4CQEA

B-raf kinase v600e mutant in complex with a diarylthiazole b-raf inhibitor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
272
structure length
250
Chain Sequence
DWEIPDGQITVGQRIGSGGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGGSILWMAPEVIRMQNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Optimization of Diarylthiazole B-Raf Inhibitors: Identification of a Compound Endowed with High Oral Antitumor Activity, Mitigated Herg Inhibition, and Low Paradoxical Effect.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SLC45A3-BRAF FUSION PROTEIN
total genus 75
structure length 250
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cqeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cqeA01
1H07A 1APME 3KB7A 3SOCA 3ZO3A 3U4WA 3VUIA 3ZUTA 3W2SA 2OGVA 4BHZA 5DEWA 4EH3A 5JZJA 1Q4LA 5KMLA 2GSFA 2WTWA 5FDPA 2FVDA 3K3IA 3F7ZA 4ZTNA 3LFCA 1UWJA 3R7OA 3ZMMA 3BLRA 4QNAA 4FBXA 2XKCA 4HGLA 2ACXA 2XIXA 2YIWA 4MWHA 2HY81 3V5LA 3RP9A 2OJ9A 3ATTA 4O7YA 2JKKA 1KOBA 1H00A 5LWNA 1WBTA 2C1BA 4ZSGA 3TACA 1YWRA 2R3OA 5HZNA 1SM2A 2ETRA 3MTFA 1GZ8A 2UZVA 2Y6OA 3H3CA 4HVGA 2ZV7A 3KXZA 3OT8A 5ANIA 3SQQA 5J1VA 3FKOA 2OIQA 2WQEA 3D15A 4YZCA 2W1ZA 3LQ3A 4RX7A 2I1MA 4ITJA 4KABA 3VUGA 4DT8A 3N51A 1MRYA 1SZMA 4TWCA 5A4TA 5IQIA 3EFKA 3O2MA 3MS9A 5FDXA 4ZXTA 1M52A 2WQNA 5LVLA 4YZNA 4HCVA 2YCFA 2CMWA 5CEPA 1ND4A 1H25A 1H0WA 1NA7A 1YRPA 4JX3A 3VIDA 1VYZA 3R71A 2IVTA 2ESMA 4I93A 4IANA 2OXYA 3RMFA 5IF1A 3QYWA 4RA5A 3TDWA 5CAQA 5C4KA 3CJGA 4MHAA 3QBNA 4UYNA 2FSMX 3P9JA 3SAYA 4ZTQA 4EZ3A 4QD6A 2FSTX 2BHHA 4LQMA 3DK6A 5CZIA 5GIPE 1PMVA 3ORLA 3EQHA 3WE4A 5A46A 3VS5A 4BBEA 3LCSA 4DTBA 4OTIA 4RC3A 4ASXA 4PDPA 5M56A 3UJGA 2XIRA 3AXWA 2EXEA 2YM7A 3BYUA 2C1AA 5DVRA 3M1SA 3F5GA 4PMTA 3LQ5A 3LMHA 2W5AA 3PY1A 3W2PA 4S2ZA 2UZEA 3CEKA 2VWVA 2OFVA 4QPSA 3ZCLA 4XRLA 2JDOA 2JBPA 4R6VA 4DFLA 4OAVB 4PDSA 3PJ2A 2BDJA 3VW8A 4XOYA 5GJDA 3FKLA 4FEQA 5HHWA 1MUOA 5EH0A 2WQBA 2ZB0A 3TTIA 2VX3A 2YIYA 4U9AA 3ZFMA 3R1QA 4F7SA 1URWA 1BI8A 3PJ8A 3MH3A 3BELA 5K9IA 1SNXA 4MXOA 1G8AA 2VTSA 2W1CA 2IPXA 3SDJA 4YU2A 3Q4TA 4DN5A 4RLKA 5CI6A 3WF7A 4QP1A 4R7HA 4IWDA 2NNWB 1SMHA 2FYSA 4L45A 3BLQA 5FRIA 3MH2A 5FG8A 2E9PA 1YQJA 5CVHA 5HE0A 4O0VA 2NPQA 5KBQA 2YM8A 3Q4UA 4IFGA 2H96A 2WELA 5HGIA 1H01A 4FUYA 5CASA 3FLQA 5L8JA 5ACKA 1PXPA 4CSVA 4KS8A 4UMRA 4Y72A 1PKDA 4PTCA 1OL1A 4EKKA 2PHKA 5CAPA 5GZ9A 4UYAA 4FSQA 5K0KA 4NW5A 4W4XA 5CZHA 4I94A 5AUXA 4DFNA 4RLLA 4LMNA 5BVEA 3KVXA 5FWKK 1LR4A 2RL5A 2WTKB 3FY2A 2C6DA 1B39A 4FTQA 4II5A 1YXVA 4ZY6A 3FZSA 5EHOA 4F9CA 1U4DA 5HG9A 5K5XA 3OWLA 5HORA 3EQRA 4Y8DA 2PMNX 2XRUA 2WMVA 2ITUA 4PNIA 3LFQA 4O82A 3R21A 5AP6A 4YJSA 3IW7A 3QCXA 1TVOA 5JRQA 3O51A 1AD5A 4IX3A 1JLUE 3FXZA 3IPHA 5DR9A 2JFMA 4TW9A 3V6SA 5I9YA 4S30A 5DWRA 2UZUE 4YMJA 4O21A 2W1DA 4JIKA 4X2KA 4JRNA 4PP9A 3FQHA 3KXGA 3LFSA 1WVYA 4QQ5A 3REPA 2OBJA 4FIHA 4EOOA 3MJ2A 2WIHA 5GNKA 4BCNA 3H0ZA 2WO6A 2XIZA 2FSOX 5C01A 4FEXA 3MJ1A 2ZYBA 3IW4A 2VZ6A 3CP9A 3COHA 4N6ZA 4RFYA 3W8LA 5I9XA 5CU0A 1Y57A 1ZZ2A 1J7UA 1GZOA 4RIWB 5IQDA 2R3NA 4W8DA 4GKHA 2OXXA 5EOBA 4F63A 1T45A 3A7HA 3QQGA 4RJ8A 2JDVA 2OG8A 4V01A 4I20A 3DOGA 3BYSA 4C4GA 4GJ2A 5T6KA 4PDOA 2C0OA 2C5VA 4M3QA 2WTDA 3HV7A 4IZ5A 3HRCA 3TNIA 5TE0A 4M97A 4ZTSA 5EQEA 4FYNA 5K5NA 3EKNA 3FSFA 1OUYA 3E3PA 4QMSA 4UN0C 4P2KA 2V0DA 3EN5A 3CIKA 3PE2A 4V05A 3SC1A 4E26A 5AM7A 3WBLA 2EUFB 4X3FA 5IH4A 3DS6A 4GS6A 5CI7A 2BIKB 4W4VA 5LCJA 1OZ1A 3ORIA 5T68A 4MNFA 4FTNA 4GK2A 2GS7A 3NW7A 4TYEA 1STCE 2QLQA 2YM4A 3OW4A 3V01A 3LOKA 3JR1A 5K0XA 3WF5A 3EZRA 3WOWA 4UMPA 3DZOA 4DFXE 2JAMA 4XHKB 1WMKA 2CGVA 5GZAA 1Q41A 3P5KA 4D4VA 2ETKA 2QOCA 1FMOE 2YZAA 4S33A 3OUNB 4E73A 5BUIA 2XK9A 4G2FA 3T3VA 4E4NA 3R7IA 4RT7A 3TG1A 1FOTA 1LEWA 2VTTA 1WBSA 3BYVA 4QQTA 3DLZA 2ZV9A 1LUFA 2J0JA 2YM3A 1S9IA 3IOKA 4FL1A 4RA4A 5EYKA 3T9TA 3G33A 4FKTA 3Q3BA 4HGTA 4K33A 3NUSA 4GT4A 2JBOA 5CLPA 3GOPA 3R63A 4DGGA 3O8TA 2CSNA 3KCKA 4J71A 2EWAA 4FC0A 4EQUA 3EYHA 2B4SB 1Q8YA 3AD4A 3FI4A 5TR6A 3LLAA 1GZNA 1OGUA 4ZJIA 4YBJA 3PZEA 2OW3A 3VO3A 2BRMA 3OXZA 1CSNA 3TV6A 5E9EA 2Y4IB 4QP9A 5ANGA 3BLHA 2CGXA 2YJSA 3AC5A 4J99A 3C5UA 4JLCA 4OW8A 2F4JA 3U87A 4R1VA 4C58A 5CAVA 3BGZA 4IJPA 4IW0A 4FIEA 3I6UA 4K1BA 4L3LA 3UG1A 2GNJA 3PVUA 2PUUA 5AIKA 3V5QA 4AN3A 4L6QA 3NVKI 4FZ7A 3SXFA 2CNUA 4G3FA 4ZS0A 5CSVA 3G15A 4DBNA 3BKBA 4F6UA 3WIKA 4C36A 2PUIA 3DNEA 4L3JA 5IKWA 3CGFA 3POZA 4W4YA 4CQGA 4LOOA 4O83A 3ZBXA 3MW1A 3HP5A 3I0OA 4AN2A 4BDBA 4LRJA 4C4EA 3A2CA 2XNPA 3QX2A 1R3CA 4IDTA 5HICA 4BL1A 4JOAA 4DGLC 4BF2A 3CJFA 3B8RA 4ZK5A 2P0CA 4IVCA 4ACGA 5JN2A 1J7IA 2CKEA 2VTRA 5EQYA 3FPMA 4BCJA 5BMMA 4FTJA 4N57A 3HRFA 3QTSA 3P1AA 5AR4A 4C8BA 5BUJA 2BTSA 1JKKA 2GNLA 3EQCA 3R1SA 1RJBA 4QMMA 2JDSA 3FLYA 5DHJA 4ANSA 2YLEA 5AWMA 4MBIA 4CFXA 2VTMA 4EEVA 2ITVA 4XS2A 4ZJVA 2I0HA 2YWVA 3TNPC 1F3MC 4QYGA 3L8XA 3ZUUA 2XH5A 3EL7A 4FV2A 5ITAA 3I5ZA 2CHLA 3Q60A 2WTVA 1H1QA 4HYSA 2Z02A 3UIMA 5AIRA 3WARA 3VAPA 3QQJA 1KV1A 3PJ1A 4L52A 3WILA 4I24A 4XP0A 1OBDA 2YERA 2GMXA 4YJPA 4RGJA 3RNYA 3C9WA 3CTQA 1HOWA 4BI0A 4PMSA 4D1ZA 4BIEA 5AR3A 5KHXA 4H3BA 4TY1A 5BVDA 4O86A 