4CPHA 2RTBB 2RTLA 4BX7A 1N7YA 1SREA 1VWCB 3T6LA 2MF6A 2C1QA 1SLFB 3WYQA 2RTMA 1VWIB 3WZPA 1KL4A 1SWPA 2RTFB 3WZQA 2A5CA 2AVIA 1N9MA 1SWGA 2RTOB 1LDQA 3VHMA 1VWMB 2RTNB 3SZHA 1SWDA 1VWJB 1SWNA 1AVEA 1VWLB 1VWRB 2RTGB 4EKVA 2C1SA 2RTIB 4YVBA 4BX7B 1N4JA 3WZOA 5K68A 1VWNB 1LUQA 2IZEB 4GJVA 1MEPA 1LCWA 3RE6A 1STRB 1HXZA 1NC9A 4GGRA 4DNEA 2BC3A 3VGWA 2ZSCA 1VWEB 1MM9A 5K67A 1VWFB 1SWFA 1Y52X 4OKAA 2RTDB 2OF9A 2IZLB 4GDAA 4JNJA 3RY1A 2IZKA 3EW2A 2IZFB 1SWHA 1STPA 2UZ2A 5IRWA 1SWQA 1SWCA 2F01A 2Y32A 1VWBB 1WBIA 5B5FA 5L3YA 2IZHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IRA A;  5JD2 A;  1SRI A;  1STS B;  1NQM A;  2FHL A;  1SWE A;  2RTE B;  1LEL A;  4U46 A;  1LDO A;  1IJ8 A;  1LCZ A;  1MOY A;  2Y3E A;  1SWJ A;  1HY2 A;  4JHQ A;  1SWK A;  1SWT A;  4BBO A;  1VYO A;  1DF8 A;  3WZN A;  3VHH A;  1SRH A;  1KFF A;  1NDJ A;  1NBX A;  1SWA A;  2IZJ A;  5IRU A;  1SLG B;  1SWB A;  1SWU A;  1Y55 X;  1SLE B;  1SWL A;  2CAM A;  4JO6 A;  3RDM A;  3RE5 A;  2FHN X;  1SRF A;  4GGT A;  1RXH A;  3T2X A;  4CPE A;  1N9Y A;  3PK2 A;  3EW1 A;  5F2B A;  3RDQ A;  1VWQ B;  2IZD B;  4GGZ A;  1SWO A;  3X00 A;  4BX6 B;  1RAV A;  1VWG B;  4I60 A;  2Y3F A;  1SLD B;  1VWA B;  2IZI A;  2JGS A;  2RTR B;  4Z28 A;  1HXL A;  2IZA A;  4CPF A;  2A8G A;  1SWS A;  4GJS A;  1VWD B;  5B5G A;  4Z2O A;  1RST B;  1KL3 A;  2RTJ A;  3T2W A;  3WYP A;  2RTH B;  4Z27 A;  4BX5 B;  1PTS A;  1Y53 X;  4BX6 A;  1HQQ A;  4Y59 A;  3VHI A;  2RTP B;  2IZC B;  5CHK A;  2WPU A;  3RDX A;  4BJ8 A;  4Z6J A;  4IRW A;  1RSU B;  1SWR A;  2QCB A;  1KL5 A;  1RXK A;  1SRJ A;  2OFB A;  4GD9 A;  1AVD A;  1LCV A;  1MK5 A;  3RDS A;  1VWK B;  4Z2V A;  1VWO B;  1VWH B;  2RTA A;  2IZG B;  3RDU A;  2RTC B;  3MM0 A;  4Z2P A;  2UYW A;  4CPH B;  1VWP B;  4BX5 A;  3FDC A;  2IZB A;  2OF8 A;  3T6F A;  1I9H A;  4CPI A;  1N43 A;  4Y5D A;  1SRG A;  2GH7 A;  3SZI A;  2A5B A;  5CSE A;  1RXJ A;  3SZJ A;  3RY2 A;  2OFA A;  3MG5 A;  3RDO A;  4BCS A;  2C4I A;  2G5L A;  2RTQ B;  2RTK A;  1NQN A;  4CPH A;  