4CQEA

B-raf kinase v600e mutant in complex with a diarylthiazole b-raf inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
250
Chain Sequence
b'DWEIPDGQITVGQRIGSGGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGGSILWMAPEVIRMQNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SLC45A3-BRAF FUSION PROTEIN
publication title Optimization of Diarylthiazole B-Raf Inhibitors: Identification of a Compound Endowed with High Oral Antitumor Activity, Mitigated Herg Inhibition, and Low Paradoxical Effect.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 250
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cqeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cqeA01
2B55A 5J7HA 4X3FA 4K2RA 2J6MA 5IPJA 2R4BA 4WA9A 5LMBA 4HGEA 4YTCA 3ITZA 5CS6A 2R9SA 4UX9A 5J95A 3QX4A 1WFCA 4ANNA 1JNKA 2XIKA 3DBCA 3TV7A 2YWPA 4AZTA 3LCKA 4EH5A 4FICA 2C0OA 5KZ0A 5HHWA 4FSYA 4A9TA 3LPBA 4XP0A 4PNIA 2A19B 4C4FA 5TE0A 4F6WA 2X0GA 5BQ0A 3EWHA 5IQAA 4K77A 3HMPA 5FEQA 2HYYA 2R64A 4NU1A 4CFUA 5T6KA 1XH7A 4MNEB 5EYKA 3JR1A 2A0CX 3IDBA 3NUSA 3NW6A 5CSXA 5DHJA 1UKIA 3MPMA 2EXEA 5DT4A 5EDPA 4IB5A 3QWKA 2YISA 4GK4A 3EZRA 4RJ8A 3GCUA 4USFA 4FOCA 3BHVA 3TNQB 5DOSA 5TO8A 3E8DA 5ITAA 3LXNA 4UEUA 4L52A 4TL0A 4KSQA 3WZUA 4NH1A 2XH5A 1J3HA 1ZYCA 4X2NA 5JFWA 2GDOA 2YLEA 1YI6A 2CN8A 3ORIA 1A06A 2XK4A 3SLSA 2VTQA 3KCFA 3R2BA 2F7XE 3EL7A 4DG2E 5DMZA 4YTFA 3N4TA 4RRVA 3UMWA 2BRBA 2R3PA 3IOPA 3VIDA 3BYMA 4ZOGA 3O8UA 4DTBA 3C0IA 3II5A 2C0IA 2VTMA 1IR3A 4GU9A 4L3PA 3Q9WA 4GK3A 3CY3A 5CALA 4GVAA 1M7QA 4R5YA 4U80A 4MXXA 4ANLA 5BYZA 2WIPA 4D4SA 2YM6A 3QQGA 4F99A 4GT3A 3KXHA 5I9XA 3CTQA 2YCFA 4XMOA 2GQSA 3D5WA 4YLJA 4GU6A 5ANEA 1TVOA 2VTHA 4AT4A 4JLCA 3RINA 3PJ8A 4EONA 3FSFA 5EM6A 3LLAA 5BVOA 2IVUA 2C5VA 2Y7JA 3DNEA 3AD6A 3L9PA 4U0IA 1YI4A 3O23A 4RWIA 3NUPA 5A4QA 4ZMEA 3DFCB 3S2PA 4O7LA 1XBBA 4I5CA 4BKYA 1H8FA 4O1OA 2WHBA 3CY2A 4C2VA 4HCVA 3QA0A 4OTFA 5I3RA 1G8SA 4TTHB 4BDIA 4ORKA 4YLKA 1XH4A 3WE4A 1DM2A 2OI4X 4C4IA 4AOJA 4DEGA 1ZMWA 2UZNA 2W4OA 3MVMA 3W32A 5DT3A 4TZRA 5HE0A 4FI1A 4JR3A 2VTLA 2YM5A 4M13A 4JNWA 4Q5EA 4ERKA 5CAVA 3C5IA 2R3MA 3MVHA 4UWYA 1Q62A 4C33A 3QA8A 4D1XA 4D4YA 2W1ZA 3VF9A 4EJNA 3FZPA 1DAWA 4TYHA 5HGIA 2NPQA 4FTLA 4HNIA 3EYHA 3DJ7A 3IG7A 2WAJA 5LJJA 3ORXA 4DEIA 2P0CA 2ZM4A 3R8MA 3KF7A 3PXRA 3QXPA 4ZTRA 5JRSA 4Z3VA 3QL8A 2HW6A 5C03A 3UIXA 4PUZA 5CU6A 4EJ7A 1YXXA 5HBJA 4C58A 4XOYA 3HLLA 3ZTXA 4O96A 2Z02A 5ANGA 5HLPA 4YR8A 3VW8A 1XH5A 5EHLA 4J1RA 5IDPA 3N4UA 4D5HA 4GYIA 3V04A 1H00A 1HOWA 3OUKA 4EH8A 3EN6A 2E9NA 2OO8X 2VWZA 5D10A 5A54A 4BIBA 4KIPA 1U5RA 4FOBA 1K3AA 5GZAA 4FTMA 3CCNA 4FG8A 4GFMA 4M3QA 4C57A 3TI1A 5HO8A 4DEEA 3ID6C 5L6WL 4UXLA 4NM0A 5IQHA 3LFNA 3RCDA 5FBNC 4L9IA 3BHUA 2F57A 3GENA 2R7IA 2BRHA 5HCYA 5HNBA 1PXPA 3UMXA 4B99A 5GJDA 5L2SA 4E4NA 2OSCA 4R6VA 5DWRA 1YW2A 3E64A 2GS2A 2I0VA 3OZ6A 1PKGA 4IZAA 5AV4A 1Q8ZA 2CKPA 4FZAB 2XCHA 5HD7A 4HGSA 4FKJA 4V05A 1Y8GA 2UUEA 4IWDA 3R7YA 2XKCA 2HOGA 2VWYA 4V04A 3RHXA 1NT2A 4I94A 4F70A 5CEPA 3FLNC 3I60A 4BDBA 4FKLA 1VJYA 4JBOA 5EYCA 4BVUA 2YERA 5EW3A 4YJSA 3PJCA 3SGCA 1B6CB 4C4JA 5CF5A 2ZOQA 2ITPA 3L9NA 3M2WA 2OJ9A 3MFUA 5HG9A 4BYJA 5M56A 3Q5ZA 5HE1A 1H25A 4BR3A 5AP3A 1R1WA 3DBDA 4BTFA 4IVDA 4XP2A 5K5NA 1LEZA 4APCA 2WZJA 1OZ1A 4BL1A 2BIYA 2FVDA 4UBAA 4DAWA 1ZZLA 4MXAA 4YHFA 3E3PA 4QPSA 4B9DA 2BILB 1OB3A 3L8VA 2BRNA 5ANKA 3U87A 1CKIA 4WSQA 4QMQA 3TUDA 3VUHA 4G6LA 2PVFA 2RIOA 4ASEA 4P2KA 3RPRA 5LCJA 3FMEA 4M14A 2W99B 4F1TA 4PP7A 1XBAA 4CFVA 5ETAA 4FSNA 3ROCA 4S30A 2WOTA 5AX3A 2YZAA 2YDJA 3TN8A 2HK5A 3SKCA 2KTYA 2X9FA 2VTRA 4F08A 4KIKA 1UNLA 4LRKA 5LVPA 3Q96A 2H8HA 3KVWA 3QD4A 5M07A 4BDGA 4IJPA 4C8BA 3R83A 4X6RA 3PY0A 2F2CB 2QU6A 3R9RA 2IVVA 3MN3A 3R8PA 5KO1A 3HV4A 4GS6A 3F2RA 3Q9XA 3RGFA 2PVNA 4QPAA 5C8NA 1MRVA 3E8EA 1H27A 3N9XA 4JBPA 3ZLWA 5BUJA 4I0RA 1GZOA 3U4WA 4O7TA 3IK3A 3VO3A 4AW5A 4QYEA 3R9OA 4AGUA 2UZDA 3HMOA 4XNEA 3KULB 3V5TA 4W4VA 3A99A 5CQWA 2F2UA 4RVMA 5AR4A 4DN5A 4F4PA 1Q61A 2BKZA 3CP9A 5L2IA 4MEDA 3F61A 4M0ZA 4YJOA 4IAYA 2O0UA 3QC4A 4Z9LA 5J9YA 1PJKA 3KC3A 4CZYB 4CSVA 5HO6A 3HUCA 2ITZA 3SG9A 1QPJA 4BZNA 4D9UA 3FKNA 5F20A 3TDVA 5BNJA 2W5BA 3R8UA 3W18A 3C0GA 4B0GA 4YJTA 3IONA 1SM2A 3PJ2A 2BDWA 2IZTA 4GH2A 1KUTA 5CTPA 2QVSE 3Q4CA 2PU8A 4MNEA 2EVAA 4ZY5A 3DKFA 4QP4A 3IKAA 4FSTA 4UMUA 2I0HA 1Q3WA 4FV5A 5JFVA 2E9UA 3L1SA 4I41A 2WEIA 4WNOA 5JT2A 1PKDA 2I1MA 5GIOE 2GTMA 2PTKA 4TW9A 4IB3A 3LQ5A 5TF9A 1H24A 1K9AA 5H8GA 4BF2A 4FKUA 1KE7A 5CXZA 3CJGA 4IBMA 3VBVA 4C3RA 2XNGA 3FLZA 3QCYA 1BL6A 2DS1A 3ZXZA 3OMVA 4O0TA 3BLHA 4C4EA 1G5SA 5JQ8A 2X6EA 4S33A 4O7NA 5JQ5A 2W9FB 2YM8A 4EOKA 2PSQA 3FQEA 4IAIA 4DCEA 1A48A 2VNYA 4NT4A 3WF5A 3OF0A 2RFEA 3C9WA 4AGWA 3ZSGA 3BIZA 4U5JA 3ZRLA 4C0TA 3FWQA 3TKIA 4RG0A 4XH6A 1JKSA 3DK6A 3HRBA 1KV2A 4UZDA 3FMLA 1OPLA 2CLXA 3KXNA 4KBAA 4GRBA 2ONLC 3C13A 3NW5A 3MH2A 2XM9A 3FC2A 3QTZA 3NSZA 2R3JA 5I0BA 3P4KA 2X8DA 3LFQA 3P7CA 5AR2A 1Q8TA 4IQ6A 3UPXA 4BBMA 3BQCA 4BCNA 2CNUA 5CNNA 2BKKA 3SAYA 2C1BA 3AT4A 4IXPA 2WXVA 2YIQA 4IZ7A 1Z5MA 4EOQA 2YCQA 4I22A 4K6ZA 1ZYLA 4Q5HA 3LLTA 4MQ1A 3TG1A 3E63A 3D94A 3FL5A 