4CQGA

The crystal structure of mpk38 in complex with otssp167, an orally- administrative melk selective inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
330
structure length
313
Chain Sequence
b'KDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKCGSLAYAAPELIQGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSKTPLTHLDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maternal embryonic leucine zipper kinase
publication title The crystal structure of MPK38 in complex with OTSSP167, an orally administrative MELK selective inhibitor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 103
structure length 313
sequence length 330
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cqgA00
2WD1A 2EXEA 3PTGA 4YZBA 4KABA 1PY5A 5KNJA 1PXLA 4FKLA 2UZOA 4KS8A 5CEKA 3TIZA 5EYDA 2W1DA 3F9NA 2C1AA 3DBEA 2BFXA 4FEQA 2VN9A 3LFEA 3LMGA 3BLRA 4FIJA 5KBRA 3FY0A 4F7NA 3WF5A 4KAOA 4R1VA 4CMTA 4MVFA 4BYJA 2VWBA 3QXOA 3RHXA 4B7TA 3FDNA 1RQQA 4IDVA 4AOTA 1Y8YA 3DBFA 3MN3A 3W8LA 2YM6A 3U4UA 2VTHA 2E9PA 2RGPA 4TW9A 2W4OA 4AAAA 3MJ2A 2PVFA 3DZQA 3GU8A 5LWNA 4YTCA 2X8DA 4QP2A 3U6HA 3FMKA 2GU8A 3Q60A 4AE9A 3TNPC 5CAQA 5JGBA 3DBDA 4D5HA 3ENMA 1EH4A 3BCEA 3QHWA 2XK4A 4OR5A 1B6CB 4LM5A 2WMAA 2OZOA 4UMTA 3UBDA 2OI4X 5CTPA 3IKAA 5DVRA 4UYAA 5TT7A 4RVMA 5J5SA 1Q8ZA 4LYNA 4JLCA 4KIOA 2XK9A 3PXKA 4DYMA 1W83A 3I60A 4EHVA 3HEGA 2PUUA 1MP8A 4IBMA 3MGYA 2ITOA 5ANJA 4Z16A 3PP1A 3PE1A 1U54A 3QXPA 5CT7A 5EW8A 4AZTA 4DH8A 4E4XA 2X7FA 5LXMA 4FKVA 2E9OA 4BDFA 5IA5A 3KXGA 4ZXTA 3RM7A 3D7TB 3R2YA 2C1BA 3D2IA 1MQBA 3K3JA 4C57A 4YR8A 5IA3A 1YDSE 5DH3A 3O0GA 5GJDA 4AA4A 2BFYA 3Q4TA 3TIYA 2G9XA 2YM7A 3EFJA 4I21A 4A07A 3FMMA 5IZFA 4EL9A 4ZTMA 4WO5A 1XHAA 3EN4A 3CEKA 4TYJA 3KVXA 3NSZA 2BZHB 3ZCLA 4PDSA 2HENA 5L3AA 4RFMA 3R7EA 4R5YA 2W1CA 5HLNA 4BI2A 3W18A 3CCNA 4E6AA 4ALVA 4C0TA 5DLSA 1T46A 1FINA 4YPDA 4X21A 3UP2A 3T9IA 2W1IA 4FSRA 3KGAA 3KULA 2B55A 2BPMA 5DT0A 5L2IA 1Q8TA 5EI6A 4ASZA 4KKHA 2ITUA 3VBXA 4QP1A 2ITNA 4Y73A 2XM8A 4XG6A 3RZFA 3PIZA 4EKKA 2ITXA 4JBOA 4YJUA 2X8IA 4FV4A 2V55A 4EUUA 4OLIA 2DUVA 3OZ6A 4WHZA 4BDJA 3LQ5A 4DG0E 5E8WA 5EM7A 4RMZA 4EZ3A 3NNXA 1OZ1A 4RIOA 5JGDA 5FLFA 2HK5A 2WTJA 2R0IA 4PMTA 4YPSA 5T6KA 1Q97A 1J91A 3C4ZA 3PRIA 1FOTA 3BV2A 4U5JA 1JOWB 3VUGA 4ALWA 3I6UA 5DA3A 4K8AA 3ZM4A 3NUYA 4PUZA 4PRJA 3DGKA 3GU7A 5CWZA 4UXLA 5HKMA 3FXWA 4Y8DA 2VRXA 2AC3A 2X2MA 3PWYA 2PZ5A 4ZSLA 4FV5A 3D15A 2ZJWA 3PWDA 3WF8A 3QZFA 2HYYA 3GFWA 3V5TA 5CXZA 4NKSA 4Y5QA 3C4EA 4BYIA 4TWCA 5DT4A 4N4SA 4PMSA 2YAAA 4FK6A 2YDJA 4MBIA 2W1HA 4FOCA 3QTQA 4P2KA 3AD4A 2QVSE 3AT4A 1IA8A 3B8QA 3IQ7A 4D4VA 2HWPA 1GZOA 4TRLA 5FP6A 4V0GA 2ETMA 3JYAA 4E4MA 2VTSA 3QGYA 3VF8A 2GCDA 1JVPP 3UE4A 3OUNB 4W9WA 3R30A 4U44A 3F82A 3MVLA 4QYYA 4FVQA 4BCHA 5IUIA 3GCUA 3RINA 2WOTA 3F5PA 4XRLA 1OMWA 4WRSA 4FF8A 4ZLZA 2E9VA 4H1JA 2NRUA 3IOKA 3QWKA 5A6OA 4IDTA 5AUXA 2EUFB 1WBWA 1E1XA 3HV4A 5DWRA 2O3PA 5BVNA 1XH7A 5DHJA 2PVNA 3CD8A 4I22A 4C4JA 2OH0E 4G16A 4QTDA 5CT0A 4F9CA 3DTWA 3Q32A 5DMZA 4ZTLA 4KD1A 4AP7A 4FKUA 4APPA 4E73A 1H25A 3S00A 2BZIB 4J7BA 4EK6A 4H36A 4YNEA 4EZ5A 4QMQA 3DTCA 1YI3A 5ANKA 3SRVB 2O5KA 5EHLA 3CR0A 1J3HA 4FTQA 4AU8A 3QRUA 1M52A 1VZOA 4Q9SA 3ANRA 5J1VA 4C33A 2EU9A 4HCUA 1YOLA 4NTSA 5A3XA 4JQEA 3R9OA 5M4FA 3D0EA 4HJOA 3LM5A 2ITZA 1ZRZA 1URCA 4FTRA 4NTTA 5EM5A 