2RTB B;  2RTL A;  4BX7 A;  1N7Y A;  1SRE A;  1VWC B;  3T6L A;  2MF6 A;  2C1Q A;  1SLF B;  3WYQ A;  2RTM A;  1VWI B;  3WZP A;  1KL4 A;  1SWP A;  2RTF B;  3WZQ A;  2A5C A;  2AVI A;  1N9M A;  1SWG A;  2RTO B;  1LDQ A;  3VHM A;  1VWM B;  2RTN B;  3SZH A;  1SWD A;  1VWJ B;  1SWN A;  1AVE A;  1VWL B;  1VWR B;  2RTG B;  4EKV A;  2C1S A;  2RTI B;  4YVB A;  4BX7 B;  1N4J A;  3WZO A;  5K68 A;  1VWN B;  1LUQ A;  2IZE B;  4GJV A;  1MEP A;  1LCW A;  3RE6 A;  1STR B;  1HXZ A;  1NC9 A;  4GGR A;  4DNE A;  2BC3 A;  3VGW A;  2ZSC A;  1VWE B;  1MM9 A;  5K67 A;  1VWF B;  1SWF A;  1Y52 X;  4OKA A;  2RTD B;  2OF9 A;  2IZL B;  4GDA A;  4JNJ A;  3RY1 A;  2IZK A;  3EW2 A;  2IZF B;  1SWH A;  1STP A;  2UZ2 A;  5IRW A;  1SWQ A;  1SWC A;  2F01 A;  2Y32 A;  1VWB B;  1WBI A;  5B5F A;  5L3Y A;  2IZH B; 
#chains in the Genus database with same CATH topology
 5IRA A;  1VPR A;  1NQM A;  2ANS A;  2JMB A;  4U46 A;  1LEL A;  4HPD A;  2Z4H A;  1BJ7 A;  1IJ8 A;  1I04 A;  1UZ2 X;  3O19 A;  4OEM A;  4ORY A;  3AKM A;  1T68 X;  2CBR A;  4TKJ A;  3HWG A;  2X45 A;  4ZHF A;  1VYO A;  2I5Z O;  2DJG A;  3BU1 A;  3VHH A;  2XST A;  1B4M A;  1LPJ A;  1SRH A;  1URE A;  1EPA A;  4O4S A;  1NDJ A;  4RUN A;  4AZM A;  2OY5 O;  2L68 A;  1NBX A;  4INN A;  4CV7 A;  4MVI A;  1SLG B;  2OY8 A;  4KT5 A;  2HKD A;  2X8S A;  3HPE A;  1SWU A;  4FQB B;  1SWL A;  2CAM A;  5F6Z A;  3RDM A;  1HN2 A;  3RE5 A;  4TKB A;  2FHN X;  3JSQ A;  3EC5 A;  1DZP A;  4O49 A;  3T2X A;  3S5V A;  2QM9 A;  3BSZ E;  5F7G A;  3WJC A;  3TGC A;  5F2B A;  1MX8 A;  3AKN A;  4OEL A;  4GNY A;  3FR4 A;  3FA8 A;  1RAV A;  1MUP A;  3WJB A;  3WXQ A;  4Z28 A;  2JW1 A;  1XKI A;  1ALB A;  2Y3F A;  4DNE A;  4O4O A;  1JZU A;  1HXL A;  3SAO A;  3P6F A;  2ALL X;  1KT3 A;  3STM X;  1IW2 A;  3U03 A;  5LJD A;  1SY1 A;  3FMZ A;  1E02 A;  2CM4 A;  2FRS A;  5F6B A;  3TGA A;  1BEB A;  3HK1 A;  1G7N A;  4O4U A;  5H9A A;  4GRJ A;  4Z27 A;  5B29 A;  4MIS A;  1E06 A;  1HQQ A;  1VYG A;  4Y59 A;  2RTP B;  2IZC B;  4GU8 A;  5FQ7 E;  