3KREA 2J5FA 4YURA 4YZBA 1KE9A 4O0YA 4AS0A 2O63A 4IVCA 2XJ0A 5BX0A 3AGMA 3SOCA 4BBFA 3EN9A 1Z57A 3OXIA 4ENXA 1IAJA 1OIQA 2XNEA 2V0DA 3NPCA 3W2PA 4NW6A 5FD2A 5I9WA 4ZS0A 1XR1A 5KUPA 2OJJA 2W1EA 3UQFA 1OL7A 2BIKB 2GS7A 3VBTA 3ZYAA 1J7LA 3ACJA 3G9NA 5E9EA 3NIEA 4ZSAA 2CCHA 3A2CA 3PA5A 2OKRA 3T8OA 3ZZWA 3LM0A 3PYYA 3W10A 4XV9A 4OTWA 5AP5A 5IUIA 2BR1A 4R7HA 5HIBA 1AQ1A 3RM6A 4DGOA 5JFXA 5M4UA 1KOAA 3GNIB 3QQHA 4B8LA 3ORNA 4XG8A 4IX4A 3MW1A 2HWOA 4CNHA 3OTUA 2GNLA 4P4CA 5AP6A 3DY7A 4FTTA 5CSPA 5FEEA 3RI1A 5EOLA 2PMLX 3OOGA 3OY1A 4GIHA 3ENMA 4NKSA 4D58A 3ZC6A 3DB8A 1ZOHA 2X7OA 3QQUA 4BB4A 3L8PA 3UC4A 2QOQA 5FQDC 3LMHA 2JIVA 4QYYA 4BCJA 3BE9A 5IA3A 4EYJA 5EYDA 4M0YA 4IDTA 3NUUA 5HNGA 3UP2A 4BICA 3BV2A 3LFSA 2J9MA 3DBFA 3IOKA 3A7HA 3F2AA 2YIXA 3E8NA 5CSHA 5IQDA 3MPAA 4G6OA 5JSMA 3BLQA 4HJOA 4LGDA 4PMSA 1M17A 4USDA 5GIPE 4IX6A 5M57A 3MVLA 4F9CA 3R8ZA 2HWPA 2F49A 4EOIA 1XHAA 3VQUA 4IAKA 2X8EA 5D9HA 2OXYA 4FT0A 3HGKA 4GKIA 3QRUA 2ZV2A 3GCQA 3QTIA 4R8QA 4A4XA 4KKEA 4QMSA 3RAIA 1YWNA 4D2RA 1WMKA 2X4FA 3HV7A 3VHEA 1JSTA 1Y91A 3VS0A 2C6MA 5AA8A 2OZOA 2XK7A 1MQ4A 4NM3A 4EH3A 1YDRE 4RJ5A 2A4LA 1WZYA 4FZFB 4PTEA 4JRVA 5GINE 4V0GA 5HTCA 2O8YA 2VTJA 3H9FA 4KKGA 2G2FA 4XJ0A 5K0XA 3OY3A 4NTSA 1H4LA 4EH4A 2OU7A 5DR2A 4DH1A 4CV8A 1PMVA 3IW6A 1H26A 3PA4A 4A9SA 4HYSA 4JQ7A 4YUQA 2ZAZA 4YGAA 1IASA 4AQCA 3KCKA 3EQFA 1EH4A 1YOJA 5JZNA 2XBJA 2VV9A 3R7IA 5LMKA 2VWVA 3KQ7A 4FUXA 4Y5QA 3DLSA 2QR8A 1U46A 2QO2A 3EFWA 4PDOA 4NL0A 1LPUA 1OKZA 4PY1A 4GK2A 5LMKC 2J2IB 1VYWA 2WQEA 3Q04A 4AZWA 5A3XA 2UZOA 3EL8A 1PXJA 4C4GA 4WG5A 3FL4A 1S9JA 4ERWA 1YDSE 4F0FA 3EKKA 4FKPA 1V0OA 3UYTA 4TKSA 3HX4A 4WNMA 5HE2A 4FVRA 3S3IA 4AG8A 4Z7HA 5E4HA 2H9VA 3QU0A 4EQUA 1MRUA 2WOUA 4I4EA 4O6EA 3DXNA 2J0MB 4L68A 2OZAB 3EQIA 3WF8A 4FVPA 3ZFXA 2X8IA 3DQXA 3MY1A 4G34A 3KXXA 2EWAA 2PVRA 1L3RE 2PVHA 3P7BA 4WRGA 2I0YA 4DEBA 5DRBA 3EYGA 2QURA 4K8AA 3N4VA 4WOVA 3KK8A 1LP4A 3VW6A 3PDTA 4DGLC 5M4FA 3QZGA 2XJ1A 3KULA 4RWKA 2DUVA 3PIXA 4RQVA 2XK8A 3CS9A 3C51A 3NYOA 4UALA 4ZIMA 2XBAA 2YIWA 4ZTMA 3QGWA 5AR8A 4U6RA 1GIIA 4WBOA 2OH0E 3SHEA 2W1IA 3HYHA 4MD9E 5C4LA 3V3VA 3IDPA 3PIZA 1OBGA 2UVXA 5JN2A 4JG6A 4OW8A 5HQ0A 4WNKA 4I92A 4TNDA 4CLJA 5TOZA 2BVAA 2W7XA 2X9EA 4LOQA 4EC8A 4MTAA 2CNQA 3WILA 3MYGA 4RA5A 1JSVA 4BYIA 3LQ3A 4K33A 3ZDUA 3F3ZA 2FB8A 4RJ4A 5LCKA 4O83A 3BRBA 3F9NA 5HX6A 1JPAA 4XHKB 2AC3A 4O0WA 3RK7A 4LL0A 2XK3A 3H4JA 4Y85A 3D83A 2HENA 2W1CA 2BFYA 2VWBA 5HG7A 1OM1A 3FHIA 1P5EA 5L8KA 3EQCA 2A2AA 4GEOA 3UGCA 2YN8A 5I5ZA 5ANIA 2ZV8A 1OBDA 4G31A 2PY3A 4FYNA 3K3IA 3PXZA 4FKGA 4YLLA 2CKOA 1QMZA 4X0MA 4IAZA 5DYJA 5ANJA 4XG7A 4TT7A 3R1SA 1SVHA 5K4JA 4D1ZA 2QQ7A 4FGRA 4A9UA 4FIGA 5KKRB 1H28A 2ZMCA 4L8MA 2GS6A 2VZ6A 3DKOA 3FI2A 4H39A 3CE3A 2JKQA 2WTVA 3RK5A 2HXLA 4BHZA 5IQGA 3G6HA 4CMUA 2BTSA 2G2IA 3HVCA 5EFQA 3ZH8A 4BCPA 2WELA 3G90X 4BDEA 3TUBA 1XH9A 1XQZA 4BGQA 2YHVA 3K54A 5DG5A 2ITUA 2P2HA 3WZDA 3QTUA 4JJRA 3IQ7A 3L9LA 1Q99A 5AP7A 3VS3A 3BEAA 2Z8CA 4FT3A 3TWJA 3UVRA 5HCZA 5M51A 3N51A 4O2PA 4E20A 1J7IA 3FV8A 4R3RA 4Z55A 4YJRA 2QNJA 3NIZA 5FBOA 4AGDA 1MRYA 2FSLX 4QNAA 2XNMA 2I0EA 2HY0A 3U6IA 3FZSA 2JC6A 2WTKB 2OXXA 4AA4A 5C01A 1P14A 3DV3A 1FINA 5FGKA 3GU4A 3MFSA 4JQ8A 4S34A 4QP1A 5TT7A 4Z7GA 4DBXA 2HZNA 3V8SA 4BI1A 4DT9A 5LVLA 4L01A 3CQEA 3OBJA 3QXOA 4DFXE 3D4QA 3PTGA 1PW2A 3RALA 5A14A 2G2HA 1JKKA 2CGVA 5FDXA 3IGGA 3NCGA 4BTKA 1KWPA 3O17A 4FT5A 2C5OA 3I81A 4O0RA 3NUAA 4FK3A 4E6DA 5L8LA 3CXWA 4QYGA 1T46A 3ZUTA 4FV3A 4CKRA 3I6WA 4QMUA 2QHNA 4O7ZA 3ZXTA 5CI6A 3QWJA 2JBPA 2W96B 4J53A 4D5KA 4DTAA 3EQHA 3REPA 5CEIA 4E93A 5D12A 5CANA 3QUEA 5BPYA 4P90A 4EH9A 3RMFA 2C1AA 2VO0A 2WQBA 2VGOA 1OL5A 4QMTA 4DITA 4CGAA 1P4FA 4FL2A 1BYGA 4NYEA 1H1SA 4F6SA 1T45A 3CQUA 5K0KA 4BI2A 3UNZA 3MV5A 4LGHA 2PULA 3NVKI 3CLYA 4G17A 4ASZA 4UZHA 5H2UA 3DU8A 3G15A 3ZMMA 3ZZEA 4DH8A 2X1NA 5IA2A 3NAXA 2W4KA 5KHXA 3UO5A 4QP8A 4C7TA 3HDNA 4MWIA 5EDQA 5ANOA 3VUTA 1PYEA 4EKLA 3UZRA 1W83A 1RJBA 3MESA 3B8RA 3R9HA 2GU8A 4RC4A 4PPBA 2O65A 4TYEA 4OTRA 3BYSA 4BDFA 4EK8A 4FT7A 3F3TA 1Q3DA 3FZOA 5HD4A 3VUDA 4WNPA 4G5PA 1XWSA 2WU7A 3H0ZA 4CYIA 2XZSA 4FZ7A 5J7BA 4EORA 2Z7RA 1P2AA 3EJ1A 4W4YA 4YZDA 3PXYA 2CKQA 3MTFA 2JD5A 4TRLA 5LWMA 4AZVA 3PE1A 5HLWA 4FTRA 2SRCA 4I24A 4NFNA 1IA8A 2C3LA 5E8ZA 4P5ZA 4YP8A 4KRDA 4CYJA 4LMNA 1PY5A 4DLJA 3FY0A 2JEDA 3FLWA 4FZDB 4MXZA 2UV2A 3PZHA 4XG2A 2OJFE 3DBQA 1Q24A 4H1MA 1FBNA 5AWMA 3MI9A 5CNOA 3SRVB 3DQWA 2VX3A 1UVRA 3R8VA 5IISA 3U55A 3V5QA 1YHSA 4BWXA 3Q4TA 4PPCA 3TJDA 2GNJA 3RKBA 3I5NA 2OGVA 5FEDA 4Z16A 4HNFA 3UO4A 1R78A 3GU6A 2PVYA 4FT9A 4D2WA 2PZPA 2PUPA 1R3CA 4QMZA 4UYNA 5EQPA 2BROA 3G51A 3I0QA 4NTTA 4D2VA 3L9MA 2C5XA 3RWPA 3C4WA 3AC8A 5D7VA 5EKNA 4KWPA 1IAHA 3NUNA 2OZAA 3LW0A 2C6OA 3MB7A 4EOJA 3UZPA 5CAOA 3ZUUA 2QG7A 3KEXA 3O71A 5IUHA 3EQRA 3WOWA 3HDMA 4M67A 1QL6A 5TKDA 2WEVA 1BI7A 4N6YA 5F4NA 5DGZA 3AC5A 4LYNA 1PMNA 5FM2A 1Y6BA 3R30A 3C0HA 3RAWA 1X8BA 2GHMA 4MXOA 4ALWA 5HU3A 4BCIA 5CI7A 2J5EA 3EN7A 4ZEGA 3ZO4A 4A9RA 2CNVA 3WARA 1KOBA 2XKFA 4WT6A 4F9BA 2YM4A 1XKKA 2P3GX 3MBLA 4C3PA 3QKLA 5IQIA 4TNBA 3GGFA 2O2UA 3IW7A 3HMIA 3WYXA 