4CQEA

B-raf kinase v600e mutant in complex with a diarylthiazole b-raf inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
250
Chain Sequence
DWEIPDGQITVGQRIGSGGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGGSILWMAPEVIRMQNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SLC45A3-BRAF FUSION PROTEIN
publication title Optimization of Diarylthiazole B-Raf Inhibitors: Identification of a Compound Endowed with High Oral Antitumor Activity, Mitigated Herg Inhibition, and Low Paradoxical Effect.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 250
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cqeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cqeA01
3QKKA 1OIYA 4LOOA 1SVEA 3AGMA 4G3DA 3FZTA 2IZSA 3QLFA 4O7SA 1M7QA 5HCXA 3VUDA 3QLGA 4FKOA 4MQ1A 3R7YA 4D2PA 2YZLA 4AOIA 2G15A 1TQIA 2XJ0A 2YABA 2YM8A 3GQLA 3I4BA 4ZS0A 5EM8A 4DFZE 4O22A 5HNGA 3ZEWA 3ORPA 2ITYA 3EHAA 4FG7A 4NIFB 3W32A 3ZUTA 4X0MA 4YGAA 5HCZA 1F5QA 3F2NA 4BCNA 2BFXA 1FOTA 3KN5A 4BKJA 3CP9A 2QOBA 5HNIX 5HBHA 2Z60A 2F2UA 5E9EA 2V5QA 2BCJA 2W05A 3HLLA 2RFEA 5FD2A 2NRYA 4I94A 5EM7A 3EJ1A 2GNGA 2Y6MA 3CJFA 4ANSA 3BYUA 2Y4PA 3U51A 1ZOEA 4YSMA 3ZFYA 4BDAA 3ROCA 2G2HA 5BVNA 2PYWA 5HTIA 4M13A 2WGJA 3ORMA 4EH3A 2J4ZA 4Z55A 2QC6A 1YOLA 3ZEPA 4ZLOA 4FSQA 3PFQA 2AYPA 4RIWA 3W10A 2C3JA 2UZLA 3KFAA 5E8ZA 2WTJA 4FTRA 4I23A 2R3NA 3NYXA 2C5VA 3BLHA 3EB0A 3UNJA 4EOLA 3VNTA 4KIPA 4O0YA 3LJ2A 5GJDA 4IFCA 3EOCA 4UX9A 3OMVA 2XRUA 4EYJA 3EN5A 3EL8A 4I0RA 3A8WA 3QFVA 5I5ZA 3HV3A 4XUFA 1L3RE 3KGAA 4BTKA 3ZSHA 4DF3A 3UO5A 2HIWA 1XH8A 2FGIA 1PHKA 1YVJA 2W9FB 3Q4TA 5KKRC 1P2AA 4XP2A 3SGCA 3O2MA 3D5WA 3COIA 4V01A 3D83A 3UC4A 3BYOA 4EI4A 2B52A 5JSMA 2YWPA 4PRJA 5KMLA 4YHFA 3LKMA 5E8UA 4NT4A 4AS0A 2CHLA 4F7SA 3D94A 5B2LA 4AP7A 5EW8A 4C4HA 3DJ6A 4ZLYA 4NYEA 3KEXA 5AR4A 3RAKA 3TZMA 2ZV7A 3GC7A 4RG0A 1OKZA 3FZRA 1DM2A 4LOQA 1DAYA 4NH1A 1OIQA 3EZRA 4YJTA 4DEGA 4MD8E 4C33A 2BKKA 3V8TA 3V5WA 2VWWA 3FMLA 3TXOA 4MBJA 5IQIA 3O23A 4QMWA 3PSBA 1O9UA 4PMSA 3ORNA 4GT5A 3V5QA 3FLSA 5LWNA 3MIAA 3UPZA 3WZUA 3KREA 3FXWA 3BGZA 3VBWA 3W2SA 2R3PA 4HVDA 5AIKA 5F9EA 3IW8A 2J6MA 4ZSGA 4UXLA 2WTKB 4D5KA 4FEWA 4OGRA 2RGPA 5EYDA 5J8IA 2BTSA 5KX8A 2QI8A 3U8WA 4RT7A 3OW4A 3VUMA 4XP3A 3TNHA 2AC5A 2VTOA 5HD7A 4EWHA 3QTSA 1PKGA 2JC6A 3UDBA 3PXFA 1ERKA 4GK3A 4BDBA 4YR8A 2OU7A 1MQBA 5AX9A 4XOZA 3ZCLA 3KCKA 4FKRA 4I5MA 4MD9E 4BCKA 3UIMA 1ZMWA 4RIXB 2X4ZA 4TYEA 1YWVA 4U97A 3V5PA 3LOKA 4AGWA 2YLFA 4F1OA 4TYHA 3ZO1A 2BALA 3BHHA 3ZRMA 4L9IA 5AP6A 4BZNA 5FLFA 3I7CA 3PIZA 4C8BA 4WRSA 2E9NA 3PY0A 3TTJA 2BDWA 2WMTA 5CY3A 4BTFA 4C4EA 2RG6A 3AC4A 3QZFA 3G6GA 5AUTA 2UW4A 2VO3A 1OMWA 3S2PA 4GIHA 3QYWA 5EDRA 2W7XA 1YHSA 3I79A 4RVTA 5AP0A 4LUEA 5CTPA 2XMYA 2QR7A 4PTEA 3RK5A 3H3CA 4BHZA 5I0BA 1TVOA 2CGWA 4FEQA 3UGCA 4EL9A 1AQ1A 4EOPA 4C59A 2C47A 1R3CA 4J52A 5TKDA 3W2QA 3FI8A 4I0SA 4H58A 4FSUA 4JG6A 4QTAA 2YCRA 1U59A 1SZMA 4BF2A 3KK9A 4AF3A 2OF2A 4G3FA 4BCIA 1O6KA 4P7EA 1LR4A 2LGCA 4AE6A 4JG7A 1P14A 3NDMA 1W84A 3TEIA 3FLNC 4L3JA 4E6CA 3GCSA 3DBEA 4S30A 3MB7A 4U8ZA 4GG5A 3QCXA 4BI0A 4CNHA 3BLQA 3EN9A 1RQQA 4FV3A 3V8WA 3OF0A 4FKSA 3S1HA 4U0IA 5CXHA 3N4UA 4E20A 2QQ7A 1QPJA 4C62A 4DH1A 2GFCA 1Z5MA 4P5QA 4NM7A 3BEAA 3ZC5A 4ZZOA 4O27B 4F1TA 4U41A 1RJBA 4OBOA 2B1PA 2C0IA 2WU7A 3FXXA 4N6YA 5M4UA 3SDJA 3E7VA 1KSWA 3ZS5A 2G2FA 3FQSA 5TO8A 1ZAOA 2HK5A 4QTCA 5F20A 3BBTB 5ITAA 3Q9ZA 4CCUA 2DUVA 2C5XA 2WFYA 4AAAA 4O7ZA 3QQKA 3GFWA 3C5UA 3QKMA 3OCSA 2QOLA 4M97A 4BWKA 4LV5A 5CVHA 5LMAA 4GW8A 3MBLA 5E90A 1XBBA 2C5NA 3KVXA 2NP8A 3OY3A 2YJSA 5EK7A 3R2YA 4J8MA 3ETAA 3IW4A 4F6UA 2X2LA 2REIA 4IWOA 3DNDA 4GT3A 5AR3A 4R5SA 2WMBA 5FEQA 4G1WA 3OP5A 1GOLA 3R0TA 2PUUA 4U3ZA 4ALUA 1TKIA 4BC6A 3LFEA 2BKZA 1F0QA 2YCFA 2RKUA 4ACCA 4FYOA 1QPEA 5L2TA 5CSHA 2UW5A 2WOTA 5JH6A 4FTIA 4I6HA 3NX8A 4Z9LA 3UBDA 5GIPE 5B2MA 2WEVA 3VBYA 2BIKB 2YITA 4EBWA 5I4NA 3P7BA 5IEVA 5IUIA 4FZ7A 4FSRA 2QG7A 3DJ5A 3A61A 3PRFA 2JD5A 3GU4A 4F9AA 1M7NA 3R9NA 2YZAA 2HW6A 4BCOA 1REKA 4C35A 4BGQA 4QTEA 4BBEA 2R3KA 3CQUA 4FKWA 2W4JA 2VAGA 3T3VA 3TZ8A 4HZSA 4CGAA 2Y6OA 1Y6BA 3ENMA 1WBOA 4V0GA 4WNMA 4DG0E 3VQUA 4O86A 1Q99A 4HW7A 5LVLA 3U6IA 4LRKA 5KMIA 3BHVA 2A2AA 2WMVA 3JY9A 2BZKB 5FQDC 2JAMA 4C57A 3ACJA 2GS7A 4EHGA 3P1AA 1J1CA 3IOKA 4EH4A 3TUBA 1PMNA 3G0FA 3H9FA 4BIEA 2EXMA 4X2KA 2PHKA 3HRBA 4X3JA 2OG8A 4FIJA 5GIOE 1VJYA 2JAVA 3VWAA 4IFGA 4XEYA 5A6OA 5KUPA 4RFMA 2ZYBA 2C0TA 1WVWA 5CWZA 4MK0A 3PWDA 3QCQA 4XV3A 2YACA 2ETKA 4PTGA 4U80A 3AXWA 1J3HA 3ULIA 3UP2A 2PZYA 4Y85A 4NCTA 3AC2A 5CAQA 3MH3A 2OFVA 4FKGA 2YAKA 1Q61A 3EQDA 5L8JA 5M4FA 4MKCA 4RJ3A 2VX1A 2ETMA 4XS2A 1DS5A 2CNUA 3SXRA 4E5AX 5DVRA 4IBMA 2PY3A 5CAOA 2PZ5A 4HGLA 3QRIA 5L2QA 4ASZA 3VHEA 4C7TA 3DKGA 4UMRA 4JX7A 3IGOA 1M2RA 1ZMVA 3C0GA 4FKJA 4BI1A 4FEXA 4MAOA 2F7EE 2BDFA 4UWBA 4ZTRA 4DCEA 4I22A 4IAZA 5AR5A 1BYGA 4KKEA 2PVFA 4F9CA 4YC8A 2X2KA 2XIXA 1QCFA 3ENHA 4RX9A 3VBXA 2C3KA 3QUDA 1OZ1A 3HV7A 3BGQA 5CU4A 5CT0A 2VD5A 3WF6A 4MD7E 4DFXE 4CRSA 3MVMA 2C6EA 3QD3A 3FLQA 3HKOA 3IW7A 3RPYA 3U9NA 4OR5A 5M57A 1PF8A 1ZY5A 4C3PA 4J96A 4QMMA 3R1SA 4OTWA 4CMUA 5IG1A 