3RDX A;  4BJ8 A;  4ML7 B;  3HOL A;  4R0B A;  2A13 A;  1VWO B;  1VWH B;  2LKK A;  3HWD A;  2IZG B;  1W4T A;  2RTC B;  3MX7 A;  3JS1 A;  4Z2P A;  3VU1 A;  1BWY A;  3UEX A;  1VWP B;  2HMB A;  4ZR2 A;  1HMS A;  1CRB A;  1I9H A;  4CPI A;  1N43 A;  4BOE A;  1EQD A;  2GH7 A;  4IB8 A;  1T0V A;  2BLG A;  2Q4N A;  3S60 A;  3SZJ A;  3KZA A;  3P6D A;  2OFA A;  1PEE A;  4Y0S A;  4XMF A;  3RDO A;  3SOT A;  2YG2 A;  1B0O A;  2DM5 A;  3FW4 A;  4IB9 A;  4D6A A;  2RTL A;  2POA A;  2C1Q A;  2CZT A;  3SLO A;  4I3D A;  1BRP A;  2RTF B;  3FEP A;  2JOZ A;  3KFG A;  4KC7 A;  3VHM A;  3VPJ E;  2NND A;  3WZP A;  2QMI A;  3ZQ3 A;  2HYS A;  3O2Y A;  1SWD A;  4IAW A;  1YWD A;  3BY0 A;  4OS8 A;  3VG7 A;  2OL7 A;  3STN A;  1HQP A;  1CBR A;  1SY0 A;  3EYC A;  1VWR B;  1JBH A;  4YCH A;  1KT7 A;  2C1S A;  2RTI B;  1MX7 A;  4GK9 A;  1N4J A;  4ORX A;  3RSW A;  1NP1 A;  3S26 A;  3F9D A;  4BX7 B;  4GJV A;  4JGL A;  5EPQ A;  1UYN X;  1LCW A;  4GGR A;  1HXZ A;  1NC9 A;  4XMG A;  5IO7 A;  2OFR X;  5H9L A;  3PP6 A;  2F73 A;  4O3W A;  1MM9 A;  4COT A;  5KIC A;  5K67 A;  5D8J A;  1JYD A;  3NX2 A;  3EMM A;  4K19 A;  5LJE A;  3PPT A;  4JNJ A;  4EFG A;  3DTQ A;  2OZQ A;  2OYB O;  1SWH A;  2KD2 A;  1DFV A;  3B2I A;  3FR5 A;  1I06 A;  3PH5 A;  4MVK A;  4QYP A;  2RCQ A;  2OVA A;  3NBX X;  5AEO A;  5B5F A;  1X8Q A;  1QY2 A;  1OBQ A;  5FQ6 E;  5FAZ A;  4ZHG A;  4CDE A;  4YGH A;  2YMS A;  1PMP A;  1SXW A;  2AF5 A;  2FHL A;  1JJU A;  2RD7 C;  2K23 A;  5H9N A;  4ZH9 A;  1AB0 A;  1GKA B;  3VG5 A;  1JQP A;  4IBA A;  3LTW A;  2Y3E A;  1SWJ A;  3C78 X;  4O3X B;  1Y0G A;  4DQ3 A;  1YIV A;  1LF7 A;  1LIE A;  1SWT A;  1ZNG A;  2Q2M A;  3HTY A;  4GE1 A;  4TNN A;  4A1Y A;  4AYH A;  1KZX A;  3B2L A;  1DF8 A;  4MVE A;  3ZW0 B;  5BYP A;  1MDC A;  2G78 A;  4CDD A;  3CQN A;  4WBK A;  3T1D A;  4WHI A;  2MO5 A;  2WUT A;  2R73 A;  5AJC A;  5IRU A;  1SWB A;  3WVM A;  1DC9 A;  2WQA E;  1SLE B;  1U0X A;  1IFB A;  1OSP O;  2AT6 X;  4JO6 A;  2GTF X;  1ZND A;  1RXH A;  2NNQ A;  3VG2 A;  