2QO7A 5M4CA 1BMKA 3D0EA 2Q83A 3G0FA 3R6XA 4ZSLA 5M44A 3DJ6A 2BHHA 4UXQA 2OXDA 1OIUA 3FYJX 2GQRA 3ERKA 3HECA 4W9WA 4MXCA 1UKHA 3P79A 4O86A 2IJMA 4EHZA 1VZOA 2YJRA 4LUEA 2UVZA 3V01A 3C5UA 3AC2A 4JI9A 3I79A 3QKMA 3HMNA 1GY3A 4DG3E 2ZV7A 4KINA 4QT1A 5EW9A 3TTIA 4YZMA 3RK9A 4J8NA 3P86A 3O50A 2QR7A 3OT3A 3T9IA 4QQJA 2XIRA 3GFEA 1CMKE 3PSBA 5C27A 3V5LA 3V5JA 3O7LB 4ZLOA 1ZYJA 3AC3A 4ZJJA 3ZOSA 4ZJVA 1R0EA 5B2MA 3TTJA 3SA0A 2WMRA 5D7AA 3JYAA 2IW9A 4FTKA 3NNXA 4IFCA 1NVQA 4F1MA 2BRGA 2PZRA 3FKOA 5F9EA 5A4EA 5CY3A 5M53A 3KGAA 3ALNA 4FV6A 1YXVA 3IW8A 5CEMA 4GJ2A 3VS6A 1E9HA 3EFLA 4FTUA 4FG9A 2UW9A 3OP5A 4QQTA 3LJ2A 5IQBA 4FG7A 3F69A 2FH9A 4YC6A 3VHKA 5IMEA 4LV8A 3PWDA 5KKRC 2JITA 3FMMA 3DB6A 3MFTA 3QTSA 4ZY4A 4YPSA 1UU3A 3KY2A 2ETRA 5G1XA 3GQLA 5HU9A 2WGJA 4J99A 4HPUE 4PL3A 4Y95A 3Q3BA 4OTQA 3WF6A 3D9VA 4KRCA 4A4OA 1CTPE 4RJ7A 2JDSA 3KVXA 5B2KA 5L3AA 2Y4IC 3AT2A 3U51A 3VUGA 4IH8A 4GKHA 4ZXTA 2Y8OA 4DF3A 2W5HA 3GP0A 4L53A 3R01A 4FEUA 4IEBA 4IAFA 3HP5A 2H96A 4PQNA 5B7VA 2R3HA 2WTIA 3NNUA 4KBKA 4AZSA 3TUCA 3MWUA 3LM5A 1PXMA 3WZEA 2VWIA 2GQGA 3D14A 4F6UA 4HZSA 3MA6A 4JRNA 3E7OA 1BI8A 5F1ZA 4GV1A 5GZ8A 5K5XA 3T9TA 4DGNA 4EH7A 1ZARA 3A7JA 2WTKC 3H10A 3AMBA 3ETAA 4HYUA 4HPTE 4RQKA 1WBSA 4B6LA 5DH3A 5IA0A 5KBQA 4BY9E 4OLIA 3U9NA 1ND4A 4E26A 3F3UA 2YCRA 2GFCA 3FMDA 4E6CA 3LCOA 4U3ZA 3MDYA 5JEBA 2ITNA 5HBEA 1YOLA 4XG6A 3UYSA 4BZDA 4EK6A 3UP7A 2PE1A 4BDDA 4BCMA 5JZJA 4CMOA 1URWA 2A27A 2NRUA 3ZSIA 1FMOE 3LJ0A 5CU4A 4ZK5A 2XK9A 4IX5A 3O2MA 4IAAA 5IMXA 1Q97A 3TJCA 3IPHA 4CKJA 4XLVA 3LCDA 4BDJA 1GIJA 2UZBA 1TQIA 3SXSA 4LL5A 3PLAE 4QP2A 2Z60A 3NS9A 3PLSA 4J97A 2ZB0A 4HVSA 3B8QA 2XRUA 4U43A 3FE3A 4ASDA 5JGBA 4RIXB 2VTNA 2W0JA 4OBPA 4I0SA 4BTJA 5K4IA 2C3KA 2WB8A 3KU2A 3P9JA 4RX8A 3FMHA 3JUHA 3BX5A 5HE3A 5HCXA 2WMTA 3I6UA 4MXYA 4NJDA 4XV1A 5BVKA 5IA1A 3QCSA 5KHWA 3KMUA 3SVVA 2WTJA 1U5QA 3OXZA 2BMCA 4FR4A 4IVAA 4LI5A 3F5PA 4IWQA 2QOBA 4FNWA 4ALUA 5AA9A 4K18A 4BHNA 2CPKE 3FMKA 3HEGA 1O9UA 1J91A 1ZZ2A 3VUMA 4ANBA 2WTCA 5D1JA 3RPVA 4EYMA 5LVOA 4QTCA 4LUDA 4GYGA 1FVTA 2FO0A 4CEGA 1MUOA 4PRJA 4AWIA 3IGOA 5AJQA 4AAAA 3PVGA 4RLKA 5CQUA 3SXRA 3P1AA 4R78A 3W2SA 3D7ZA 5AADA 4OAUC 3OCGA 2OBJA 4Y5HA 4FEWA 4O7RA 4FODA 4G3DA 1JAMA 4GL9A 4TXCA 1PXKA 2P4IA 2VU3A 4EK3A 4JG8A 1OECA 3PRFA 2R7BA 5HVKA 3DA6A 1YXSA 3S0OA 3GT8A 3QZIA 3DS6A 1ZYDA 4CZTA 4E3CA 4CTCA 4ZMFA 3RZFA 3I5ZA 4WKQA 4Y73A 2JKMA 5IA4A 1ZYSA 3QLFA 2OWBA 2XNNA 1YWRA 2E9OA 3U54A 3KK9A 4A7CA 4D0WA 3ZHPC 4AOTA 1KE5A 4I21A 4TWNA 4W4XA 3QD2B 2J90A 4YHTA 4L67A 3CKWA 1PXOA 3SRVA 2RG5A 3BBWA 4XEYA 3DOGA 4YPDA 5EHOA 1I09A 2BTRA 4PNKA 4L3JA 5H3QA 5CASA 3M1SA 3NNVA 4NSTA 4BDHA 3KN5A 4RIWB 5AR7A 3KFAA 4GJ3A 2I6LA 2ERKA 3OBGA 5C8MA 2XCKA 2ZMDA 4I93A 4MK0A 1M7NA 3NYVA 2Y6MA 4IM2A 3RBWA 4FE2A 4WRSA 3TDWA 3PFQA 4DCAA 4EI4A 2C0TA 1U54B 3C1XA 3SDJA 4I0TA 2ZDTA 4AFEA 4D9TA 3TT0A 4RPVA 4FKVA 4D0XA 1UU9A 2RFSA 3QCQA 4F0GA 3UNKA 1M2PA 2QOHA 3FUPA 5L8JA 4EOOA 4IX3A 5BVDA 3QZFA 3UQGA 4YZ9A 1KSWA 2W1GA 1KE6A 2UW6A 3ZLSA 2CJMA 3D5UA 5AM7A 5AIKA 3UOKA 3PE2A 4QMWA 2ONLA 4O7SA 5E1SA 3ZO3A 5E90A 4RWLA 2R3LA 5HESA 1BLXA 2UZLA 3AC4A 1WBTA 4DH5A 4ID7A 5IH5A 4IMYA 4KD1A 4TPTA 5L2WA 4OAVB 4Y72A 3DAKA 3OWKA 3QUDA 1ZMVA 5AX9A 2YEXA 4GFOA 4AOIA 4GT5A 2QHMA 2B7AA 2CLQA 3JVRA 2WQMA 4IWPA 2RGPA 3ZFYA 3UJGA 4FV0A 2C4GA 3RAHA 1UV5A 3NUXA 4CZUA 5KNJA 2PZIA 5DBXA 3PXQA 3QYZA 4O7WA 3A7FA 3KA0A 3I7CA 3LFCA 2Y0AA 5FTQA 3UOLA 4FV4A 4FIFA 4WBBB 3MIAA 4I5MA 4B4LA 2PE2A 2XM8A 3NUYA 4O22A 4OUCA 5CU3A 5AP2A 4L45A 3EQBA 4MHAA 4K0YA 3FDNA 5L2QA 4E7WA 5GJFA 2JLDA 4E6QA 1UNGA 2ITWA 5F94A 4H36A 2QOFA 2VTAA 3VWAA 4FKTA 3KMWA 3EFJA 1H1PA 4CXAA 3O0GA 4WUAA 3GOPA 3DTWA 5CVGA 3F7WA 1STCE 2BZKB 3MTLA 3FSKA 5AUVA 3QBNA 3AD5A 4C59A 1OKWA 5IEXA 4K1BA 2G1TA 2X81A 3VJOA 3PXFA 3LQ8A 2OIBA 3FMNA 5DEWA 5K3YA 5D11A 2OH4A 2W06A 5CT7A 5AP4A 4NZWB 3PVUA 3BELA 4AA5A 2OIQA 2ZVAA 3FZTA 2ITXA 5AUWA 3A4PA 4AUAA 4CV9A 1WBPA 3UOHA 2IPXA 3FLYA 3K5VA 3RM7A 2QOOA 4C62A 3AXWA 4RZWA 5KMOA 3LCTA 2X6DA 2VO6A 3OHTA 5E8VA 2PMOX 4FKOA 5AFVA 3DZOA 2JKOA 3QTXA 4PP9A 2DQ7X 4X7QA 1OIYA 2R3QA 5G6VA 2UW7A 3E62A 2OF2A 4U41A 1ZOGA 4C02A 3U6HA 3TM0A 4AN3A 3F3VA 4RIYB 2VX0A 3P7AA 3ANQA 4IANA 5DFPA 5IZFA 4AN2A 4E5AX 3R21A 5CEQA 5HTIA 2QU5A 4XBUA 5C4KA 2EXCX 5DI1A 4L42A 2VGPA 4MCVA 5CZIA 4JIKA 4MD8E 4IDVA 4AN9A 3O8TA 4G16A 4F7SA 3O96A 3MH3A 2C47A 5IKWA 3NMUF 3VBQA 4ZZOA 1AD5A 3C4EA 3PY1A 1UU7A 5AV0A 3QLGA 5CU2A 4D2SA 1Q4LA 5J1VA 5E91A 3TV4A 4AF3A 3DTCA 2REIA 3IECA 4RIOA 2BAQA 2Y9QA 4XBRA 3ZFMA 4BFMA 2W05A 2ERZE 4FKQA 3PZEA 3VJNA 3ZBFA 4AXAA 2OK1A 4FV8A 5E8WA 2VTOA 5AAEA 2HIWA 4QP6A 3BYOA 3K5UA 1VEBA 4QMYA 2BDFA 3CGOA 5AP1A 3HAMA 3KMMA 3Q60A 4X2KA 5FP6A 3AQVA 2IW8A 3NR9A 4ZY6A 4KS8A 3G2FA 3D5XA 3TNIA 3QD3A 4YHJA 4BTMA 3RAKA 1YHVA 2C30A 4FF8A 4QMLA 1FGIA 2BDJA 4KNBA 2JIUA 4RIXA 1OUYA 3F88A 1GZKA 2KULA 3BQRA 1XH8A 3P08A 3T3VA 5IUGA 2QOKA 4NM7A 2CKEA 3ORMA 4FIJA 5IQEA 4NCTC 4QO9A 4MKCA 2OIDA 3D2KA 2PZ5A 4MYGA 3UVPA 3VS4A 3WYYA 3ZS5A 4GT4A 5J87A 1Y6AA 2GNGA 2R3NA 3EQGA 3SW7A 4KBCA 2YDKA 3MY5A 4HCUA 4RJ6A 4MF0A 4U40A 5AP0A 4U97A 4X3FB 4YC3A 3LIJA 