3GCSA 4AZTA 5FEQA 2ZMCA 3Q9YA 3TIYA 3A8XA 4JI9A 4W9XA 4J8NA 5DRBA 3NNUA 4AGCA 2WNTA 4ERKA 3GFEA 4RIYB 3ZU7A 2DS1A 3GEQA 3Q04A 5M07A 1P14A 2IN6A 5EYDA 5J7HA 2UZOA 4A4OA 3O50A 2V22A 2B1PA 4DLJA 4BCIA 4YO6A 3VULA 3NYNA 3RPSA 4QTBA 4CFVA 3NNWA 4GYIA 4C4FA 4YHFA 3QCSA 4E6CA 4F99A 4ZS4A 4U3YA 3QTXA 4FV5A 3IKAA 4X2GA 1WBOA 2UZDA 3EFLA 4BZOA 3MFTA 5LJJA 4NCTA 1YI4A 2BRGA 3B8QA 3JY9A 4V04A 3UODA 3QQLA 3KXNA 4J53A 1FQ1B 3QAME 5CVGA 4YNOA 3DNDA 3SA0A 3U6HA 3HVCA 2YACA 3DJ5A 3HA8A 3Q2MA 3VS0A 3PXZA 2QNJA 3DDQA 3EFJA 3HMNA 1YOJA 2F57A 3FZRA 3LW0A 1OITA 3IDPA 2V62A 3LE6A 3DBFA 2QOBA 5BVKA 5KCVA 4QMTA 1M7NA 4H05A 5JGDA 4RIWA 2WTJA 2VGPA 3UNJA 3P79A 4AZWA 5M08A 4MD7E 2QOOA 3FDNA 4DH8A 1NVQA 2F9GA 3PG3A 3VUMA 2QI8A 2BZHB 2OFUA 1XH5A 4EK4A 4YLLA 3QYZA 1PMNA 4KKGA 3TZ9A 3UYSA 2JIVA 2EB3A 2I7QA 1Z5MA 3NMUF 1PYXA 3AC3A 4R5YA 3NUAA 3PPZA 4O7VA 4TWPA 4YPDA 1CDKA 4GU9A 5L8LA 5DFPA 5AM6A 4BBMA 3KULB 2F2UA 2X9FA 1WZYA 2R3IA 3KXMA 3Q6WA 3RALA 4O38A 4D4RA 2CNVA 5IDNA 5AP2A 2A1AB 4D2TA 2F2CB 3ANQA 5ACBC 2IW8A 2R3MA 4D1SA 3HAVA 2VNYA 5EI2A 3ZRKA 4ALVA 2XIYA 4K77A 4YC8A 5DGZA 5EK7A 2X81A 4GMYA 1YXUA 5IEVA 2DWBA 4JAJA 4M69A 3PY3A 3FMLA 4OTQA 4GUBA 2UVZA 1KUTA 2YAAA 4L00A 2REIA 3O8PA 3UNZA 1MQ4A 5ANDA 4ZY5A 1MP8A 3SRVA 2X4FA 4XX9A 2WAJA 2G01A 1ZMUA 1RW8A 4PL3A 1JKLA 3PZHA 1OMWA 4F0IA 3RJCA 1R39A 2C47A 2GFCA 4QOXA 4I4EA 3UO6A 4DC2A 4F4PA 5JFSA 5E1SA 4WKQA 4FT9A 3L9LA 1W84A 2JDTA 3PXRA 5IUHA 4F7LA 3FBVA 2B9HA 3RPRA 3FI3A 3CD3A 1SYKA 3I5NA 4F1TA 5TOZA 2E9VA 4EZ5A 3DKFA 4R1YA 1J91A 5C4LA 4YURA 3R8MA 5L6WL 3LFEA 4LOQA 3U54A 1JKSA 4CT2A 4NJ3A 2VTAA 4BDHA 4F7JA 4CKJA 3E7VA 2UVXA 2GHGA 3AD6A 3DB8A 5EKNA 4XEYA 3FLNC 5JGAA 3I0QA 4CRSA 2C6EA 3LFBA 3DJ6A 2J9MA 4MD9E 5AX9A 5B7VA 4A7CA 4KWPA 4OTFA 2QG5A 3NSZA 4Q2AA 4UALA 4RWLA 5M06A 2W4KA 3HRBA 3IO7A 4U97A 5EDQA 3DK7A 4MK0A 2QOKA 4FV8A 3GBZA 2DQ7X 3RPYA 4PL5A 4XMOA 2RSVA 2QHNA 3ZBFA 4XV2A 4R3RA 4FSRA 4PY1A 5JEBA 5BYZA 5IH5A 1GZKA 1OKWA 3ANRA 3QWJA 2YWPA 4GEOA 4NT4A 1OPJA 2UZTA 3F5XA 4R5SA 4XV9A 3CCNA 3C4CA 3I6WA 4CKRA 3UP2A 3PPKA 5HKMA 3SOAA 3QKKA 3BU6A 4IVDA 4NFNA 4YZ9A 2DUVA 3ZXTA 4D9TA 3MIYA 3OD6X 2HENA 4G6NA 3LIJA 5BX0A 3L8VA 1WBVA 2ZM4A 5H9BA 2W96B 5KNJA 3UNKA 4ARKA 3PJ3A 2PL0A 3QLFA 4BTMA 4NEUA 4FIJA 4NKAA 2PPQA 2G2HA 3V5PA 5CF6A 5AUUA 4EKLA 3AD5A 5AV3A 1J7LA 2YDKA 4I0RA 5ICPA 4DH5A 3OHTA 4ERWA 4IX6A 3DXNA 3ORNA 5D9HA 5H8GA 3W33A 2PZ5A 5GHVA 3QU0A 4AGWA 4BDAA 1OIRA 1GJOA 2FSLX 5IU2A 5IQHA 3HDNA 3LXLA 4LFIA 3V5JA 2QODA 2X2MA 1HCLA 1O6YA 1PXMA 2ERZE 3HMMA 3KKVA 2WOUA 4O7TA 2EXCX 4YJVA 5E8TA 3AMBA 3F82A 2R7BA 3MY1A 4K9YA 4LRMA 5HBHA 2YEXA 3L9PA 5AFVA 2XCHA 1F0QA 5IA2A 2VTNA 4F9BA 4CLJA 5EYMA 2ZOQA 3E8EA 3VUDA 3ENHA 4FZFB 3C51A 4IMYA 5J79A 3NVMB 3FQSA 4DGMA 4ALUA 3F3VA 3QTRA 3GC8A 4FE2A 2BMCA 4RJ5A 5J87A 4BB4A 2R3LA 3IQ7A 3FPQA 4WG4A 3EQBA 4ANNA 5HNIX 4TYHB 3AC4A 4EH5A 3SVVA 2PZIA 3VNTA 2G9XA 3RAIA 1YI6A 4CNHA 1OBGA 4MXXA 4JDJA 3VBXA 4CGAA 3QC9A 3TNWA 3PA4A 5CT7A 5FM3A 2XBAA 4XNEA 3G0EA 1R0PA 2B55A 2R4BA 2WMQA 5HIBA 4WHZA 3VHKA 3WZJA 2C5XA 3EN7A 3ULZA 4DH1A 4EOPA 2X2KA 3KA0A 5T3QA 3UG2A 2BROA 2CGWA 5D10A 5HNBA 3AT3A 3ROYA 3GCPA 5FTGA 3ZSGA 5EDRA 4RQKA 5FP6A 4CRLA 1PJKA 4TZRA 3OVVA 4G9RA 4EK8A 1IRKA 3F88A 3GCUA 3MV5A 3Q52A 3LXNA 3GGFA 2B9IA 4X3JA 3UP7A 3VBVA 2GCDA 3DDPA 3FXWA 2VWBA 2B9JA 4RX8A 5AR5A 3NYVA 3II5A 1IA9A 1OECA 3MFSA 2YCQA 1UNGA 3MN3A 4H3PA 4MBJA 3RHKA 4EQCA 4F65A 1BL7A 4FIIA 4WSQA 3ZYAA 1FGIA 3ZC5A 1ZOGA 3A99A 4FKPA 1IASA 3QXOA 3NWWA 1FBNA 3VUTA 4EOQA 5LXMA 4QQJA 4TN6A 5CF8A 4BVUA 2XRWA 2JKOA 5EI8A 2YCSA 4IACA 4RC2A 5CVFA 3DKCA 3VBWA 2UW6A 4CFUA 2R3FA 4C3RA 4O84A 2GNGA 4WOVA 3EYGA 3R04A 4AOTA 5A9UA 3S00A 4UBAA 4ID7A 4YSJA 3U55A 3DBQA 3PIXA 1E1VA 4GRBA 5HBEA 3R0TA 5CSPA 3O23A 3COMA 3QX4A 4RFMA 4EOIA 5H3QA 1XH6A 1XJDA 2C68A 1QCFA 2QU5A 2WD1A 1JVPP 2A4LA 3OXTA 4PDYA 4CYIA 3MGYA 3OUKA 3FZPA 4EH2A 3EZVA 1OB3A 2QOIA 4EK3A 3POOA 3D5UA 3QC4A 4F7NA 3G51A 4O0YA 2A0CX 3G6HA 3PRIA 2R2PA 1UU3A 2VGOA 3RHXA 4ZLYA 3WF6A 4BFMA 2R3PA 2GQSA 1URCA 2XJ1A 5DBXA 4LL5A 3LKMA 1ZYLA 4BKYA 4BWXA 2OK1A 2YM5A 4XG6A 5BVFA 2YDIA 3GCVA 3SG8A 3ZLWA 4AGDA 3OEZA 1XH7A 4P5ZA 1YVJA 1YW2A 5B0XA 2VRXA 3AT4A 2UV2A 3R7GA 3E63A 4J8MA 4IAKA 4IM2A 4QPMA 4WBOA 5J7BA 4E6QA 4AUAA 4EOKA 2PVRA 3H9FA 1J1BA 1UNHA 1T46A 5AJQA 3F3WA 5HU9A 1UKIA 2C5NA 4K0YA 5HLNA 1OIYA 4YP8A 4O1PA 3ALNA 4S31A 4FNXA 3LLTA 3HECA 2ITPA 2PZRA 2OKRA 4TYIA 1ZRZA 4I22A 1UNLA 3KRLA 4X0MA 3BHUA 4BGHA 3ORKA 2O64A 1R78A 4KS7A 4AOJA 3BE2A 3EHAA 4EHGA 3GQLA 4YLKA 1Y6AA 1REKA 3BQCA 3NNXA 4FI1A 2IW6A 4J52A 4QMUA 4AXAA 4IVAA 5G6VA 2WMWA 4EHZA 2RKUA 4AA5A 5HQ0A 4X2FA 4TXCA 4IM3A 4E3CA 4RC4A 1IAHA 4E6DA 2OF4A 5JFXA 2OU7A 3QLGA 4G3CA 3FQEA 2ZVAA 2BFXA 4MX9A 5CEQA 2C6LA 4G34A 3LXPA 3QD3A 2W9FB 1H4LA 2W1GA 4JNWA 4KIQA 4U3ZA 3IG7A 3QTQA 3VQUA 3AC2A 4EH8A 1DM2A 4M67A 3F3UA 4ASEA 2VN9A 3FHIA 3G5DA 2J50A 2PZYA 4CMOA 1PMUA 4EJ7A 1V1KA 3EOCA 3L9MA 4XUFA 3MVLA 3ORPA 5LARA 1OPKA 3CQWA 3PA3A 5JGBA 4QMXA 5K4IA 5E1EA 1TKIA 1TQPA 1J1CA 1Q8WA 4JIAA 3NW5A 3GT8A 1K9AA 3UIUA 3KCFA 3O7LB 4FF8A 3RNIA 3LCOA 5D11A 5M57A 3WYXA 5AV4A 3LJ0A 4JXFA 5A4LA 