3ZLYA 3CY2A 2XEYA 3BPRA 5DBXA 5IQBA 4QMLA 4BL1A 2O0UA 3BQCA 3OBGA 4GIIA 4IIRA 3HEGA 3OEFX 4FKPA 1NA7A 4A9RA 1OI9A 5LMBA 1Q8UA 3ORXA 3VBVA 3HDNA 3BU3A 3UP7A 2VWUA 2J50A 4IVCA 5AV0A 5K4IA 3NS9A 4NIFA 1JWHA 2FVDA 4JL9A 4WBBB 3PUPA 3ZDUA 1GJOA 3BYMA 2ZM1A 3NSZA 4X3FC 4YHTA 5L2SA 2EUFB 3SHEA 3IONA 3WYYA 3FL5A 3DNEA 4IB5A 5CEKA 4AZTA 4PP7A 4CZUA 5L3AA 4EH2A 4CFNA 2FSLX 3NNVA 2O5KA 3HRFA 4E4NA 5CU6A 4P90A 4ITJA 3LMGA 5CSWA 3ZC6A 4GYGA 3ZBFA 4C2VA 4D4YA 2YM4A 1YHWA 5E8YA 2UW6A 3BX5A 2C6DA 2P55A 3EKKA 1HCLA 3LXKA 3SX9A 4JAIA 5CU2A 4XG2A 3FMNA 2XIZA 3HDMA 3NCGA 2EXEA 4WBOA 2X8DA 3C0HA 4KIKB 2LAVA 3WI6A 5KKRB 1BI7A 4ZIMA 1K3AA 3W8QA 3C4ZA 3C7QA 4LQMA 1HOWA 2GNJA 5BX0A 3NIZA 1IR3A 2IN6A 1XHAA 2HYYA 3WZEA 5AA8A 3R01A 3TACA 4JIKA 3GOKA 2XK4A 5EI2A 1OKWA 2CGUA 4QMZA 1JVPP 4MNFA 1OECA 4LOPA 4XCUA 3UQGA 4X2GA 3P23A 4EOJA 3DK6A 4FSWA 5AP5A 5DRBA 4C37A 3F2AA 3ZRLA 4MEDA 2VTPA 3BZ3A 4Q5EA 4I5PA 4TYIA 4GEOA 5H9BA 3OXZA 2XK8A 5K0KA 5BVEA 3VRZA 4OT5A 2OFUA 3QHRA 4HNIA 3ZBXA 5L8LA 2ONLC 4ZLZA 2QOHA 4HZRA 3DOGA 4QP4A 2IW9A 4EHVA 3T9IA 4OAUC 4A9UA 3DDQA 4GJ3A 1W82A 3QYZA 3NNWA 1SMHA 1YDSE 3FWQA 4B6LA 5DYJA 4O83A 1IAHA 2ITTA 4UEUA 2KTYA 3DS6A 3O71A 5HI2A 4ZSEA 4QNAA 3LVPA 4WO5A 1ZMUA 4O0RA 1ZYDA 2PL0A 2WQEA 2ZDTA 4B8MA 4RVMA 4JIAA 2Y4IC 1I44A 3LZBA 2J0JA 3PTGA 2GNHA 2KULA 3RAIA 2WPAA 2YIWA 5DT3A 2OWBA 3R8UA 4LFIA 4F0FA 1CMKE 2HXQA 4EC9A 2I7QA 5IQFA 4FL2A 3UNZA 4IJPA 4ITIA 5M53A 4KABA 4Y5QA 4MTAA 4BYJA 4FA2A 2GNIA 3QD4A 5IA1A 3ZTXA 2B54A 3ALNA 5F94A 3MVLA 4XMOA 2OZAB 4YU2A 3QKLA 2HAKA 3COMA 2F7XE 3G5DA 3UE4A 5J5SA 5AMNA 1GIHA 3IPHA 5AV1A 4UZHA 1H1PA 4PDYA 3F5GA 1M2PA 2CCIA 2X6EA 4LGDA 1Y57A 1YXSA 3O7LD 5LMKC 1GAGA 2X8EA 4NWMA 4AGUA 3TV4A 2BRHA 5BVDA 2UUEA 4OUCA 3V51A 2PE0A 4N0SA 3VBTA 1YDTE 4FK3A 3RINA 4FIHA 3DA6A 4FKQA 1XH9A 4KD1A 5HIBA 2IWIA 5G6VA 3F3VA 4FTAA 5E8XA 5K5XA 2Q83A 4H1MA 2YIQA 3HV6A 4BWXA 4NKAA 4QQCA 3PVBA 4O0XA 2JFMA 4XBRA 4YJOA 1WBTA 1VYWA 4I1ZA 2ZB0A 1U54A 5E8WA 3LIJA 1CTPE 2PTKA 2WKMA 2WMWA 3LCOA 2PMLX 2VTRA 2Q0BA 1JKSA 1IEPA 3SG9A 3FZ1A 5E91A 3VS6A 1JKTA 2O63A 3G51A 3GCPA 3OVVA 3OW3A 5EI8A 3T3UA 3VS2A 5IA0A 4AZVA 2QURA 4YP8A 3DAKA 4HYUA 4MF0A 3D7TA 2F4JA 3DY7A 2CN5A 5EI6A 3HAVA 4CKJA 5D1JA 4IX3A 4A9SA 4ITHA 3LMHA 4GS6A 3KK8A 1F3MC 3QTXA 4Q5HA 2E2BA 3PSDA 4A07A 4C4JA 4EEVA 3W2RA 4BCFA 4RQKA 3LXPA 3DBQA 4Q2AA 5DIAA 4F0GA 2OF4A 3C9WA 1SNXA 4IZ7A 4LL5A 2G01A 4NJDA 5A14A 4IEBA 2V7AA 3AC8A 1A48A 3WIKA 4YTFA 4YURA 4G9CA 3IDCA 4YZDA 5CSXA 4EH7A 4GCJA 2VWYA 4GVJA 1Q24A 3GC9A 3UVPA 4U42A 2VTMA 4ZZNA 2ZDUA 3BU5A 3R1YA 5AJQA 5HLPA 4O6EA 5AP4A 2G2IA 5JRSA 4IB3A 2G1TA 3O8UA 3A4PA 5AV2A 3QTWA 3QAME 4A4XA 3PPJA 4JR7A 1ZZ2A 4MNEA 2XP2A 5C01A 5C8KA 5IQEA 2C4GA 4DHFA 1R0PA 3QRTA 4FIGA 3PP1A 4QP2A 1VZOA 4RC3A 3GENA 3NUYA 3EIDA 4L3LA 3MY5A 4E6QA 3W2PA 4FV5A 2QO2A 2X9FA 3JVRA 5CNNA 5HIDA 1FVVA 2PU8A 4O0UA 3FYJX 3NW6A 4CG8A 1OKYA 4FSTA 4OTRA 3HZTA 3EN6A 4XG7A 4FTJA 2WELA 4YJUA 4CG9A 2BROA 4EQUA 2QU6A 5D7VA 4I6BA 3FXZA 4FVQA 1P5EA 3MV5A 4XG8A 3G9NA 1ZLTA 4JQEA 4EOOA 2NNWB 5AUWA 1NVSA 4QT1A 3IDBA 3L9PA 1WMKA 4QQJA 3UIBA 4BDDA 4DTBA 4BWPA 4AZEA 3OCGA 4IVAA 4APCA 2WTDA 2GTMA 1R39A 2EXCX 3T8OA 3EQRA 1Q62A 4RJ4A 3MTLA 5ACBC 3SW7A 2OO8X 5FP6A 4L43A 3VHKA 1U5QA 2YIYA 5KHXA 3SOAA 2WMUA 5CU3A 4QMQA 3OROA 3E8DA 3K54A 4W9WA 3SC1A 4IACA 4YNEA 5KO1A 5JK3A 3E8CA 4M0ZA 5G1XA 3UIUA 2JDOA 2YJRA 3PA5A 3LW0A 4TPTA 4O21A 3VIDA 3TKIA 3AT3A 3LM5A 5EQEA 3EN7A 4CFWA 1PW2A 4X7QA 5AV3A 3QRJA 4GMYA 4D2SA 1OPLA 3PIYA 3OFMA 3IKAA 4FK6A 5DOSA 4AU8A 2C6MA 5D9HA 1WBNA 3QCYA 4X6RA 5JZJA 3FMJA 4D0XA 5KMNA 3FC2A 3TV7A 4BCQA 3KULB 4YLLA 4MH7A 4OTIA 1URWA 4K2RA 3CQEA 5F4NA 4PY1A 4FL1A 5CI6A 4XJ0A 3ZRKA 3V5JA 3L9NA 4DFBA 3OD6X 2PVYA 3LFFA 1NY3A 3P7CA 4GKIA 5AR7A 3F5UA 3E7OA 2YERA 4QMVA 1FQ1B 3OY1A 2JBPA 4N4SA 1BUHA 4QMOA 4AWIA 3BI6A 2A19B 2GFSA 2WIHA 4W8EA 3W18A 3OHTA 3PA4A 1SM2A 4IB1A 4H36A 3ZSIA 4BDIA 4O2ZA 3PY3A 2BPMA 1WFCA 1KE9A 5FTGA 4O1PA 4L67A 3G2FA 3GC0A 4JQ7A 2BIYA 2GNFA 3PJ1A 5D7AA 2VRXA 5GHVA 2CCHA 4FG9A 2BRNA 2AC3A 2O64A 4PDPA 3PXKA 3S00A 2CLXA 1UNGA 3HVCA 4QP7A 2YFXA 1YKRA 4FVRA 3MVJA 3AC1A 3HNGA 2E9VA 4NEUA 4F09A 3RCDA 3P5KA 2YDKA 5KZIA 2YIXA 2VTSA 2CSNA 4AUAA 3ANQA 2CNVA 2PVLA 1MUOA 2RFDA 5A54A 3U6HA 4RZWA 3HX4A 3P0MA 2R3JA 4P4CA 2R7IA 2R0IA 4IWDA 2IVUA 5EYCA 2J0KA 5KE0A 4D2VA 3OWKA 4HVIA 2HY81 4E6AA 2VTHA 2X4FA 2JKOA 4FZFB 4OTHA 3QX4A 3LFSA 3KMUA 1XBAA 2OJ9A 3A99A 3L8SA 3KVWA 4BTMA 4ZSAA 2FSMX 2J0IA 2CJMA 2WQBA 5IQGA 3ZMMA 3PG1A 5CEIA 2FYSA 3A7FA 5H8BA 4IADA 4O7WA 4XOYA 1Q41A 1T45A 1BLXA 2JKMA 4FV4A 1U4DA 4YUQA 2RIOA 2XKCA 3QWJA 1HCKA 4JI9A 3PA3A 3CCNA 5D11A 1WAKA 2V55A 4L52A 4DGGA 3C51A 3FY2A 4C61A 3RZBA 4EONA 3V01A 1B39A 3DXNA 4QRCA 4YPSA 3D5XA 5ETIA 5HU9A 4WG3A 3AQVA 4PNKA 5BVKA 5CVGA 5ANGA 3D5UA 2DWBA 1Q8ZA 4XG9A 3MI9A 3NUXA 4QP1A 3QXOA 4WSQA 3TNIA 2OXXA 3PIXA 2UVXA 1Q3DA 1YI6A 4L44A 4L45A 4O0VA 4HVSA 1ZWSA 4FSMA 3VRYA 4EUTA 1OVEA 3OUNB 3DBDA 3V8SA 4CFMA 3LLTA 5TR6A 3T9TA 4GSBA 5FUTA 5J87A 2BAJA 4CCBA 3QUPA 5A3XA 4KIKA 4DGMA 2GSFA 3PVWA 1KE5A 3KF7A 3JUHA 3E92A 3Q9WA 2PZIA 3QD2B 4IWPA 4BN1A 5EYMA 3PPZA 