4ORU A;  1N9Y A;  1LNM A;  4ZGF A;  3EW1 A;  1GT4 A;  5AJB A;  4PSQ A;  4YCE A;  4GUZ A;  3SLJ A;  3WJD A;  2KTD A;  2X8T A;  1OBP A;  1SWO A;  1YWC A;  2PI3 O;  3ELZ A;  3X00 A;  3H3I A;  4ARH A;  2PY1 A;  1LID A;  2IZI A;  2FWV A;  2JGS A;  3BRN A;  5C0N A;  2A8G A;  3MBT A;  1SWS A;  3OE3 A;  1JIW I;  1FEL A;  2OVE A;  2AT0 X;  2OVS A;  4QAE A;  4YKO A;  3EM0 A;  3U9P C;  2VFC A;  1G74 A;  2E4J A;  2LBA A;  3FLL A;  2RTJ A;  3TF6 A;  2KT4 B;  2R74 A;  4Y0P A;  4GDZ A;  2XKL A;  1PTS A;  1QY0 A;  1RBP A;  5L8N A;  2HLV A;  3Q34 A;  3IA8 A;  5LJK A;  1LKE A;  5IO5 A;  4XMH A;  3RDS A;  1CBI A;  4ES7 A;  1AEL A;  4Z2V A;  1BM5 A;  3N91 A;  1ICM A;  1YWA A;  5H8T A;  3RDU A;  4YGZ A;  4EDE A;  2I5V O;  3CQR A;  5L8O A;  1LFO A;  2R56 A;  4BVM A;  4CPH B;  1A57 A;  4KH8 A;  4QRL A;  1JYJ A;  5HZQ A;  1OBU A;  2WWP A;  2OF8 A;  5HAE A;  4NV7 A;  1P6P A;  2A5B A;  3PED A;  4I95 A;  1RXJ A;  5B2A O;  4IAB A;  3RY2 A;  2RQ0 A;  4I9S A;  3RWX A;  2FR2 A;  4YBU A;  4QGX A;  3MG5 A;  3APV A;  4OMW A;  3FR2 A;  2C4I A;  2G5L A;  5F58 A;  3BX7 A;  3LHN A;  5BVS A;  1OEK A;  1KT5 A;  1TOW A;  4GNW A;  2A2U A;  4RUU A;  4CPH A;  3NX1 A;  2FTB A;  1SRE A;  2Z4I A;  2WSJ A;  4I6S A;  5AQ6 A;  4U8U N;  2RTM A;  1JJJ A;  5KID A;  1KL4 A;  1SWP A;  2OVD A;  2RTO B;  1SWG A;  1IKJ A;  1SA8 A;  1VWM B;  2JU8 A;  1SXU A;  1AVE A;  1QG5 A;  2JN3 A;  3LV4 A;  1L6M A;  2RTG B;  3D96 A;  4GZV A;  3SLT A;  2LA7 A;  4EKV A;  1OPB A;  1SY2 A;  4FGI B;  4HPB A;  4HWM A;  3CMP A;  1VWN B;  4LZV A;  3PEC A;  2IZE B;  3WZO A;  3IFB A;  1MEP A;  2G79 A;  1GT1 A;  2QOM A;  5HCE C;  1LIF A;  5EDC A;  3RE6 A;  1STR B;  2OFM X;  4A60 A;  4B55 A;  3VGW A;  2ZSC A;  5HBS A;  3BX8 A;  5HA1 A;  4HPC A;  1X89 A;  5B10 O;  1Y52 X;  4XME A;  3WOV A;  4DQ4 A;  5CE4 A;  3ZUO A;  2IZF B;  3NR3 A;  3B2K A;  1BSO A;  2F09 A;  2UZ2 A;  3P6E A;  1O1V A;  3FA9 A;  5EED A;  1O1U A;  5IRW A;  1EXS A;  4AZQ A;  2F01 A;  2Y32 A;  4O3Z A;  1H91 A;  1JV4 A;  1BLR A;  