2YDJA 3MPTA 4IXPA 2HZ4A 2SRCA 4WD5A 4AT3A 2Z7RA 2ONLA 4OBQA 5ETAA 4DFZE 2ERKA 5IEYA 1W98A 4CXAA 1NY3A 4FG8A 5IQAA 3N4VA 4CTBA 4W4WA 5JH6A 2QQ7A 4KD1A 3R2YA 4NH1A 4AA4A 4DEDA 2C5OA 4YHJA 4EWQA 2B0QA 4IAZA 3U9NA 4LUDA 5J9LA 3D94A 3JXWA 2X8IA 4ZLZA 3UQCA 3CQEA 2XK8A 4FV4A 2W5HA 2J2IB 4YJTA 4D55A 4BR3A 3LCDA 3OTVA 5D1JA 5ETFA 3ZFXA 4AW0A 5E92A 4IJ9A 5I3OA 4EBVA 4BDFA 3WF9A 5L2TA 3TUBA 1WCCA 3C4FA 3FJQE 2A19B 3COKA 4HVIA 2H6DA 4E5AX 3TM0A 3TZ7A 2DYLA 4C33A 5M09A 2PVHA 4DEAA 5CQWA 2R0UA 2Y4IC 3BHHA 4R78A 3R22A 4KIPA 3UVRA 3BE9A 4N0SA 4FOCA 3VJNA 5CENA 3FV8A 3D2IA 3JY0A 3UDBA 3CQUA 3IK3A 5LVOA 4EUTA 1MRVA 3R8PA 4YZDA 4E20A 3BZ3A 3BEGA 4H3QA 2R3JA 2YITA 1WBPA 1XBCA 5CSXA 2HYYA 4YC6A 4M69B 4AZVA 4EHEA 3FMHA 4ANBA 5EW3A 2O5KA 4HGEA 4FNZA 4PPAA 2FGIA 3D4QA 4QTDA 2WFYA 4RX9A 3EMGA 1AQ1A 3FMMA 2QG7A 3HA6A 1JPAA 3TCPA 5BUEA 3V8SA 2Y4PA 4XLIA 3BGQA 1LPUA 2PZPA 4WNPA 2ZM3A 5HG7A 1NVSA 3R8VA 2AYPA 5CEOA 5DN3A 1W7HA 2PVKA 2YIRA 3QKLA 4B99A 4YUQA 4OAUC 3P7BA 4XOZA 2QU6A 1NT2A 4U42A 1FPUA 2X2LA 5IA1A 4HW7A 2J0LA 3VS1A 1XH4A 3F3ZA 5D7VA 3CKWA 4FV7A 3V51A 2WEIA 2WTKC 2IZSA 3GOKA 3C50A 4LRKA 3RAWA 3UOLA 3MH0A 1XHAA 4XG9A 3DJ7A 3R9DA 2UW4A 2CPKE 3F69A 5EFQA 3PXFA 4YJOA 3ALOA 3RBWA 3OP5A 2WMAA 5GJGA 2BAKA 4XG3A 3FL5A 4FSMA 4X2JA 2HZNA 5CQUA 3DKGA 2ETMA 1FINA 1PXLA 2OLCA 3C0IA 2YIXA 4S32A 4WO5A 1ZMWA 2Z7LA 3OOMA 1Q8UA 3ODYX 1BUHA 3ZFYA 4RIOA 3UMXA 2I0YA 1H8FA 2OH0E 3OWKA 2VWUA 3OWPA 4FG9A 4G1WA 3DCVA 2WB8A 4I0SA 2OZOA 5DEYA 3DPKA 4ZSEA 4BYIA 3AC8A 4JR3A 2BHEA 4FV3A 4M68A 2E9OA 5E7RA 3P7AA 4G16A 4FTIA 1HCKA 3O7LD 4CMUA 2BZKB 1WBWA 2BZIB 3DFCB 2J7TA 5LOHA 5JT2A 3FKNA 3NYXA 3S3IA 2P4IA 3E8NA 4RVLA 3LHJA 3OFMA 2O8YA 3D7TB 2XKDA 3E7OA 3R1NA 4HOKA 4G6OA 5EM7A 4RVMA 4P4CA 2UUEA 3LM5A 4O0WA 4R3PA 5IEXA 5CAUA 2PU8A 4UEUA 2QVSE 4BCPA 4IE9A 4GT5A 3Q2JA 5C8MA 3L8SA 5EI6A 3SRVB 5KHWA 3DQWA 4FKJA 3TJDA 4BIBA 4CTCA 3CSVA 4APPA 4IIRA 2Y8OA 2C6OA 3R9HA 5JMSA 5HCXA 5HTIA 4MD8E 5AP5A 3UPXA 5LVMA 4O6LA 5CEIA 5FLFA 4MXZA 3SD0A 4U79A 2XJ0A 5HX8A 2C6IA 2RFDA 1RQQA 2ZAZA 3Q4CA 3AMAA 4L7FA 3R7YA 5KX8A 4O27B 1YXSA 2GS6A 3NLBA 5C03A 4L68A 1KE8A 4PX6A 4RWJA 4AE9A 3ELJA 4RPVA 2IO6A 3QUPA 1B38A 5IQBA 3TNHA 4APCA 1GY3A 3E8DA 3TZMA 3UIXA 3F2RA 3PXQA 3BV3A 3ZH8A 4N4SA 5HIDA 1VJYA 3FMNA 3RK5A 3R02A 3EIDA 4D4SA 3GENA 2YCRA 3ITZA 3ZLYA 4RZWA 3EWHA 2ITXA 4PWNA 3UZTA 4MXAA 3GNIB 1UA2A 4KUJA 4L8MA 4PMPA 1R1WA 3D7TA 4OTPA 4D2PA 4YTHA 3PIYA 5AR7A 3BU5A 4RSSA 4EONA 2OXDA 4FT3A 4DH3A 3KFAA 3TJCA 1NVRA 2E9UA 3KC3A 4H58A 3VF9A 4ZSJA 4CCUA 4PMMA 2FA2A 3PSDA 3EKKA 1IA8A 3MYGA 2WMUA 4Y5QA 4ZJJA 4ASDA 4X6QC 4FR4A 4DCEA 3DZQA 3G6GA 4MH7A 4MNEA 2ZV2A 4FSTA 2OWBA 4I6FA 4C02A 4BWKA 2X39A 4JAIA 3UIBA 4ENYA 2VWYA 4HZSA 2B9FA 3RGFA 4B6LA 4ZSAA 5HU3A 3A62A 4KNBA 4EH7A 4LM5A 5EDPA 4NFMA 3L1SA 4FICA 3EH9A 3KL8A 3DBDA 4E8AA 4FGRA 2X6EA 1Q3WA 2XK6A 5C8KA 2W1FA 3LPBA 2QOFA 3NUNA 3SGCA 1U54A 4ZP5A 4NM7A 5HLPA 4HPUE 4GG5A 3MVJA 2JD5A 4LI5A 4KIKB 5JFVA 3HUBA 4WNOA 4W9WA 4EYMA 3DXQA 2BFYA 1FVTA 2ITYA 3IONA 2XNMA 2UW5A 4PL4A 5CSWA 1DAYA 2VO7A 4F0GA 3PLSA 5DNRA 1PKGA 2QLUA 3FI2A 4X6RA 5JRSA 1W0XC 4CT1A 4FIGA 3U51A 2WKMA 3ACKA 4WNKA 3R00A 3UZRA 1U54B 3HKOA 2PE0A 3GQIA 4G9CA 3V8WA 2X7GA 4L7SA 4ANQA 4QP8A 4BDJA 1WBNA 3DBCA 4KIKA 3QGYA 2XBJA 2VWXA 2YFXA 2QC6A 4HPTE 3BWFA 4JL9A 3DAJA 4YNEA 3SX9A 4EWHA 3KK9A 5AA8A 3FLWA 3PDTA 1YXTA 5E8YA 3G0FA 4QRCA 4FKVA 2VD5A 1UWHA 4FK6A 3TKHA 1BL6A 1SVHA 4YO4A 1NW1A 1WVXA 5FQDC 4GH2A 4DYMA 4NL0A 4ZMFA 3BX5A 4QP4A 3P4KA 1P2AA 1VZOA 3QRIA 5AV2A 5H8EA 3U9CA 1FVVA 1PXIA 3F5PA 4DAWA 3LCKA 4KIOA 3BHVA 4L44A 4QYYA 4AA0A 4J1RA 2QO7A 4YHTA 2FO0A 1ZMVA 1QPCA 5CU3A 4U0IA 3QUDA 3NZ0A 3EQGA 4GFGA 4PQNA 5LMKC 3KMWA 3QRKA 3O8UA 4Z7HA 4RJ7A 2QO9A 4EJNA 4XBRA 4XV3A 4FYOA 3VUKA 3BHTA 4LUEA 4F9YA 2UW9A 5E8SA 2GTNA 3DT1A 3PSCA 4L46A 4CFNA 4IX4A 4XG2A 1Y6BA 3QRJA 3ERKA 1JKTA 4I21A 3BQRA 3UE4A 1KE5A 3F2AA 4QP7A 3COIA 3OY3A 1PYEA 4ZZNA 3S95A 3VQHA 4XLVA 4JBOA 2LGCA 4GKIA 4RWIA 1M14A 3QQUA 3OWJA 4JDHA 5AR2A 3ENMA 3A61A 3A4PA 1YHVA 2HELA 3TEIA 3O71A 1PRYA 4IH8A 4H1JA 4U43A 4FKWA 3NUYA 3TKUA 1XWSA 2HCKA 2XNBA 4AF3A 4QMVA 5KMJA 3KVWA 4U5JA 2E2BA 4ANMA 3QTIA 5FD2A 3MSSA 2Z7SA 2YJRA 4KRDA 4OTRA 5HVYA 4YZMA 4O7RA 4FVPA 1ERKA 5FM2A 5G1XA 4ENXA 4FT7A 1Q99A 4JRVA 5CALA 5B2MA 4QTAA 3HL7A 2C3IB 2JIIA 3IW8A 3DLSA 4OTDA 3MFUA 1OIQA 4I92A 3D83A 4CCBA 4EH6A 4QTEA 3PVWA 5CYIA 4NKSA 3NDMA 3W18A 3DGKA 4C4HA 4FKLA 2GDOA 3HNGA 5F4NA 4FEWA 4PPBA 4MKCA 2PVYA 5HX6A 4CLIA 1JQHA 5AR8A 3FYJX 1Q8TA 1KE6A 5HNGA 3RAHA 4ZTRA 4BI1A 2OO8X 2Q83A 4I5PA 3ZSIA 2OJJA 2PYWA 4GK4A 4OR5A 2ONLC 2JKQA 3E88A 5DLSA 4FKUA 3F6XA 4GSBA 4BN1A 1DI9A 3LMGA 4AQCA 1Z57A 4NYEA 2CKQA 4S34A 4U80A 4IADA 3CPCA 2Q0BA 3QWKA 1BYGA 4PPCA 3EQPA 5DIAA 2WHBA 4TNBA 4UB7A 4Q5HA 5C9CA 2IG7A 2CNQA 3ORZA 4YPSA 5ETIA 1ZOHA 2QOLA 3KF7A 4I6HA 2VAGA 4UWYA 4DEHA 4I3ZA 3ZZWA 4HVSA 5DMZA 4G3GA 5DR2A 5HCZA 1U59A 4GW8A 4H36A 5L2QA 3K2LA 5A4EA 5GIOE 4L67A 4QMLA 2QKRA 4E4LA 5IMXA 2VX0A 3QCQA 4FSZA 4I5CA 2OJIA 4TYJA 4UZDA 3ZONA 2OJFE 4FTTA 4ACDA 3LFNA 4ZAUA 3P23A 5AUZA 1VYWA 5FGKA 3VS4A 3QHRA 3QZFA 5F94A 4C62A 3JPVA 