2WQNA 4UZDA 4C36A 2I0VA 4MXYA 2A4LA 4G34A 4HYIA 2UVYA 1TQMA 3CXWA 1KV2A 1PYEA 4M68A 4AFJA 3FJQE 3MW1A 1CM8A 5DFPA 4RA4A 5JFWA 3LCSA 2ITZA 2JDRA 3TUCA 4I92A 4ENXA 1H0WA 4FTMA 4PP9A 5AP2A 4RPVA 1KE8A 1PXOA 2UW7A 3SRVA 4GFGA 5DEWA 3F69A 2VO7A 1XH7A 3RMFA 3M42A 4DH8A 2Y4IB 2VTAA 4IX4A 1X8BA 3NZ0A 4BDKA 4D1ZA 2ZB1A 2W5AA 5HTCA 1E1XA 3EFJA 4RIYA 1H26A 2CGVA 2PUPA 4YNOA 1JLUE 1EH4A 3B2WA 3BBWA 3GCUA 4MBIA 3RNYA 1NVRA 3DU8A 4PPAA 4CFUA 4S32A 2IPXA 4N57A 4FV6A 5ETFA 3O0GA 5HORA 2IJMA 3TL8A 4JJRA 1G8SA 2CKQA 5J7BA 4OT6A 4RC4A 1OUYA 2JDSA 5C9CA 5HO7A 1I09A 2WO6A 2XNOA 3LXNA 4ANBA 2FO0A 2PZPA 3PJ3A 1RE8A 3U4WA 3F3ZA 4C0TA 5JGAA 4XG3A 3P08A 3BV2A 3MPMA 4O96A 4ZY4A 3BELA 3QWKA 2Z7LA 3IG7A 4ZEGA 2C6LA 1SYKA 3D4QA 4DN5A 3ERKA 4PL5A 3FMDA 2HWPA 5D12A 5JFVA 3HA8A 2BDJA 3LM0A 2OZAA 5HTBA 4YHJA 4DBXA 4GT4A 2R64A 3HMNA 5L8KA 1ZXEA 3FZSA 3THBA 3UOKA 4LL0A 2UW3A 2UV2A 4ZTSA 5HGIA 4K18A 2UZVA 1H1RA 5JQ5A 4I24A 3FZOA 4FTQA 4X6QC 5I9XA 3LFNA 4FT9A 4B9DA 4XYFA 3MJ2A 4NZWB 4LYNA 5BUIA 4TZRA 4FODA 3KRXA 3RAWA 4TTHB 4EORA 4H3PA 3BKBA 4FTOA 4J97A 5HX8A 1H0VA 4RVKA 2XKEA 3TIZA 1JOWB 3Q4CA 3QGYA 4WRGA 3NAXA 4R3PA 3D14A 4CVAA 4M7IA 4C02A 4GUEA 3NNUA 1PMVA 4FTNA 2JIVA 2YM7A 4YZMA 4JDJA 2RL5A 5JT2A 4IAKA 4N6ZA 4RX7A 2YHVA 4L6QA 4UMQA 4AA4A 2YA9A 3NGAA 3RM6A 2OJFE 4BDFA 4CMTA 4ZTMA 2WTWA 1PRYA 4UMTA 3R1QA 3DK3A 3DKCA 5CLPA 2IVSA 2X1NA 3CIKA 4BB4A 1FINA 4AT5A 4PMPA 3HYHA 2C69A 3QQGA 1UU8A 3N4TA 4PL4A 3FPQA 3KRJA 4I6QA 5HG8A 3U54A 4IAAA 4W4VA 4WNKA 3KXXA 3K3JA 1OBDA 2R7BA 4IZAA 4R3RA 5DR9A 3WF5A 1KE6A 5FBOA 4Y95A 1OIRA 3OCBA 4DG2E 2VWBA 4NUSA 5D10A 2OI4X 4USFA 3D2IA 5F95A 5FEEA 1Q5KA 5AAEA 4Y83A 2ZM3A 4F08A 1ZOGA 2R3LA 4NSTA 3KRRA 1SNUA 1E1VA 4BY9E 3RCJA 2XNNA 3ZONA 1H01A 5ANEA 3E87A 2R3OA 1PXLA 3F7ZA 1JPAA 2VTLA 4QP8A 4TRLA 4YJRA 4E4MA 1ND4A 4M0YA 4TT7A 4QYHA 4FUXA 1JSTA 5HE2A 4J8NA 5CALA 5BYLA 5T68A 4EZ3A 4FSZA 3A7IA 5CU0A 4CKIA 4EKLA 3R8LA 1DI8A 2JKKA 4FMQA 4B99A 3GNIB 4L53A 4HNFA 3R22A 4BIDA 3S3IA 3TG1A 2O3PA 3AMBA 1PKDA 1GZOA 3QF9A 2NPQA 2ITPA 3DB8A 3K5UA 3BGPA 3FQEA 3CKWA 2XUUA 3NPCA 4X21A 3RWPA 4CLIA 3UZTA 3I6WA 4TWOA 3ZUVA 2R3MA 2C6KA 3TKUA 3A60A 3TWJA 4TL0A 4MQ2A 4G6LA 4ZAUA 3IS5A 2Y0AA 4MX9A 5CYIA 1Q4LA 5LARA 3FLZA 3Q9XA 1UU3A 2B9HA 4KIQA 2XF0A 3ID6C 1RW8A 2A1AB 4UBAA 2XK9A 1G8AA 4BKYA 5BMMA 3O8PA 4EK5A 3HECA 2WTIA 3Q60A 2WB8A 5M4IA 1PMEA 2HCKA 4BFMA 4M12A 1YOJA 2C1AA 2GNLA 4FNXA 5EKNA 4XRJA 5F1ZA 5IMEA 2XNEA 5K5NA 2GHLA 3DQWA 1MRYA 2WEIA 4IDVA 3DQXA 3CEKA 4JX3A 3ZO4A 4I20A 5M06A 3BQRA 2VWIA 4AN9A 4QD6A 4K9YA 3ZHPC 4QP3A 1H4LA 5CX9A 4WHZA 4EZ5A 2CKOA 1J7UA 5DR6A 5H3QA 3U4UA 5J9LA 3O50A 4NM3A 3EFWA 2JIIA 4A4OA 3VQHA 2BAQA 1GY3A 2J51A 3LXLA 4IZYA 1G5SA 3OT3A 3SLSA 4R7HA 3IOPA 4II5A 4ANLA 4C34A 4MXCA 1J7IA 4HGEA 2JFLA 4NM5A 4F9BA 4TYGA 4C58A 4FT3A 4ZTQA 2EB2A 2GTNA 3WF7A 2YIRA 3OWJA 4U45A 3GI3A 3CTJA 2XNGA 4FT0A 4S2ZA 3VJNA 3Q5ZA 3ZO3A 3Q52A 3FLWA 4NJ3A 4CV9A 5GNKA 4YJVA 3QTUA 4QPAA 3F6XA 3KULA 4DTKA 4HGSA 4LMUA 4IAYA 3PXRA 4MF1A 1S9IA 5JMSA 3MH0A 5CQWA 3WE4A 4B8LA 3R21A 4W4XA 4OW8A 4TNBA 4F6SA 3M11A 4RWKA 2OIBA 3BE9A 4ZSJA 1XWSA 3CS9A 3FI3A 4EOKA 3CSVA 3W1FA 3P4KA 3ZSGA 3DBCA 3U87A 4JXFA 3QC4A 4HYSA 3JVSA 4FV7A 4L46A 5IQCA 4ZP5A 4EOIA 2W99B 4TWPA 2W1EA 4WA9A 4LUDA 2I0YA 4RGJA 5FXSA 1YXUA 4KBKA 4F7NA 3EQHA 3GQIA 1K9AA 3M1SA 2WOUA 4RVLA 5M07A 2P4IA 5IH5A 3KRLA 5KHWA 4PF4A 2XKDA 4M67A 3UZRA 5DMZA 4I93A 1R1WA 3QHWA 4RJ5A 2V0DA 3RJCA 3Q04A 4QMYA 4K0YA 2O2UA 4QYYA 3EQFA 3WILA 4YZ9A 2XZSA 2RFNA 3GCVA 4RIWB 4XRLA 1NW1A 3JXWA 3RALA 1WBWA 3BLRA 3FQHA 5E7RA 3GGFA 3MDYA 4EJ7A 3R7IA 3ITZA 1H28A 2UW0A 2X0GA 1OL5A 5HHWA 4EOSA 2BMCA 4H1JA 4MHAA 4BDGA 4G2FA 3V5LA 4OTDA 4YJQA 3WIGA 3HMOA 4QP9A 1KOAA 4E4LA 3JS2A 3CPBA 3H30A 2QCSA 5BPYA 4C4FA 3MN3A 4HCUA 2XK6A 3MFUA 3IQ7A 5AP7A 3VS5A 3SA0A 2OSCA 4ACDA 1UWJA 4NK9A 2UZBA 5JKGA 1OBGA 5EFQA 4EH6A 5ETCA 1G3NA 3UG2A 2C0OA 5AIRA 4G3EA 4GYIA 3NVKI 2WD1A 5GZ9A 1O6YA 2BVAA 3GFEA 4FKLA 1H1WA 3EQGA 4XX9A 5A46A 1WBPA 4YC3A 3PSCA 3TDWA 4K8AA 2P2HA 4BGHA 3E64A 3QUEA 2IZTA 3R04A 3RNIA 4RX5A 4U40A 3BWJA 5HVYA 3NYNA 4BYIA 5BVFA 4FT7A 1CKJA 3K5VA 4KBCA 3EH9A 3WARA 3UO6A 1KE7A 4I3ZA 3QA8A 3BV3A 2FA2A 2PSQA 3BHTA 2RFSA 4M8TA 2OJGA 4UYNA 3BU6A 4OTFA 5E1EA 5J7HA 4FNZA 4MXOA 4QYGA 1OITA 5FTOA 2WXVA 4ZS4A 2ERKA 1OB3A 3I6UA 2VUWA 3FY0A 5JFXA 2CMWA 2OGVA 4FZAB 1CDKA 2X7OA 1JKLA 5A9UA 4WG4A 5HG5A 2GPHA 5M44A 1LEZA 3G0EA 2WZJA 4PV0A 3LQ3A 1O6LA 1GZ8A 4OAVB 5LCKA 3WBLA 4XG6A 4UWCA 3R63A 1UU9A 3UVRA 1OL2A 4JQ8A 4YLKA 1W0XC 3SV0A 3E8EA 2OZOA 4ID7A 4TYHB 3ROYA 2E9UA 3IK3A 4FIFA 4JAJA 5AM6A 3FI4A 3SXFA 3TI1A 3MH1A 4BVUA 4F64A 1STCE 4FC0A 4JDIA 2BZIB 4XV1A 1YXXA 2OW3A 3RPVA 4JBVA 2PE2A 3E88A 4ANMA 3N9XA 4O0WA 3GU6A 5AR8A 2PK9A 5T3QA 3AG9A 3DPKA 4BZOA 4C3FA 3A7GA 4FBXA 4XBUA 3RPOA 4FOCA 4CTBA 5KMMA 1XH6A 3ZM9A 2ZAZA 4RIXA 5GINE 2EB3A 3C0IA 3H0YA 3U6JA 4HPUE 3ALOA 4M69B 5FXQA 3EKNA 2B4SB 2YDIA 3TV6A 3HMPA 5DA3A 5FXRA 3HAMA 4Q9ZA 2YM5A 3W33A 2I40A 2ZOQA 2JLDA 3CBLA 5HCYA 4LGGA 2QOKA 2YISA 1BI8A 1XH4A 3GEQA 4ACGA 2QG5A 4HGTA 3I5ZA 3VUTA 1UV5A 3OUKA 4MWHA 3MYGA 4LMNA 4O84A 5KMKA 3R7UA 