2ACP X;  1EII A;  4M6S A;  4I3C A;  2IZH B;  2GTL N;  3VE1 A;  1K3B A;  4YGG A;  1STS B;  2RTE B;  1SWE A;  4N7C A;  1KQX A;  2FS6 A;  3OD9 A;  1BBP A;  1LDO A;  1LCZ A;  1S44 A;  2W2A A;  1D2U A;  2X56 A;  2Q39 A;  3G7X A;  2W2B A;  1HY2 A;  2DJF A;  2L9C A;  4JHQ A;  4KCA A;  2RCT A;  2X55 A;  4MIR A;  5BVT A;  3P6H A;  1TVQ A;  1GX3 A;  4CK4 A;  1JMX A;  3UEV A;  1EPB A;  5LKE A;  1GGL A;  4FBV A;  2BHV A;  2BS5 A;  4YMY A;  5LJB A;  1CBS A;  5B11 O;  1DV9 A;  5LJG A;  3FA7 A;  1BSY A;  1QQS A;  1KFF A;  3VG3 A;  2LFO A;  2X8F A;  5B27 A;  4IB7 A;  4ZHD A;  1SWA A;  1EUO A;  2QOS C;  2G8C O;  1Y55 X;  1E5P A;  3D97 A;  4NW4 A;  1EIO A;  1EI5 A;  5HCC C;  1ZNL A;  2BSZ A;  4GGT A;  4I3B A;  3ZWE A;  3BDR A;  5HZ5 A;  3KFH A;  4O9S A;  3RZY A;  3RDQ A;  4MEE A;  2HZQ A;  4TKH A;  1OEJ A;  2N93 A;  2IZD B;  4CSB A;  5FEN A;  1IIU A;  3NP1 A;  3FYF A;  4I60 A;  1U17 A;  4IAX A;  4QGW A;  3JQO A;  4UU2 A;  4IMN A;  4CPF A;  4BGF A;  3P24 A;  3OBL A;  2HNX A;  4GJS A;  3FID A;  2K62 A;  3PDF A;  5B5G A;  2Q2P A;  2L5P A;  1A2D A;  1HBQ A;  1N0S A;  3PH6 A;  5HTE A;  3EBW A;  4OS0 A;  1VYF A;  3T2W A;  3WYP A;  5HTD A;  3I17 A;  3P02 A;  3CKG A;  2FT9 A;  1GXA A;  1Y53 X;  1YWB A;  2OY1 O;  3L4R A;  1B8E A;  4EQA C;  5CHK A;  2ZAI A;  3E3C A;  1G85 A;  2WPU A;  2QO5 A;  3HWE A;  4PJ2 A;  1EAL A;  2WR6 A;  2X4M A;  4Z6J A;  2IFB A;  3WBG A;  5FQ8 E;  1DZM A;  2QCB A;  1ADL A;  1HBP A;  1MK5 A;  1LCV A;  2OFB A;  3F8A A;  1X8N A;  3FA6 A;  4GD9 A;  3ELX A;  4M7M A;  4ZFX A;  1QAB E;  4I9R A;  4ID2 A;  3MM0 A;  2A0A A;  4U3Q A;  5D47 A;  3ZW2 A;  2UYW A;  5DPQ A;  1XCA A;  3B2H A;  1I05 A;  1B56 A;  2X32 A;  3FDC A;  3FW5 A;  2IZB A;  1HMR A;  2BT9 A;  4WFV A;  4Y5D A;  1SRG A;  1S2P A;  3F6Z B;  2KW1 A;  3D95 A;  5CSE A;  4WFU A;  4ALO A;  2ACO A;  4XMD A;  4ZJ0 A;  3TZS A;  3DSZ A;  1AQB A;  5LJH A;  4YFR A;  2GJ5 A;  4BCS A;  3B2J A;  4YBP A;  2RTQ B;  4QYN A;  1G5W A;  1FJ1 E;  1GX8 A;  1NQN A;  1KZW A;  1NP4 A;  2RTB