2VO6A 2I6LA 4E5AX 5I9UA 2CKEA 5TO8A 3W1FA 5CAPA 5AR7A 2HCKA 1PMNA 3RM6A 4B8MA 3QC9A 4PV0A 2FSMX 1OB3A 1BI8A 1H24A 3C0GA 3UVPA 3OD6X 2XNEA 3ORIA 3TNWA 5J7HA 4L7SA 4Y83A 4JNWA 4BC6A 2UZDA 2QOKA 1JPAA 2OIQA 2QD9A 1SNUA 5K0XA 3NUUA 4DEBA 5FWKK 3ZS5A 4YGAA 2XIRA 4FNZA 3R0TA 3BYMA 4DFZE 5CF8A 3DJ5A 3E93A 2XJ0A 4W4XA 4IZAA 3POZA 2YABA 5ITAA 5AV1A 3DNDA 1AQ1A 2I0EA 2R64A 3B2TA 2XNOA 5AV0A 3A4OX 4FZDB 3LFSA 4MH7A 3R7UA 4BZOA 3Q6WA 1O9UA 3EL7A 4HNIA 2Z8CA 4L53A 3D5XA 3K5UA 4RFZA 4HVHA 3QRTA 1JSVA 2J9MA 2X4ZA 4C3FA 4WG5A 2EVAA 3UTOA 2XNBA 3QUEA 2HZ4A 4H58A 3JS2A 1TVOA 3BU6A 4ZTNA 5LVLA 4EUTA 3LM0A 5CY3A 5J95A 4DH1A 2QOOA 2W7XA 4IAAA 4NK9A 4QMPA 1W98A 4I6FA 4BGGA 4JBVA 3G0EA 4PF4A 3FY2A 4GS6A 5C9CA 3BYVA 2XBAA 3ODZX 5BVKA 5CSWA 2Q0BA 1WBOA 2XCKA 3O17A 4M68A 4AFJA 5HD4A 2XK3A 5BVDA 2RL5A 2V0DA 5LARA 4FICA 4K0YA 4K18A 5EW3A 4F0GA 5HOAA 3CQWA 4QMTA 1QPDA 4IQ6A 4JXFA 5FD2A 3IK3A 4QMNA 2ERZE 3TTIA 3VN9A 2QURA 2FSOX 4MQ2A 4CEGA 3SW7A 2C6EA 2VWYA 2W4KA 2ZAZA 4WOVA 5L8LA 2XA4A 3K3IA 4U97A 3QWJA 3ZUVA 3W2RA 5FXRA 4XOYA 4IX4A 5IF1A 3D4QA 3P78A 4FTLA 5JGAA 5LVOA 5CU2A 2C3LA 2UW8A 1PMVA 4GK3A 3R7OA 1IEPA 4FR4A 3EQGA 4ANLA 3IOPA 4JIAA 3R9HA 3WBLA 3OWKA 4Z3VA 3P5KA 3PIXA 4OTPA 1OL6A 4U6RA 4UV0A 4XG7A 3SKCA 5HX6A 3FAAA 3O2MA 4NU1A 4XNEA 4JR3A 3QKMA 5DT3A 4QNYA 4KBCA 5KE0A 3TWJA 1OIUA 4EOMA 3E8CA 3EFLA 3OCGA 4CFFA 5HORA 3WYYA 5TOZA 2UZBA 4ZZMA 3V5WA 4DFLA 5CEPA 4MF0A 4AG8A 4EHZA 3PUPA 4J8MA 5LMKC 3SDJA 3Q4UA 4L00A 3UVQA 3R71A 2CSNA 4CFNA 1R39A 4DG3E 3PYYA 4EK4A 3BZ3A 4G3GA 4E7WA 4OBOA 3LCKA 4FKWA 4OTWA 1SVGA 3G5DA 2YM3A 5H9BA 5A46A 3DKCA 4IWDA 3NR9A 4NCTC 4G34A 4TNDA 4WKQA 4YNOA 5M53A 2WTIA 3DKGA 4GJ3A 4D1SA 3LHJA 3AC5A 5E8YA 5LQFA 1VYZA 3AMYA 4XUFA 2XK8A 5K4JA 3EN5A 1GZ8A 2ZM1A 4AN9A 2R3KA 2OICA 3GQLA 5KBQA 1NVRA 3C51A 4ARKA 4AX8A 4BTMA 5TR6A 2E9UA 3KY2A 3BPRA 4GT4A 3ACJA 4YLKA 4CKRA 2QO7A 4MF1A 5A54A 4XHKB 2JDTA 4II5A 4D4SA 2PMNX 2XEZA 4C2VA 1ZOHA 2UZWE 2KULA 5KZIA 1F3MC 3GUBA 2JGZA 3EN7A 3GOPA 4C59A 2C5XA 4FIIA 4CKIA 1ZYJA 4RX5A 5JFXA 4Y72A 3VQUA 1M7NA 4KBAA 2GNLA 4GCJA 3EQBA 3HZTA 4QQ5A 4R8QA 2VWIA 4K6ZA 3L9MA 3L9PA 4FIHA 4WIHA 2BDWA 4IACA 4GK2A 4PY1A 3SD0A 3FMHA 3FZPA 1H1QA 1YVJA 2R4BA 5HX8A 4LQMA 4Q2AA 4P5ZA 1R3CA 2WQBA 4UWBA 4BTFA 5A4LA 3SLSA 2AYPA 2YACA 1WBVA 3FBVA 4P90A 4FNYA 3G90X 3BHHA 1WVYA 4F7LA 1FQ1B 1YOMA 4K77A 4RA5A 5HE0A 5HO7A 4E93A 4FSYA 4U43A 2NO3A 4RIWB 4XP3A 4YSMA 5ANGA 3QC4A 4M67A 3T3UA 3ZO3A 3CGOA 2X7GA 3FV8A 4RIXA 3V04A 4LL5A 2BRHA 2GTNA 1UWHA 3W2SA 1H0VA 3O7LD 5JFWA 3QCXA 4FMQA 4ACCA 4S32A 2R2PA 4ZSJA 3TNIA 5DRDA 5HICA 3KRJA 3SQQA 3RAWA 3IG7A 4NIFB 5A4EA 4KB8A 4I93A 3PJCA 4FNWA 4OTGA 2AC5A 3HKOA 3D14A 3I0OA 3ZXTA 4BI1A 4AT4A 3TZ7A 3Q5IA 2WPAA 5C27A 4BGQA 3CKWA 4WUAA 3E64A 5HVYA 2DS1A 1KV2A 3IECA 3UNJA 4U7ZA 3CTJA 4X2FA 5CX9A 4BGHA 1U59A 3AQVA 1KWPA 3OXZA 4LUEA 5DI1A 1UKHA 5J8IA 4CRLA 4G3FA 4FTTA 2O8YA 3BELA 4BN1A 4IB3A 2QHMA 4DH7A 4BCJA 4I6QA 4U80A 5J87A 3WF7A 2E2BA 2OJGA 2XH5A 4M15A 4EHEA 3PG3A 3HMOA 4EH8A 2VNWA 2OWBA 2WTCA 2YHVA 3MYGA 3R8PA 5K0KA 5CAVA 4YTHA 1Z57A 4WD5A 4K9YA 3L8SA 2A2AA 4CZYB 2J2IB 4QP7A 2WIHA 3RTPA 4FVPA 1ZY4A 4MCVA 2CPKE 4FTMA 4DGLC 3CXWA 3Q96A 4E3CA 5AR5A 1TQIA 3F3UA 3EYGA 5KZ0A 4M69B 3OOMA 5A6NA 2YWPA 3U6JA 3ORPA 1Q99A 3KU2A 3Q04A 3LCDA 2JIIA 4QYHA 4YZDA 3C0IA 3R73A 5HEZA 3UO6A 2OXDA 5L6OA 