3TT0A 5DN3A 2VX3A 3QQHA 5FDXA 5LVPA 4O7YA 4AW2A 4CRLA 4W9XA 3E5AA 4L8MA 3LFDA 4JT3A 3SW4A 1IA8A 2AUHA 5HE0A 1FMKA 3R30A 4GH2A 2PVKA 3JY0A 2C6IA 2YAAA 3PVUA 4J7BA 3L8VA 3ODZX 4AN3A 5FWKK 5I9WA 3MSSA 4JBOA 2VTTA 2H96A 2UW8A 4S33A 5CT7A 5A4LA 3F5PA 1KOBA 3FMEA 1XQZA 3GXLA 2WMRA 1XJDA 3QD0A 2P33A 4FEUA 4CXAA 5AAGA 3EZVA 5HE1A 3DAJA 5L2WA 5I9UA 4I4FA 4FF8A 5CAPA 4RWIA 3LCTA 5EG3A 2W06A 3PJ8A 3VC4A 4F0IA 1Q8WA 2YLEA 4E6DA 4CZYB 3PG3A 5KZ0A 5A4QA 4QPMA 3W55A 2HZ4A 4IAIA 4DGLC 2ZV9A 1LUFA 3R9DA 4GKHA 4ANQA 4L42A 4DGNA 3VJOA 2A0CX 2XYNA 5HVJA 3DTWA 4RRVA 3FEGA 1MRUA 5FTQA 4XV9A 3ZYAA 3Q32A 3RAHA 3RPSA 4WOVA 4F99A 3UPXA 3U55A 3A7HA 3WF8A 5C03A 3PLAE 3H10A 3GCQA 3G9LX 4YBJA 3AD5A 5FM2A 4GK4A 4U79A 4HCVA 5E4HA 1GNGA 4D9UA 4PNIA 2VN9A 3EQIA 2Y8OA 4K77A 3GVUA 4AXAA 4BCHA 1JNKA 3POOA 1H08A 5IQAA 4TWCA 2ITVA 4I21A 2Y7JA 1CSNA 2B7AA 4DLIA 1JQHA 1KWPA 3FMMA 3O7LB 3PYYA 4IQ6A 4DE4A 5CZHA 2CKEA 3LCDA 3CC6A 3UYSA 3FKNA 3KA0A 5HU3A 4BICA 3KB7A 1XO2B 2XRWA 2FUMA 3Q4UA 4U9AA 4ANOA 3KRWA 4GL9A 4TWNA 2PMIA 5IDPA 1W7HA 4E1ZA 4FG8A 4IJ9A 4PDSA 1ZYJA 2VO6A 3ZLSA 3ZUUA 2PVHA 4FTTA 3RK7A 5KMOA 4IM0A 2JDVA 3DXQA 4JBQA 4DH3A 2C6TA 5EW3A 3MH2A 5HO6A 5JGBA 5GZAA 3A8XA 4ZTNA 1U46A 3FHRA 3I81A 3KXMA 1IASA 4IANA 4H05A 4F63A 3B2TA 4HOKA 5HLWA 3NNXA 4L01A 4LRJA 3NVMB 3VUGA 2YWVA 3LQ5A 3FZPA 4YJSA 4BHNA 2QR8A 5E8VA 3P7AA 2R3RA 5HG7A 3Q6WA 4RC2A 3DCVA 4IE9A 3KKVA 3TNWA 4E93A 4ZY6A 3L8XA 5E8SA 5L6PA 1R78A 1UVRA 4J71A 3MY1A 3EFLA 3ULZA 4FZ6A 3VVHA 5CXZA 5AM7A 5E92A 4FI1A 4GUBA 5AP1A 4CT1A 3LMIA 4M3QA 4FE2A 2UW9A 2W9ZB 3QXPA 5CASA 3GU8A 3KMMA 5IA2A 4FKVA 1JAMA 3ZZWA 1WVXA 3RTPA 1IAJA 4KUJA 4MXAA 4AW0A 3DFCB 4I6FA 3TZ7A 3R7OA 3CR0A 2J7TA 4XNEA 3R6XA 1WBSA 4PWNA 4DEBA 1W83A 4YSJA 4O7RA 1DAWA 1E9HA 2OXDA 2IG7A 3QALE 4N70A 3TN8A 5HBEA 3QTIA 4D2WA 3GP0A 5K4JA 3VS4A 3TM0A 2XBJA 3D2KA 1IA9A 5DPVA 3DKOA 5CEQA 3HA6A 4DYMA 3OG7A 2OK1A 4PDOA 3NW7A 4IDTA 2A27A 3VS0A 5BVOA 3R7EA 4FTCA 3C4XA 4OBQA 5ETAA 4CT2A 4FNYA 3DFAA 3ORTA 4IC8A 3ELJA 3I60A 4EKKA 4ASDA 3DGKA 4QP6A 3FLYA 4D28A 1FVRA 2JITA 5LWMA 4FEVA 2X81A 3ZLWA 5DHJA 5JQ8A 2YEXA 3GUBA 3TCPA 2VZ6A 3GC8A 5AP3A 2RSVA 4ONAA 1JKKA 5ANIA 5AAFA 3VS7A 4JVGA 1CKPA 5I3RA 3TIYA 5M51A 3O17A 2GDOA 2WQOA 3GOPA 4CFVA 5AV4A 2YM3A 2ZV8A 3KY2A 4FUYA 1Y8GA 4EHEA 5HE3A 2Z7RA 4L7SA 2F2CB 4IC7A 3KL8A 3EL7A 4IH8A 4PL3A 1H24A 2JDTA 3N51A 5DT4A 3ZZEA 4AGCA 3QQFA 3JR1A 4FKIA 5AUXA 4KKGA 5B0XA 4KKHA 4AFEA 2QOIA 4LG4A 5AUZA 4ASXA 4A9YA 4EWQA 4EK8A 5AEPA 3DJ7A 5EOLA 5I9YA 3DAEA 2OLCA 4UN0C 4QMSA 5HEZA 1YQJA 4IHPA 4YZCA 2W4KA 3FDNA 4NTSA 4KIOA 3Q5IA 2W1IA 3L9LA 5IA4A 3LPBA 5IEXA 3QRUA 5C8NA 3JPVA 3CE3A 5LVNA 4DFNA 2BAKA 2IO6A 2XBAA 3NAYA 4IVDA 3LE6A 4QMXA 2ERZE 2VNYA 5KMJA 5EHYA 2ESMA 2W4OA 1OIUA 5ANJA 3DTCA 3FMHA 4K33A 4R78A 4X3FB 1ZARA 3ATTA 4P2KA 3HL7A 5AWMA 3QC9A 2QO7A 5BUJA 3F82A 1W8CA 4R6VA 2XH5A 5ANOA 2W0JA 4V04A 4E4XA 3OOMA 2OXYA 3I7BA 2RF9A 3GT8A 3HMMA 4F65A 4G3GA 4BZDA 1S9JA 3EQPA 2YCSA 3KQ7A 3E3BX 4FZDB 3PXZA 4WSYA 4MVFA 3RKBA 4AX8A 3KC3A 5CAVA 4BR3A 5LVOA 4R7IA 3EN4A 3BWFA 3NYVA 4L00A 4TN6A 2WU6A 4FT5A 5EH0A 3UNKA 1YI3A 4L3PA 1OL7A 2JKQA 4KAOA 4O0SA 4WNOA 5DR2A 5EOBA 3PDTA 4I41A 3TNQB 1GZNA 3RVGA 2XA4A 3COKA 3D9VA 5LJJA 1IRKA 3VBQA 2OKRA 2HELA 4ERWA 5HBJA 4ORKA 5IEYA 3QZHA 4KRDA 3TTIA 3WE8A 3D7ZA 2W1FA 4QMPA 4FICA 5JFSA 2IZRA 4CZTA 1B6CB 5FG8A 1UU7A 3NCZA 1B38A 1WVYA 3II5A 3WZDA 4BCMA 4MXZA 3A62A 4EYMA 1H8FA 4BDEA 3MFRA 2C3IB 3RK9A 4U3YA 3Q2MA 5HLNA 3AMAA 5KBQA 3EQCA 5EHLA 2VTNA 3E62A 4KWPA 4RSSA 1URCA 2V22A 2QVSE 1LEWA 4S31A 5JZNA 5BYZA 4D55A 4W4WA 4RMZA 3CGFA 4R1YA 3EFKA 2C6OA 3MESA 2UVZA 5LXMA 2BRMA 4BDCA 3AOXA 1OPJA 3V04A 4BGGA 3NUSA 3B8RA 4DH7A 5IMXA 4PMMA 4BTJA 4D1SA 4ZK5A 3WOWA 3Q6UA 3FYKX 1BMKA 1FGKA 2R3QA 2W5BA 4FTLA 5J95A 4DEIA 3QQJA 4V05A 3FE3A 3NR9A 2C1BA 3HP5A 3W8LA 4ASEA 4I0TA 3LJ0A 4TXCA 4FL3A 2ITUA 3Q9YA 2DQ7X 2WMAA 2ZMCA 2ZMDA 4TYJA 3WF9A 3CQWA 3ZO2A 4FVPA 4UXQA 4DEEA 3SXSA 3MY0A 2JGZA 4O6LA 5C26A 3C13A 2QKRA 4KNBA 4CLJA 3QX2A 1QPCA 5HICA 3G90X 4HYHA 3SD0A 1V0BA 4JBPA 3DZOA 3UC3A 1M52A 4RA5A 5I9ZA 2I0HA 4RFYA 2ITWA 4JG8A 4EK6A 2CDZA 2Z2WA 2ZJWA 3H9RA 2CPKE 3MVHA 5CEMA 3O8TA 3PRIA 2R0UA 1UNLA 4YJPA 4U6RA 5K0XA 5L4QA 2GS6A 4QNYA 1GIJA 3DV3A 1H1QA 3OTVA 4RWLA 5DWRA 3L1SA 4B4LA 1Q3WA 1BKXA 1CKIA 1Q97A 2F49A 2PMOX 3HUCA 3NW5A 4FKUA 5CF8A 4ZZMA 5DNRA 4NW5A 5LOHA 2B9IA 4TKSA 4Y5HA 5CS6A 3UTOA 3ZM4A 1VYZA 1PYXA 3P78A 3QA0A 4FTKA 2QHMA 3MA3A 4IXPA 2VV9A 1U54B 3LFBA 4I4EA 2PMNX 5CF5A 1L8TA 4R5YA 4Z16A 5HVKA 4M69A 2CNQA 4ARKA 4YO6A 4G31A 3FHIA 3MGYA 1XBCA 2VTIA 2PPQA 4O7NA 5BVWA 4D2TA 3R02A 4QQ5A 2QOFA 4FV2A 2GQSA 4F70A 5C8MA 3R83A 3ZXTA 3AGLA 4GU6A 3DBFA 4PPBA 3RHKA 5DG5A 3RP9A 2XYUA 4E5WA 4RJ8A 3CPCA 5CNOA 3D7TB 4FSYA 4UV0A 3HGKA 3V3VA 4YLJA 2XB7A 3NUPA 4BBFA 3DKFA 2PUNA 4Z3VA 3KCFA 5HG9A 4YTIA 3ACKA 3PXQA 3QTRA 3DLZA 4GK2A 3FUPA 3AMYA 3H9OA 2B0QA 4GVAA 1VEBA 5FRIA 4CMOA 2W5HA 4AACA 1Y8YA 3LHJA 4WNPA 3W16A 5CEOA 4WUAA 3POZA 3GB2A 4U44A 2QODA 5L2IA 2DS1A 2FH9A 3LFCA 1ZYSA 5HO8A 3UOHA 4JLCA 2ETRA 1OKVA 4GV1A 3QQUA 4WUNA 3VAPA 4HVHA 5JN2A 5EQYA 4NW6A 3COHA 4PPCA 3DB6A 