B;  1UYO X;  2AT8 X;  1N7Y A;  3T6L A;  5HWZ A;  2OL6 O;  2MF6 A;  3WYQ A;  3V8U A;  1X8O A;  2RA6 A;  3WZQ A;  2A5C A;  2AVI A;  1LDQ A;  2Q9S A;  3D4R A;  3D9W A;  4ORW A;  5K06 A;  4AW8 A;  2RTN B;  4NP1 A;  4FBR A;  4LZU A;  3SZH A;  1KGL A;  1VWJ B;  1SWN A;  2M4L A;  2FLJ A;  2ZAG A;  2VDF A;  5CYB A;  3BS2 A;  1BSQ A;  4NLI A;  2FS7 A;  4KII A;  4TLJ A;  4YDA A;  4DCB A;  1LUQ A;  4LKP A;  4AZN A;  4NLJ A;  1DZK A;  4LKT A;  3CBC A;  1QFV A;  3CBS A;  4NYR A;  1FEN A;  4NYQ A;  2BC3 A;  3PQS A;  3RBY A;  3ZW1 B;  4CDC A;  4TQ2 A;  4MVL A;  1GX9 A;  1ZRY A;  1KT4 A;  1VWF B;  1SWF A;  2AT5 X;  3AUM O;  4IB6 A;  4YFQ A;  3C77 X;  4NNS A;  5HZ9 A;  4OKA A;  5F1E A;  1YUP A;  4GDA A;  4YFP A;  3CWK A;  3VE2 A;  5B3M O;  1W5R A;  1PBO A;  2NNE A;  2IZK A;  1STP A;  5HZ8 A;  1T8V A;  2ASN X;  4TJZ A;  4QQ1 A;  1ML7 A;  1SWQ A;  5D45 A;  1A18 A;  1X8U A;  3ZW1 A;  1VWB B;  1WBI A;  3OJY C;  5L3Y A;  2MHD A;  2GTL O;  3HWF A;  3Q6L A;  5JD2 A;  1QWD A;  1OPA A;  1SRI A;  4YDB A;  1KOI A;  3KVN A;  1ACD A;  5D4A A;  2W2F A;  4HPA A;  3P6C A;  2QO4 A;  1GT5 A;  1MOY A;  2LBV A;  4ORS A;  3UEU A;  4AZR A;  2MM3 A;  3CKF A;  1SWK A;  2G7B A;  1ERB A;  2EU7 X;  3U0D A;  4BBO A;  1LIB A;  2NP1 A;  1FDQ A;  2OL8 O;  2P8G A;  4A1H A;  2GC9 A;  3WZN A;  4ZHH A;  1EW3 A;  5KHP A;  4QZT A;  2IZJ A;  2WQ9 A;  5DG4 A;  2L67 A;  1A3Y A;  5EDB A;  4GKC A;  2WEX A;  4ORR A;  1SRF A;  1D3S A;  1KQW A;  1I78 A;  1R0U A;  3KFI A;  3P6G A;  4CPE A;  4U9C A;  3NAD A;  3PK2 A;  4Y0Q A;  2O62 A;  4EXZ A;  1VWQ B;  2RN4 A;  1CBQ A;  1W6F A;  1QFT A;  4GET A;  4GGZ A;  4IMO A;  4BX6 B;  1VWG B;  5IXG A;  1CJ5 A;  3APX A;  1SLD B;  1VWA B;  4U8U M;  2RTR B;  3QQ2 A;  2IZA A;  1MVG A;  3NQ3 A;  1NGL A;  2CZU A;  1VWD B;  1AVG I;  1K24 A;  4Z2O A;  1YP6 A;  1O8V A;  4D6B A;  5FFH A;  3ZI8 A;  4C5P A;  4YKM A;  3BLG A;  4KC8 A;  1RST B;  3STK A;  1KL3 A;  3WJG A;  4NV8 A;  1KT6 A;  4XMC A;  1FTP A;  1IFC A;  2JU7 A;  1DF3 A;  2RTH B;  4BX5 