4LGHA 4L6QA 4S30A 4CZUA 1U4DA 2J0JA 3A7HA 3VBYA 2PZYA 1Y6BA 4R3RA 5EM6A 1BMKA 4D5KA 3Q9YA 1KE9A 5AR3A 3TZMA 3BRBA 4AA0A 4BI0A 2BR1A 4I5CA 4IX6A 2XEYA 3VS1A 4IM2A 3VF9A 4RC3A 3VQHA 3R9NA 2H34A 3SW4A 2XZSA 1OECA 3F69A 1V1KA 3KXMA 5BQ0A 4PP7A 1MQ4A 2DQ7X 3PZEA 4H3PA 3KFAA 2VU3A 4O0WA 5CVGA 4EEVA 1J1CA 3LQ8A 4HYHA 3RGFA 3FPMA 4F4PA 2UZTA 3BHVA 3NLBA 3PSCA 4K2RA 4YZMA 3OT3A 1KE7A 3ZDIA 4F9YA 2HW7A 2F9GA 3EN9A 2XNGA 2GSFA 3ZZEA 2WO6A 3LCSA 2J5FA 2GNJA 1Q8UA 2YJRA 4G17A 5CZHA 4DFYA 4IIRA 3HRCA 2IJMA 2GHGA 2OZAA 2UVZA 3QD0A 4JX7A 2OXYA 2UVXA 4L43A 4OTIA 5DG5A 4ZY4A 3CPBA 4ITHA 3R7VA 2I0HA 4XX9A 4P4CA 5M57A 4FSMA 2XIYA 5FDXA 3BQRA 4FT0A 4TL0A 2IVSA 1JWHA 5BVWA 4BKJA 2QG5A 5JKGA 5HE2A 4JX3A 2VX0A 2EB2A 4IAZA 5LCKA 5GJFA 4EH6A 4CFWA 3HP2A 3QTXA 1SMHA 2DYLA 2XMYA 4D2VA 4C62A 1ZZ2A 1CTPE 4BKZA 5BNJA 4QQTA 2C0TA 2G15A 2H6DA 4AS0A 2W17A 3ENHA 4FOBA 4LV8A 4M97A 4O1PA 3MY1A 1CMKE 3CS9A 3F3ZA 3GNIB 3OBJA 4J53A 2R3HA 3FMEA 2GS2A 3EQIA 4MNEB 3WZUA 4W4YA 2Y0AA 4EH7A 4UB7A 5KO1A 4HZSA 5CNOA 3EOCA 4MBJA 3QALE 3BU5A 3OF0A 4AZFA 2JAVA 2B9IA 3GU4A 4AGDA 2IVUA 4C4HA 3ACKA 3VVHA 5M55A 4D1ZA 4BL1A 3LJ1A 2A1AB 4UBAA 1VEBA 5I3RA 5J1WA 5HIBA 4O2PA 4FKGA 4YLLA 4IHPA 2QLUA 4IAFA 3BWJA 3QLGA 3QQKA 5CF6A 2BIKB 3L9LA 3JXWA 3V5PA 3UMWA 3UOJA 4ZJJA 4ASXA 1JSTA 4U79A 4UY9A 5HBHA 5BUIA 3BV3A 2CGWA 3TL8A 3RZBA 3RCJA 3QTSA 3VUKA 2GHMA 3PG1A 3ALNA 4YJVA 2XKCA 3NEWA 4MWIA 2PY3A 1ZYDA 3LFAA 3R63A 5FXSA 2OU7A 4GW8A 4RBLA 3VUHA 3D94A 4Z7HA 5EHYA 4U9AA 3I0QA 2JLDA 4QYGA 5D41A 3FYJX 5BYZA 5IUHA 3KXHA 4QD6A 2UZNA 4IJ9A 1OKWA 4CYJA 3P0MA 2XKFA 2BRMA 1WBTA 3IW8A 5FQDC 3EB0A 3OY1A 4FT9A 3KRRA 2YITA 4JDHA 3V3VA 3FLYA 3FZTA 4PWNA 4MYGA 3MS9A 3ZRLA 3ZYAA 2WOUA 3DDPA 3PP0A 3OEFX 1P2AA 3BLHA 4XOZA 4X6RA 4OAUC 3AC2A 3LFFA 1H0WA 4JS8A 2JC6A 5DEWA 3ORTA 4AZEA 2VV9A 3E3BX 4XG9A 5IU2A 3AMBA 2YERA 5CEMA 5CSPA 4S2ZA 2C3KA 4WBOA 2I1MA 3WIKA 3FZSA 4DINA 5CNNA 4GYIA 3V5LA 2Y9QA 1JKKA 2W1ZA 2C4GA 1WMKA 3OW4A 4OBQA 3H4JA 3UOKA 2QR8A 2JDOA 3F7WA 4ZZNA 1YXTA 4O1OA 2XM9A 5ETCA 3BEAA 4ALUA 4B6LA 4DEEA 3F66A 3Q9WA 2C47A 3TTJA 3QZIA 1XH5A 4G5PA 4I5MA 5EM8A 4WRGA 5H8BA 1JBPE 3ORKA 1H26A 3AT3A 4RT7A 2WU7A 2AUHA 3C4XA 4ZK5A 3FPQA 2PVRA 3FZ1A 5JK3A 4RVKA 2VWWA 3QRKA 4I3ZA 4NJ3A 2R3JA 3AC3A 4QMSA 4R7HA 4EH9A 4GVJA 2DWBA 4EOSA 3ULZA 3EWHA 2QHNA 2UVYA 3HECA 2OW3A 1JLUE 3TXOA 2GDOA 3L8PA 3EHAA 4PQNA 5ACKA 3D7TA 1G3NA 3LZBA 3WILA 3ZUUA 3UO5A 4JRNA 3CLYA 3CP9A 4RVLA 3W2QA 3SOAA 4X3FB 2YCFA 3HRFA 1FPUA 4QP8A 5E90A 3SHEA 4E5BA 1H00A 1W82A 4ENYA 4RIYB 3KRXA 4A4OA 5M4UA 1S9JA 3BKBA 3QL8A 2QI8A 5F20A 5L8JA 2VTRA 1ZYSA 1MRUA 2PZPA 2RFEA 5CANA 3VC4A 3VBQA 3PA5A 3QHRA 3O96A 4FUYA 3TCPA 3ZO4A 4N70A 3W32A 4TYHB 3MH0A 4OT5A 2JIVA 5C01A 3HUCA 3FHRA 1PXMA 3PXYA 3UIMA 3FSKA 4A9SA 4O96A 2XRWA 2R7IA 3FWQA 5EOLA 4JRVA 2H9VA 1QL6A 4RJ5A 4IW0A 5AUUA 2ZM4A 3ELJA 2H8HA 1MRYA 4XEYA 5L2WA 4WUNA 3Q9ZA 1JKTA 2HZ0A 3PXRA 5IH6A 5CYIA 2CGVA 4OTDA 3UQCA 3ZLWA 4NW5A 1GNGA 4HPUE 5I0BA 4L3LA 4UMPA 4EHGA 3QFVA 1PYXA 2XRUA 3KEXA 4UMQA 1WAKA 2HY0A 2XKEA 4FG7A 2FB8A 2IW6A 3DB6A 3MFUA 3NW7A 4FZ7A 4XG4A 1V0PA 2WXVA 2RFDA 1O6LA 5EH0A 4MEDA 2E9NA 2P0CA 4NWMA 3ZH8A 3KCKA 4YP8A 4JI9A 4A7CA 1YKRA 4FNXA 3OBGA 1J1BA 1KE6A 3MIAA 3RJCA 4HPTE 2ITVA 1NVQA 5A4TA 2PL0A 4I20A 4ZZOA 3MTLA 5J79A 3IW6A 5F4NA 2PZIA 1IG1A 3UP7A 3K2LA 1WBSA 2CDZA 