4MBLA 3DJ5A 4YSMA 2YIYA 1UU8A 4LGGA 5J5SA 3NX8A 4RFYA 2CCIA 4E5BA 3WZJA 2RFDA 1LEWA 2XEZA 4J71A 4CG9A 3B2TA 5IQCA 4EBWA 2HCKA 3BZ3A 3QX2A 2QOCA 2HXQA 1YQJA 2RG6A 3VBXA 3FHRA 3FLSA 4HVHA 3PPKA 2I7QA 2CHLA 4EBVA 4NWMA 3UVQA 4ACDA 4QTAA 2JFLA 3ENHA 2OLCA 4CLIA 5CAPA 4PMPA 3M11A 3MPTA 3PG1A 2AUHA 2Z7SA 4BCGA 4CT2A 5J9LA 4ACGA 5C9CA 1FQ1B 4A4LA 4EHEA 3E7VA 2BAJA 2NP8A 4ONAA 5BVNA 3FBVA 4DA5A 3R73A 3EFKA 4DBNA 5CT0A 3NCZA 3ZM4A 2UZVA 1XJDA 4FSZA 4YZCA 2RFNA 3OT8A 3R04A 4BCFA 3AGLA 4QMMA 5ACBC 3R8LA 4U8ZA 1DI8A 4ZTQA 1FMKA 4H3PA 4ZZNA 1URCA 3ZDIA 3VULA 4O82A 4E6AA 4WUNA 2IG7A 4IZ5A 3CD8A 3HKOA 4IM3A 1H01A 4ACMA 5A4TA 3ODZX 2W17A 4YZNA 5M06A 3FMJA 3FKLA 2J4ZA 3GC7A 3NEWA 3C7QA 1E1XA 3AT3A 2IZUA 3FZ1A 5FRIA 3ZLYA 4I3ZA 5HVJA 1OKYA 3BWJA 2JAVA 3BPRA 3RHKA 4DEHA 4DYMA 3F6XA 4YNEA 3V8TA 3TZ7A 1OL1A 1QPCA 3DKGA 3V5WA 3FAAA 3NGAA 4DEDA 5EM5A 3B2WA 4BDAA 3TNWA 1ERKA 5BYYA 4QP9A 5IH6A 4AE9A 4XCUA 5AV1A 3GXLA 1IG1A 4G6NA 3UOJA 2C6KA 2GPHA 2J0LA 3GB2A 4ZSEA 3D15A 4BWPA 3VS5A 4OTPA 4Y46A 2BHEA 3QQFA 3G6GA 1MP8A 3QD0A 4H1JA 5EKOA 5ETFA 2X2MA 5HG8A 4RWJA 3CSVA 1KE8A 4X2FA 5ETIA 5I3OA 4AW2A 3V5PA 4QOXA 4Y83A 4C2WA 4F1OA 2WFYA 2Y4IB 4ACHA 3PRIA 2QG5A 5KMLA 4G3EA 4YJVA 5EI2A 1V1KA 3TIYA 3NLBA 3UIUA 3CTHA 2XP2A 1ZY4A 4FNYA 3AG9A 3UIMA 2ITVA 4HZRA 4H3QA 2JBOA 1CKJA 3QTWA 4TN6A 3UIBA 3UO6A 3PSCA 3ORLA 3W2QA 2JFMA 5ACKA 2XNPA 3TV6A 4KA3A 2P33A 5AUUA 2C6LA 3ZLXA 5AIRA 1M2RA 3F2NA 4O21A 3ACKA 5BVEA 4IFGA 4RVTA 4X6QC 1IRKA 2HAKA 4O38A 2ZB1A 3OWJA 2XNBA 2ITYA 3IS5A 4QMOA 4UB7A 3VBYA 3Q52A 2E9VA 3DNDA 4U79A 3VN9A 4JVGA 4W4WA 2QOIA 4ANSA 1F0QA 2NNWB 2F7ZE 3KXGA 3LMGA 3AMAA 4GFGA 4R77A 4J98A 4U3YA 2UVYA 2IZSA 4FSUA 4IVBA 3CPCA 4XP3A 1Q5KA 3FXZA 4F7JA 5DLSA 2EXMA 5LMAA 1O6KA 3OW4A 5EM7A 3FJQE 2VTTA 3EN4A 2PE0A 4R1YA 4BKZA 5EH0A 2ESMA 3ULZA 2WMUA 3AOXA 4MNFA 4D55A 2PZYA 4RVKA 3RCJA 3RWQA 5AR3A 4MBIA 1SVEA 3VRYA 4E5WA 2X7GA 4QMNA 5HNIX 5J5TA 4G3CA 3CEKA 4N0SA 5AAFA 4G2FA 4LMUA 3R7UA 4GCJA 2E9PA 1WVYA 4EUUA 3Q9YA 1JLUE 2AYPA 2ACXA 1Q41A 1DAYA 2R3KA 3F66A 3KXZA 3TKHA 3K3JA 4CKIA 1NY3A 5JRQA 3CIKA 3PA3A 3PJ3A 3EH9A 3U9CA 2BZIB 1J7UA 5E8XA 5FXSA 2WMSA 3G9LX 3KRLA 4PDYA 4JBVA 3HV6A 1FVVA 3F5XA 3ORTA 2XK6A 4I5PA 2CGWA 2V62A 3BI6A 3FQSA 4H05A 5E1EA 3FY2A 5I9VA 3LZBA 3SOAA 2YIRA 1M52A 4ZP5A 2G15A 4M68A 3LFFA 3I4BA 1HCKA 4R3PA 3Q4ZA 4YO6A 5CZHA 4G3FA 5E8SA 4BCKA 4D1SA 3PPJA 3IW4A 4DFZE 5AR5A 3E3BX 3L8SA 4TYIA 3NYXA 2J51A 4IW0A 4QP7A 5L6OA 4PV0A 5J9ZA 3ET7A 1HCLA 2LGCA 4S32A 4O6LA 4GG5A 3CR0A 3GFWA 1ATPE 4FTIA 3TNHA 3GC0A 4APPA 3Q6WA 3COHA 3LXLA 1AGWA 2IWIA 3CQWA 3WF7A 2PUIA 2WQOA 5A6NA 3OFMA 4HW7A 3HRFA 4GG7A 1PXNA 4TWCA 4NIFB 4PL5A 3ZCLA 3V6SA 3MH0A 3KRXA 4L00A 5EYMA 1PMEA 3FPQA 5EM8A 4EKKA 3KXMA 3W16A 4YTIA 1W7HA 4UN0C 4TY1A 3QYWA 4EHVA 2OF4A 2R3IA 4C61A 4FA2A 1OKVA 2CMWA 5HOAA 3NW7A 4KAOA 5AEPA 2V5QA 4E1ZA 3BYUA 2C3IB 3W55A 3H0YA 4U7ZA 5DR6A 5T68A 1W84A 4AX8A 2QONA 3R02A 4RSSA 2RSVA 4IC7A 4JR7A 3QQKA 3LFAA 3WF9A 3LHJA 1ZLTA 4WD5A 3WI6A 2BZJA 2QODA 1PHKA 4U81A 3A8WA 2JDTA 4X21A 5FM3A 5KMIA 5LVNA 4L7SA 2FGIA 3H9OA 3CBLA 2WO6A 1ZRZA 2W1DA 4D4VA 1JWHA 1UNHA 4RVLA 4KKHA 4J96A 4FSQA 4FNXA 4JBQA 1OUKA 4X3FC 5CSWA 1L8TA 5CLPA 2B0QA 3CC6A 2X2LA 3Q53A 4YJPA 3QRTA 5IEYA 5HG5A 4O84A 5JH6A 3QGYA 2VWWA 1ZWSA 3HA8A 3QHWA 2QCSA 3DDQA 3Q4UA 4FYOA 3QC9A 4LV5A 4UY9A 3JPVA 4WHZA 2WTDA 3W2OA 3ODYX 4MD7E 1SMHA 5HLNA 5IG1A 4FIIA 2B9HA 4HCTA 5EK7A 3KB7A 5LQFA 4AA0A 2WMWA 4BGGA 3GUBA 1PMUA 4YC8A 1SNUA 3OWPA 4BGHA 5HTBA 3HMMA 3LCSA 2W9ZB 4DC2A 2ITOA 5AMNA 4O0VA 4YJNA 5T3QA 4RGJA 5EW8A 3W2CA 5EG3A 5CF8A 2QI8A 3A62A 2Q0BA 4N4SA 4KIOA 4F09A 4BI0A 4U42A 3A7IA 4ARKA 2DYLA 1H08A 1OITA 4ZZMA 2C68A 3QZHA 2EB2A 4B8MA 5LARA 4I1ZA 2YACA 2GTNA 2PMNX 5FLFA 4ZAUA 4M7IA 4KS7A 4FV7A 1IEPA 2J0JA 3EZVA 4C34A 5A4LA 4EUTA 3HNGA 2GHLA 4KB8A 3QHRA 4QQCA 3UQCA 4CVAA 3PXKA 2R3RA 3QKKA 2PUUA 4W8DA 5E8YA 4RFZA 5HICA 2V22A 1MQBA 2R2PA 3Q5IA 4FTOA 4U44A 3Q2JA 3SV0A 4XUFA 3E92A 3MVJA 4USEA 2XUUA 4XLIA 3U6JA 5EQEA 4EWHA 4ZSJA 4PF4A 4JOAA 3RPYA 3PUPA 4MX9A 2GFSA 2PHKA 4QMXA 2WU6A 2IO6A 2OJIA 3MY0A 3BHTA 2XKEA 3PVWA 4AZEA 4MF1A 2JDOA 1BKXA 5DIAA 1CM8A 4G9RA 5GHVA 3F82A 4FTNA 3QALE 4YU2A 5JMSA 4CQGA 2OFVA 1YOMA 3BGQA 4DFLA 2ETMA 2ZV9A 4ANOA 4CRSA 1UA2A 5CEOA 4CFMA 4BCHA 2HZ4A 3NRMA 3BHYA 5HKMA 4BIDA 3ZO2A 2B9FA 2C6IA 3BEGA 3DT1A 3D5VA 4FKRA 4QP3A 1JSUA 3BLRA 4S2ZA 4EC9A 4F9YA 2PWLA 1REJA 5K9IA 4Y8DA 4JAJA 3SG8A 4OBOA 4EOPA 4EK4A 1B39A 2H34A 3DPKA 5F95A 3VBWA 3W33A 3PWYA 3AC1A 3ZONA 4ZSGA 3AMYA 1NVRA 3EOCA 4FNZA 4EOSA 1WVWA 1V0BA 4CCBA 4PX6A 1YDTE 4LFIA 4V01A 3HA6A 3TIZA 3C4ZA 3HV3A 1LUFA 4AW0A 4FTCA 3ALOA 3FQHA 4GMYA 4O0XA 3A7GA 4RX5A 4JX7A 4MAOA 3Q6UA 5C8KA 3OS3A 3ZRKA 3ZUVA 4BCOA 2YAKA 4ANQA 5IEVA 3PIYA 4R7BA 4DG0E 4NJ3A 5TR6A 2W1HA 1ZMUA 1J1CA 3POOA 3TZ9A 2OFUA 4IACA 4O0SA 3KL8A 2VRXA 2Y4PA 2YFXA 2OICA 4J7BA 4WO5A 4EQCA 1BL7A 3C4XA 4GUBA 3GC9A 2R5TA 4ALVA 1APME 3HAVA 3L8XA 2YM3A 4L43A 3TEIA 1U4DA 2EB3A 4A06A 3JS2A 5ANDA 4L3LA 2C6EA 2W1FA 2B9IA 2HZIA 1KV1A 3HL7A 5FG8A 5AUTA 5LWNA 4M69B 1OVEA 4G5JA 3A8XA 2WMVA 5AM6A 3EMGA 4I6HA 4V0GB 3OEZA 3D7TB 3BCEA 