4FV1A 4YTCA 2XJ2A 4YBKA 3F61A 3G33A 4FV9A 4Y8DA 4BKZA 4ENYA 4DEAA 4D4RA 5A4CA 2EVAA 5J79A 5IDNA 4JRVA 5CVFA 3RWQA 2YM6A 3FC1X 3OEZA 4GFOA 3Q3BA 2GCDA 2BRBA 1ZOHA 3L9MA 4MNEB 2Z7QA 3PLSA 2GHGA 4O2PA 1W98A 1UKIA 4AT3A 3PY1A 2PULA 4DEDA 4OLIA 3FL4A 1FGIA 2HY0A 3FKLA 4RWJA 3QRKA 2UZTA 3ZDIA 4IVBA 3F5XA 3QZGA 5IUGA 3AC5A 3PZHA 4NL0A 5B7VA 5ACKA 1REJA 4O7TA 4IWQA 3F9NA 3UVQA 4YJNA 3VN9A 5L6WL 1V0PA 2I1MA 3O96A 2XM9A 3QL8A 5FM3A 2XK7A 4D0WA 3G15A 1PXJA 1U5RA 3B8QA 3GU5A 4FV0A 1FVTA 4G16A 4GRBA 4UB7A 3R9OA 2Z02A 2OICA 4I5CA 4PMTA 2WAJA 2BUJA 4G5JA 4RZVA 2FSTX 4EHZA 4QMNA 5CF6A 2B9FA 2IZUA 2WTVA 3BYSA 1H07A 3OWPA 1Z9XA 4MBLA 3UO4A 3VO3A 3C5IA 1Y91A 2JBOA 3PXYA 1YW2A 4KA3A 4U81A 5J1WA 4NM0A 5DLSA 5IISA 3VUKA 3BCEA 3K3IA 2XCHA 5DH3A 1A9UA 2X8IA 4JOAA 4F1MA 4AZWA 3TJDA 4XH6A 5FBNC 4AG8A 2WIPA 1YRPA 4XG4A 4ALVA 4L68A 1OM1A 5CSPA 3CTHA 4M15A 2OIQA 2UZEA 4X2JA 1PXIA 3HMIA 3PVGA 4EZ7A 1J7LA 3LLAA 4H39A 3ZLXA 4CEGA 3P86A 2B53A 4DGOA 5EHOA 5FDPA 3H4JA 2VU3A 4D4SA 5HIEA 5J9YA 3CGOA 5HQ0A 4Y46A 4A9TA 3HV5A 2DYLA 4FIIA 1BL7A 4EUUA 5KCVA 4DT9A 5DI1A 3NMUF 2GQGA 3LQ8A 4J99A 2ACXA 2VO0A 2XNMA 2ZM4A 4W4YA 4C3RA 5IH6A 3FSFA 1OUKA 3EWHA 3PZEA 4RX8A 4XV2A 2O65A 4BIBA 4GFMA 1ATPE 2UZDA 3ORLA 4YZNA 4EQMA 5M55A 1BL6A 3LCKA 2W1ZA 4TY1A 4NCTC 4FNWA 4ZXTA 2VWVA 4ALWA 4O91A 4CV8A 4F9WA 4S34A 3QZIA 2PWLA 5D41A 2BTRA 3BYVA 3QTQA 5J5TA 3NUUA 2F57A 1PMUA 3C50A 4NFMA 4QMTA 2BR1A 2ZV2A 4K1BA 4E7WA 5K3YA 4DH5A 4F7LA 4DG3E 3QCSA 3AD4A 3LFQA 3PWYA 5IPJA 4YPDA 2OBJA 3I0QA 1P4FA 1P4OA 5I3OA 3NEWA 3IDPA 2VX0A 4JDHA 5IZFA 3SVVA 2X2MA 3OBJA 3I0OA 4AQCA 3HP2A 3V6RA 1T46A 3BIZA 5EM6A 3DLSA 2W1DA 1KUTA 5H8EA 2BHEA 4NKSA 4WIHA 4G6NA 3JYAA 1ZRZA 1UNHA 4J95A 4BCJA 5CAUA 2WQMA 3A2CA 2PVJA 3F66A 1NXKA 4GU9A 3TJCA 3ZFXA 4EC8A 5HOAA 5J9ZA 1DI9A 4DFUA 2XK3A 4LM5A 5AR2A 3VS1A 5AA9A 3E93A 3KXGA 4O82A 3PJCA 2PVNA 2J0MB 3KF4A 3QU0A 2OIDA 3OOGA 4U7ZA 1PXMA 3UZPA 2WTCA 2QU5A 1V1KA 2XIKA 2YDJA 2Z7SA 5GJGA 3Q53A 4FR4A 3PPKA 5EW9A 4C38A 2I6LA 5TE0A 4D58A 2XNBA 4PUZA 4FIEA 2VGPA 1JSUA 3FI2A 4R77A 3C1XA 5E8TA 3IO7A 4AN2A 4W8DA 2R5TA 2WMXA 4M84A 3VF8A 3IW6A 3UMXA 3OXTA 4IMYA 3OTUA 3RZFA 2G9XA 3R9RA 3E63A 3S95A 4K6ZA 4IM2A 1NT2A 2GHMA 3CY3A 4O1OA 3W2OA 4BDJA 3ATSA 3FPMA 1Y6AA 1YWNA 2X9EA 4EOMA 1ZYLA 2R9SA 4E26A 1JBPE 5HD4A 3KU2A 3R71A 5FP5A 5KNJA 4M66A 4GJ2A 3HRCA 3R8PA 2Y9QA 1FPUA 2HZIA 2WMQA 3L8PA 4USDA 3MJ1A 4LGHA 2J2IB 2OH4A 3REPA 4JDKA 3F88A 2GMXA 4IM3A 4ZMEA 3OT8A 5C1QB 5AX3A 4C2WA 3V5TA 2OJJA 4KBAA 4CD0A 5CF4A 2CKPA 2JEDA 1JSVA 5EDQA 4P5ZA 2GQRA 4IZ5A 5ANKA 4EK3A 5A4EA 3AT2A 5M4CA 5CEPA 4X3FA 2PUIA 3RM7A 4IX6A 4ZMFA 4QMUA 4FX3A 3CKXA 4MWIA 3FSKA 5M56A 3C4WA 3LAUA 5BNJA 3KMWA 4JS8A 2F9GA 4WD5A 3WYXA 4BI2A 4EH9A 4CFFA 2XNPA 5JGDA 3U9CA 5HX6A 1YXTA 2R3GA 1RDQE 3TKHA 2UZNA 4YO4A 4ZTLA 2QOOA 3ZU7A 3VUHA 4D5HA 4HCTA 3VULA 1KV1A 4KSPA 1IG1A 3C4CA 3UIXA 4EQCA 4IX5A 1A06A 3UODA 4LRMA 2B55A 5EQPA 3D5VA 3KXNA 3N4VA 3Q2JA 2HW7A 4RJ6A 4FYNA 4ZY5A 3UQFA 1OPKA 2X7FA 5BMSA 4FKTA 4U43A 1SVGA 4DT8A 4AZSA 4X2FA 1PXPA 2E9PA 4USEA 4DEHA 3F7WA 3BE2A 3FKOA 1NVQA 3CD8A 2QD9A 3SG8A 3VW8A 4J53A 4B0GA 1UA2A 2W1HA 5C4LA 4AA0A 2H34A 1PY5A 5CZIA 4A7CA 4UMUA 4QO9A 3IECA 3R8MA 1MP8A 2R3FA 3UOLA 3F2RA 1QPDA 3C4FA 4MCVA 4CQEA 3W2CA 3SRVB 3H0ZA 2H8HA 4K11A 4HPTE 4B7TA 5AUVA 4NTTA 1FMOE 2PVRA 3CLYA 3FAAA 5DE2A 3BHYA 3LJ1A 2OH0E 2ONLA 2CLQA 5A6NA 5AADA 1AD5A 1XH5A 2QLUA 2IW8A 4RIYB 4ERKA 4O7VA 4O7LA 5IU2A 2UZUE 1WZYA 4DBNA 1H25A 2P0CA 4QYEA 2RG5A 1PXKA 4CQGA 4CSVA 4DFLA 4UALA 3ZH8A 4GG7A 1M17A 2WTKC 1XR1A 5IQHA 4DCAA 4QYFA 2BRGA 3DDPA 4YC6A 4ZJIA 3O51A 4E8AA 5I9VA 2BZJA 2QO9A 3MPTA 3UG1A 5LQFA 2EU9A 4LI5A 2C30A 4KS8A 4IAFA 2XCKA 1Q8YA 2JIUA 2VNWA 5BYYA 1YWRA 4DITA 2HOGA 4ZJJA 1R0EA 4DTAA 2VTJA 3IW5A 4QOXA 4JR3A 4C4IA 4UWYA 2ITNA 3E8NA 3PP0A 5EYKA 3TUDA 3TDVA 5IA5A 2VGOA 1LPUA 2QHNA 1ZY4A 3MB6A 4ZSLA 5TOZA 3P9JA 1YOMA 4L7FA 4ZOGA 3UYTA 4ACHA 2BZHB 2ITQA 1PXNA 4BCPA 2V62A 2X7GA 1H27A 3BEGA 3OZ6A 3R28A 2J0LA 3K2LA 4AT4A 5DGZA 3AD6A 3PJ2A 2J5FA 3SOCA 4ZJVA 2GU8A 5FGKA 3OS3A 4R7BA 3CD3A 1V0OA 5C27A 5LMKA 3MA6A 4I5HA 1WBVA 3CJGA 3SKCA 4KRCA 2WHBA 2R4BA 5EKOA 1OL1A 1AGWA 1K2PA 1H00A 2QONA 2SRCA 3SAYA 3VF9A 3LFAA 2C5YA 5TT7A 5HESA 1SVHA 2J9MA 3R1NA 2HWOA 2ITOA 1MQ4A 4NFNA 4Q9SA 3TNPC 5LVMA 4TW9A 1WCCA 2UZOA 3PE1A 5DEYA 3UJGA 3ZFMA 5AUUA 4F4PA 2XS0A 4OBPA 3AC3A 3GU7A 3V6SA 3F3UA 3R8ZA 4BRXA 4AW1A 2E9OA 2IW6A 2W1CA 5DT0A 3D0EA 1PJKA 2J5EA 3S4QA 4E3CA 3I5NA 3C4EA 2XKFA 3G6HA 2FSOX 4RLLA 3EQBA 2XM8A 4NU1A 5BQ0A 3NIEA 4XLVA 2HXLA 3PE2A 4UYAA 5A4TA 3D15A 2YN8A 1QMZA 3KN6A 5KBRA 2QLQA 4D1XA 2XJ1A 3E3PA 4AZFA 2EWAA 4R1VA 4ANNA 4BBMA 4KS7A 2PE1A 2V7OA 4J1RA 1FBNA 4XP0A 3MFTA 4MXXA 4X2NA 2Q0NA 5M09A 4G6OA 4OTPA 4YZBA 4AE9A 4XHKB 5DRDA 2CGXA 2ZVAA 1J1BA 2IVTA 4AGDA 4IB0A 3DXPA 3FV8A 1XKKA 4OTGA 2P2IA 2R2PA 4R3CA 4Y72A 4APPA 2XIYA 3MWUA 1OGUA 1J91A 4RBLA 4XLIA 4DAWA 2QKWB 4UY9A 5EM5A 1VR2A 5IH4A 5CSVA 3RBWA 2XVDA 2W17A 3VUIA 3RPRA 5CANA 5L6OA 5M08A 2BILB 3RI1A 4O38A 1YDRE 4AOTA 2WNTA 4KINA 4KSQA 4DINA 2HENA 2YCQA 3ODYX 3M2WA 4QTBA 3CTQA 4F6WA 3UQCA 4WKQA 4FV8A 2W1GA 3WZJA 