2V7AA 3DNEA 4EH5A 1K3AA 3OROA 3VBTA 3VHEA 5K3YA 3S3IA 3R01A 2XBJA 4GV1A 4Q5EA 2BILB 2JDVA 5LMKA 2QLQA 3D2KA 4EJNA 1GAGA 1ZYCA 4QQCA 4HGSA 4NCTA 4EOOA 2JDRA 4XG2A 4YC3A 3VS4A 5H8EA 5DNRA 3EZVA 4IWOA 3R8ZA 1BLXA 4QO9A 1WVWA 2C6DA 4PPCA 1ZY5A 4IWPA 3UZPA 3GC0A 3EQDA 3H10A 4A4XA 4UEUA 4DGMA 3QRJA 3D7ZA 4JVGA 3JUHA 3ORNA 5FEQA 1I44A 2OK1A 4QTCA 2YM5A 5EG3A 5GZ9A 2QKWB 3E7VA 4EQUA 5BPYA 1Q3DA 2CGXA 5HG5A 5BVOA 3GCSA 1SNXA 3R1YA 2UW0A 4E5WA 4ZOGA 5CSHA 5EK7A 3EN6A 3OCTA 1UU7A 3BU3A 4RZWA 5IDNA 4O2ZA 3RMFA 5CENA 2YIRA 2UW5A 4YJTA 4QT1A 3RPYA 3COKA 1JAMA 2WQNA 3AXWA 5H2UA 5HHWA 4L9IA 4S31A 3P4KA 2YEXA 3FI4A 2F7XE 4FKQA 4C36A 1CKIA 1IASA 5CI6A 5EFQA 2OJFE 1YI6A 1PKGA 3I79A 3SRVA 3BGPA 4EK8A 2P4IA 3E87A 3ZMMA 2PVHA 3PSDA 5I3OA 2WMRA 5KMJA 4JQ7A 5E91A 1UNHA 3MSSA 5EI2A 2QOQA 1X8BA 2WEIA 3V6RA 2ZV9A 4RJ3A 3FL5A 4MKCA 4QMLA 4F65A 3CIKA 4YURA 3MWUA 3QD2B 4GYGA 2QKRA 2BROA 4DTKA 2WFYA 3JY9A 5BVFA 3MA3A 3GENA 2YJSA 3DK6A 4PPBA 4V04A 3RNYA 1HCLA 3F3TA 2JDSA 2VAGA 3CD3A 4EK5A 3EMGA 2BTRA 4FKIA 2UW9A 3UQFA 1RDQE 2F49A 3B8RA 1O6KA 3EKKA 1URWA 2ETRA 5L2SA 3ZDUA 3Q5ZA 2LAVA 3HUBA 3NW6A 5H8GA 4YJQA 3ROCA 4C38A 5HCXA 4B4LA 5I9XA 4QYFA 4JDIA 4X2NA 3CBLA 5FEEA 2F7ZE 2EWAA 3N9XA 4QPSA 1QPJA 4CMOA 3DFCB 3ET7A 4UX9A 2W5AA 3QA0A 5ETIA 3PY0A 2V5QA 4PL5A 5AA9A 2HW6A 2WZJA 3F7ZA 1JKSA 4EC9A 4IC8A 3ZLXA 4BDDA 4LOOA 5ETFA 5KMLA 3MH3A 4KWPA 4AN2A 4X3FC 5L2TA 1PYEA 4CSVA 2GS7A 3WE4A 1TQPA 2ZV2A 4EH3A 2JKMA 5AWMA 4R6VA 4CNHA 4O0UA 1W7HA 4KSPA 4BCNA 5F9EA 5KMIA 1RJBA 2O65A 4F70A 2WMBA 1APME 2XK7A 4ENXA 3OVVA 4IFCA 5JZJA 3BX5A 3ITZA 3F5GA 4J98A 4AF3A 4YHJA 1OITA 3TEIA 5CVHA 3D5WA 3RCDA 4O0XA 1YHSA 4X6QC 4BF2A 4KKGA 2J6MA 5AUWA 4D1XA 2JAMA 2CLXA 5AP1A 4C61A 2C6MA 4USEA 4LI5A 3SA0A 3SXFA 2YAKA 4LV5A 4TWPA 3FLSA 3OT8A 4DLJA 1LEWA 5AM6A 4NFNA 3H0YA 2C3IB 1Q24A 2J90A 4N6ZA 4O27B 3WF9A 1Y57A 3GU6A 5E8XA 2VD5A 4C35A 3PA4A 2Z7QA 3V5QA 3TJCA 3ZXZA 2BAJA 4F63A 3PY1A 1ZLTA 4IB5A 1W84A 4DBNA 5HG7A 2C5OA 4CT1A 2R3FA 3QLFA 4RPVA 3LPBA 2C0IA 5EOBA 1QPCA 3MDYA 4RWIA 4GVAA 1MUOA 2IZSA 4G3CA 4ANBA 3PJ8A 4ZLOA 2O63A 4BDKA 4EQMA 2J4ZA 5EKOA 4XG8A 5B7VA 3CQUA 4GU6A 4FX3A 4R3PA 1WCCA 3NUSA 4UYNA 5AR2A 5HU9A 2V22A 3OCSA 3ORZA 5HCYA 3RPRA 1Z9XA 4FIEA 2J0MB 4BTKA 3ZO2A 1GIHA 5I9WA 1Z5MA 4FV2A 2X2LA 4FUXA 3W16A 2P2IA 3NGAA 1NY3A 5FDPA 3RK5A 3C0HA 3F3WA 4IZ5A 2ZOQA 4YTFA 4XV1A 1OGUA 4BCPA 2VWUA 4HVIA 2QODA 3TKIA 3UPXA 2BHHA 2PTKA 3MVHA 3ZZWA 2F7EE 2FSLX 4LRMA 1LPUA 3E7OA 1U46A 2GQGA 2OFVA 3LXPA 3VW6A 3KA0A 3KVWA 3R7GA 5LVNA 3DQXA 5ANEA 4D28A 3WI6A 3R8UA 2C68A 3IPHA 4NW6A 3PJ1A 3MY5A 4C4FA 4BIDA 2X2KA 4C58A 4CQGA 4FIFA 3FKOA 3ZU7A 4GFOA 1YDTE 4RG0A 3MH1A 3QTWA 3GCVA 5D7VA 5LWMA 5IMEA 1SVEA 3OXTA 3W2PA 2CCIA 4S34A 3PFQA 4RFYA 4F6WA 1YWNA 1PMEA 2BZJA 1DI8A 1ZMWA 3LOKA 2W06A 3MFRA 3PJ2A 4XG3A 1V0BA 4YO6A 4NEUA 5D7AA 3ZSGA 4YJSA 1K9AA 3ORLA 2XB7A 4HVSA 3PY3A 2UZUE 3NCZA 4RX8A 3DAEA 3NYNA 3TZ8A 3UNKA 4E6CA 3QTIA 1L3RE 1OVEA 2ITTA 4U3ZA 1OI9A 4XS2A 3TZ9A 2OJIA 2WHBA 3HRBA 4GH2A 3C4FA 3LE6A 3RK7A 4G9RA 5AM7A 1YHVA 2CN8A 3RWPA 1P4FA 3EKNA 5HD7A 4BHZA 4J1RA 4MD9E 4RIWA 1NXKA 1H28A 4BIEA 3DOGA 4YUQA 5AAGA 4XRJA 5E1SA 5AP2A 4CV8A 5LMAA 1U5RA 4FTCA 4EQCA 4BVUA 3UMXA 4FIGA 3E8NA 3QQGA 3I7BA 4L01A 4RX7A 3POOA 4NM7A 4F6SA 3EL8A 2BDJA 2PZRA 1YWRA 3COHA 3ANQA 4BBEA 3S4QA 3UQGA 4KS7A 3NW5A 4NIFA 