4RX7A 2XIXA 3FI3A 3K2LA 3M42A 1Q8YA 1REKA 2C5NA 3LXPA 3LKMA 3UODA 4EZ7A 3RZBA 1R0PA 3ZSHA 5IA5A 3C50A 2J7TA 5C26A 4MQ2A 2V7OA 2UZWE 3CTJA 3I0OA 2PVLA 5E7RA 2YWVA 4BZOA 3OXTA 4AW1A 2PL0A 3SX9A 4CT1A 3JVSA 2NO3A 4OBQA 3QUPA 1BX6A 4MVFA 5CAUA 2YCSA 4OTIA 4DINA 2I40A 3RJCA 4YNOA 4ACCA 3LXKA 4Q9SA 2P55A 3C4FA 4JT3A 4L6QA 2XA4A 3NAYA 3UNJA 1Q8UA 3GI3A 3R0TA 3FYKX 4NIFA 5E8TA 4C38A 4UYAA 4CG8A 3Q2MA 2EUFB 4Q9ZA 1XBCA 1ZY5A 2YABA 3MH1A 4AE6A 1H1QA 2PVMA 4BN1A 5EOBA 2QLUA 3QTRA 3FXWA 2BALA 3FPMA 3GOKA 5AV3A 3COIA 4RT7A 4BKJA 2LAVA 4FKWA 4I6QA 4YTHA 3A4OX 4X3JA 2IN6A 4QMPA 3V8WA 3OCBA 5L6PA 2GSFA 3KKVA 4WIHA 3THBA 4AP7A 2NRYA 1WCCA 4M15A 3ULIA 1SYKA 5B0XA 4FTJA 1W82A 2A1AB 4PTGA 5CYIA 4JDKA 1Q8WA 4JIAA 2WQNA 3H3CA 1P4OA 4IM0A 4O27B 4OR5A 3H30A 4X2GA 5BMMA 5CAQA 2R3FA 4YMJA 5JFSA 4WG4A 1YVJA 4LQMA 3GU8A 5HX8A 1F5QA 2C6DA 2R0IA 2R0UA 3GBZA 3R7GA 4FKSA 3W1FA 2XS0A 2VTSA 3LMIA 4R1VA 4F0IA 2FSMX 4XV3A 1IA9A 4FL1A 1XO2B 1ZXEA 2UW0A 3FLQA 1OGUA 4FC0A 1OI9A 4LOOA 1G3NA 4QNYA 3CPBA 4DTKA 1PXIA 2PVKA 2WKMA 2XRWA 5DVRA 3W2RA 3S1HA 3CGFA 4GIIA 2J0IA 3TL8A 3I7BA 2BZHB 3ELJA 4OGRA 4A9YA 2F4JA 5IQFA 4EOMA 2AC5A 1LR4A 1QPEA 2ZM3A 3DLZA 4RA4A 4KABA 3WBLA 2X4ZA 4IIRA 4R5SA 3TZMA 4UWBA 4FEQA 2ZDUA 3UG1A 1UWHA 2E2BA 5I9YA 4R3CA 2JKKA 4H58A 4AT5A 4PL4A 4E4XA 2ETKA 1M14A 1I44A 2CGUA 4EZ3A 4FBXA 3NYNA 1YXUA 3S4QA 3ATSA 3PJ1A 4II5A 4EEVA 4BDKA 2BPMA 1FGKA 2UZEA 3GCSA 3PVBA 3PP1A 3P0MA 2G01A 2F9GA 4JAIA 4BBEA 3DAEA 3QRKA 3EIDA 4QRCA 2UZTA 2QOLA 4M84A 1JKLA 4D28A 3TXOA 5CXHA 4DE4A 3DAJA 1J1BA 1OIRA 1ZAOA 2F7EE 2R3GA 4L7FA 3R7OA 4I20A 2PK9A 5M4IA 3MJ2A 3P78A 5B2LA 4CCUA 5JGAA 5AV2A 3DZQA 5HVYA 4AT3A 1CDKA 1OMWA 4DFNA 5DNRA 4FEXA 2B9JA 2XJ2A 4JDJA 3LE6A 2R3OA 5ETCA 2VWXA 4HOKA 3QQLA 2H6DA 2VTPA 4C37A 5BVFA 3MS9A 1H1RA 2VO3A 3MGYA 2DWBA 4M66A 4XG9A 5H8EA 2UZUE 5AUXA 2B53A 1DI9A 2XVDA 4PTCA 5FXRA 5I4NA 1RE8A 5FUTA 4U45A 4G3GA 4RJ3A 5LOHA 1TKIA 4ZLZA 3S00A 4GSBA 4M12A 3V51A 3HP2A 4QTBA 4AZFA 3EQDA 3IW5A 1VYZA 3TACA 5DR9A 1RDQE 1JVPP 2XYUA 3QRJA 4DT8A 2YDIA 2WMXA 3BU6A 3ZRMA 4N70A 1CSNA 4W9XA 4DLIA 5AAGA 3DKCA 3MA3A 2W5AA 3EB0A 1TQPA 2Q0NA 4CFXA 4O2ZA 2BUJA 4IB1A 1NW1A 3E87A 5GNKA 5IH4A 1FOTA 1WBVA 3A60A 3VS7A 1GZNA 1YWVA 3ZEWA 4EQMA 4ITJA 4F9AA 1H07A 3HUBA 3P23A 3F7ZA 2PPQA 4EZ5A 5BUEA 3R22A 3WZKA 4RBLA 1JKTA 1W0XC 3OOMA 2B52A 2XIYA 1YKRA 2ZM1A 3GU5A 2QO9A 4BRXA 5EQYA 3FZRA 3DBEA 3ORKA 4FV2A 4MBJA 3ATTA 2CGXA 3G5DA 4ZTSA 5HZNA 4EK5A 5JK3A 2JGZA 3UDBA 4FIEA 3I1AA 3RP9A 5BUIA 4F7LA 3R7VA 5KX8A 4ZS4A 3SD0A 4I6FA 1U59A 1K2PA 1WAKA 4NUSA 1NA7A 5AUYA 4C4HA 1H0VA 2WMQA 3RNYA 4FZ6A 3VS2A 4M97A 3LFDA 3O51A 4JDHA 3MB6A 4LOPA 3NNWA 5KMNA 1CKPA 5CENA 5FDPA 3BGZA 4YJQA 4YBJA 3SW4A 1OL6A 4J95A 2C69A 4BWKA 4E4LA 3BKBA 1ZOEA 3IO7A 2YJSA 5KZIA 4AFJA 3OUNB 4EL9A 5A46A 3VQHA 4FSMA 2IZRA 4G1WA 4ZTLA 1E1VA 2QD9A 1JQHA 1Y8YA 4XS2A 5HORA 3EKNA 4F9WA 2IVTA 2RL5A 2XIZA 3GCVA 3GVUA 3OVVA 3MIYA 3E93A 3MJ1A 3ZO1A 1H1WA 3DK7A 3OC1A 3OWLA 4GUEA 4FV1A 4F7NA 1GNGA 4CD0A 3S95A 3FI4A 2VX1A 4UWCA 5DPVA 3ANRA 5KMJA 2ITQA 3BGPA 3HV5A 1JOWB 5DE2A 5C1QB 3G0EA 5D41A 4CFFA 4D2PA 3OCSA 4TWOA 3PY3A 4ITIA 4NCTA 4OTGA 3DXPA 3U4UA 4PMMA 3FC1X 4DEAA 4HVIA 3T3UA 2WD1A 1A9UA 4M69A 4BC6A 2FA2A 4CTBA 2PMIA 5CVFA 4MWHA 3GU7A 1GJOA 3V6RA 2WPAA 2Z2WA 5KBRA 2P2IA 3D7TA 3QCXA 1WBOA 4MH7A 5KMMA 3UZTA 3WIKA 1W98A 2VTIA 4LM5A 4JX3A 3AD4A 3R7EA 4DGMA 4FGBA 2YITA 4ZTNA 3LFEA 4DHFA 4O81A 4DGGA 4JQEA 2JDVA 4FVQA 3E8CA 3VNTA 4EOLA 3EHAA 3CKXA 4ZTHA 3BE2A 2UW3A 3ZC5A 4LRJA 3TNPC 3VC4A 4E4MA 2XEYA 3G33A 4W8EA 2BAKA 4WG3A 3BWFA 3DGKA 3JXWA 4OT6A 4GW8A 2CSNA 3DFAA 4FTQA 3UTOA 2WTWA 2B1PA 1DS5A 3CD3A 5A6OA 5EDRA 3H9RA 1S9IA 4IHPA 3E88A 4JDIA 4O0UA 2GMXA 3DK3A 5M55A 3SQQA 2BCJA 4KIQA 2XKDA 4EHGA 4NW5A 2X7FA 2IVSA 1F3MC 1GAGA 2VUWA 2CDZA 2WMBA 4DFUA 2OW3A 4UV0A 4K9YA 1GZ8A 5AUZA 4N57A 2JIIA 2QKWB 4ITHA 3R1YA 4XRLA 3UE4A 5GJGA 1R39A 4WSYA 3OG7A 2BRMA 4UMRA 3HRCA 3TKUA 5H9BA 3RPSA 2ITTA 4I23A 4QPMA 3KN6A 1NXKA 3UPZA 2RKUA 4B7TA 2FUMA 4XRJA 4RIWA 4O7YA 3KF4A 4P5QA 3UC3A 3E5AA 4JXFA 1RW8A 3OTVA 4U9AA 5JKGA 1Y57A 4HGTA 3R2YA 4IB0A 4XV2A 5HIEA 3EQPA 2OG8A 3NZ0A 3DCVA 4M8TA 1JBPE 1OL2A 2Z7LA 4XYFA 5DEYA 1U54A 2ZYBA 4H3BA 4R7IA 4CMTA 2WMAA 4IJ9A 5FTGA 3RPOA 2G9XA 5KMKA 4QMVA 2GNFA 2YM7A 3BU3A 1OPJA 2GNHA 2HZ0A 4FIHA 4LRMA 5KCVA 3POZA 4P7EA 1PXLA 4FKIA 3OROA 5L4QA 2PYWA 4I5HA 3RNIA 3GCPA 4QD6A 5ICPA 3LJ1A 1O6YA 5BVWA 5LVMA 2C5YA 4OTHA 4PDPA 5BYLA 4FTAA 4XG4A 3ZU7A 4A07A 2J0KA 4X2JA 5EI8A 4L46A 1QCFA 3Q32A 5M08A 5J1WA 1GOLA 2HELA 2GCDA 2FSTX 4UMTA 1UWJA 3ZEPA 3R1NA 4QTDA 3GC8A 5L2TA 3ZM9A 1PYXA 3QRIA 2VNWA 3RTPA 4QYFA 4C3FA 4E73A 4LG4A 4HYHA 1XH6A 3ZBXA 5DT0A 3FI8A 3PP0A 5A4CA 2O5KA 4O1PA 2RF9A 4TYHB 1G8AA 4GVJA 1O6LA 1TQMA 3R28A 3NDMA 1M2QA 4CFNA 2BFXA 4I4FA 4QQ5A 4RC3A 4IADA 4NFMA 2UW8A 4YSJA 2C6TA 2UW4A 3P5KA 3PG3A 1VR2A 3C4CA 3OCTA 4ENYA 1H0WA 3BU5A 2WNTA 2CN5A 3PSDA 1PF8A 4E8AA 3VS1A 1SVGA 3BYVA 4YO4A 4JL9A 4J52A 4NKAA 5DN3A 1NVSA 5HEZA 3R9DA 3RVGA 5BMSA 5KE0A 4AACA 5CF6A 2VN9A 3SC1A 3ORZA 2QLQA 4IZYA 4FMQA 3PPZA 4XOZA 3W8LA 4BIEA 5H8BA 2VO7A 4JS8A 3F3WA 4RLLA 4IWOA 