2WMXA 4E7WA 1YHSA 5D7AA 3Q5ZA 3A7FA 4L53A 4B0GA 3QRUA 2CLXA 3R1YA 2VO3A 4EZ7A 4L01A 3UC3A 2OZAB 2WMBA 2KULA 4IEBA 1H1WA 2B52A 4NJDA 3C5IA 3BI6A 4LOPA 4PTGA 3QCYA 1H24A 3C13A 3ORMA 4MNEB 5TT7A 3Q96A 1BI7A 3LAUA 4QMWA 3RI1A 5M53A 2IJMA 5DT0A 4AW2A 1EH4A 4IB0A 2I6LA 1F5QA 2O2UA 3HUCA 2G15A 5ANOA 4BC6A 1U46A 3C4WA 3MBLA 4A9UA 4CKIA 3L8PA 4Y95A 4ALWA 3PSBA 3MI9A 1YHWA 4NIFB 3OY1A 4M14A 4U6RA 2YABA 2JKMA 2YISA 5D41A 2XNEA 3E87A 3R7VA 3GXLA 4DCAA 3QA8A 5HG5A 3MIAA 4JQEA 5KMIA 4OT6A 3OC1A 4L9IA 2IVVA 4C57A 2VTJA 3LFDA 4CMTA 1A06A 5EKOA 5BPYA 3Q32A 2O3PA 4I5HA 2PY3A 1H08A 4DFBA 3PG1A 1AGWA 5L3AA 3FL4A 3P08A 2HZIA 4IX5A 4M13A 4BI2A 2I0VA 4V0GA 2QKWB 4NTSA 4AP7A 1OKVA 4J96A 3OMVA 3NUPA 5HO6A 1Q61A 4FGBA 4TNDA 2WEVA 2O65A 4WRSA 2RFNA 3R9NA 4D58A 3PWDA 5A14A 4CD0A 5CEKA 2ITWA 5HI2A 4GT3A 4CYJA 2GPHA 3C0HA 3RWPA 3OF0A 3R2BA 5K3YA 3V6RA 3C7QA 4R7IA 1ZYCA 3MWUA 4HYUA 5HO8A 2GHLA 5IUGA 2CLQA 3TV4A 2VO0A 2C0IA 3IW6A 2UW3A 3QZIA 3HV6A 3GU4A 5KO1A 3QZHA 3N4UA 3Q5IA 4EC8A 4UV0A 3LCTA 3ACJA 3D5XA 1CTPE 2R3GA 2BDWA 2WPAA 1PW2A 3A8WA 3D9VA 3OBJA 3ZUVA 3TTJA 4E4XA 3ATSA 4NIFA 3OZ6A 3V8TA 4ZSLA 2VTLA 1OPLA 2Y0AA 3NAYA 4JR7A 5JQ8A 3EJ1A 3FMEA 3HGKA 3WI6A 3WZKA 3SXSA 5BVWA 4D2VA 4JG6A 1H27A 4A4XA 2HK5A 4AGUA 3DTWA 4KBKA 2VWWA 5KKRC 1LP4A 3UOJA 4KSPA 4RJ3A 5HD7A 3VBYA 4ZTMA 1BKXA 2B53A 2GQRA 1KSWA 3ZOSA 2W1HA 3NRMA 4IC7A 3JYAA 4MCVA 2VTQA 3F3TA 4O22A 3N9XA 3OW3A 3R01A 5A6NA 3ZTXA 4ONAA 3LXKA 2B7AA 4OBPA 3U6JA 4QTCA 1OM1A 4TPTA 4GCJA 4XV1A 4BICA 3TNQB 2VUWA 3CE3A 2X6DA 2IZRA 3OCGA 1H1PA 5FP5A 3ZO1A 3TWJA 4BKJA 3TT0A 4C7TA 2ZDUA 4PNKA 2UZWE 3HV5A 4O2ZA 1XKKA 3K5UA 4Y83A 4YTIA 3ULIA 3MA6A 4IVBA 4IB1A 3TXOA 4B8MA 1YI3A 2CDZA 4K11A 4LV8A 2HW6A 2JLDA 3PUPA 3KF4A 4LG4A 4OLIA 5BYYA 3OEFX 4I0TA 2JFLA 3BBWA 2ITZA 4F0FA 4FA2A 4L43A 4DG3E 3CY2A 3WF8A 2W5BA 4FV1A 4E5WA 5L2IA 1H0VA 4JG7A 4RVTA 4Z9LA 2VO6A 1PXKA 3W2CA 3FUPA 4GVAA 2V7OA 5DT3A 3RK7A 5KMMA 5HLWA 1OIUA 4TYHA 4D2WA 5L6OA 3ZEPA 2FUMA 3EL8A 2C3KA 3FHRA 4FMQA 4O0SA 4CQEA 3ORTA 3PVBA 4NSTA 3D5WA 2UZBA 5JQ5A 2CN5A 2RIOA 3AG9A 3D14A 4YLJA 4RMZA 4QP2A 2PSQA 3RINA 3RKBA 2VNWA 3UMWA 3VBTA 4QP3A 4MAOA 3VWAA 5LMKA 5E4HA 4WBBB 1W8CA 3A60A 4F6WA 3HP2A 2R3QA 3LJ2A 2HWOA 2C4GA 3R7UA 5J5SA 2OJGA 4USDA 1M2RA 4HCTA 1ZWSA 4TRLA 3MH1A 4K8AA 4NUSA 5KKRB 2V5QA 4GU6A 3MY5A 3TUDA 1IAJA 3HAMA 4ITIA 3H9RA 4O7WA 4EI4A 1JNKA 4WSYA 4DEBA 3THBA 4D0WA 2VU3A 4ZMEA 2HY0A 2R9SA 3BYOA 2XKEA 2YN8A 1G3NA 4FL2A 2OF2A 3IS5A 3FZ1A 2JIUA 2JGZA 5EHLA 3OG7A 5ANKA 4BZNA 5LVPA 4KKHA 5M4CA 4O7ZA 3R73A 4MXCA 4IFCA 5AEPA 3TDVA 3ZSHA 2W9ZB 4D4YA 3MTLA 4FTCA 3GU5A 4C3PA 3UOHA 1W82A 4I23A 4BCGA 3KXXA 5IQGA 5BYLA 4XG8A 4ZTLA 3EFWA 5DPVA 2HAKA 4UXQA 5CU4A 5FXQA 5M55A 5I9ZA 4FSYA 5E8XA 3SW7A 4DITA 1ZY4A 2HIWA 3ZRLA 4OTWA 2C5YA 2ZM1A 3NAXA 4FZAB 5AV0A 3LVPA 3ORXA 3W2OA 5AA9A 4UZHA 2H34A 2VTHA 4CFWA 4M66A 4EOLA 4AT4A 5AAFA 3V04A 3AT2A 4ACCA 2OH4A 4DFUA 3C1XA 4AFEA 1A9UA 3OCSA 2R5TA 4AWIA 5IA4A 1MRUA 4KB8A 4PRJA 3I81A 4WIHA 1OI9A 4NW6A 2X8EA 2XCKA 5ANEA 4EK5A 3S0OA 3F61A 4GYGA 1SVEA 3E64A 4AU8A 1JAMA 2BILB 4XYFA 3A7IA 5IA5A 5CANA 1B6CB 2O0UA 4GG7A 4IAFA 3DU8A 1OL6A 5IPJA 4YBKA 3PP0A 3UYTA 1VEBA 3DV3A 4KBCA 2A2AA 2R64A 3PIZA 2BUJA 3NW6A 2UZNA 2UW0A 3HV3A 2P3GX 4FT5A 3H0YA 3VRYA 4XRJA 4FEVA 2X7FA 5CSHA 5KBRA 1TQIA 1OKYA 5FBOA 3UVPA 5FEDA 2BRBA 5GZ8A 3VVHA 1ZLTA 3EN9A 3NR9A 2AC5A 4Y5HA 5I9VA 5KMOA 3QA0A 2QOQA 2PMLX 3TZ8A 3LFAA 2A27A 3NS9A 3PLAE 5FXSA 3HMIA 3I79A 5EW9A 2BCJA 1SVGA 4BDKA 3AOXA 1CM8A 3D5VA 2R3RA 4D9UA 1OUKA 2C69A 5TKDA 5L2SA 3W32A 4IWQA 4DA5A 4G31A 3T3UA 5EQPA 4WUNA 2WTIA 3VC4A 5IDPA 1DS5A 5IA3A 4C2WA 3D7ZA 5M44A 1PHKA 3VUHA 5AP1A 2CCIA 3MVHA 5CF5A 4DE4A 1H1SA 3MPMA 4GFMA 3E5AA 1ZARA 4IM0A 4TTHB 1I44A 4KINA 5E8ZA 3PY0A 4WRGA 2BR1A 2Y9QA 3NUXA 2AUHA 5AP4A 3BRBA 4BCKA 3M42A 5HG8A 1CKPA 2RFSA 4IC8A 4BCHA 4YTFA 2ZDTA 3A7GA 4F1OA 3RZBA 2XP2A 4NM5A 4EOMA 2CGUA 4AE6A 5FTQA 4YJNA 3C4XA 3CTHA 4DINA 2GNHA 3GU8A 1DAWA 3NUUA 4IWPA 4P7EA 1Y91A 5JZNA 4JQ7A 2YIQA 4F70A 5AP7A 2QOHA 1QPJA 3M2WA 4YJQA 3CKXA 3R30A 3PFQA 4Z3VA 3RPOA 4G5JA 2XVDA 2QHMA 4TWOA 3ODZX 4LGDA 4K2RA 4TWNA 5HE1A 4BTKA 5AUTA 5J9YA 5AUVA 1U5RA 1X8BA 5CNNA 4WUAA 4PTEA 5CS6A 2YA9A 3H30A 4GL9A 2J0KA 4O0RA 2VV9A 2BAJA 3QD2B 2P2IA 3Q6UA 5FTOA 4DFYA 3UGCA 1PXNA 5JSMA 4Y73A 2IWIA 4QMYA 4YGAA 4FKOA 4IDVA 4WNMA 4OTGA 1GIJA 4FTKA 3AQVA 2FB8A 3AGMA 4P90A 3Q4ZA 3CY3A 4IHPA 5L6PA 4L42A 5CWZA 1MQBA 2JITA 3G9NA 4I41A 1PXJA 4RX5A 1QMZA 3NCGA 3QGWA 2J5FA 3KMMA 4O0UA 2QCSA 3FSKA 4CZUA 1RE8A 2YHVA 2X1NA 3EQDA 4QP6A 4EQMA 3U8WA 4R7BA 1L3RE 2HWPA 3QD0A 4EH9A 5EG3A 3LFFA 3GC7A 4ACMA 4CZYB 3E62A 4O2PA 4MTAA 3A7JA 2X4ZA 3E93A 4GFOA 3UQGA 3GP0A 4AACA 5K4JA 4QMQA 3MPAA 4DG2E 3EQFA 4XP3A 3GI3A 5GINE 5EM8A 4A9SA 4F09A 3N4TA 4BY9E 2XNNA 4K18A 5A3XA 1KE9A 2W17A 3MY0A 1Q3DA 3VW6A 4OTHA 5F9EA 4AG8A 4DHFA 4E5BA 3QALE 2WQOA 1UVRA 2Z2WA 4Z7GA 5KMKA 4UMTA 4EUUA 4F08A 2ZJWA 3GVUA 4C37A 4BTFA 3K54A 2Y6MA 4L3PA 3ID6C 3ZXZA 2UVYA 5DYJA 5CAOA 3DK3A 4A06A 3GU6A 3UTOA 4BRXA 4D0XA 1UKHA 2W99B 3BGPA 4BKZA 5EYCA 3LMIA 1LEZA 2W06A 3WE8A 2WQMA 4RJ6A 4BYJA 4D1XA 1SNUA 4WG5A 4FNYA 