4LV8A 3OWLA 4BDHA 2R3HA 5C4KA 4O0TA 4YTHA 3NLBA 5ICPA 5JEBA 2P3GX 3RHXA 4DA5A 1H1SA 4EOQA 5CENA 2O8YA 3ORKA 3MPAA 3MTFA 4RFZA 3R9HA 4A4LA 5IUHA 3MS9A 4ACMA 1UKHA 4RJ7A 4DLJA 3BHUA 4CYJA 2CN8A 4PTCA 4Z7HA 2GS2A 3I1AA 3OCTA 5IQDA 3Q4ZA 1GIIA 5HNBA 4V0GB 1YXVA 3A7JA 4EK4A 1ZZLA 5IKWA 4F9YA 2NO3A 4FSNA 4E5BA 4O81A 2VWXA 5BUEA 1UWHA 4EH5A 4QPSA 4QTDA 4FGRA 4CFXA 1TQPA 2BFYA 1GZKA 2PZRA 3QTZA 2J90A 2C3LA 5CI7A 5HKMA 4CYIA 4UMPA 4RLKA 5IA3A 4H3BA 3EMGA 3OC1A 4JNWA 3DZQA 5CQUA 2XIRA 4HVGA 2Z8CA 3QQLA 5IF1A 4G9RA 4Y73A 3ANRA 4G17A 5B2KA 3ZXZA 5GZ8A 3S0OA 1Z57A 3ET7A 2W96B 3HUBA 4F7JA 1YI4A 4FGBA 1QL6A 4D4VA 5AUYA 3UOJA 3GBZA 3WZKA 5GJFA 4AW5A 4BCGA 5HZNA 2H9VA 4WT6A 3MFSA 4U5JA 2QOQA 3MIYA 3NWWA 4DC2A 3EYHA 3F3WA 1BX6A 3IGGA 5ANDA 5H8GA 3SQQA 2B9JA 4MYGA 1YHVA 1MRVA 2QOCA 3R7GA 5J1VA 4G3CA 5LCJA 2OJIA 3RGFA 3ORZA 4D2RA 3R00A 2R3IA 4FTUA 2H6DA 2WMSA 2FB8A 5AFVA 4J98A 2X39A 3DT1A 4CKRA 3ZOSA 3P79A 2VTQA 4KB8A 5TF9A 3AT4A 2QNJA 4TNDA 3QGWA 4RIOA 3R73A 1M14A 3DK7A 3F3TA 2C5OA 4AA5A 3R8VA 4RQVA 1APME 3NUAA 4CTCA 2VWZA 3HV4A 3QBNA 5K9IA 4HJOA 4IW0A 5T6KA 1OL6A 3ORIA 5EDPA 4A06A 2X6DA 2C68A 4EH8A 3TZ9A 2ITXA 4PQNA 4G5PA 2UZWE 2F7ZE 3A4OX 3FBVA 1M2QA 5FEDA 1Q8TA 2NRUA 4QQTA 3VS3A 5H2UA 2IVVA 4E73A 3BRBA 4H3QA 1ZYCA 4JRNA 4EJNA 2HZNA 2I0EA 4D9TA 3NRMA 3KXZA 1LP4A 3Q96A 3VW6A 4ZTHA 4C4GA 4PX6A 3R7VA 4YMJA 2XEZA 3FMKA 3NUNA 3NYOA 3R2BA 2HZ0A 4FOBA 3KXHA 4OTQA 4WG5A 2PVMA 3OXIA 5JRQA 5E1SA 4DFYA 4R8QA 2BHHA 4AOJA 3UMWA 4EBVA 3EYGA 4Z7GA 4M14A
chains in the Genus database with same CATH superfamily
3QKKA 1OIYA 4LOOA 1SVEA 3AGMA 4G3DA 2X0QA 3FZTA 2IZSA 3QLFA 4O7SA 1M7QA 5HCXA 3VUDA 3QLGA 4FKOA 4MQ1A 3R7YA 4D2PA 2YZLA 4AOIA 2G15A 1TQIA 2XJ0A 2YABA 2YM8A 3GQLA 3I4BA 4ZS0A 5EM8A 4DFZE 4O22A 5HNGA 3ZEWA 3ORPA 2ITYA 3EHAA 4FG7A 4NIFB 3W32A 3ZUTA 4X0MA 4YGAA 5HCZA 1F5QA 3F2NA 4BCNA 3UDTA 2BFXA 1FOTA 3KN5A 4BKJA 3CP9A 2QOBA 5HNIX 5HBHA 2Z60A 2F2UA 5E9EA 2V5QA 2BCJA 2W05A 3HLLA 2RFEA 5FD2A 2NRYA 4I94A 5EM7A 3EJ1A 2GNGA 2Y6MA 3CJFA 4ANSA 3BYUA 2Y4PA 3U51A 1ZOEA 4YSMA 3ZFYA 4BDAA 3ROCA 2G2HA 5BVNA 2PYWA 5HTIA 4M13A 2WGJA 3ORMA 4EH3A 2J4ZA 4Z55A 2QC6A 1YOLA 3ZEPA 4ZLOA 4FSQA 3PFQA 2AYPA 4RIWA 3W10A 2C3JA 2UZLA 3KFAA 5E8ZA 2WTJA 4FTRA 4I23A 2R3NA 3NYXA 2C5VA 3BLHA 3EB0A 3UNJA 4EOLA 3VNTA 4KIPA 4O0YA 3LJ2A 5GJDA 4IFCA 3EOCA 4UX9A 3OMVA 2XRUA 4EYJA 3EN5A 3EL8A 4I0RA 3A8WA 3QFVA 5I5ZA 3HV3A 4XUFA 1L3RE 3KGAA 4BTKA 3ZSHA 4DF3A 3UO5A 2HIWA 1XH8A 2FGIA 1PHKA 1YVJA 2W9FB 3Q4TA 5KKRC 1P2AA 4XP2A 3SGCA 3O2MA 3D5WA 3COIA 4V01A 3D83A 3UC4A 3BYOA 4EI4A 2B52A 5JSMA 2YWPA 4PRJA 5KMLA 4YHFA 3LKMA 5E8UA 4NT4A 4AS0A 2CHLA 4F7SA 3D94A 5B2LA 4AP7A 5EW8A 4C4HA 3DJ6A 4ZLYA 4NYEA 3KEXA 5AR4A 3RAKA 3TZMA 2ZV7A 3GC7A 4RG0A 1OKZA 3FZRA 1DM2A 4LOQA 1DAYA 4NH1A 1OIQA 3EZRA 4YJTA 4DEGA 4MD8E 4C33A 2BKKA 3V8TA 3V5WA 2VWWA 3W0PA 3FMLA 3TXOA 4MBJA 5IQIA 3O23A 4QMWA 3PSBA 1O9UA 4PMSA 3ORNA 4GT5A 3V5QA 3FLSA 5LWNA 2A98A 3MIAA 3UPZA 3WZUA 1G8KA 3KREA 3FXWA 3BGZA 3VBWA 3W2SA 2R3PA 4HVDA 5AIKA 5F9EA 3IW8A 2J6MA 4ZSGA 4UXLA 2WTKB 4D5KA 4FEWA 4OGRA 2RGPA 5EYDA 5J8IA 2BTSA 5KX8A 2QI8A 3U8WA 4RT7A 3OW4A 3VUMA 4XP3A 3TNHA 2AC5A 2VTOA 5HD7A 4EWHA 3QTSA 1PKGA 2JC6A 3UDBA 3PXFA 1ERKA 4GK3A 4BDBA 4YR8A 2OU7A 1MQBA 5AX9A 4XOZA 3ZCLA 3KCKA 4FKRA 4I5MA 4MD9E 4BCKA 3UIMA 1ZMWA 4RIXB 2X4ZA 4TYEA 1YWVA 4U97A 3V5PA 3LOKA 4AGWA 2YLFA 4F1OA 4TYHA 3ZO1A 2BALA 3BHHA 3ZRMA 4L9IA 5AP6A 4BZNA 5FLFA 3I7CA 3PIZA 4C8BA 4WRSA 2E9NA 3PY0A 3TTJA 2BDWA 2WMTA 5CY3A 4BTFA 4C4EA 2RG6A 3AC4A 3QZFA 3G6GA 5AUTA 2UW4A 2VO3A 1OMWA 3S2PA 4GIHA 3QYWA 5EDRA 2W7XA 1YHSA 3I79A 4RVTA 5AP0A 4LUEA 5CTPA 2XMYA 2QR7A 4PTEA 3RK5A 3H3CA 4BHZA 5I0BA 1TVOA 2CGWA 4FEQA 3UGCA 4EL9A 1AQ1A 4EOPA 4C59A 2C47A 1R3CA 4J52A 5TKDA 3W2QA 3FI8A 4I0SA 4H58A 4FSUA 4JG6A 4QTAA 4QEBA 2YCRA 1U59A 1SZMA 4BF2A 3KK9A 4AF3A 2OF2A 4G3FA 4BCIA 1O6KA 4P7EA 1LR4A 2LGCA 4AE6A 4JG7A 1P14A 3NDMA 1W84A 3TEIA 3FLNC 4L3JA 4E6CA 3GCSA 3DBEA 4S30A 3MB7A 4U8ZA 4GG5A 3QCXA 4BI0A 4CNHA 3BLQA 3EN9A 1RQQA 4FV3A 3V8WA 3OF0A 4FKSA 3S1HA 4U0IA 5CXHA 3N4UA 4E20A 2QQ7A 1QPJA 4C62A 4DH1A 2GFCA 1Z5MA 4P5QA 4NM7A 3BEAA 3ZC5A 4ZZOA 4O27B 4F1TA 4U41A 1RJBA 4OBOA 2B1PA 2C0IA 2WU7A 3FXXA 4N6YA 4DHJA 5M4UA 3SDJA 3E7VA 1KSWA 3ZS5A 2G2FA 3FQSA 5TO8A 1ZAOA 2HK5A 4QTCA 5F20A 3BBTB 5ITAA 3Q9ZA 4CCUA 2DUVA 2C5XA 2WFYA 4AAAA 4O7ZA 3QQKA 3GFWA 3C5UA 3QKMA 3OCSA 2QOLA 4M97A 4BWKA 4LV5A 5CVHA 5LMAA 4GW8A 3MBLA 5E90A 1XBBA 2C5NA 3KVXA 2NP8A 3OY3A 2YJSA 5EK7A 3R2YA 4J8MA 3ETAA 3IW4A 4F6UA 2X2LA 2REIA 4IWOA 3DNDA 4GT3A 5AR3A 4R5SA 2WMBA 5FEQA 4G1WA 3OP5A 1GOLA 3R0TA 2PUUA 4U3ZA 4ALUA 1TKIA 4BC6A 3LFEA 2BKZA 1F0QA 2YCFA 2RKUA 4ACCA 4FYOA 1QPEA 5L2TA 5CSHA 2UW5A 2WOTA 5JH6A 4FTIA 4I6HA 3NX8A 4Z9LA 3UBDA 5GIPE 5B2MA 2WEVA 3VBYA 2BIKB 2YITA 4EBWA 5I4NA 3P7BA 5IEVA 5IUIA 4FZ7A 4FSRA 2QG7A 3DJ5A 3A61A 3PRFA 2JD5A 3GU4A 4F9AA 1M7NA 3R9NA 2YZAA 2HW6A 4BCOA 1REKA 4C35A 4BGQA 4QTEA 4BBEA 2R3KA 3CQUA 4FKWA 2W4JA 2VAGA 3T3VA 3TZ8A 4HZSA 2NYAA 2Y6OA 1Y6BA 3ENMA 1WBOA 4V0GA 4WNMA 4DG0E 4CGAA 3VQUA 4O86A 1Q99A 4HW7A 5LVLA 3U6IA 4LRKA 5KMIA 3BHVA 