4BCQA 3BHHA 4NEUA 3ROYA 4F63A 4CRLA 3OD6X 2FSOX 3R1QA 1V0PA 2YZLA 3F5GA 5FXQA 4D2TA 3KRWA 3QQJA 3GEQA 3EN5A 5CF4A 3VAPA 2Z7QA 1GIHA 4CFWA 2WIHA 4XG3A 1WBNA 3QF9A 3DDPA 5CWZA 3MFRA 1OPKA 3R71A 3VRZA 4DFBA 2GHGA 3R63A 4I6BA 2GNIA 2XB7A 5CX9A 2PVJA 4RFMA 4O91A 4TYGA 3WE8A 2O64A 2V55A 2VAGA 3VUKA 2VWUA 3SXFA 3F5UA 4FSRA 3UBDA 5M09A 3KRJA 1WBWA 3D2IA 5FTOA 3FXXA 3OEFX 4F65A 3BV3A 4RZVA 1SZMA 2PUNA 1FPUA 4FK6A 5IU2A 2YLFA 4FV9A 4TYJA 4K11A 3U8WA 4KUJA 5HO7A 3BBTB 5CSVA 4YJUA 2O3PA 4RIYA 4UMQA 2HW7A 1WVXA 2B4SB 3O7LD 4DH7A 4HYIA 2QC6A 4IC8A 5EI6A 3TCPA 3KRRA 4HGLA 4YBKA 4AGCA 3LAUA 4L44A 5I9ZA 3ORPA 3O8PA 3R00A 4FX3A 4OTDA 4EH2A 1B38A 3TZ8A 4BDCA 4PDSA 3QFVA 3NWWA 4ZLYA 3CJFA 4OT5A 4NK9A 3A61A 2VD5A 2YAAA 4PPAA 1YI3A 4HVDA 2X2KA 5J79A 2EU9A 4EH6A 2UW5A 1BUHA 4XX9A 5E92A 2JAMA 2QKRA 5FWKK 2B54A 5CEKA 3VF8A 4ZJIA 4ANMA 2ZJWA 3VUIA 4RMZA 4S31A 5GZ9A 3R9NA 4HVGA 1QPDA 4TWPA 4QYHA 5HBHA 3Q9ZA 2IW6A 1RQQA 4KSPA 3UG2A 5IF1A 1Z9XA 3COMA 2J50A 1SNXA 5HIDA 5EHYA 4N6ZA 3FEGA 4FEVA 1W8CA 3JY0A 2XF0A 3JY9A 2X39A 3COKA 1YRPA 3LOKA 3IDCA 4KIKB 2OJGA 3WIGA 4D4RA 1YXTA 4FUYA 4C36A 3LVPA 2W4JA 5I9UA 1FVRA 3W8QA 5CVHA 4CQEA 5CU0A 2C3JA 2HY81 5J8IA 4DH3A 4O7VA 3NVMB 5DA3A 3HZTA 2FYSA 4PWNA 4C35A 2V7AA 3GQIA 4NM5A 3VVHA 3MSSA 4J8MA 1YHWA 4EWQA 4Q2AA 4UMPA 4FSWA 5E8UA 1PRYA 3QAME 4ASXA 5JGDA 2XMYA 5HI2A 4QTEA 5FP5A 4AU8A 4F64A 3LFBA 3QTQA 4FL3A 2YA9A 2XYNA 5DRDA 5A9UA 2Y6OA 3OW3A 2XNOA 4G9CA 5IDNA 5LXMA 4DFYA 4IE9A 4PMTA 4JG7A 4RX9A 4RC2A 2JDRA 3DXQA
chains in the Genus database with same CATH superfamily
2B55A 5J7HA 4X3FA 4K2RA 2J6MA 5IPJA 2R4BA 4WA9A 5LMBA 4HGEA 4YTCA 3ITZA 5CS6A 2R9SA 4UX9A 5J95A 3QX4A 1WFCA 4ANNA 1JNKA 2XIKA 3DBCA 3TV7A 2YWPA 4AZTA 3LCKA 4EH5A 4FICA 2C0OA 5KZ0A 5HHWA 4FSYA 4A9TA 3LPBA 4XP0A 4PNIA 2A19B 4C4FA 5TE0A 4F6WA 2X0GA 5BQ0A 3EWHA 5IQAA 4K77A 3HMPA 5FEQA 2HYYA 2R64A 4NU1A 4CFUA 5T6KA 1XH7A 4MNEB 5EYKA 3JR1A 2A0CX 3IDBA 3NUSA 3NW6A 5CSXA 5DHJA 1UKIA 3MPMA 2EXEA 5DT4A 5EDPA 4IB5A 3QWKA 2YISA 4GK4A 3EZRA 4RJ8A 3GCUA 4USFA 4FOCA 3BHVA 3TNQB 5DOSA 5TO8A 3E8DA 5ITAA 3LXNA 4UEUA 4L52A 4TL0A 4KSQA 3WZUA 4NH1A 2XH5A 1J3HA 1ZYCA 4X2NA 5JFWA 2GDOA 2YLEA 1YI6A 2CN8A 3ORIA 1A06A 2XK4A 3SLSA 2VTQA 3KCFA 3R2BA 2F7XE 3EL7A 4DG2E 5DMZA 4YTFA 3N4TA 4RRVA 3UMWA 2BRBA 2R3PA 3IOPA 3VIDA 3BYMA 4ZOGA 3O8UA 4DTBA 3C0IA 3II5A 2C0IA 2VTMA 1IR3A 4GU9A 4L3PA 3Q9WA 4GK3A 3CY3A 5CALA 4GVAA 1M7QA 4R5YA 4U80A 4MXXA 4ANLA 5BYZA 2WIPA 4D4SA 2YM6A 3QQGA 4F99A 4GT3A 3KXHA 5I9XA 3CTQA 2YCFA 4XMOA 2GQSA 3D5WA 4YLJA 4GU6A 5ANEA 1TVOA 2VTHA 4AT4A 4JLCA 3RINA 3PJ8A 4EONA 3FSFA 5EM6A 3LLAA 5BVOA 2IVUA 2C5VA 2Y7JA 3DNEA 3AD6A 3L9PA 4U0IA 1YI4A 3O23A 4RWIA 3NUPA 5A4QA 4ZMEA 3DFCB 3S2PA 4O7LA 1XBBA 4I5CA 4BKYA 1H8FA 4O1OA 2WHBA 3CY2A 4C2VA 4HCVA 3QA0A 4OTFA 5I3RA 1G8SA 3W0SA 4TTHB 4BDIA 4ORKA 4YLKA 1XH4A 3WE4A 1DM2A 2OI4X 4C4IA 4AOJA 4DEGA 1ZMWA 2UZNA 2W4OA 3MVMA 3W32A 5DT3A 4TZRA 5HE0A 4FI1A 4JR3A 2VTLA 2YM5A 4M13A 4JNWA 4Q5EA 4ERKA 5CAVA 3C5IA 2R3MA 3MVHA 4UWYA 1Q62A 4C33A 3QA8A 4D1XA 2AQXA 4D4YA 2W1ZA 3VF9A 4EJNA 3FZPA 1DAWA 4TYHA 5HGIA 2NPQA 4FTLA 4HNIA 3EYHA 3DJ7A 3IG7A 2WAJA 5LJJA 3ORXA 4DEIA 2P0CA 2ZM4A 3R8MA 3KF7A 3PXRA 3QXPA 4ZTRA 5JRSA 4Z3VA 3QL8A 2HW6A 5C03A 3UIXA 4PUZA 5CU6A 4EJ7A 1YXXA 5HBJA 4C58A 4XOYA 3HLLA 3ZTXA 4O96A 2Z02A 5ANGA 5HLPA 4YR8A 3VW8A 1XH5A 5EHLA 4J1RA 5IDPA 3N4UA 4D5HA 4GYIA 3V04A 1H00A 1HOWA 3OUKA 4EH8A 3EN6A 2E9NA 2OO8X 2A98A 2VWZA 5D10A 5A54A 4BIBA 4KIPA 1U5RA 4FOBA 1K3AA 5GZAA 4FTMA 3CCNA 4FG8A 4GFMA 4M3QA 4C57A 3TI1A 5HO8A 4DEEA 3ID6C 5L6WL 4UXLA 3ML1A 4NM0A 2XAMA 5IQHA 3LFNA 3RCDA 5FBNC 4L9IA 3BHUA 2F57A 3GENA 2R7IA 2BRHA 5HCYA 5HNBA 1PXPA 3UMXA 4B99A 5GJDA 5L2SA 4E4NA 2OSCA 4R6VA 5DWRA 1YW2A 3E64A 2GS2A 2I0VA 3OZ6A 1PKGA 4IZAA 5AV4A 3KIOC 1Q8ZA 2CKPA 4FZAB 2XCHA 5HD7A 4HGSA 4FKJA 4V05A 1Y8GA 2UUEA 4IWDA 3R7YA 2XKCA 2HOGA 2VWYA 4V04A 3RHXA 1NT2A 4I94A 4F70A 5CEPA 3FLNC 3I60A 4BDBA 4FKLA 1VJYA 4JBOA 5EYCA 4BVUA 2YERA 5EW3A 4YJSA 3PJCA 3SGCA 1B6CB 4C4JA 5CF5A 2ZOQA 2ITPA 3L9NA 3M2WA 2OJ9A 3MFUA 5HG9A 4BYJA 5M56A 3Q5ZA 5HE1A 4AXEA 1H25A 4BR3A 5AP3A 1R1WA 4DDIA 3DBDA 4BTFA 4IVDA 4XP2A 5K5NA 1LEZA 4APCA 2WZJA 1OZ1A 4BL1A 2BIYA 2FVDA 4UBAA 4DAWA 1ZZLA 4MXAA 4YHFA 3E3PA 4QPSA 4B9DA 2BILB 1OB3A 3L8VA 2BRNA 5ANKA 3U87A 1CKIA 4WSQA 4QMQA 3TUDA 3VUHA 2IF8A 4G6LA 4F78A 2PVFA 2RIOA 4ASEA 4P2KA 3RPRA 5LCJA 3FMEA 4M14A 2W99B 4F1TA 4PP7A 1XBAA 4CFVA 5ETAA 4FSNA 3ROCA 4S30A 2WOTA 5AX3A 2YZAA 2YDJA 3TN8A 2HK5A 3SKCA 2KTYA 2X9FA 2VTRA 4F08A 4KIKA 1UNLA 4LRKA 5LVPA 3Q96A 2H8HA 3KVWA 3QD4A 5M07A 4BDGA 4IJPA 4C8BA 3R83A 4X6RA 3PY0A 2F2CB 4FJVA 2QU6A 3R9RA 2IVVA 3MN3A 3R8PA 5KO1A 3HV4A 4GS6A 3F2RA 3Q9XA 3RGFA 2PVNA 3W0MA 4QPAA 5C8NA 1MRVA 3E8EA 1H27A 3N9XA 4JBPA 1G8JA 3ZLWA 5BUJA 4I0RA 1GZOA 3U4WA 4O7TA 3IK3A 3VO3A 4AW5A 4QYEA 3R9OA 4AGUA 2UZDA 3HMOA 4XNEA 3KULB 3V5TA 4W4VA 3A99A 5CQWA 2F2UA 4RVMA 5AR4A 4DN5A 4F4PA 1Q61A 2BKZA 3CP9A 5L2IA 4MEDA 3F61A 4M0ZA 4YJOA 4IAYA 2O0UA 3QC4A 4Z9LA 5J9YA 1PJKA 3KC3A 4CZYB 4CSVA 5HO6A 3HUCA 2ITZA 3SG9A 1QPJA 4BZNA 4D9UA 3FKNA 5F20A 3TDVA 5BNJA 