4I6BA 5DG5A 3UQFA 3TUCA 3LM0A 4FKSA 1V0OA 4DH7A 2W1EA 2RF9A 4HJOA 2PE1A 1GOLA 2RFEA 4JDIA 3KRRA 1IG1A 4E1ZA 3S1HA 2GTMA 2C6TA 4IWOA 2PVNA 3R8ZA 5DH3A 5KUPA 4ACHA 3FEGA 2BVAA 1KE7A 1Y8GA 4ANOA 4X21A 1OL2A 1REJA 2I0EA 2BPMA 3WZDA 1IR3A 3CS9A 1P5EA 2X9EA 4MF1A 1ZYDA 3BHYA 3CC6A 3HZTA 4K6ZA 4U7ZA 2XA4A 3ZZEA 5A4QA 1Q62A 3RPVA 3KK8A 2BRNA 2IVUA 3IGOA 3KY2A 3OCTA 4F9AA 5DI1A 4O7LA 5CT0A 2XF0A 1M2QA 3HX4A 4CEGA 4F6SA 3ZHPC 3CBLA 3KRWA 1E9HA 1K3AA 3H4JA 3PE1A 2W05A 2HXQA 2P33A 4NTTA 4AS0A 4QT1A 4HVHA 1L8TA 3JVRA 4YZBA 4ZLOA 5HVKA 4RWKA 2FH9A 4QMZA 3W1FA 3GB2A 1PF8A 2C6MA 5C27A 4ASZA 4FTMA 3PJCA 4P5QA 3NGAA 3QZGA 2YZLA 5HVJA 3O17A 4W8EA 5DA3A 3G90X 4FSWA 4H1MA 4NCTC 4N6YA 1UU7A 2PVJA 3VHEA 4I1ZA 1OVEA 5E8WA 5AUWA 5AAGA 3CGOA 2IZUA 4ZOGA 5ETCA 5IQCA 4JBQA 5IQEA 3GUBA 4YJRA 3I1AA 3FY0A 3ROCA 5CXHA 3T8OA 4DBXA 1VR2A 3OXIA 2XB7A 3C4ZA 2UZLA 3LQ8A 5CF4A 3B2TA 5IZFA 4C61A 4B9DA 2E9NA 3MB7A 1KOAA 4RG0A 2J6MA 2OZAA 2X0GA 5AUYA 3RAKA 4AFJA 2XZSA 4GIHA 2P2HA 4CV8A 2G2FA 1S9JA 5AX3A 4QPAA 2ZV8A 2ITQA 3NNVA 3KXHA 3PXKA 2OI4X 3QQHA 4IQ6A 4DG0E 3Q53A 4Q9ZA 5TO8A 2WGJA 2XYNA 3FWQA 5CNOA 5DR6A 2WXVA 5LMAA 3TN8A 1BLXA 4C2VA 4O7SA 4DGNA 2WZJA 3PA5A 3I7CA 4AW5A 3SLSA 1CKJA 3HMPA 2UW8A 3LJ1A 3U6IA 4FZ6A 2XYUA 2XK7A 4BCFA 1KV2A 2VX1A 3GCQA 4IAYA 5KZIA 3R8UA 1XBAA 4IB5A 3K3JA 4UWCA 3FC1X 2C30A 1H26A 4EOSA 3H10A 2YM6A 4JDKA 5BMSA 3MDYA 5M4UA 5EOLA 1G5SA 3PXYA 3QL8A 4J7BA 1JSUA 2QR8A 4FK3A 4FVQA 4O6EA 4D28A 3IW5A 1I09A 5AP0A 4UMUA 5A4CA 4XCUA 5L2WA 4BHNA 3WZEA 4QMPA 4Z16A 4RBLA 3GC0A 4XBUA 3SW4A 4A9YA 3IECA 1O6KA 4QO9A 5C8NA 4RFZA 2B54A 4C3FA 4C38A 3QHWA 4B7TA 3BU3A 5EW8A 4GVJA 1G8SA 4E93A 4FKIA 5F95A 3CLYA 3NYOA 3CPBA 3QFVA 3QKMA 5HCYA 5I9UA 4M7IA 3OROA 1YDRE 1ZXEA 4EYJA 2XJ2A 1JWHA 4G3EA 1BX6A 2JAVA 5J95A 4XH6A 1WFCA 4ORKA 3UO5A 4NM3A 2CJMA 3CR0A 2XKFA 3FMKA 3RTPA 1XBBA 2QURA 5A54A 2QD9A 2EXMA 3QD4A 2W1IA 4RVKA 2CKOA 4ZZOA 5CU6A 4BDGA 3OTUA 1QL6A 1U5QA 5H2UA 3WYYA 4Q9SA 3W16A 3WZUA 3KU2A 5BVNA 2X8DA 4PP7A 4M0YA 5HIEA 3ZM9A 4BCMA 4V0GB 4U44A 5F1ZA 2GNIA 3MA3A 3HMOA 4O81A 2WMSA 3JVSA 4EHVA 1ZYJA 2BTRA 2OICA 2EB2A 4IB3A 4BDDA 4AAAA 4E4MA 4E6AA 3FZTA 5J5TA 2ITOA 2W4JA 4KSQA 2YLFA 4O0XA 4U40A 2F49A 4D5KA 3O96A 3VS7A 4FKGA 1JSVA 2RG6A 4IBMA 3NIZA 4HNFA 3T9IA 2C6KA 3BWJA 4ZEGA 2XM8A 3ETAA 3IOPA 5DT4A 3UO4A 3VRZA 4NU1A 4BIDA 5IMEA 2V55A 2J5EA 3OBGA 1K2PA 4M84A 3ZM4A 3MESA 1UU8A 3SV0A 3GC9A 3BV2A 2BIYA 4XJ0A 1YXXA 2Q0NA 3F7WA 3CD8A 5E8UA 3ZDIA 3GFWA 1R0EA 4FT0A 2JDRA 2BKZA 2J90A 4U41A 3K5VA 4MXYA 3UPZA 5I9WA 4HGSA 4C4IA 2AC3A 4H39A 4O7NA 4OT5A 2Z60A 2W0JA 2J4ZA 2IVSA 4BWPA 1TQMA 4AOIA 3FLSA 4M0ZA 4FTUA 5J8IA 4HCUA 2WMRA 4X3FC 2W4OA 4CFFA 3PWYA 1WVWA 3R8LA 3TI1A 2Y7JA 3W55A 3SHEA 2RGPA 4QQCA 3ZEWA 4FVRA 5CXZA 1PXOA 4QMNA 5I4NA 3ZO2A 2GHMA 2BZJA 2H9VA 3IDCA 1H28A 1QPDA 4EORA 2PWLA 3Q9XA 5LCKA 4X3FB 4FTLA 5AADA 3SG9A 3R9OA 4KRCA 1UU9A 2CKPA 2VWIA 2XM9A 3E3BX 5AAEA 5KMNA 5M51A 3RVGA 2WU7A 4JS8A 4FV0A 3QF9A 2PVFA 3V5TA 4C4JA 4MQ1A 2KTYA 2XK4A 1M17A 3MVMA 4LYNA 5CY3A 4YSMA 3QQFA 5AP3A 4AZSA 3I60A 3P86A 4NM0A 4FTAA 4BDCA 4GUEA 3D2KA 5BQ0A 3FYKX 3QTWA 3HEGA 3QXPA 4IZ7A 4KKEA 4BZDA 4FX3A 3OS3A 4GIIA 5KZ0A 3ZDUA 2QO2A 2XK3A 2Z8CA 3V3VA 4F64A 1P4OA 5LVNA 4FODA 4GV1A 4HYIA 3RCJA 3C4EA 4I6QA 4M15A 5A6OA 3PP1A 4KA3A 3F9NA 2J0IA 2ZB1A 3DB6A 1W83A 1XH8A 4USEA 3DAEA 3OCBA 4RJ4A 2G1TA 3RM6A 3VS6A 4B8LA 4AN9A 1JOWB 3DBEA 3U4UA 5C1QB 1E1XA 3CXWA 4G17A 2F7EE 2OIDA 2WIPA 3VS2A 5IUIA 5C26A 5CU2A 4MYGA 3VF8A 5M4FA 3FMDA 5F20A 4CG9A 3DKOA 1JSTA 3RZFA 4BBFA 3KN5A 4MVFA 3NIEA 1FMKA 1WAKA 2C0TA 1ZZLA 1Y8YA 4UXLA 3R28A 2JC6A 3H9OA 3AC1A 4FIFA 5DE2A 4EOJA 1NXKA 3FZOA 4UMQA 3ZC6A 5LQFA 4FTOA 3P0MA 3OT3A 3UC4A 3QRTA 1XR1A 2IW9A 4F1MA 4QMOA 3AMYA 5FUTA 4J98A 1ZAOA 5GJFA 4RZVA 4FOBA 4QYHA 3JS2A 2PUNA 1IEPA 3TV7A 2PUPA 4DEEA 1V0PA 4ZZMA 4BCQA 2G2IA 4IZAA 4Z55A 4LMUA 4USFA 1OL7A 4DTKA 3DTCA 5I0BA 4FEUA 2VTIA 2PK9A 2UW7A 2YAKA 5EHYA 3Q9WA 4OUCA 4EC9A 4CVAA 4HNIA 4JBVA 4O1OA 4FV6A 3E92A 4UY9A 1YDSE 3HYHA 4MF0A 2PMOX 4EK6A 3F2NA 3KN6A 1BMKA 3GU7A 2NRYA 1CKIA 3BEAA 3EN6A 4LV5A 4PV0A 4U8ZA 4R77A 1RDQE 5DRDA 4QNYA 1FGKA 4RIXB 4XG7A 2VTPA 5DOSA 5HESA 2IZTA 1O6LA 3BCEA 4C35A 4D2SA 2NP8A 3VN9A 4MQ2A 2I40A 1YKRA 4FSUA 2XIKA 4A9RA 3TL8A 2LAVA 4D2RA 1PMEA 4XG4A 2XMYA 5JK3A 4JJRA 2GNFA 5JFWA 3R83A 3FXXA 4HZRA 3BBTB 3W2RA 4HVDA 2XNOA 4FG7A 3I7BA 1J3HA 4IAAA 4WG3A 2JEDA 4FKRA 4Q5EA 3W8QA 4TL0A 2PVMA 3FI8A 4DLIA 4Y46A 4BGQA 2PULA 1A48A 5JKGA 2QR7A 3TKIA 3F66A 3OOGA 4IAIA 1ZYSA 3G2FA 4FNWA 5CEMA 2C3JA 4M8TA 4B4LA 1GIIA 4D5HA 5ANJA 3FE3A 4BTJA 3KREA 3QTUA 5FXRA 2WOTA 3KRXA 2R0IA 2BALA 3P7CA 1DI8A 3KMUA 2W7XA 4MEDA 4C34A 2GS2A 4TT7A 5LMBA 3PRFA 2NO3A 2PE2A 4AZEA 5HD4A 2ITTA 4G3DA 4IZYA 5M4IA 4UX9A 3ZLXA 2XS0A 4DGOA 4PUZA 3TIZA 3UZPA 3VS3A 1ATPE 2EVAA 4ITHA 4MBLA 3VBQA 2BDFA 2ZMDA 3D0EA 2P55A 3PTGA 5I3RA 4RIXA 3MFRA 3BYMA 3VJOA 2GU8A 4CV9A 3F5UA 4DT9A 4G5PA 4QYEA 2R3KA 3HDMA 1Z9XA 1O9UA 3KEXA 4O91A 3FC2A 2F7XE 4LGGA 4JVGA 5E91A 3BPRA 4J97A 5BVOA 4FTRA 4OGRA 1Q97A 4EH4A 4O0TA 2HOGA 4I5MA 1QPEA 1XQZA 3KQ7A 4GK3A 1OKZA 4X7QA 3ZS5A 4FUXA 1ZOEA 4EL9A 