4HZRA 1XBBA 2X6EA 2J50A 2YM4A 4C3RA 3ZC5A 1HCKA 1REJA 2QO9A 4WNPA 2C6KA 2WMSA 3Q52A 2BTSA 3KF7A 4EYJA 3SXRA 4EH2A 3OW3A 4IADA 4MTAA 3T3VA 5CU0A 4EOPA 1XH4A 4CTBA 2F2CB 3L8XA 4TY1A 1R0PA 4FL2A 5A9UA 4KBKA 3I5ZA 3BE9A 4HW7A 3MPMA 3GCQA 4JAIA 4FV8A 2ITPA 5I9VA 3PVUA 4EONA 4ZY6A 3TNQB 5FTQA 5BMMA 4ZSGA 1AD5A 3COIA 2OJJA 3RKBA 1ZZLA 5KKRB 4EI4A 5DRBA 3IW5A 2OJ9A 3PPKA 3ZFMA 5HVKA 3RK9A 2VO0A 4D2SA 5HTBA 4WT6A 3MW1A 4AFEA 1XH9A 3R9DA 3IDCA 5ANOA 3AC1A 3MBLA 1AGWA 4ASEA 1LP4A 4RJ6A 3VUTA 4GT3A 1OIYA 4FTNA 2QC6A 2RKUA 4CVAA 2J0LA 4AE6A 4R7IA 1B39A 4X0MA 2X6DA 3UODA 2UZLA 3OFMA 2R3GA 4TPTA 5HI2A 3NS9A 4M69A 2HY81 3HNGA 3P7BA 5E8ZA 3S1HA 3OG7A 5FP5A 2YIYA 4KIQA 4L8MA 4W9XA 3EQPA 1UWJA 3Q3BA 3MFTA 4MXOA 4XV3A 1OPJA 2B4SB 3FLNC 3PXQA 2ETKA 4M3QA 5L6WL 5HLWA 1LUFA 2WIPA 3PPJA 4FV7A 4FI1A 3KMWA 1XH6A 5J7BA 1ZARA 3UGCA 3KMUA 2CN5A 5AP4A 4B8LA 2HXQA 4UWYA 3TI1A 1YQJA 4MBLA 4YJPA 4O91A 1HOWA 5I5ZA 4IAIA 5DE2A 2BRBA 2EB3A 5L6PA 3REPA 4LMUA 4AW2A 4D9TA 5HTCA 5F94A 2W9ZB 4XP2A 5FRIA 3QQHA 4ERWA 4FL3A 5LVMA 2GMXA 3I7CA 4FKSA 4IEBA 4AW0A 3I6WA 3BHTA 3VHKA 3E63A 2ZM3A 1QCFA 5E7RA 2RIOA 4D55A 4DEAA 1UA2A 3QQFA 2WQEA 3BYSA 3SOCA 4YHTA 2W1EA 5JFVA 3OTUA 1CSNA 4FZ6A 2QO2A 4X2JA 2YA9A 1XQZA 3NYOA 2HIWA 4J95A 4JQ8A 4Y5HA 4YC8A 5EDRA 4IANA 5D1JA 3OCBA 4GT5A 4ZJVA 3QU0A 3R00A 4Q5HA 2WMVA 4APCA 1CM8A 3HGKA 3O7LB 2VO7A 1ZWSA 5T68A 3BIZA 5C8MA 4KIKB 3BYUA 3V8TA 3SVVA 3AGLA 2GTMA 1OKYA 4Y46A 2ITYA 4B0GA 4TWNA 4I23A 4AN3A 4A4LA 4ID7A 4O22A 2C6LA 3QYZA 5C26A 3V51A 5EYMA 4MNEA 2Y7JA 4FTJA 2XVDA 3E62A 4L46A 2Z7RA 4NZWB 2BRGA 3F2AA 4BIBA 2V7OA 3R6XA 4PL4A 3ZEPA 2OIDA 2VO3A 2F4JA 5AX9A 3V01A 2JKKA 5C8NA 4DITA 4U42A 1M2QA 5HG8A 2O2UA 1FGKA 4PL3A 2WMUA 4FA2A 2WU6A 4U40A 3I81A 1OUKA 4AQCA 5J9ZA 2JEDA 2ERKA 2X81A 4FTAA 2QOLA 1FMKA 3EQCA 2R3PA 3CQEA 5GNKA 4A9RA 4L68A 3VAPA 4OTFA 4PX6A 2XJ1A 3P79A 1PXKA 3TN8A 3DK3A 4C34A 2JFMA 3FXXA 4C4EA 5JT2A 4MD8E 5G6VA 3A4PA 2NPQA 2GNHA 3D5UA 3WYXA 1KOBA 3FLWA 5LVPA 2OBJA 2GNIA 4GUBA 2Z2WA 3WZDA 3H0ZA 4TZRA 1WZYA 4ANOA 5JQ8A 4IB0A 5A4CA 3HLLA 2R3RA 2VTQA 5K5NA 4G31A 4X3JA 1QMZA 5FBOA 4BCGA 3HA8A 1DI9A 3ZC6A 4J8NA 2Y8OA 4MD7E 3FMJA 2NRYA 4EH4A 3G9LX 3ZFYA 4HVGA 4FKRA 5AAEA 2YDIA 2G2FA 3FKLA 4M14A 4U3YA 4TNBA 3TNHA 4JT3A 3BGQA 3UC3A 3O50A 3DKFA 5FM3A 1PXOA 2RSVA 2VTTA 4PTEA 2WQMA 2WKMA 3H9OA 2W5BA 3UIBA 4RGJA 2QOCA 1Q3WA 3R83A 2O64A 4RZVA 3GC9A 3TV4A 3MPTA 2OF4A 5B0XA 3GU5A 4BCOA 4I94A 5CZIA 3H30A 2GHLA 3KQ7A 1YHWA 2VTOA 4MXZA 4BFMA 3V8SA 4CMUA 2C69A 5CU3A 5KKRC 3L1SA 2VWXA 3FLZA 5CI7A 2W99B 3VO3A 3G9NA 3ZBFA 4Y85A 5KHXA 3KRLA 5F95A 1SVHA 2C5NA 4D2PA 3G51A 2CMWA 3DAKA 3M1SA 4YO4A 1PXJA 3DK7A 3MA6A 4K1BA 3P86A 2G01A 2P33A 4TYIA 3CTHA 4E6DA 3KF4A 2YISA 3MTFA 4JG7A 1ZYLA 3HVCA 4G3DA 4H39A 5BX0A 1H08A 1OUYA 2B52A 2QR7A 3VW8A 5IA4A 4HYIA 4FZFB 2GFCA 4D0XA 1E1VA 2HZNA 3Q6UA 3C1XA 4IX5A 3VJOA 3PVWA 4DN5A 4X3FA 3LFQA 3QTRA 4ZEGA 4XYFA 2GNGA 3DBCA 3GB2A 4IAKA 4RA4A 4IJPA 4L7FA 4N0SA 4RIYA 4R3CA 1XO2B 4G3EA 4ITIA 4IM3A 1VR2A 5HVJA 1GJOA 4BBFA 3E8DA 5AUYA 4AW1A 3O71A 4G5JA 1YXXA 4UXQA 5FEDA 3UPZA 2XYUA 4NM0A 3DCVA 3GFEA 4LFIA 4WNKA 4FBXA 4TYHA 2XIZA 4O38A 3FI3A 2Y6OA 5DOSA 2B53A 3DBQA 3SAYA 5KMKA 3FC1X 4C37A 2IVVA 3NUNA 3OXIA 5HBJA 4MNFA 4IC7A 3TT0A 3FQSA 4ZY5A 3DA6A 2ONLC 3G0FA 3I5NA 4ANMA 3FYKX 5DN3A 3R8LA 3AC8A 4AZVA 1I09A 4FKJA 