2W5BA 3R8UA 3W18A 3W0NA 3C0GA 4B0GA 4YJTA 3IONA 1SM2A 3W0OA 3PJ2A 2BDWA 2IZTA 4GH2A 1KUTA 5CTPA 2QVSE 3Q4CA 2PU8A 4MNEA 2EVAA 4ZY5A 3DKFA 4QP4A 3IKAA 4FSTA 4UMUA 2I0HA 1Q3WA 4FV5A 5JFVA 2E9UA 3L1SA 4I41A 2WEIA 4WNOA 5JT2A 1PKDA 2I1MA 5GIOE 2GTMA 2PTKA 4TW9A 4IB3A 3LQ5A 5TF9A 1H24A 1K9AA 5H8GA 4BF2A 4FKUA 1KE7A 5CXZA 3CJGA 4IBMA 3VBVA 4C3RA 2XNGA 3FLZA 3QCYA 1BL6A 2DS1A 3ZXZA 3OMVA 4O0TA 3BLHA 4C4EA 1G5SA 5JQ8A 2X6EA 4S33A 4O7NA 5JQ5A 2W9FB 2YM8A 4EOKA 2PSQA 3FQEA 4IAIA 4DCEA 1A48A 2VNYA 4NT4A 3WF5A 3OF0A 2RFEA 3C9WA 4AGWA 3ZSGA 3BIZA 4U5JA 3ZRLA 4C0TA 3FWQA 3TKIA 4RG0A 4XH6A 1JKSA 3DK6A 3HRBA 1KV2A 4UZDA 3FMLA 1OPLA 2CLXA 3KXNA 4KBAA 4GRBA 2ONLC 3C13A 3NW5A 3MH2A 2XM9A 3FC2A 3QTZA 3NSZA 2R3JA 5I0BA 3P4KA 2X8DA 3LFQA 3P7CA 5AR2A 1Q8TA 4IQ6A 3UPXA 4BBMA 3BQCA 4BCNA 2CNUA 5CNNA 2BKKA 3SAYA 2C1BA 3AT4A 4IXPA 2WXVA 2YIQA 4IZ7A 1Z5MA 4EOQA 2YCQA 4I22A 4K6ZA 1ZYLA 4Q5HA 3LLTA 4MQ1A 3TG1A 3E63A 3D94A 3FL5A 3KREA 2J5FA 4YURA 4YZBA 1KE9A 4O0YA 4AS0A 2O63A 4IVCA 2XJ0A 5BX0A 3AGMA 3SOCA 4BBFA 3EN9A 1Z57A 3OXIA 4ENXA 1IAJA 1OIQA 2XNEA 2V0DA 3NPCA 3W2PA 4NW6A 5FD2A 5I9WA 4ZS0A 1XR1A 5KUPA 2OJJA 2W1EA 3UQFA 1OL7A 3PFYA 2BIKB 2GS7A 3VBTA 3ZYAA 1J7LA 3ACJA 3G9NA 5E9EA 3NIEA 4ZSAA 2CCHA 3A2CA 3PA5A 2OKRA 3T8OA 3ZZWA 3LM0A 3PYYA 3W10A 4XV9A 2XALA 4OTWA 5AP5A 5IUIA 2BR1A 4R7HA 5HIBA 1AQ1A 3RM6A 4DGOA 5JFXA 5M4UA 1KOAA 3GNIB 3QQHA 4B8LA 3ORNA 4XG8A 2X0PA 4IX4A 3MW1A 2HWOA 4CNHA 3OTUA 2GNLA 4P4CA 5AP6A 3DY7A 4FTTA 5CSPA 5FEEA 3RI1A 5EOLA 2PMLX 3OOGA 3OY1A 4GIHA 3ENMA 4NKSA 4D58A 3ZC6A 3DB8A 1ZOHA 2X7OA 3QQUA 4BB4A 3L8PA 3UC4A 2QOQA 5FQDC 3LMHA 2JIVA 4QYYA 4BCJA 3BE9A 5IA3A 4EYJA 5EYDA 4M0YA 4IDTA 3NUUA 5HNGA 3UP2A 4BICA 3BV2A 3LFSA 2J9MA 3DBFA 3IOKA 3A7HA 3F2AA 3O5AA 2YIXA 3E8NA 5CSHA 5IQDA 3MPAA 4G6OA 5JSMA 3BLQA 4HJOA 4LGDA 4PMSA 1M17A 4USDA 5GIPE 4IX6A 5M57A 3MVLA 4F9CA 3R8ZA 2HWPA 2F49A 4EOIA 1XHAA 3VQUA 4IAKA 2X8EA 5D9HA 2OXYA 4FT0A 3HGKA 4GKIA 3QRUA 2ZV2A 3GCQA 3QTIA 4R8QA 4A4XA 4KKEA 4QMSA 3RAIA 1YWNA 4D2RA 1WMKA 2X4FA 3HV7A 3VHEA 1JSTA 1Y91A 3VS0A 4AAYA 2C6MA 5AA8A 2OZOA 2XK7A 1MQ4A 4NM3A 4EH3A 1YDRE 4RJ5A 2A4LA 1WZYA 3UDSA 4FZFB 4PTEA 4JRVA 5GINE 4V0GA 5HTCA 2O8YA 2VTJA 3H9FA 4KKGA 2G2FA 4XJ0A 5K0XA 3OY3A 4NTSA 1H4LA 4EH4A 2OU7A 5DR2A 4DH1A 4CV8A 1PMVA 3IW6A 1H26A 3PA4A 4A9SA 4HYSA 4JQ7A 4YUQA 2ZAZA 4YGAA 1IASA 4AQCA 3KCKA 3EQFA 1EH4A 1YOJA 5JZNA 2XBJA 2VV9A 3R7IA 5LMKA 2VWVA 3KQ7A 4FUXA 4Y5QA 3DLSA 2QR8A 1U46A 2QO2A 3EFWA 4PDOA 4NL0A 1LPUA 1OKZA 4PY1A 4GK2A 5LMKC 2J2IB 1VYWA 2WQEA 3Q04A 4AZWA 5A3XA 2UZOA 3EL8A 1PXJA 3AKKA 4C4GA 4WG5A 3FL4A 1S9JA 4ERWA 1YDSE 4F0FA 3EKKA 4FKPA 2XARA 1V0OA 3UYTA 4TKSA 3HX4A 4WNMA 5HE2A 4FVRA 3S3IA 4AG8A 4Z7HA 5E4HA 2H9VA 3QU0A 4EQUA 1MRUA 2WOUA 4I4EA 4O6EA 4QDEA 3DXNA 2J0MB 4L68A 2OZAB 3EQIA 3WF8A 3TMOA 4FVPA 3ZFXA 2X8IA 3DQXA 3MY1A 4G34A 3KXXA 2EWAA 2PVRA 1L3RE 2PVHA 3P7BA 4WRGA 2I0YA 4DEBA 3P5JC 5DRBA 3EYGA 2QURA 4K8AA 3N4VA 4WOVA 3KK8A 1LP4A 3VW6A 3PDTA 4DGLC 5M4FA 3QZGA 2XJ1A 3KULA 4O4DA 2DUVA 3PIXA 4RQVA 2XK8A 3CS9A 3C51A 3NYOA 4RWKA 4UALA 2XBAA 2YIWA 4ZIMA 4ZTMA 3QGWA 5AR8A 4U6RA 1GIIA 4WBOA 2OH0E 3SHEA 2W1IA 3HYHA 4MD9E 5C4LA 3V3VA 3IDPA 3PIZA 1OBGA 2UVXA 5JN2A 4JG6A 4OW8A 5HQ0A 4WNKA 4I92A 4TNDA 4CLJA 5TOZA 2BVAA 2W7XA 2X9EA 4LOQA 4EC8A 4MTAA 2CNQA 3WILA 3MYGA 4RA5A 1JSVA 4BYIA 3LQ3A 4K33A 3ZDUA 3F3ZA 2FB8A 4RJ4A 4FRFA 5LCKA 4O83A 3BRBA 3F9NA 5HX6A 1JPAA 4XHKB 4AXFA 2AC3A 4O0WA 3RK7A 4LL0A 2XK3A 3H4JA 4Y85A 3D83A 2HENA 2W1CA 2BFYA 2VWBA 5HG7A 1OM1A 3FHIA 1P5EA 5L8KA 3EQCA 2A2AA 4GEOA 3UGCA 2YN8A 5I5ZA 5ANIA 2ZV8A 1OBDA 4G31A 2PY3A 4FYNA 3K3IA 3PXZA 4FKGA 4YLLA 1OGYA 2CKOA 1QMZA 4X0MA 4IAZA 5DYJA 5ANJA 4XG7A 4TT7A 3R1SA 1SVHA 5K4JA 4D1ZA 2QQ7A 4FGRA 4A9UA 4FIGA 5KKRB 1H28A 2ZMCA 4L8MA 2GS6A 2VZ6A 3DKOA 3FI2A 4H39A 3CE3A 2JKQA 2WTVA 3RK5A 2HXLA 4BHZA 5IQGA 3G6HA 4CMUA 2BTSA 2G2IA 3HVCA 5EFQA 3ZH8A 4BCPA 2WELA 3G90X 4BDEA 3TUBA 1XH9A 1XQZA 4BGQA 2YHVA 3K54A 5DG5A 2ITUA 2P2HA 3WZDA 3QTUA 4JJRA 3IQ7A 3L9LA 1Q99A 5AP7A 3VS3A 3BEAA 2Z8CA 4FT3A 3TWJA 3UVRA 5HCZA 5M51A 3N51A 4O2PA 4E20A 1J7IA 3FV8A 4R3RA 4Z55A 4YJRA 2QNJA 3W0QA 3NIZA 5FBOA 4AGDA 1MRYA 2FSLX 4QNAA 2XNMA 2I0EA 2HY0A 3U6IA 3FZSA 2JC6A 2WTKB 2OXXA 4AA4A 5C01A 1P14A 3DV3A 1FINA 5FGKA 3GU4A 3MFSA 4JQ8A 4S34A 4QP1A 5TT7A 4Z7GA 4DBXA 2HZNA 3V8SA 4BI1A 4DT9A 5LVLA 4L01A 3CQEA 3OBJA 3QXOA 4DFXE 3D4QA 3PTGA 1PW2A 3RALA 5A14A 2G2HA 1JKKA 2CGVA 5FDXA 3IGGA 3NCGA 4DHIB 4BTKA 4AXDA 1KWPA 3O17A 4FT5A 2C5OA 3I81A 4O0RA 3NUAA 4FK3A 4E6DA 5L8LA 3CXWA 4QYGA 1T46A 3ZUTA 4FV3A 4CKRA 3I6WA 4QMUA 2QHNA 4O7ZA 3ZXTA 5CI6A 3QWJA 2JBPA 2W96B 4J53A 4D5KA 4DTAA 3EQHA 3REPA 5CEIA 4E93A 5D12A 5CANA 3QUEA 5BPYA 4P90A 4EH9A 3RMFA 2C1AA 2VO0A 2WQBA 2VGOA 1OL5A 4QMTA 4DITA 4CGAA 1P4FA 4FL2A 1BYGA 4NYEA 1H1SA 4F6SA 1T45A 3CQUA 5K0KA 4BI2A 3UNZA 3MV5A 4LGHA 2PULA 3NVKI 3CLYA 4G17A 4ASZA 4UZHA 5H2UA 3DU8A 3G15A 3ZMMA 3ZZEA 4DH8A 2X1NA 5IA2A 3NAXA 2W4KA 5KHXA 3UO5A 4QP8A 4C7TA 3HDNA 4MWIA 5EDQA 5ANOA 3VUTA 1PYEA 4EKLA 3UZRA 1W83A 1RJBA 3MESA 3B8RA 3R9HA 2GU8A 2X0QA 4RC4A 4PPBA 2O65A 4TYEA 4OTRA 3BYSA 4BDFA 