2WU6A 5L4QA 2Z7QA 5LWMA 3ZLSA 4CG8A 4AW1A 3M11A 4HYHA 4ZTHA 3V5WA 4AT5A 1KWPA 2PTKA 1OL5A 3EQIA 5FBNC 3HLLA 3DQXA 4R3CA 3LZBA 1YWNA 4J95A 3P78A 4FSNA 1CMKE 3AGLA 1UV5A 1JBPE 2HXLA 3DXPA 4JG8A 3E8CA 2BAQA 4C0TA 1GAGA 2VTOA 3ZRMA 4U81A 4NWMA 4BDEA 4YC3A 3DA6A 4CFMA 3NX8A 4O96A 2RG5A 5B2KA 5IH6A 4ZIMA 2GQGA 1GIHA 4FKQA 1XH9A 2C3LA 1V0BA 2O63A 3B2WA 3QUEA 4JT3A 4BDIA 2EU9A 4LL0A 3DAKA 4M12A 5TF9A 5B2LA 3NEWA 4GJ3A 5IA0A 4F9WA 5IISA 2J51A 3L9NA 4DEIA 2HZ0A 3W10A 3UOKA 1ZY5A 4AX8A 5L8KA 2OIBA 1M7QA 4PF4A 4NK9A 3PYYA 2PMIA 4NZWB 3FMJA 4U45A 5E90A 3WIGA 1GNGA 3C0GA 3FLZA 4TYGA 4QYFA 2R7IA 3KRJA 4FZDB 4G6LA 1M2PA 2HW7A 4RQVA 1P4FA 2CN8A 3RK9A 4XP2A 4ZY4A 5HOAA 2CCHA 3S4QA 4BCOA 3UBDA 4AZFA 2XUUA 1FVRA 3BIZA 4KBAA 4DTAA 5IQFA 3EB0A 3FAAA 3PVGA 2H8HA 3DY7A 4TKSA 4A07A 3QQKA 5H8BA 4YR8A 5HO7A 4Y85A 5J1WA 5BNJA 3DFAA 3PPJA 3RM7A 5HEZA 3G9LX 4I4FA 3I4BA 2J0MB 4UWBA 4EBWA 3IGGA 3SKCA 2BKKA 5AMNA 3O0GA 2R3HA 3KGAA 1PY5A 5EM6A 3RWQA 4FV9A 5HBJA 4R8QA 4RRVA 1XO2B 3KULA 3A4OX 5KE0A 2X7OA 2ITNA 3ZO4A 2NRUA 2OSCA 3R6XA 3EN4A 4JX7A 4YJUA 4OBOA 5CTPA 4BGGA 4C59A 5I5ZA 3R9RA 3QTZA 2WTCA 5HTBA 2F7ZE 4FL3A 5HE3A 3IDBA 4RIYA 4DF3A 4KAOA 1H1RA 2GFSA 2V7AA 5E8VA 1YOLA 2XEYA 5HTCA 1Q5KA 2VWZA 1YOMA 1YDTE 3ET7A 4A4LA 4X2NA 3R7EA 5J9ZA 2QONA 3JUHA 4DEGA 4YTCA 3UVQA 4N70A 5CX9A 2WMTA 3NCZA 1Q24A 5EM5A 4ANLA 3RCDA 4MWIA 2PVLA 5FEEA 5D12A 2XNGA 4WA9A 3MB6A 3S2PA 4JQ8A 3Q9ZA 5IG1A 3SXRA 2XEZA 3NPCA 1Q8ZA 2BRHA 4WT6A 5HE2A 3W2QA 4A9TA 4LGHA 4CZTA 1YWVA 3CTJA 5AV1A 3HV4A 4JBPA
chains in the Genus database with same CATH superfamily
1H07A 1APME 3KB7A 3SOCA 3ZO3A 3U4WA 3VUIA 3ZUTA 3W2SA 2OGVA 4BHZA 5DEWA 4EH3A 5JZJA 1Q4LA 5KMLA 2GSFA 2WTWA 5FDPA 2FVDA 3K3IA 3F7ZA 4ZTNA 3LFCA 1UWJA 3R7OA 3ZMMA 3BLRA 4QNAA 4FBXA 2XKCA 4HGLA 2ACXA 2XIXA 2YIWA 4MWHA 2HY81 3V5LA 3AKKA 3RP9A 2OJ9A 3ATTA 4O7YA 2JKKA 1KOBA 1H00A 5LWNA 1WBTA 2C1BA 4ZSGA 3TACA 1YWRA 2R3OA 5HZNA 1SM2A 2ETRA 3MTFA 1GZ8A 2UZVA 2Y6OA 3H3CA 4HVGA 2ZV7A 3KXZA 3OT8A 5ANIA 3SQQA 5J1VA 3FKOA 4AQKA 2OIQA 3AKJA 2WQEA 3D15A 4YZCA 2W1ZA 3LQ3A 4RX7A 2I1MA 4ITJA 4KABA 3VUGA 4DT8A 3N51A 1MRYA 1SZMA 4TWCA 5A4TA 3KIOC 3EFKA 3O2MA 3MS9A 5FDXA 4ZXTA 5IQIA 1M52A 2WQNA 5LVLA 4YZNA 4HCVA 2YCFA 2CMWA 5CEPA 1ND4A 1H25A 1H0WA 1NA7A 1YRPA 4JX3A 3VIDA 1VYZA 3R71A 2IVTA 2ESMA 4I93A 4IANA 2OXYA 3RMFA 5IF1A 2X0PA 3QYWA 4RA5A 3TDWA 5CAQA 5C4KA 3CJGA 4MHAA 3QBNA 4UYNA 2FSMX 3P9JA 3SAYA 4ZTQA 4EZ3A 4QD6A 2FSTX 2BHHA 4LQMA 3DK6A 5CZIA 5GIPE 1PMVA 3ORLA 3EQHA 3WE4A 5A46A 3VS5A 4BBEA 3LCSA 4DTBA 4OTIA 4RC3A 4ASXA 4PDPA 5M56A 3UJGA 2XIRA 3AXWA 2EXEA 2YM7A 3BYUA 4JMQA 2C1AA 5DVRA 3M1SA 3F5GA 4PMTA 3LQ5A 3LMHA 2W5AA 3PY1A 3W2PA 4S2ZA 2UZEA 3CEKA 2VWVA 2OFVA 4QPSA 3ZCLA 4XRLA 2JDOA 2JBPA 4R6VA 4DFLA 4OAVB 4PDSA 3PJ2A 2BDJA 3VW8A 4XOYA 5GJDA 3FKLA 4FEQA 5HHWA 1MUOA 5EH0A 2WQBA 2ZB0A 3TTIA 2VX3A 2YIYA 4U9AA 3ZFMA 3R1QA 4F7SA 1URWA 1BI8A 3PJ8A 3MH3A 3BELA 5K9IA 1SNXA 4MXOA 1G8AA 2VTSA 2W1CA 2IPXA 3SDJA 4YU2A 3Q4TA 4DN5A 4RLKA 5CI6A 3WF7A 4QP1A 4R7HA 4IWDA 2NNWB 1SMHA 2FYSA 4L45A 3BLQA 5FRIA 3MH2A 5FG8A 2E9PA 1YQJA 5CVHA 5HE0A 4O0VA 2NPQA 5KBQA 2YM8A 3Q4UA 4IFGA 2H96A 2WELA 5HGIA 1H01A 4FUYA 5CASA 3FLQA 5L8JA 5ACKA 1PXPA 4CSVA 4KS8A 4UMRA 4Y72A 1PKDA 4PTCA 1OL1A 4EKKA 2PHKA 5CAPA 5GZ9A 4UYAA 4FSQA 5K0KA 4NW5A 4W4XA 5CZHA 4I94A 5AUXA 4DFNA 4RLLA 4LMNA 5BVEA 3KVXA 5FWKK 1LR4A 2RL5A 2WTKB 3FY2A 2C6DA 1B39A 4FTQA 4II5A 1YXVA 4ZY6A 3FZSA 5EHOA 4F9CA 1U4DA 3BLAA 5HG9A 5K5XA 3OWLA 5HORA 3EQRA 4Y8DA 2PMNX 2XRUA 2WMVA 2ITUA 4PNIA 3LFQA 4O82A 3R21A 5AP6A 4YJSA 3IW7A 3QCXA 1TVOA 5JRQA 3O51A 1AD5A 4IX3A 1JLUE 3FXZA 3IPHA 5DR9A 2JFMA 4TW9A 3V6SA 5I9YA 4S30A 5DWRA 2UZUE 4YMJA 4O21A 2W1DA 4JIKA 4X2KA 4JRNA 4PP9A 3FQHA 3KXGA 3LFSA 1WVYA 4QQ5A 3REPA 2OBJA 4FIHA 4EOOA 3MJ2A 2WIHA 5GNKA 4BCNA 3H0ZA 2WO6A 2XIZA 2FSOX 5C01A 4FEXA 3MJ1A 2ZYBA 3IW4A 2VZ6A 3CP9A 3COHA 4N6ZA 4RFYA 3W8LA 5I9XA 5CU0A 1Y57A 1ZZ2A 1J7UA 1GZOA 4RIWB 5IQDA 2R3NA 4W8DA 4GKHA 2OXXA 5EOBA 4F63A 1T45A 3A7HA 3QQGA 4RJ8A 2JDVA 2OG8A 4V01A 4I20A 3DOGA 3BYSA 4C4GA 4GJ2A 5T6KA 4PDOA 2C0OA 2C5VA 4M3QA 2WTDA 3HV7A 4IZ5A 3HRCA 3TNIA 5TE0A 4M97A 4ZTSA 5EQEA 4FYNA 5K5NA 3EKNA 3FSFA 1OUYA 3E3PA 4QMSA 4UN0C 4P2KA 2V0DA 3EN5A 3CIKA 3PE2A 4V05A 3SC1A 4E26A 5AM7A 3WBLA 2EUFB 4X3FA 5IH4A 3DS6A 4GS6A 5CI7A 2BIKB 4W4VA 5LCJA 1OZ1A 3ORIA 5T68A 4MNFA 4FTNA 4GK2A 2GS7A 4DHZA 3NW7A 4TYEA 1STCE 2QLQA 2YM4A 3OW4A 3V01A 3LOKA 3JR1A 5K0XA 3WF5A 3EZRA 3WOWA 4UMPA 3DZOA 4DFXE 2JAMA 4XHKB 1WMKA 2CGVA 5GZAA 1Q41A 3P5KA 4D4VA 2ETKA 2QOCA 1FMOE 2YZAA 4S33A 3OUNB 4E73A 5BUIA 2XK9A 4G2FA 3T3VA 4E4NA 3R7IA 4RT7A 3TG1A 1FOTA 1LEWA 2VTTA 1WBSA 3BYVA 4QQTA 3DLZA 2ZV9A 1LUFA 2J0JA 2YM3A 1S9IA 3IOKA 4FL1A 4RA4A 5EYKA 3T9TA 3G33A 4FKTA 3Q3BA 4HGTA 4K33A 3NUSA 4GT4A 2JBOA 5CLPA 3GOPA 3R63A 4DGGA 3O8TA 2CSNA 3KCKA 4J71A 2EWAA 4FC0A 4EQUA 2IEWA 3EYHA 2B4SB 1Q8YA 3AD4A 3FI4A 5TR6A 3LLAA 1GZNA 1OGUA 4ZJIA 4YBJA 3PZEA 2OW3A 3VO3A 2BRMA 3OXZA 1CSNA 3TV6A 5E9EA 4QDEA 2Y4IB 4QP9A 5ANGA 3BLHA 2CGXA 2YJSA 3AC5A 4J99A 3C5UA 4JLCA 4OW8A 2F4JA 3U87A 4R1VA 4C58A 1ST4A 5CAVA 3BGZA 4IJPA 4IW0A 