B;  1Y9L A;  3NPO A;  4BX6 A;  3FEL A;  1FE3 A;  3VHI A;  2MWH A;  4IRW A;  1RSU B;  1SWR A;  1Z24 A;  5EZ2 A;  1ZNH A;  1KL5 A;  4YH0 A;  1GT3 A;  1RXK A;  1SRJ A;  2CBS A;  5H9K A;  1AVD A;  4NNT A;  4ALB A;  1VWK B;  1OEE A;  2RTA A;  3GAQ A;  4QNI A;  4ZGU A;  3MVF A;  4L3R A;  4QZU A;  1X8P A;  5BVQ A;  3K3L A;  1ICN A;  3PQU A;  2JU3 A;  1TOU A;  4BX5 A;  3AEH A;  5HZ6 A;  1RLB E;  4L1N A;  4OMX A;  4ZHC A;  3T6F A;  1SXY A;  5IO6 A;  2HZR A;  3APW A;  1S7D A;  3SZI A;  1GM6 A;  1SXX A;  2AT3 X;  2LB6 A;  4OS3 A;  3S5X A;  1QY1 A;  3BU9 A;  3WJE A;  2FR3 A;  5JR8 A;  2GTL M;  3FIQ A;  3QKG A;  4ODD A;  4EEJ A;  4QGV A;  4AZO A;  3WJF A;  2FKG A;  2RTK A;  3GE2 A;  4FBO A;  2FKJ A;  1TXL A;  5L8I A;  4GH7 A;  3RKG A;  1SMP I;  4BX7 A;  1VWC B;  1U18 A;  1PM1 X;  3CR6 A;  1YP7 A;  3C76 X;  1SLF B;  3I0A A;  3NQK A;  1VWI B;  2KTS A;  1HMT A;  3FEK A;  2BS6 A;  2OY7 A;  3ZUI A;  4BQU A;  1N9M A;  4CDF A;  1JJX A;  1ERX A;  2CM9 A;  4O3Y A;  1ZNE A;  1KXO A;  4N7D A;  5LKF A;  5EEE A;  3KFF A;  1BRQ A;  1VWL B;  2FGS A;  4UU3 A;  4A8Z A;  2A3F X;  3EBK A;  3ZZV A;  2AL0 X;  4AZP A;  2WEW A;  4YVB A;  5HCD C;  5K68 A;  4ZCB A;  3UEW A;  3TGB A;  1IKE A;  2VFB A;  1PBY A;  1Y9T A;  2A2G A;  2X46 A;  5LJC A;  3FEN A;  3NQ9 A;  1TW4 A;  3O22 A;  4ZH6 A;  3VG4 A;  1VWE B;  5HA0 A;  4ON1 A;  4LQZ A;  3HOE A;  1SY3 A;  2AKQ A;  1E2T A;  2RTD B;  1FEM A;  3UAQ A;  1I4U A;  2IZL B;  1GKA A;  2OF9 A;  4Y0R A;  3RY1 A;  5D48 A;  3EW2 A;  1DZJ A;  1E00 A;  1ZNK A;  2MJI A;  3APU A;  3KQ0 A;  4U8U O;  2AMM X;  3VG6 A;  2QO6 A;  4O4X A;  1SWC A;  1WUB A;  2X34 A;  2AH7 X;  3ZW0 A;  1JMZ A;  1LIC A;  4HFO A;  1X71 A; 
#chains in the Genus database with same CATH homology