4IH8A 5DIAA 3FKNA 3LFNA 5CS6A 3VS0A 4LL0A 4YJOA 5DR6A 4KNBA 2VZ6A 1H8FA 4WNOA 5B2KA 1FVVA 5CEOA 1XKKA 2H96A 1IRKA 3QCSA 4Z9LA 4CFUA 5LCJA 4OAVB 1PXNA 2PMIA 3COMA 4IZYA 4AT3A 4WG3A 3IGOA 5GZ8A 4RX9A 5E8SA 3IW4A 5J5TA 3ETAA 2BRNA 5E1EA 3VNTA 2W5HA 3WE8A 4R1YA 3PSBA 3PVBA 4B99A 2XJ2A 4YU2A 2BKZA 4IX3A 2R5TA 4D4RA 4E4NA 4QOXA 4TKSA 4AA5A 3OUKA 2FUMA 2ITWA 2O0UA 1Q5KA 3RPOA 3R1QA 4ZSAA 2Z7LA 1YDRE 4FV3A 3KN5A 4IE9A 5AX3A 3QTZA 1WFCA 1YXSA 4FG8A 1P5EA 3DU8A 3OWJA 4BDGA 3O23A 4ZP5A 3N51A 3THBA 1TKIA 2IWIA 3QX2A 3QQJA 5AP7A 4QMMA 4ITJA 3IDPA 4GL9A 4EBVA 4LGGA 5EKNA 2OG8A 4RLLA 5FXQA 2LGCA 4UMRA 3V6SA 1FMOE 3L9NA 4YZNA 4CV9A 2W4JA 2X9EA 3O8PA 3NYXA 4YJRA 4O0SA 4AZSA 2P55A 1UVRA 2WMTA 4FVRA 5KMOA 5D12A 5BYYA 3QKKA 4XLVA 4L45A 3UG2A 3V8WA 4G9CA 2EXMA 1KOAA 2HAKA 3TJDA 1WBNA 4QTAA 3NX8A 2VTMA 1PF8A 4UZDA 3JVSA 5JSMA 4FKOA 4BKYA 2ZMCA 3L8VA 1VJYA 5IISA 2J0KA 3KC3A 3ZBXA 1A9UA 3A7IA 3LAUA 4WSYA 3H9FA 4C2WA 1GY3A 3VUIA 5GJGA 2F2UA 5F1ZA 2R0UA 5D9HA 4I4EA 5FG8A 3TUCA 4W8DA 5AA8A 4CFXA 2YM8A 3LLTA 2WB8A 3KXXA 4AUAA 5AIRA 3AOXA 2YLFA 5K9IA 4J52A 4DEHA 4IVBA 5IKWA 4J97A 4JBPA 5JRQA 2UW6A 2UZEA 2YCSA 1ZOEA 4RC4A 4EOKA 1Q61A 4I0RA 3K5VA 3NAXA 4ACGA 3R1SA 1Q8YA 3MPAA 5IDPA 3NAYA 4RJ8A 3FLQA 4KKEA 4HOKA 3A99A 4M12A 3CJFA 4BDBA 2QOIA 3WZJA 5HZNA 1GOLA 2G2HA 3W2OA 4F1OA 4F9BA 1Q41A 2J7TA 4D4YA 5T3QA 1OPLA 4GFMA 2YLEA 5AMNA 3ZSIA 3OWLA 3W55A 2I40A 4JDKA 4UALA 3HMPA 4XBRA 4QYEA 3QUPA 4EOJA 3HV3A 1BL7A 4C3PA 5KUPA 5G1XA 3SC1A 3AC4A 3ZUTA 4ACHA 1PXPA 4A06A 4BB4A 3HV6A 1F5QA 3UVRA 4YJNA 2JD5A 3MVJA 5HE3A 3DFAA 4DAWA 5AUTA 4CFVA 1OL7A 3EFKA 5L2QA 2BHEA 5HE1A 3ZONA 4OBPA 2FVDA 3FMDA 5FBNC 1FVTA 4HGEA 3RPVA 2ZMDA 5HBEA 4IM0A 2P3GX 3LCTA 3UYSA 4I5PA 2IZRA 2JIUA 1JNKA 4D2TA 4DH3A 5AV2A 3Q2MA 3QAME 3RALA 2BAKA 1DM2A 2Q0NA 2R9SA 4UZHA 3ZOSA 5M44A 2W05A 2C6OA 5DEYA 3QD4A 3U87A 3R21A 4CKJA 5E8VA 2YCQA 2Z60A 4LRKA 3R7YA 3EIDA 4BDCA 4GSBA 4GEOA 4L44A 4AACA 3BBTB 2EXCX 3EH9A 5CQUA 5DBXA 3D5VA 3DDQA 4YTIA 3FQHA 3TUDA 2C5YA 5HNIX 3IGGA 1R1WA 3A61A 2HWOA 4FZAB 5FM2A 3CTQA 3FZRA 3DY7A 5M51A 1R0EA 2UV2A 5EI8A 1ZXEA 2QOHA 4I4FA 2VTJA 3NDMA 3VUDA 1U5QA 2R3LA 2WMQA 3QTUA 4OTRA 3ZEWA 4U0IA 2IZUA 3IO7A 5AJQA 1OIRA 4FYOA 3ROYA 2XIXA 3CC6A 4AOJA 4OUCA 2OKRA 2RG5A 3D83A 4TYEA 2W96B 5IUGA 1T45A 2SRCA 4LUDA 4ZTQA 2R3QA 5HNGA 3Q53A 2ZB0A 4DEGA 2C30A 4K11A 3ZTXA 5CSVA 3G6HA 3PE2A 3U6IA 1XBCA 4MK0A 5JRSA 1ATPE 5K4IA 4IVCA 3MIYA 4EOQA 1U54B 2R3OA 2WQOA 3CY3A 5IG1A 3VS2A 3GOKA 2ZVAA 4GU9A 1M17A 3ODYX 3QD3A 4C7TA 3A7FA 3BWFA 3QZHA 4DGNA 3E3PA 1BL6A 4F0IA 4F08A 2CGUA 4IZ7A 1KE5A 2XP2A 2BZKB 4IVAA 4O0YA 4AZWA 3RAKA 3MB6A 4GG5A 3JY0A 4HYUA 1PHKA 4BCFA 4I1ZA 2RFSA 2YDKA 2YFXA 4OTQA 2PVLA 3ORXA 4L3PA 3RI1A 3SV0A 4HVDA 2OO8X 2ACXA 4DC2A 4JAJA 2WTKB 3NNVA 4JDJA 4F9WA 3IW7A 4Z55A 4ZTRA 4ERKA 5A4QA 3NRMA 1OIQA 4YLJA 4MQ1A 4JL9A 4RWLA 3F2NA 1ZMVA 3QQUA 3UOLA 4PNKA 1CDKA 2A0CX 3Q9XA 2FH9A 2BCJA 2ZYBA 3UOHA 4XH6A 3VIDA 3KULB 4BWXA 5CF5A 3HP5A 4I0TA 4DH5A 3O51A 4QPMA 3MI9A 4F0FA 3C4WA 5AV3A 2IO6A 2JBPA 3MB7A 4FSQA 4LGDA 3NIEA 5HIEA 4FV9A 4FKTA 4G2FA 4M8TA 4EK3A 3M11A 2R3IA 3TUBA 3LXNA 4XBUA 2X9FA 3E92A 4KIPA 1H01A 2FYSA 2HELA 1UU9A 2XNPA 2XUUA 3EQFA 3HX4A 4FC0A 4G6NA 3GXLA 4M84A 4RSSA 4AXAA 4XMOA 3KK8A 5JEBA 5AAFA 3MH2A 3UYTA 2QONA 5AUVA 4XV2A 1JQHA 4ANQA 4TN6A 2BUJA 4WA9A 2P2HA 4D0WA 