2A2AA 2WMVA 3JY9A 2BZKB 5FQDC 2JAMA 4C57A 3ACJA 2GS7A 4EHGA 3P1AA 1J1CA 3IOKA 4EH4A 3TUBA 1PMNA 3G0FA 3H9FA 4BIEA 2EXMA 4X2KA 2PHKA 3HRBA 4X3JA 2OG8A 4FIJA 5GIOE 1VJYA 2JAVA 3VWAA 4IFGA 4XEYA 5A6OA 5KUPA 4RFMA 2ZYBA 2C0TA 1WVWA 5CWZA 4MK0A 3PWDA 3QCQA 4XV3A 2YACA 2ETKA 4PTGA 4U80A 3AXWA 1J3HA 3ULIA 3UP2A 2PZYA 4Y85A 4NCTA 3AC2A 5CAQA 3MH3A 2OFVA 4FKGA 2YAKA 1Q61A 3EQDA 5L8JA 5M4FA 4MKCA 4RJ3A 2VX1A 2ETMA 4XS2A 1DS5A 2CNUA 3SXRA 4E5AX 5DVRA 4IBMA 2PY3A 5CAOA 2PZ5A 4HGLA 3QRIA 5L2QA 4ASZA 3VHEA 4C7TA 3DKGA 4UMRA 4JX7A 3IGOA 1M2RA 1ZMVA 3C0GA 4FKJA 4BI1A 4FEXA 4MAOA 2F7EE 2BDFA 4UWBA 4ZTRA 4DCEA 4I22A 4IAZA 5AR5A 1BYGA 4KKEA 2PVFA 4F9CA 4YC8A 2X2KA 2XIXA 1QCFA 3ENHA 4RX9A 3VBXA 2C3KA 3QUDA 1OZ1A 3HV7A 3BGQA 5CU4A 5CT0A 2VD5A 3WF6A 2X0PA 4MD7E 4DFXE 4CRSA 3MVMA 2C6EA 3QD3A 3FLQA 3HKOA 3IW7A 3RPYA 3U9NA 4OR5A 5M57A 1PF8A 1ZY5A 4C3PA 4J96A 4QMMA 3R1SA 4OTWA 4CMUA 5IG1A 3ZLYA 3CY2A 2XEYA 3BPRA 5DBXA 5IQBA 4QMLA 4BL1A 2O0UA 3BQCA 3OBGA 4GIIA 4IIRA 3HEGA 3OEFX 4FKPA 1NA7A 4A9RA 1OI9A 5LMBA 1Q8UA 3ORXA 3VBVA 3HDNA 3BU3A 3UP7A 2VWUA 2J50A 4IVCA 5AV0A 5K4IA 3NS9A 4NIFA 1JWHA 2FVDA 4JL9A 4WBBB 3PUPA 3ZDUA 1GJOA 3BYMA 2ZM1A 3NSZA 4X3FC 4YHTA 5L2SA 2EUFB 3SHEA 3IONA 3WYYA 3FL5A 3DNEA 4IB5A 5CEKA 1ST4A 4AZTA 4PP7A 4CZUA 5L3AA 4EH2A 4CFNA 2FSLX 3NNVA 2O5KA 3HRFA 4E4NA 5CU6A 3BL7A 4P90A 4ITJA 3LMGA 5CSWA 3ZC6A 4GYGA 3ZBFA 4C2VA 4D4YA 2YM4A 1YHWA 5E8YA 2UW6A 3BX5A 2C6DA 2P55A 3EKKA 1HCLA 3LXKA 3SX9A 4JAIA 5CU2A 4XG2A 3FMNA 2XIZA 3HDMA 3NCGA 2EXEA 4WBOA 2X8DA 3C0HA 4KIKB 2LAVA 3WI6A 5KKRB 1BI7A 4ZIMA 1K3AA 3W8QA 3C4ZA 3C7QA 4LQMA 1HOWA 2GNJA 5BX0A 3NIZA 1IR3A 2IN6A 1XHAA 2HYYA 3WZEA 5AA8A 3R01A 3TACA 4JIKA 3GOKA 2XK4A 5EI2A 1OKWA 2CGUA 4QMZA 1JVPP 4MNFA 1OECA 4LOPA 4XCUA 3UQGA 4X2GA 3P23A 4EOJA 3DK6A 4FSWA 5AP5A 5DRBA 4C37A 3F2AA 3ZRLA 4MEDA 2VTPA 3BZ3A 4Q5EA 4I5PA 4TYIA 4GEOA 5H9BA 3OXZA 2XK8A 5K0KA 5BVEA 3VRZA 4OT5A 2OFUA 3QHRA 4HNIA 3ZBXA 5L8LA 2ONLC 4ZLZA 2QOHA 4HZRA 3DOGA 4QP4A 2IW9A 4EHVA 3T9IA 4OAUC 4A9UA 3DDQA 4GJ3A 1W82A 3QYZA 3NNWA 1SMHA 1YDSE 3FWQA 4B6LA 5DYJA 4O83A 1IAHA 2ITTA 4UEUA 2KTYA 3DS6A 3O71A 5HI2A 4ZSEA 4QNAA 3UDZA 3LVPA 4WO5A 1ZMUA 4O0RA 1ZYDA 2PL0A 2WQEA 2ZDTA 4B8MA 4RVMA 4JIAA 2Y4IC 1I44A 3LZBA 2J0JA 3PTGA 2GNHA 2KULA 3RAIA 2WPAA 2YIWA 5DT3A 2OWBA 3R8UA 4LFIA 4F0FA 1CMKE 2HXQA 4EC9A 2I7QA 5IQFA 4FL2A 3UNZA 4IJPA 4ITIA 5M53A 4KABA 4DDGA 4Y5QA 4MTAA 4BYJA 4FA2A 2GNIA 3QD4A 5IA1A 3ZTXA 2B54A 3ALNA 5F94A 3MVLA 4XMOA 3KIOC 2OZAB 4YU2A 3QKLA 2HAKA 3COMA 2F7XE 3G5DA 3UE4A 5J5SA 5AMNA 1GIHA 3IPHA 5AV1A 4UZHA 1H1PA 4PDYA 3F5GA 1M2PA 2CCIA 2X6EA 4LGDA 1Y57A 1YXSA 3O7LD 5LMKC 1GAGA 2X8EA 4NWMA 4AGUA 4FRFA 2BRHA 3TV4A 5BVDA 2UUEA 4OUCA 3V51A 2PE0A 4N0SA 3VBTA 1YDTE 4FK3A 3RINA 4FIHA 3DA6A 4FKQA 1XH9A 4KD1A 5HIBA 2IWIA 5G6VA 3F3VA 4FTAA 5E8XA 5K5XA 2Q83A 3AKKA 4H1MA 2YIQA 3HV6A 4BWXA 4NKAA 4QQCA 3PVBA 4O0XA 2JFMA 4XBRA 4YJOA 1WBTA 1VYWA 4I1ZA 2ZB0A 1U54A 5E8WA 3LIJA 1CTPE 2PTKA 2WKMA 2WMWA 3LCOA 2PMLX 2VTRA 2Q0BA 1JKSA 1IEPA 3SG9A 3FZ1A 5E91A 3VS6A 1JKTA 2O63A 3G51A 3GCPA 3OVVA 3OW3A 5EI8A 3T3UA 3VS2A 5IA0A 4AZVA 2QURA 4YP8A 3DAKA 4HYUA 4MF0A 3D7TA 2F4JA 3DY7A 2CN5A 5EI6A 3HAVA 4CKJA 5D1JA 4IX3A 4A9SA 4ITHA 3LMHA 4GS6A 3KK8A 1F3MC 3QTXA 4Q5HA 2E2BA 3PSDA 4A07A 4C4JA 4EEVA 3W2RA 4BCFA 4RQKA 3LXPA 3DBQA 4Q2AA 5DIAA 4F0GA 2OF4A 3C9WA 1SNXA 4IZ7A 4LL5A 2G01A 4NJDA 5A14A 4IEBA 2V7AA 3AC8A 1A48A 3WIKA 4YTFA 4YURA 4G9CA 3IDCA 4YZDA 5CSXA 4EH7A 4GCJA 2VWYA 4GVJA 1Q24A 3GC9A 3UVPA 4U42A 2VTMA 4ZZNA 2ZDUA 3BU5A 3R1YA 5AJQA 5HLPA 4O6EA 5AP4A 2G2IA 5JRSA 4IB3A 2G1TA 3O8UA 3A4PA 5AV2A 3QTWA 3QAME 4A4XA 3PPJA 4JR7A 1ZZ2A 4MNEA 2XP2A 5C01A 5C8KA 5IQEA 2C4GA 4DHFA 1R0PA 3QRTA 4FIGA 3PP1A 4QP2A 1VZOA 4RC3A 3GENA 3NUYA 3EIDA 4L3LA 3MY5A 4E6QA 3W2PA 4FV5A 2QO2A 2X9FA 3JVRA 5CNNA 5HIDA 1FVVA 2PU8A 4O0UA 3FYJX 3NW6A 4CG8A 1OKYA 4FSTA 4OTRA 3HZTA 3EN6A 4XG7A 4FTJA 2WELA 4YJUA 4CG9A 2BROA 4EQUA 2QU6A 5D7VA 4I6BA 3FXZA 4FVQA 1P5EA 3MV5A 4XG8A 3G9NA 1ZLTA 4JQEA 4EOOA 2NNWB 5AUWA 1NVSA 4QT1A 3IDBA 3L9PA 1WMKA 4QQJA 3UIBA 4BDDA 4DTBA 4BWPA 4AZEA 3OCGA 4IVAA 4APCA 2WTDA 2GTMA 1R39A 2EXCX 3T8OA 3EQRA 1Q62A 4RJ4A 3MTLA 5ACBC 3SW7A 2OO8X 5FP6A 4L43A 3VHKA 1U5QA 2YIYA 3W0OA 5KHXA 3SOAA 2WMUA 5CU3A 4QMQA 3OROA 3E8DA 3K54A 4W9WA 3SC1A 3NFGB 4IACA 4YNEA 5KO1A 5JK3A 3E8CA 4M0ZA 5G1XA 3UIUA 2JDOA 2YJRA 3PA5A 3LW0A 4TPTA 4O21A 3VIDA 3TKIA 3AT3A 3LM5A 5EQEA 3EN7A 4CFWA 1PW2A 4X7QA 5AV3A 3QRJA 4GMYA 4D2SA 1OPLA 3PIYA 3OFMA 3IKAA 4FK6A 5DOSA 4AU8A 4QDVA 2C6MA 5D9HA 1WBNA 3QCYA 4X6RA 5JZJA 3FMJA 4D0XA 5KMNA 3FC2A 3TV7A 4BCQA 3KULB 4YLLA 4MH7A 4OTIA 1URWA 4K2RA 3CQEA 5F4NA 4PY1A 4FL1A 5CI6A 4XJ0A 3ZRKA 3V5JA 3L9NA 4DFBA 3OD6X 2PVYA 3LFFA 1NY3A 3P7CA 3PUFC 5AR7A 4GKIA 3F5UA 3E7OA 2YERA 4QMVA 1FQ1B 3OY1A 2JBPA 4N4SA 1BUHA 4QMOA 4AWIA 3BI6A 2A19B 2GFSA 2WIHA 4W8EA 3W18A 3OHTA 3PA4A 1SM2A 4IB1A 4H36A 3ZSIA 4BDIA 4O2ZA 3PY3A 2XARA 2BPMA 1WFCA 1KE9A 5FTGA 4O1PA 4L67A 3G2FA 3GC0A 4JQ7A 2BIYA 2GNFA 3PJ1A 5D7AA 2VRXA 5GHVA 2CCHA 4FG9A 2BRNA 2AC3A 2O64A 4PDPA 3PXKA 3S00A 2CLXA 1UNGA 3HVCA 4QP7A 2YFXA 1YKRA 4FVRA 