4FIEA 3I6UA 4K1BA 4L3LA 3UG1A 2GNJA 3PVUA 2PUUA 5AIKA 3V5QA 4AN3A 4L6QA 3NVKI 4FZ7A 3SXFA 2CNUA 4G3FA 4ZS0A 5CSVA 3G15A 4DBNA 3BKBA 4F6UA 3WIKA 4C36A 2PUIA 3DNEA 4L3JA 5IKWA 3CGFA 3POZA 4W4YA 4CQGA 4LOOA 4O83A 3ZBXA 3MW1A 3HP5A 3I0OA 4AN2A 4BDBA 4LRJA 4C4EA 3A2CA 2XNPA 3QX2A 1R3CA 4IDTA 5HICA 4BL1A 4JOAA 4DGLC 4BF2A 3CJFA 3B8RA 4ZK5A 2P0CA 4IVCA 4ACGA 5JN2A 1J7IA 2CKEA 2VTRA 5EQYA 3FPMA 4BCJA 5BMMA 4FTJA 4N57A 3HRFA 3QTSA 3P1AA 5AR4A 4C8BA 5BUJA 4LV7A 2BTSA 1JKKA 2GNLA 3EQCA 3R1SA 1RJBA 4QMMA 2JDSA 3FLYA 5DHJA 4ANSA 2YLEA 5AWMA 4MBIA 4CFXA 2VTMA 4EEVA 2ITVA 4XS2A 4ZJVA 2I0HA 2YWVA 3TNPC 1F3MC 4QYGA 3L8XA 3ZUUA 2XH5A 3EL7A 4FV2A 5ITAA 3I5ZA 2CHLA 3Q60A 2WTVA 1H1QA 4HYSA 2Z02A 3UIMA 5AIRA 3WARA 3VAPA 3QQJA 1KV1A 3PJ1A 4L52A 3WILA 4I24A 4XP0A 1OBDA 2YERA 2GMXA 4YJPA 4RGJA 3RNYA 3C9WA 3CTQA 1HOWA 4BI0A 4PMSA 4D1ZA 4BIEA 5AR3A 5KHXA 4H3BA 4TY1A 5BVDA 4O86A 3GCSA 4AZTA 5FEQA 2ZMCA 3Q9YA 3TIYA 3A8XA 4JI9A 4W9XA 4J8NA 5DRBA 3NNUA 4AGCA 2WNTA 4ERKA 3GFEA 4RIYB 3ZU7A 2DS1A 3GEQA 3Q04A 5M07A 1P14A 2IN6A 5EYDA 5J7HA 2UZOA 4A4OA 3O50A 2V22A 2B1PA 4DLJA 4BCIA 4YO6A 3VULA 3NYNA 3RPSA 4QTBA 4CFVA 3NNWA 4GYIA 4C4FA 4YHFA 3QCSA 4E6CA 4F99A 4ZS4A 4U3YA 3QTXA 4FV5A 3IKAA 4X2GA 1WBOA 2UZDA 3EFLA 4BZOA 3MFTA 5LJJA 4NCTA 1YI4A 2BRGA 3B8QA 3JY9A 4V04A 3UODA 3QQLA 3KXNA 4J53A 1FQ1B 3QAME 5CVGA 4YNOA 3DNDA 3SA0A 3U6HA 3HVCA 2YACA 3DJ5A 3HA8A 3Q2MA 3VS0A 3PXZA 2QNJA 3DDQA 3UDSA 3EFJA 3HMNA 1YOJA 2F57A 3FZRA 3LW0A 1OITA 3IDPA 2V62A 4AXDA 3LE6A 4O4FA 3DBFA 2QOBA 5BVKA 5KCVA 4QMTA 1M7NA 4H05A 5JGDA 4RIWA 2WTJA 2VGPA 3UNJA 3P79A 4AZWA 5M08A 4MD7E 2QOOA 3FDNA 4DH8A 1NVQA 2F9GA 3PG3A 3VUMA 2QI8A 2BZHB 2OFUA 1XH5A 4EK4A 4YLLA 3QYZA 1PMNA 4KKGA 3TZ9A 3UYSA 2JIVA 2EB3A 2I7QA 1Z5MA 3NMUF 1PYXA 3AC3A 4R5YA 3NUAA 3PPZA 4O7VA 4TWPA 4YPDA 1CDKA 4GU9A 5L8LA 5DFPA 5AM6A 4BBMA 3KULB 2F2UA 2X9FA 1WZYA 2R3IA 3KXMA 3Q6WA 3RALA 4O38A 4D4RA 2CNVA 5IDNA 5AP2A 2A1AB 4D2TA 4I6LA 2F2CB 3ANQA 5ACBC 2IW8A 2R3MA 4D1SA 3HAVA 2VNYA 5EI2A 3ZRKA 4ALVA 2XIYA 4K77A 4YC8A 5DGZA 5EK7A 2X81A 4GMYA 1YXUA 5IEVA 2DWBA 4JAJA 4M69A 3PY3A 3FMLA 4OTQA 4GUBA 2UVZA 1KUTA 2YAAA 4L00A 2REIA 3O8PA 3UNZA 1MQ4A 5ANDA 4ZY5A 1MP8A 3SRVA 2X4FA 4XX9A 2WAJA 2G01A 1ZMUA 1RW8A 4PL3A 1JKLA 3PZHA 1OMWA 4F0IA 3RJCA 1R39A 2C47A 2GFCA 4QOXA 4I4EA 3UO6A 4DC2A 4F4PA 5JFSA 5E1SA 4WKQA 4FT9A 3L9LA 1W84A 2JDTA 3PXRA 5IUHA 4F7LA 3FBVA 2B9HA 3RPRA 3FI3A 3CD3A 1SYKA 3I5NA 4F1TA 5TOZA 2E9VA 4EZ5A 3DKFA 4R1YA 1J91A 5C4LA 4YURA 3R8MA 5L6WL 3LFEA 4LOQA 3U54A 1JKSA 4CT2A 4NJ3A 2VTAA 4BDHA 4F7JA 4CKJA 3E7VA 2UVXA 2GHGA 3AD6A 3DB8A 5EKNA 4O4BB 3FLNC 4XEYA 3I0QA 5JGAA 4CRSA 2C6EA 3LFBA 3DJ6A 2J9MA 4MD9E 5AX9A 5B7VA 4A7CA 4KWPA 4OTFA 2QG5A 3NSZA 4Q2AA 4UALA 4RWLA 5M06A 2W4KA 3HRBA 3IO7A 4U97A 5EDQA 3DK7A 4MK0A 2QOKA 4FV8A 3GBZA 2DQ7X 3RPYA 4PL5A 4XMOA 2RSVA 2QHNA 3ZBFA 4XV2A 4R3RA 1G8KA 4FSRA 3W0RA 4PY1A 5JEBA 5BYZA 5IH5A 1GZKA 1OKWA 3ANRA 3QWJA 2YWPA 4GEOA 4NT4A 1OPJA 2UZTA 3F5XA 4R5SA 4XV9A 3CCNA 3C4CA 3I6WA 4CKRA 1XMLA 3UP2A 3PPKA 5HKMA 3SOAA 3QKKA 3BU6A 4IVDA 4NFNA 4YZ9A 2DUVA 3ZXTA 4D9TA 3MIYA 3OD6X 2HENA 4G6NA 3LIJA 5BX0A 3L8VA 1WBVA 2ZM4A 5H9BA 2W96B 5KNJA 3UNKA 4ARKA 3PJ3A 2PL0A 3QLFA 4BTMA 4NEUA 4FIJA 4NKAA 2PPQA 2G2HA 3V5PA 5CF6A 5AUUA 4EKLA 3AD5A 5AV3A 1J7LA 2YDKA 4I0RA 5ICPA 4DH5A 3OHTA 4ERWA 4IX6A 3DXNA 3ORNA 5D9HA 5H8GA 3W33A 2PZ5A 5GHVA 3QU0A 4AGWA 4BDAA 1OIRA 3VONA 1GJOA 2FSLX 5IU2A 5IQHA 3HDNA 3LXLA 4LFIA 3V5JA 2QODA 2X2MA 1HCLA 1O6YA 1PXMA 2ERZE 3HMMA 3KKVA 2WOUA 4O7TA 2EXCX 4YJVA 5E8TA 3AMBA 3F82A 2R7BA 3MY1A 4K9YA 4LRMA 5HBHA 2YEXA 3L9PA 5AFVA 2XCHA 1F0QA 5IA2A 2VTNA 4F9BA 4CLJA 5EYMA 2ZOQA 3E8EA 3VUDA 3ENHA 4FZFB 3C51A 4IMYA 5J79A 3NVMB 3FQSA 4O4CA 4DGMA 4ALUA 3F3VA 3QTRA 3GC8A 2XAOA 4FE2A 2BMCA 1G8JA 4RJ5A 5J87A 4BB4A 2R3LA 3IQ7A 3FPQA 4WG4A 3NFFB 3EQBA 4ANNA 5HNIX 4TYHB 3AC4A 4EH5A 3SVVA 2PZIA 3VNTA 2G9XA 3RAIA 1YI6A 4CNHA 1OBGA 4MXXA 4JDJA 3VBXA 4CGAA 3QC9A 3TNWA 3PA4A 5CT7A 5FM3A 2XBAA 4XNEA 3G0EA 1R0PA 2B55A 2R4BA 2WMQA 5HIBA 4WHZA 3VHKA 3WZJA 2C5XA 3EN7A 3ULZA 4DH1A 4EOPA 2X2KA 3KA0A 5T3QA 3UG2A 2BROA 2CGWA 5D10A 5HNBA 3AT3A 3ROYA 3GCPA 5FTGA 3ZSGA 5EDRA 4FRFA 4RQKA 5FP6A 3W0SA 4CRLA 1PJKA 4TZRA 3OVVA 4G9RA 4EK8A 1IRKA 3F88A 3GCUA 3MV5A 3Q52A 3LXNA 3GGFA 2B9IA 4X3JA 3UP7A 3VBVA 2GCDA 3DDPA 3FXWA 2VWBA 2B9JA 4RX8A 5AR5A 3NYVA 3II5A 1IA9A 1OECA 3MFSA 2YCQA 1UNGA 3MN3A 4H3PA 4MBJA 3RHKA 4EQCA 4F65A 1BL7A 4FIIA 4WSQA 3ZYAA 1FGIA 3ZC5A 1ZOGA 3A99A 4FKPA 1IASA 3QXOA 3NWWA 1FBNA 3VUTA 4EOQA 5LXMA 4QQJA 4TN6A 5CF8A 4BVUA 2XRWA 2JKOA 5EI8A 3ML1A 2YCSA 4IACA 4RC2A 5CVFA 3DKCA 3VBWA 2UW6A 4CFUA 2R3FA 1ST0A 4C3RA 4O84A 2GNGA 4WOVA 3EYGA 3R04A 4AOTA 5A9UA 3S00A 4UBAA 4ID7A 4YSJA 3U55A 3DBQA 3PIXA 1E1VA 4GRBA 3W0NA 5HBEA 3R0TA 5CSPA 3O23A 3COMA 3QX4A 4RFMA 4EOIA 5H3QA 1XH6A 1XJDA 2C68A 1QCFA 2QU5A 2WD1A 1JVPP 2A4LA 3OXTA 4PDYA 4CYIA 3MGYA 3OUKA 3FZPA 4EH2A 3EZVA 1OB3A 2QOIA 4EK3A 3POOA 3D5UA 3QC4A 4F7NA 3G51A 4O0YA 2A0CX 3G6HA 3PRIA 2R2PA 1UU3A 2VGOA 3RHXA 4ZLYA 3WF6A 4BFMA 4AXFA 2R3PA 2GQSA 1URCA 2XJ1A 5DBXA 4LL5A 3LKMA 1ZYLA 4BKYA 4BWXA 2OK1A 