3NCGA 1H1RA 3UNZA 4AWIA 4NUSA 1VYWA 4J99A 1H1SA 3AGMA 3C5UA 3VUMA 4X7QA 4EBWA 4JR7A 4KA3A 4O0TA 1PMUA 5AUZA 3FZOA 4MX9A 5CEIA 3AD5A 4W8EA 4WNMA 3GEQA 3KRWA 2XS0A 4NM3A 3VRZA 3WZKA 3FC2A 4WG4A 4ONAA 4UWCA 5D11A 3EYHA 5GHVA 1UV5A 3IDBA 1W8CA 4KRDA 4M0YA 5B2MA 1P14A 2QCSA 3G2FA 5HO6A 3UZTA 4ZTHA 3CGFA 4QMXA 1ERKA 4A9UA 4V0GB 4E26A 2IVTA 2VGPA 3BI6A 4FSTA 3DLSA 2B9FA 3VBVA 1R78A 4LOQA 2OF2A 3NNUA 1UNGA 3GC8A 5HESA 4A9YA 2FA2A 3FJQE 2PVMA 4O0RA 1KE8A 4GG7A 2BAQA 2ZB1A 4D2RA 3PRFA 4Y95A 5EDQA 3V5JA 2X8EA 4FYNA 4FSUA 3GVUA 3LVPA 2HXLA 4W4VA 5B2LA 3A60A 3ZSHA 4QTBA 1G5SA 1TQMA 4GIIA 1FVRA 4IMYA 4M7IA 3PXZA 5EYKA 3TV6A 3VS5A 4F99A 3II5A 4YZCA 2C6TA 4V05A 3ALOA 1GZNA 4Z7GA 5LMBA 5HU3A 4QMVA 2I0VA 4PPAA 3A2CA 3LFCA 3UDBA 5HIDA 2PSQA 5HQ0A 3EQHA 3PA3A 3F88A 3QQLA 4HGLA 3HA6A 4NJDA 3BE2A 4QPAA 3LXLA 4I24A 3ULIA 1ZAOA 3S95A 4WSQA 3GCPA 5BUJA 4ASDA 4DFXE 4DGGA 1H4LA 3MVMA 3R02A 1O6YA 2C0OA 2RFNA 3GQIA 2W9FB 3PJ3A 2ZDTA 4FG9A 4FT7A 5J9LA 2IW9A 4HYSA 1H07A 5JN2A 1RW8A 4AGUA 4E8AA 4MAOA 2CHLA 4FT5A 2GS6A 1M2PA 3MFSA 3C4CA 4TYGA 5DGZA 5EHOA 4QMWA 5ACBC 3W2CA 4CZTA 1M2RA 3QA8A 3AT2A 2UW3A 3BHYA 5HCZA 3F5XA 5TE0A 3TACA 5L8KA 4FV0A 2QU6A 1SYKA 4KSQA 2VGOA 2WTWA 2YIXA 3VS6A 2IZTA 4H3QA 4YC6A 3RWQA 5IEVA 2X0GA 3OOGA 1DAYA 4MWHA 4QP6A 3QX4A 5LJJA 4F9AA 4FSWA 4MXYA 3TKUA 3C7QA 3F3VA 3LIJA 5LOHA 1OKZA 4DGOA 1CKPA 2GFSA 2WNTA 5M4IA 2VUWA 1BI7A 1SM2A 3GT8A 4C02A 5IPJA 4I0SA 4FSZA 4DFNA 4QP3A 3QCYA 2JFLA 3WOWA 1M7QA 3CE3A 3R2BA 1GIIA 3R8VA 1Q4LA 3KKVA 3G33A 3WIGA 2PE0A 2XIKA 5J9YA 1PKDA 2X7OA 2B1PA 4FV1A 4X2KA 4ZJIA 4NT4A 2ONLA 2R7BA 1K2PA 3PIYA 4H1MA 2FSTX 1Y6AA 2XYNA 3LW0A 4BCIA 3DLZA 4BWKA 4BDHA 2W0JA 4N6YA 2YZAA 3GGFA 5TKDA 4QP9A 1H27A 3BGZA 4F6UA 1JKLA 2KTYA 3FHIA 3DAJA 4F7SA 5AP0A 1OL1A 3FMNA 2WTKC 2A27A 5FTOA 4P5QA 4K33A 5AP5A 2Y4PA 3OC1A 3OP5A 3FSFA 1Y91A 4I5HA 4RJ4A 5HLPA 3WF6A 4QTEA 5D10A 5IA2A 4KIKA 4B9DA 1KV1A 4ACMA 4M0ZA 3GC7A 4MXCA 2WMXA 4FTUA 1OL5A 3ERKA 3LFDA 3UJGA 5H3QA 3ZO1A 2I0YA 2R3NA 1H1WA 5BUEA 3OS3A 2YCRA 3RNIA 3WZEA 4JG6A 3D9VA 4E20A 4PMMA 3E5AA 3U9CA 4E6QA 3HMNA 3S2PA 5DR2A 4MXXA 4BCQA 4BDEA 2WEVA 5M4CA 5C1QB 3P7CA 1GZKA 3EJ1A 4XV9A 3KL8A 4TT7A 5IH4A 2XK6A 2PE1A 4U81A 3QYWA 1BX6A 4GFGA 4JOAA 4EZ7A 4QP4A 3O8TA 3UC4A 3P7AA 3ZHPC 4A9TA 1CKJA 4HCTA 1V0OA 5HGIA 4CTCA 4FL1A 3JVRA 4M66A 4FK3A 4RQKA 1BYGA 3ZRKA 5IA0A 4I92A 1PW2A 4OTHA 4G6LA 1NA7A 3GBZA 3AD6A 2C3JA 1OM1A 4CCBA 5CU4A 4NFMA 2PWLA 2QNJA 4L42A 1GIJA 3HMMA 5JH6A 3PLSA 4AW5A 4FV6A 5AR4A 5AEPA 4UN0C 4F7JA 1PXIA 4OT6A 5JMSA 1LR4A 4NH1A 2PK9A 4FTOA 5CVFA 4BCMA 3MJ1A 4CLIA 5IH5A 4GUEA 4KRCA 4ZTSA 4U8ZA 4ANNA 5KMNA 3S0OA 3E88A 4WBBB 2B54A 4USDA 5E8UA 1F0QA 3BQCA 4JG8A 5CAUA 4I6HA 3RAIA 2W1FA 3HDNA 3R1NA 4GJ2A 4PTCA 3BBWA 5HO8A 2Y4IB 3A7GA 4OW8A 3UG1A 4QMUA 3RBWA 3BYOA 4C8BA 3CKXA 5JFSA 1WBPA 3M42A 2OGVA 3PXFA 1YW2A 4HGTA 5EW9A 3DJ7A 3TV7A 3ZLYA 2VX1A 5ETAA 4L67A 2G2IA 3P1AA 3VS7A 4CD0A 2GPHA 4PNIA 4ANSA 1SZMA 4XCUA 1DS5A 1YRPA 5CASA 4QMOA 5KX8A 1OL2A 2ESMA 2HOGA 3EZRA 5FGKA 4BWPA 1XR1A 2YIQA 2Z7SA 2FO0A 4DG2E 3HMIA 3U51A 3LFBA 4P7EA 4E1ZA 3LCOA 4RVTA 3DT1A 2QU5A 1WVXA 3QGWA 5CEQA 1YXUA 3PVGA 4V01A 3FXZA 4GRBA 4EKLA 1Q62A 5IA1A 3QRIA 1A06A 5IMXA 3Q4CA 3LJ2A 4YHFA 3WARA 2X4FA 2A19B 3VWAA 3OEZA 5AV4A 2C5VA 1FGIA 4JIKA 4ZS0A 4RC2A 4IB1A 4BTJA 3NNWA 1OKVA 4ZIMA 3BHUA 