 5IRA A;  5JD2 A;  1SRI A;  1STS B;  1NQM A;  2FHL A;  1SWE A;  2RTE B;  1LEL A;  4U46 A;  1LDO A;  1IJ8 A;  1LCZ A;  1MOY A;  2Y3E A;  1SWJ A;  1HY2 A;  4JHQ A;  1SWK A;  1SWT A;  4BBO A;  1VYO A;  1DF8 A;  3WZN A;  3VHH A;  1SRH A;  1KFF A;  1NDJ A;  1NBX A;  1SWA A;  2IZJ A;  5IRU A;  1SLG B;  1SWB A;  1SWU A;  1Y55 X;  1SLE B;  1SWL A;  2CAM A;  4JO6 A;  3RDM A;  3RE5 A;  2FHN X;  1SRF A;  4GGT A;  1RXH A;  3T2X A;  4CPE A;  1N9Y A;  3PK2 A;  3EW1 A;  5F2B A;  3RDQ A;  1VWQ B;  2IZD B;  4GGZ A;  1SWO A;  3X00 A;  4BX6 B;  1RAV A;  1VWG B;  4I60 A;  2Y3F A;  1SLD B;  1VWA B;  2IZI A;  2JGS A;  2RTR B;  4Z28 A;  1HXL A;  2IZA A;  4CPF A;  2A8G A;  1SWS A;  4GJS A;  1VWD B;  5B5G A;  4Z2O A;  1RST B;  1KL3 A;  2RTJ A;  3T2W A;  3WYP A;  2RTH B;  4Z27 A;  4BX5 B;  1PTS A;  1Y53 X;  4BX6 A;  1HQQ A;  4Y59 A;  3VHI A;  2RTP B;  2IZC B;  5CHK A;  2WPU A;  3RDX A;  4BJ8 A;  4Z6J A;  4IRW A;  1RSU B;  1SWR A;  2QCB A;  1KL5 A;  1RXK A;  1SRJ A;  2OFB A;  4GD9 A;  1AVD A;  1LCV A;  1MK5 A;  3RDS A;  1VWK B;  4Z2V A;  1VWO B;  1VWH B;  2RTA A;  2IZG B;  3RDU A;  2RTC B;  3MM0 A;  4Z2P A;  2UYW A;  4CPH B;  1VWP B;  4BX5 A;  3FDC A;  2IZB A;  2OF8 A;  3T6F A;  1I9H A;  4CPI A;  1N43 A;  4Y5D A;  1SRG A;  2GH7 A;  3SZI A;  2A5B A;  5CSE A;  1RXJ A;  3SZJ A;  3RY2 A;  2OFA A;  3MG5 A;  3RDO A;  4BCS A;  2C4I A;  2G5L A;  2RTQ B;  2RTK A;  1NQN A;  4CPH A;  2RTB B;  2RTL A;  4BX7 A;  1N7Y A;  1SRE A;  1VWC B;  3T6L A;  2MF6 A;  2C1Q A;  1SLF B;  3WYQ A;  2RTM A;  1VWI B;  3WZP A;  1KL4 A;  1SWP A;  2RTF B;  3WZQ A;  2A5C A;  2AVI A;  1N9M A;  1SWG A;  2RTO B;  1LDQ A;  3VHM A;  1VWM B;  2RTN B;  3SZH A;  1SWD A;  1VWJ B;  1SWN A;  1AVE A;  1VWL B;  1VWR B;  2RTG B;  4EKV A;  2C1S A;  2RTI B;  4YVB A;  4BX7 B;  1N4J A;  3WZO A;  5K68 A;  1VWN B;  1LUQ A;  2IZE B;  4GJV A;  1MEP A;  1LCW A;  3RE6 A;  1STR B;  1HXZ A;  1NC9 A;  4GGR A;  4DNE A;  2BC3 A;  3VGW A;  2ZSC A;  1VWE B;  1MM9 A;  5K67 A;  1VWF B;  1SWF A;  1Y52 X;  4OKA A;  2RTD B;  2OF9 A;  2IZL B;  4GDA A;  4JNJ A;  3RY1 A;  2IZK A;  3EW2 A;  2IZF B;  1SWH A;  1STP A;  2UZ2 A;  5IRW A;  1SWQ A;  1SWC A;  2F01 A;  2Y32 A;  1VWB B;  1WBI A;  5B5F A;  5L3Y A;  2IZH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...