3MVJA 3AC1A 3HNGA 2E9VA 4AXDA 4NEUA 4F09A 3RCDA 4O4BB 3P5KA 2YDKA 5KZIA 2YIXA 2VTSA 2CSNA 4AUAA 3ANQA 2CNVA 2PVLA 1MUOA 2RFDA 5A54A 3U6HA 4RZWA 3HX4A 3P0MA 2R3JA 4P4CA 2R7IA 2R0IA 4IWDA 2IVUA 5EYCA 2J0KA 5KE0A 4D2VA 3OWKA 4HVIA 2HY81 4E6AA 2VTHA 2X4FA 2JKOA 4FZFB 4OTHA 3QX4A 3LFSA 3KMUA 1XBAA 2OJ9A 3A99A 3L8SA 3KVWA 4BTMA 4ZSAA 2FSMX 2J0IA 2CJMA 2WQBA 5IQGA 3ZMMA 3PG1A 5CEIA 2FYSA 3A7FA 5H8BA 4IADA 4O7WA 4XOYA 1Q41A 1T45A 1BLXA 2JKMA 4FV4A 1U4DA 4YUQA 2RIOA 2XKCA 3QWJA 1HCKA 4JI9A 3PA3A 3CCNA 5D11A 4JMQA 1WAKA 2V55A 4L52A 4DGGA 3C51A 3FY2A 4C61A 3RZBA 4EONA 3V01A 1B39A 3DXNA 4QRCA 4YPSA 3D5XA 5ETIA 5HU9A 4WG3A 3AQVA 4PNKA 5BVKA 5CVGA 5ANGA 3D5UA 2DWBA 1Q8ZA 4XG9A 3MI9A 3NUXA 4QP1A 3QXOA 4WSQA 3TNIA 2OXXA 3PIXA 2UVXA 1Q3DA 1YI6A 4L44A 4L45A 4O0VA 4HVSA 1ZWSA 4FSMA 4DHZA 3VRYA 4EUTA 1OVEA 3OUNB 3DBDA 3V8SA 4CFMA 3LLTA 5TR6A 3T9TA 4GSBA 5FUTA 5J87A 2BAJA 4CCBA 3QUPA 5A3XA 4KIKA 4DGMA 2GSFA 3PVWA 1KE5A 3KF7A 3JUHA 3E92A 3Q9WA 2PZIA 3QD2B 4IWPA 4BN1A 5EYMA 3PPZA 2WQNA 4UZDA 4C36A 2I0VA 4MXYA 2A4LA 4G34A 4HYIA 2UVYA 1TQMA 3CXWA 1KV2A 1PYEA 4M68A 4AFJA 3FJQE 3MW1A 1CM8A 5DFPA 4RA4A 5JFWA 3LCSA 2ITZA 2JDRA 3TUCA 4I92A 4ENXA 1H0WA 4FTMA 4PP9A 5AP2A 2AQXA 1KE8A 4RPVA 1PXOA 2UW7A 3SRVA 4GFGA 5DEWA 3F69A 2VO7A 1XH7A 3RMFA 3M42A 4DH8A 2Y4IB 2VTAA 4IX4A 1X8BA 3NZ0A 4BDKA 4D1ZA 2ZB1A 2W5AA 5HTCA 1E1XA 3EFJA 4RIYA 1H26A 2CGVA 2PUPA 3VONA 4YNOA 1JLUE 1EH4A 3B2WA 3BBWA 3GCUA 4MBIA 3RNYA 4F78A 1NVRA 3DU8A 4PPAA 4CFUA 4S32A 2IPXA 4N57A 4FV6A 5ETFA 3O0GA 5HORA 2IJMA 3TL8A 4JJRA 1G8SA 2CKQA 5J7BA 4OT6A 4RC4A 1OUYA 2JDSA 5C9CA 5HO7A 1I09A 2WO6A 2XNOA 3LXNA 4ANBA 2FO0A 2PZPA 3PJ3A 1RE8A 3U4WA 3F3ZA 4C0TA 5JGAA 4XG3A 3P08A 3BV2A 3MPMA 4O96A 4ZY4A 3BELA 3QWKA 2Z7LA 3IG7A 4ZEGA 2C6LA 1SYKA 3D4QA 4DN5A 3ERKA 4PL5A 3FMDA 2HWPA 5D12A 5JFVA 3HA8A 2BDJA 3LM0A 2OZAA 5HTBA 3TYKA 4YHJA 4DBXA 4GT4A 2R64A 3HMNA 5L8KA 1ZXEA 3FZSA 3THBA 3UOKA 4LL0A 2UW3A 2UV2A 4ZTSA 5HGIA 4K18A 2UZVA 1H1RA 5JQ5A 4I24A 3FZOA 4FTQA 4X6QC 5I9XA 3LFNA 4FT9A 4B9DA 4XYFA 3MJ2A 4NZWB 4LYNA 5BUIA 4TZRA 4FODA 3KRXA 3RAWA 4TTHB 4EORA 4H3PA 3BKBA 4FTOA 4J97A 5HX8A 1H0VA 4RVKA 2XKEA 3TIZA 1JOWB 3Q4CA 3QGYA 4WRGA 3NAXA 4R3PA 3D14A 4CVAA 4M7IA 4C02A 4GUEA 3NNUA 2IEWA 1PMVA 4FTNA 2JIVA 2YM7A 3W0SA 4YZMA 4JDJA 2RL5A 5JT2A 4IAKA 4N6ZA 4RX7A 2YHVA 4L6QA 4UMQA 4AA4A 2YA9A 3NGAA 3RM6A 2OJFE 4BDFA 4CMTA 4ZTMA 2WTWA 1PRYA 4UMTA 3R1QA 3DK3A 4AXFA 3DKCA 5CLPA 2IVSA 2X1NA 3CIKA 4BB4A 1FINA 4AT5A 4PMPA 3HYHA 2C69A 3QQGA 1UU8A 3N4TA 4PL4A 3FPQA 3KRJA 4I6QA 5HG8A 3TMOA 3U54A 4IAAA 4W4VA 4WNKA 3KXXA 3K3JA 1OBDA 2R7BA 4IZAA 4R3RA 5DR9A 3WF5A 1KE6A 5FBOA 4Y95A 1OIRA 3OCBA 4DG2E 2VWBA 4NUSA 5D10A 2OI4X 4USFA 3D2IA 5F95A 5FEEA 3PFYA 1Q5KA 5AAEA 4Y83A 2ZM3A 4F08A 1ZOGA 2R3LA 4NSTA 3KRRA 1SNUA 1E1VA 4BY9E 3RCJA 2XNNA 3ZONA 1H01A 5ANEA 3E87A 2R3OA 1PXLA 3F7ZA 1JPAA 2VTLA 4QP8A 4TRLA 4YJRA 4E4MA 1ND4A 4M0YA 4TT7A 4QYHA 4FUXA 1JSTA 5HE2A 4J8NA 5CALA 5BYLA 5T68A 4EZ3A 4FSZA 3A7IA 5CU0A 4CKIA 4EKLA 3R8LA 1DI8A 2JKKA 4FMQA 4B99A 3GNIB 4L53A 4HNFA 3R22A 4BIDA 3S3IA 3TG1A 2O3PA 3AMBA 1PKDA 1GZOA 3QF9A 2NPQA 2ITPA 3DB8A 3K5UA 3BGPA 3FQEA 3CKWA 2XUUA 3NPCA 4X21A 3RWPA 4CLIA 3UZTA 4AAYA 3I6WA 4TWOA 3ZUVA 2R3MA 2C6KA 3TKUA 3A60A 3TWJA 4TL0A 4MQ2A 4G6LA 4ZAUA 3IS5A 2Y0AA 4MX9A 5CYIA 1Q4LA 5LARA 3FLZA 3Q9XA 1UU3A 2B9HA 4KIQA 2XF0A 3ID6C 1RW8A 2A1AB 4UBAA 3W0QA 2XK9A 1G8AA 4BKYA 5BMMA 3O8PA 4EK5A 3HECA 2WTIA 3Q60A 2WB8A 5M4IA 1PMEA 2HCKA 4BFMA 4M12A 1YOJA 2C1AA 2GNLA 3NFFB 4FNXA 5EKNA 4XRJA 5F1ZA 5IMEA 2XNEA 5K5NA 2GHLA 3DQWA 1MRYA 2WEIA 4IDVA 3DQXA 3CEKA 4JX3A 3ZO4A 4I20A 5M06A 3BQRA 2VWIA 4AN9A 4QD6A 4K9YA 3ZHPC 3P5JC 4QP3A 1H4LA 5CX9A 4WHZA 4EZ5A 2CKOA 1J7UA 5DR6A 5H3QA 3U4UA 5J9LA 3O50A 4NM3A 3EFWA 2JIIA 4A4OA 4I6LA 3VQHA 2BAQA 1GY3A 2J51A 3LXLA 4IZYA 1G5SA 3OT3A 3SLSA 4R7HA 3IOPA 4II5A 4ANLA 4C34A 4MXCA 1J7IA 4HGEA 2JFLA 4NM5A 4F9BA 4TYGA 4C58A 4FT3A 4ZTQA 2EB2A 2GTNA 3WF7A 2YIRA 3OWJA 4U45A 3GI3A 3CTJA 2XNGA 4FT0A 4S2ZA 3VJNA 3Q5ZA 3ZO3A 3Q52A 3FLWA 4NJ3A 4CV9A 5GNKA 4YJVA 3QTUA 4QPAA 3F6XA 3KULA 4DTKA 4HGSA 4LMUA 4IAYA 3PXRA 4MF1A 1S9IA 5JMSA 3MH0A 5CQWA 3WE4A 4B8LA 3R21A 4W4XA 4OW8A 4TNBA 4F6SA 3M11A 4RWKA 2OIBA 3BE9A 4ZSJA 1XWSA 3CS9A 3FI3A 4EOKA 3CSVA 3W1FA 3P4KA 3ZSGA 3DBCA 3U87A 4JXFA 3QC4A 4HYSA 3JVSA 4FV7A 4L46A 5IQCA 4ZP5A 4EOIA 2W99B 4O4DA 4TWPA 2W1EA 4WA9A 4LUDA 2I0YA 4RGJA 5FXSA 1YXUA 4KBKA 4F7NA 3EQHA 3GQIA 1K9AA 3M1SA 2WOUA 4RVLA 5M07A 2P4IA 5IH5A 3KRLA 5KHWA 4PF4A 2XKDA 4M67A 3UZRA 5DMZA 4I93A 1R1WA 3QHWA 4RJ5A 2V0DA 3RJCA 3Q04A 4QMYA 4K0YA 2O2UA 4QYYA 3EQFA 3WILA 4YZ9A 2XZSA 2RFNA 3GCVA 4RIWB 4XRLA 1NW1A 3JXWA 3RALA 1WBWA 3BLRA 3FQHA 5E7RA 3GGFA 3MDYA 4EJ7A 3R7IA 3ITZA 1H28A 2UW0A 2X0GA 1OL5A 5HHWA 4EOSA 2BMCA 4H1JA 4MHAA 4BDGA 4G2FA 3V5LA 4OTDA 4YJQA 3WIGA 3HMOA 4QP9A 1KOAA 4E4LA 3JS2A 3CPBA 3H30A 2QCSA 5BPYA 4C4FA 3MN3A 4HCUA 2XK6A 3MFUA 3IQ7A 5AP7A 3VS5A 3SA0A 2OSCA 4ACDA 1UWJA 4NK9A 2UZBA 5JKGA 1OBGA 5EFQA 4EH6A 5ETCA 1G3NA 3UG2A 2C0OA 5AIRA 4G3EA 4GYIA 3NVKI 2WD1A 5GZ9A 3W0MA 1O6YA 2BVAA 3GFEA 4FKLA 1H1WA 3EQGA 4XX9A 5A46A 1WBPA