2YM5A 4XG6A 5BVFA 2YDIA 3GCVA 3SG8A 3ZLWA 4AGDA 3OEZA 1XH7A 4P5ZA 1YVJA 1YW2A 5B0XA 2VRXA 3AT4A 2UV2A 3R7GA 3E63A 4J8MA 4IAKA 4IM2A 4QPMA 4WBOA 5J7BA 4E6QA 4AUAA 4EOKA 2PVRA 3H9FA 1J1BA 1UNHA 1T46A 5AJQA 3F3WA 5HU9A 1UKIA 2C5NA 4K0YA 5HLNA 1OIYA 4YP8A 4O1PA 3ALNA 4S31A 4FNXA 3LLTA 3HECA 2ITPA 2PZRA 2OKRA 4TYIA 1ZRZA 4I22A 1UNLA 3KRLA 4X0MA 3BHUA 4BGHA 3ORKA 2O64A 1R78A 4KS7A 4AOJA 3BE2A 3EHAA 4EHGA 3GQLA 4YLKA 1Y6AA 1REKA 3BQCA 3NNXA 4FI1A 2IW6A 4J52A 4QMUA 4AXAA 4IVAA 5G6VA 2WMWA 4EHZA 2RKUA 4AA5A 5HQ0A 4X2FA 4TXCA 4IM3A 4E3CA 4RC4A 1IAHA 4E6DA 2OF4A 5JFXA 2OU7A 3QLGA 4G3CA 3FQEA 2ZVAA 2BFXA 4MX9A 5CEQA 2C6LA 4G34A 3LXPA 3QD3A 2W9FB 1H4LA 2W1GA 4JNWA 4KIQA 4U3ZA 3IG7A 3QTQA 3VQUA 3AC2A 4EH8A 1DM2A 4M67A 3F3UA 4ASEA 2VN9A 1XMMA 3FHIA 3G5DA 2J50A 2PZYA 4CMOA 1PMUA 4EJ7A 1V1KA 3EOCA 3L9MA 4XUFA 3MVLA 3ORPA 5LARA 1OPKA 3CQWA 3PA3A 5JGBA 4QMXA 5K4IA 5E1EA 1TKIA 1TQPA 1J1CA 1Q8WA 4JIAA 3NW5A 3GT8A 1K9AA 3UIUA 3KCFA 3O7LB 4FF8A 3RNIA 3LCOA 5D11A 5M57A 3WYXA 5AV4A 3LJ0A 4JXFA 5A4LA 2YDJA 3MPTA 4IXPA 2HZ4A 2SRCA 4WD5A 4AT3A 3P5JC 2Z7RA 2ONLA 4OBQA 5ETAA 4DFZE 2ERKA 5IEYA 1W98A 3O5AA 4CXAA 1NY3A 4FG8A 5IQAA 3N4VA 4CTBA 3W0OA 4W4WA 5JH6A 2QQ7A 4KD1A 3R2YA 4NH1A 4AA4A 4DEDA 2C5OA 4YHJA 4EWQA 2B0QA 4IAZA 3U9NA 4LUDA 5J9LA 3D94A 3JXWA 2X8IA 4ZLZA 3UQCA 3CQEA 2XK8A 4FV4A 3PFYA 2W5HA 2J2IB 4YJTA 4D55A 4BR3A 3LCDA 3OTVA 5D1JA 5ETFA 3ZFXA 4AW0A 5E92A 4IJ9A 5I3OA 4EBVA 4BDFA 3WF9A 5L2TA 3TUBA 1WCCA 3C4FA 3FJQE 2A19B 3COKA 4HVIA 2H6DA 4E5AX 3TM0A 3TZ7A 2DYLA 4C33A 5M09A 2PVHA 4DEAA 5CQWA 2R0UA 3W0QA 2Y4IC 3BHHA 3W0MA 4R78A 3R22A 4KIPA 3UVRA 3BE9A 4N0SA 4FOCA 3VJNA 5CENA 3FV8A 3D2IA 3JY0A 3UDBA 3CQUA 3IK3A 5LVOA 4EUTA 1MRVA 3R8PA 4YZDA 4E20A 3BZ3A 3BEGA 4H3QA 2R3JA 2YITA 1WBPA 1XBCA 5CSXA 2HYYA 4YC6A 4M69B 4AZVA 4EHEA 3FMHA 4ANBA 5EW3A 2O5KA 4HGEA 2XARA 4FNZA 4PPAA 2FGIA 3D4QA 4QTDA 2WFYA 4RX9A 3EMGA 1AQ1A 3FMMA 2QG7A 3HA6A 1JPAA 3TCPA 5BUEA 3V8SA 2Y4PA 4XLIA 3BGQA 1LPUA 2PZPA 4WNPA 2ZM3A 5HG7A 1NVSA 3R8VA 2AYPA 5CEOA 5DN3A 1TFFA 1W7HA 2PVKA 2YIRA 3QKLA 4B99A 4YUQA 4OAUC 3P7BA 4XOZA 2QU6A 1NT2A 4U42A 1FPUA 2X2LA 5IA1A 4HW7A 2J0LA 3VS1A 1XH4A 3F3ZA 5D7VA 3CKWA 4FV7A 3V51A 2WEIA 2WTKC 2IZSA 3GOKA 3C50A 4LRKA 3RAWA 3UOLA 3MH0A 1XHAA 4XG9A 3DJ7A 3R9DA 2UW4A 2CPKE 3F69A 5EFQA 3PXFA 4YJOA 3ALOA 3RBWA 3OP5A 2WMAA 5GJGA 2BAKA 4XG3A 3FL5A 4FSMA 4X2JA 2HZNA 5CQUA 3DKGA 2ETMA 1FINA 1PXLA 2OLCA 3C0IA 2YIXA 4S32A 4WO5A 1ZMWA 2Z7LA 3OOMA 1Q8UA 3ODYX 1BUHA 3ZFYA 4RIOA 3UMXA 2I0YA 1H8FA 2OH0E 3OWKA 2VWUA 3OWPA 4FG9A 4G1WA 3DCVA 2WB8A 4I0SA 2OZOA 5DEYA 3DPKA 4ZSEA 4BYIA 3AC8A 4JR3A 2BHEA 4FV3A 4M68A 2E9OA 5E7RA 3P7AA 4G16A 4FTIA 1HCKA 3O7LD 4CMUA 2BZKB 1WBWA 2BZIB 3DFCB 2J7TA 5LOHA 5JT2A 3FKNA 3NYXA 3S3IA 2P4IA 3E8NA 4RVLA 3LHJA 3OFMA 2O8YA 3D7TB 2XKDA 3E7OA 3R1NA 4HOKA 4G6OA 5EM7A 4RVMA 4P4CA 2UUEA 3LM5A 4O0WA 4R3PA 5IEXA 5CAUA 2PU8A 4UEUA 2QVSE 4BCPA 4IE9A 4GT5A 3Q2JA 5C8MA 3L8SA 5EI6A 3SRVB 5KHWA 3DQWA 4FKJA 3TJDA 4BIBA 4CTCA 3CSVA 4APPA 4IIRA 2Y8OA 2C6OA 3R9HA 5JMSA 5HCXA 5HTIA 4MD8E 5AP5A 3UPXA 5LVMA 4O6LA 2XANA 5CEIA 5FLFA 4MXZA 3SD0A 4U79A 2XJ0A 5HX8A 2C6IA 2RFDA 1RQQA 2ZAZA 3Q4CA 3AMAA 4L7FA 3R7YA 5KX8A 4O27B 1YXSA 2GS6A 3NLBA 5C03A 4L68A 1KE8A 4PX6A 4RWJA 4AE9A 3ELJA 4RPVA 2IO6A 3QUPA 1B38A 5IQBA 3TNHA 4APCA 1GY3A 3E8DA 3TMOA 3TZMA 3UIXA 3F2RA 3PXQA 3BV3A 3W0PA 3ZH8A 4N4SA 5HIDA 1VJYA 3FMNA 3RK5A 3R02A 3EIDA 4D4SA 3GENA 2YCRA 3ITZA 3ZLYA 4RZWA 3EWHA 2ITXA 4PWNA 3UZTA 4MXAA 3GNIB 1UA2A 4KUJA 4L8MA 4PMPA 1R1WA 3D7TA 4OTPA 4D2PA 4YTHA 3PIYA 5AR7A 3BU5A 4RSSA 4EONA 2OXDA 4FT3A 4DH3A 3KFAA 3TJCA 1NVRA 2E9UA 3KC3A 4DDGA 4H58A 3VF9A 4ZSJA 4CCUA 4PMMA 2FA2A 3PSDA 3EKKA 1IA8A 3MYGA 2WMUA 4Y5QA 4ZJJA 4ASDA 4X6QC 4FR4A 4DCEA 3DZQA 3G6GA 4MH7A 4MNEA 1W2CA 2ZV2A 4FSTA 2OWBA 4I6FA 4C02A 4BWKA 2X39A 4JAIA 3UIBA 4ENYA 2VWYA 4HZSA 2B9FA 3RGFA 4B6LA 4ZSAA 5HU3A 3A62A 4KNBA 4EH7A 4LM5A 5EDPA 4NFMA 3L1SA 4FICA 3EH9A 3KL8A 3DBDA 4E8AA 4FGRA 2X6EA 1Q3WA 2XK6A 5C8KA 2W1FA 3LPBA 2QOFA 3NUNA 3SGCA 1U54A 4ZP5A 4NM7A 5HLPA 4HPUE 4GG5A 3MVJA 2JD5A 4LI5A 4KIKB 5JFVA 3HUBA 4WNOA 4W9WA 4EYMA 3DXQA 2BFYA 4QDVA 1FVTA 2ITYA 3IONA 2XNMA 2UW5A 2ZFYA 4PL4A 5CSWA 1DAYA 2VO7A 4F0GA 3PLSA 5DNRA 1PKGA 2QLUA 3FI2A 2XAMA 4X6RA 5JRSA 1W0XC 4CT1A 4FIGA 3U51A 2WKMA 3ACKA 4WNKA 3R00A 3UZRA 1U54B 3HKOA 2PE0A 3GQIA 4G9CA 3V8WA 2X7GA 4L7SA 4QEBA 4ANQA 4QP8A 4BDJA 1WBNA 3DBCA 4KIKA 3QGYA 2XBJA 2VWXA 2YFXA 2QC6A 4HPTE 3BWFA 4JL9A 3DAJA 4YNEA 3SX9A 4EWHA 3KK9A 5AA8A 3FLWA 3PDTA 1YXTA 5E8YA 3G0FA 4QRCA 4FKVA 2VD5A 1UWHA 4FK6A 3TKHA 1BL6A 1SVHA 4YO4A 1NW1A 3UDTA 1WVXA 5FQDC 4GH2A 4DYMA 4NL0A 4ZMFA 3BX5A 4QP4A 3P4KA 1P2AA 1VZOA 3QRIA 5AV2A 5H8EA 3U9CA 1FVVA 1PXIA 3F5PA 4DAWA 3LCKA 4KIOA 3BHVA 4L44A 4QYYA 4AA0A 4J1RA 2QO7A 4YHTA 2FO0A 1ZMVA 1QPCA 5CU3A 4U0IA 3QUDA 3NZ0A 3EQGA 4GFGA 4PQNA 5LMKC 3KMWA 3QRKA 3O8UA 4Z7HA 4RJ7A 2QO9A 4EJNA 4XBRA 4XV3A 4FYOA 3VUKA 3BHTA 4LUEA 4F9YA 2UW9A 5E8SA 2GTNA 3DT1A 3PSCA 4L46A 4CFNA 4IX4A 4XG2A 1Y6BA 3QRJA 3ERKA 1JKTA 4I21A 3BQRA 3UE4A 1KE5A 3F2AA 4QP7A 3COIA 3OY3A 1PYEA 4ZZNA 3S95A 3VQHA 4XLVA 4JBOA 2LGCA