4EK8A 4FT7A 3F3TA 1Q3DA 3FZOA 5HD4A 3VUDA 4WNPA 4G5PA 1XWSA 2WU7A 3H0ZA 4CYIA 2XZSA 4FZ7A 5J7BA 4EORA 2Z7RA 1P2AA 3EJ1A 4W4YA 4YZDA 3PXYA 2CKQA 3MTFA 2JD5A 4TRLA 5LWMA 4AZVA 3PE1A 5HLWA 4FTRA 2SRCA 4I24A 4NFNA 1IA8A 2C3LA 5E8ZA 4P5ZA 4YP8A 4KRDA 4CYJA 4LMNA 1PY5A 4DLJA 3FY0A 2JEDA 3FLWA 4FZDB 4MXZA 2UV2A 3PZHA 4XG2A 2OJFE 3DBQA 1Q24A 4H1MA 1FBNA 5AWMA 3MI9A 5CNOA 3SRVB 3DQWA 2VX3A 1UVRA 3R8VA 5IISA 3U55A 3V5QA 1YHSA 4BWXA 3Q4TA 4PPCA 3TJDA 2GNJA 3RKBA 3I5NA 2OGVA 5FEDA 4Z16A 4HNFA 3UO4A 1R78A 3GU6A 2PVYA 4FT9A 4D2WA 2PZPA 2PUPA 1R3CA 4QMZA 4UYNA 5EQPA 2BROA 1ST4A 3G51A 3I0QA 4NTTA 4D2VA 3L9MA 2C5XA 3RWPA 3C4WA 3AC8A 5D7VA 5EKNA 4KWPA 1IAHA 3NUNA 2OZAA 3LW0A 1W2DA 2C6OA 3MB7A 4EOJA 3UZPA 5CAOA 3ZUUA 2QG7A 3KEXA 3O71A 5IUHA 3EQRA 3WOWA 3HDMA 4M67A 1QL6A 5TKDA 2WEVA 1BI7A 4N6YA 5F4NA 5DGZA 3AC5A 4LYNA 1PMNA 5FM2A 1Y6BA 3R30A 3C0HA 3RAWA 1X8BA 2GHMA 4MXOA 4ALWA 5HU3A 4BCIA 5CI7A 2J5EA 3EN7A 4ZEGA 3ZO4A 4A9RA 2CNVA 3WARA 1KOBA 2XKFA 4WT6A 4F9BA 2YM4A 1XKKA 2P3GX 3MBLA 4C3PA 3QKLA 5IQIA 4TNBA 3GGFA 2O2UA 3IW7A 3HMIA 3WYXA 2QO7A 5M4CA 1BMKA 3D0EA 2Q83A 3G0FA 3R6XA 4ZSLA 5M44A 3DJ6A 2BHHA 4UXQA 2OXDA 1OIUA 3FYJX 2GQRA 3ERKA 3HECA 4W9WA 4MXCA 1UKHA 3P79A 4O86A 2IJMA 4EHZA 1VZOA 2YJRA 4LUEA 2UVZA 3V01A 3C5UA 3AC2A 4JI9A 3I79A 3QKMA 3HMNA 1GY3A 4DG3E 2ZV7A 4KINA 4QT1A 5EW9A 3TTIA 4YZMA 3BL9A 3RK9A 4J8NA 3P86A 3O50A 2QR7A 3OT3A 3T9IA 4QQJA 2XIRA 3GFEA 1CMKE 3PSBA 5C27A 3V5LA 3V5JA 3O7LB 4ZLOA 1ZYJA 3AC3A 4ZJJA 3ZOSA 4ZJVA 1R0EA 5B2MA 3TTJA 3SA0A 2WMRA 5D7AA 3JYAA 2IW9A 4FTKA 3NNXA 4IFCA 1NVQA 4F1MA 2BRGA 2PZRA 3FKOA 5F9EA 5A4EA 5CY3A 5M53A 3KGAA 3ALNA 4FV6A 1YXVA 3IW8A 5CEMA 4GJ2A 3VS6A 1E9HA 3EFLA 4FTUA 4FG9A 2UW9A 3OP5A 4QQTA 3LJ2A 5IQBA 4FG7A 3F69A 2FH9A 4YC6A 3VHKA 5IMEA 4LV8A 3PWDA 5KKRC 2JITA 3FMMA 3DB6A 3MFTA 3QTSA 4ZY4A 4YPSA 1UU3A 3KY2A 2ETRA 5G1XA 3GQLA 5HU9A 2WGJA 4J99A 4HPUE 4PL3A 4Y95A 3Q3BA 4OTQA 3WF6A 3D9VA 4KRCA 4A4OA 1CTPE 4RJ7A 2JDSA 3KVXA 5B2KA 5L3AA 2Y4IC 3AT2A 3U51A 3VUGA 4IH8A 4GKHA 4ZXTA 2Y8OA 4DF3A 2W5HA 3GP0A 4L53A 3R01A 4FEUA 4IEBA 4IAFA 3HP5A 2H96A 4PQNA 5B7VA 2R3HA 2WTIA 3NNUA 4KBKA 4AZSA 3TUCA 3MWUA 3LM5A 1PXMA 3WZEA 2VWIA 2GQGA 3D14A 4F6UA 4HZSA 3MA6A 4JRNA 3E7OA 1BI8A 5F1ZA 4GV1A 5GZ8A 5K5XA 3T9TA 4DGNA 4EH7A 1XMMA 4JMQA 1ZARA 3A7JA 2WTKC 3H10A 3AMBA 3ETAA 4HYUA 4HPTE 4RQKA 1WBSA 4B6LA 5DH3A 5IA0A 5KBQA 4BY9E 4OLIA 3U9NA 1ND4A 4E26A 3F3UA 2YCRA 2GFCA 3FMDA 4E6CA 3LCOA 4U3ZA 3MDYA 5JEBA 2ITNA 5HBEA 1YOLA 4XG6A 3UYSA 4BZDA 4EK6A 3UP7A 2PE1A 4BDDA 4BCMA 5JZJA 4CMOA 1URWA 2A27A 2NRUA 3ZSIA 1FMOE 3LJ0A 5CU4A 4ZK5A 2XK9A 4IX5A 3O2MA 4IAAA 5IMXA 1Q97A 3TJCA 3IPHA 4CKJA 4XLVA 3LCDA 4BDJA 1GIJA 2UZBA 1TQIA 3SXSA 4LL5A 3PLAE 4QP2A 2Z60A 3NS9A 3PLSA 4J97A 2ZB0A 4HVSA 3B8QA 2XRUA 4U43A 3FE3A 4ASDA 5JGBA 4RIXB 2VTNA 2W0JA 4OBPA 4I0SA 4BTJA 5K4IA 2C3KA 2WB8A 3KU2A 3P9JA 4RX8A 3FMHA 3JUHA 3BX5A 5HE3A 5HCXA 2WMTA 3I6UA 4MXYA 4NJDA 4XV1A 5BVKA 5IA1A 3QCSA 5KHWA 3KMUA 3SVVA 2WTJA 1U5QA 3OXZA 2BMCA 4FR4A 4IVAA 4LI5A 3F5PA 4IWQA 2QOBA 4FNWA 4ALUA 5AA9A 4K18A 4BHNA 2CPKE 3FMKA 3HEGA 1O9UA 1J91A 1ZZ2A 3VUMA 4ANBA 2WTCA 5D1JA 3RPVA 4EYMA 5LVOA 4QTCA 4LUDA 4GYGA 1FVTA 2FO0A 4CEGA 1MUOA 4PRJA 4AWIA 3IGOA 5AJQA 4AAAA 3PVGA 4RLKA 5CQUA 3SXRA 3P1AA 4R78A 3W2SA 3D7ZA 5AADA 4OAUC 3OCGA 2OBJA 4Y5HA 4FEWA 4O7RA 4FODA 4G3DA 1JAMA 4GL9A 4TXCA 1PXKA 2P4IA 2VU3A 4EK3A 4JG8A 1OECA 3PRFA 2R7BA 5HVKA 3DA6A 1YXSA 3S0OA 3GT8A 3QZIA 3DS6A 1ZYDA 4CZTA 4E3CA 4CTCA 4ZMFA 3RZFA 3I5ZA 4WKQA 4Y73A 2JKMA 5IA4A 1ZYSA 3QLFA 2OWBA 2XNNA 1YWRA 2E9OA 3U54A 3KK9A 4A7CA 4D0WA 3ZHPC 4AOTA 1KE5A 4I21A 4TWNA 4W4XA 3QD2B 2J90A 4YHTA 4L67A 3CKWA 1PXOA 3SRVA 2RG5A 3BBWA 4XEYA 3DOGA 4YPDA 5EHOA 1I09A 2BTRA 4PNKA 4L3JA 5H3QA 5CASA 3M1SA 3NNVA 4NSTA 4BDHA 3KN5A 4RIWB 5AR7A 3KFAA 4GJ3A 2I6LA 2ERKA 3OBGA 5C8MA 2XCKA 2ZMDA 4I93A 4MK0A 1M7NA 3NYVA 3W0PA 2Y6MA 4IM2A 3RBWA 4FE2A 4WRSA 3TDWA 3PFQA 4DCAA 4EI4A 2C0TA 1U54B 3C1XA 3SDJA 4I0TA 2ZDTA 4AFEA 4D9TA 3TT0A 4RPVA 4FKVA 4D0XA 1UU9A 2RFSA 3QCQA 4F0GA 3UNKA 1M2PA 2QOHA 3FUPA 5L8JA 4EOOA 4IX3A 5BVDA 3QZFA 3UQGA 4YZ9A 1KSWA 2W1GA 1KE6A 2UW6A 3ZLSA 2CJMA 3D5UA 5AM7A 5AIKA 3UOKA 3PE2A 4QMWA 2ONLA 4O7SA 5E1SA 3ZO3A 5E90A 4RWLA 2R3LA 5HESA 1BLXA 2UZLA 3AC4A 1WBTA 4DH5A 4ID7A 5IH5A 4IMYA 4KD1A 4TPTA 5L2WA 4OAVB 3W0RA 4Y72A 3DAKA 3OWKA 3QUDA 1ZMVA 5AX9A 2YEXA 4GFOA 4AOIA 4GT5A 2QHMA 2B7AA 2CLQA 3JVRA 2WQMA 4IWPA 2RGPA 3ZFYA 3UJGA 4FV0A 2C4GA 3RAHA 1UV5A 3NUXA 4CZUA 5KNJA 2PZIA 5DBXA 3PXQA 3QYZA 4O7WA 3A7FA 3KA0A 3I7CA 3LFCA 2Y0AA 5FTQA 3UOLA 4FV4A 4FIFA 4WBBB 3MIAA 4I5MA 4B4LA 2PE2A 2XM8A 3NUYA 4O22A 4OUCA 5CU3A 5AP2A 4L45A 3EQBA 4MHAA 4K0YA 3FDNA 5L2QA 4E7WA 5GJFA 2JLDA 4E6QA 1UNGA 2ITWA 5F94A 4DHJA 4H36A 2QOFA 2VTAA 3VWAA 4FKTA 3KMWA 3EFJA 1H1PA 4CXAA 3O0GA 4WUAA 3GOPA 3DTWA 5CVGA 3F7WA 1STCE 2BZKB 3MTLA 3FSKA 5AUVA 3QBNA 3AD5A 4C59A 4MUQA 1OKWA 5IEXA 4K1BA 2G1TA 2X81A 3VJOA 3PXFA 3LQ8A 2OIBA 3FMNA 5DEWA 5K3YA 5D11A 2OH4A 2W06A 5CT7A 4DDGA 5AP4A 4NZWB 3PVUA 3BELA 4AA5A 2OIQA 2ZVAA 3FZTA 2ITXA 5AUWA 3A4PA 4AUAA 4CV9A 1WBPA 3UOHA 2IPXA 3FLYA 3K5VA 3UDTA 3RM7A