2VTPA 2ZDUA 3U9NA 3DKOA 5A14A 4AOIA 2C6IA 2CCHA 3C13A 4FTKA 1H1PA 2PHKA 3DV3A 3FUPA 3GP0A 4QRCA 3R22A 5ANDA 2FGIA 4PMPA 2BALA 5AIKA 4F64A 3NZ0A 4RIXB 3M2WA 4RWKA 4Q9ZA 4NKAA 4BHNA 4FTIA 1REKA 3KXZA 4JJRA 4XJ0A 4F1TA 1YOJA 4GMYA 4GIHA 5IEYA 1XBAA 4MXAA 4E4LA 2BVAA 5L4QA 5CALA 1XJDA 4EOIA 3OMVA 3FE3A 3PZHA 4IWQA 3DXNA 4TTHB 2UW4A 3RP9A 5CXHA 1E9HA 2V62A 3ORMA 3BLQA 3KK9A 5CLPA 3O8UA 2B9JA 5M56A 5AR8A 5HG9A 4CRSA 5ANIA 1ZMUA 3G6GA 2UZVA 4BICA 4X2GA 3C50A 5GZAA 1STCE 2PVJA 4BCKA 5AP3A 4CXAA 4LRJA 2X39A 1ZOGA 5KCVA 2WGJA 4DLIA 5AADA 3FMLA 4RWJA 4L52A 3A7JA 1S9IA 3SXSA 4ZSEA 1IR3A 2OFUA 4G1WA 4MHAA 4ZLYA 4RLKA 2VTNA 4EWHA 2G1TA 2HZIA 2XKDA 3QUDA 5CAOA 5E92A 2ITQA 4USFA 4FODA 4BZNA 4XP0A 4UMUA 4PP9A 3P08A 3QCQA 1JSUA 4YZ9A 5I9ZA 1DAWA 4YBKA 3KCFA 3P9JA 4LOPA 5BMSA 3DZOA 2VTIA 2WELA 1RE8A 2YIWA 3CPCA 2UW7A 2CJMA 3OWPA 4IVDA 4RJ7A 3W8QA 4AGWA 4DEDA 3CY2A 3VBWA 4FSNA 3AG9A 4RQVA 3U4WA 3OY3A 4BDIA 4D58A 5KMMA 3EFWA 1MRVA 3IONA 4U41A 2WTVA 3FL4A 4F09A 2VTLA 4CLJA 2XCHA 4BRXA 2VWVA 4YMJA 2JKOA 4PDOA 5KHWA 2BIYA 2UUEA 1XWSA 2XNMA 3P23A 3DB8A 4O0VA 4QMYA 4TXCA 4DCEA 4TWOA 2B7AA 3W10A 4LG4A 4EYMA 4HNFA 4CFMA 4D9UA 1NVSA 5BVEA 2VTAA 4EC8A 5K5XA 3ZFXA 3NPCA 2OXXA 4FT3A 3OHTA 3QF9A 2PMLX 3I1AA 4O21A 1Q8WA 2WTDA 1QPEA 3K54A 4M13A 4NM5A 4R5SA 3H3CA 5JQ5A 5C03A 2JITA 1UU8A 3HYHA 4ZAUA 3MV5A 2PE2A 2QOFA 3KN6A 4XLIA 3HDMA 4CYIA 2BMCA 3UIXA 5HNBA 2JKQA 4J96A 2XF0A 3LJ0A 2OIBA 4GK4A 5TF9A 3R28A 4DEIA 4QNAA 2OH4A 3VRYA 3T9TA 3ZLSA 4BDAA 4YBJA 3RPSA 1W0XC 2CLQA 1M14A 4H3BA 4J71A 4G6OA 4LMNA 4EWQA 4KINA 4U45A 3B2WA 4D2WA 1LEZA 4IFGA 1P4OA 3U8WA 2ZV8A 2J0IA 2J51A 5EYCA 3Q4ZA 4AT5A 1YXVA 2IN6A 2QQ7A 1YI4A 2NP8A 2PMOX 3DS6A 2YN8A 3KXNA 4QQJA 3DQWA 2R3MA 3F5UA 4W4WA 1OPKA 3TG1A 1UNLA 3GI3A 4CCUA 5IEXA 3KB7A 2OZAB 4S33A 2PVKA 1YWVA 3QZGA 3HL7A 3NIZA 3OTVA 3C9WA 3E8EA 3F61A 4FGBA 3QKLA 4EORA 3W33A 3FQEA 4DHFA 2PVYA 2ZV7A 5C8KA 3RHKA 4CQEA 3LXKA 2BDFA 2JBOA 3BEGA 4ACDA 2GNFA 3MY0A 4FKPA 5JZNA 2OSCA 3UO4A 2WAJA 2VWZA 2Y4IC 4O6EA 3AMAA 3DJ6A 2RF9A 1PJKA 1XH8A 5EDPA 3I4BA 3A8WA 3NWWA 2QOBA 3R7IA 4CT2A 5AP6A 1UU3A 3HV5A 3JPVA 2X1NA 3VULA 2RG6A 4I41A 4PDPA 4AGCA 3NUXA 1KSWA 4BBMA 2Y6MA 3A8XA 3H9RA 4QMZA 4RRVA 5I4NA 4NSTA 3R04A 5DFPA 4HCVA 4F1MA 4JBQA 4C4GA 5HTIA 4PTGA 3DPKA 5DPVA 3TKHA 1B38A 4BZDA 2J5EA 3A62A 4IXPA 2B9HA 3EQRA 3RVGA 5ICPA 2IW8A 1BKXA 3R8MA 5CU6A 4C4IA 3VJNA 2VNYA 5I9YA 2F57A 3PPZA 3T8OA 1UKIA 1BUHA 2WMWA 3IS5A 5DR9A 4EOLA 3HV7A 2A4LA 3KMMA 3ZRMA 4OGRA 5CSXA 3VS3A 1Y8GA 2VX3A 4IAYA 3SX9A 5E8TA 2REIA 2XNNA 4L3JA 3RAHA 5CF4A 3CJGA 3NYVA 2W1GA 4I6BA 3NUPA 4O6LA 3F6XA 4YSJA 3FI2A 3QBNA 5CQWA 3UIUA
chains in the Genus database with same CATH superfamily
2WD1A 2EXEA 3PTGA 4YZBA 4KABA 1PY5A 5KNJA 1PXLA 4FKLA 2UZOA 4KS8A 5CEKA 3TIZA 5EYDA 2W1DA 3F9NA 2C1AA 3DBEA 2BFXA 4FEQA 2VN9A 3LFEA 3LMGA 3BLRA 4FIJA 5KBRA 3FY0A 4F7NA 3WF5A 4KAOA 4R1VA 4CMTA 4MVFA 4BYJA 2VWBA 3QXOA 3RHXA 4B7TA 3FDNA 1RQQA 4IDVA 4AOTA 1Y8YA 3DBFA 3MN3A 3W8LA 2YM6A 3U4UA 2VTHA 2E9PA 2RGPA 4TW9A 2W4OA 4AAAA 3MJ2A 2PVFA 3DZQA 3GU8A 5LWNA 4YTCA 2X8DA 4QP2A 3U6HA 3FMKA 2GU8A 3Q60A 4AE9A 3TNPC 5CAQA 5JGBA 3DBDA 4D5HA 3ENMA 1EH4A 3BCEA 3QHWA 2XK4A 4OR5A 1B6CB 4LM5A 2WMAA 2OZOA 4UMTA 3UBDA 2OI4X 5CTPA 3IKAA 5DVRA 4UYAA 5TT7A 4RVMA 5J5SA 1Q8ZA 4LYNA 4JLCA 4KIOA 2XK9A 3PXKA 4DYMA 1W83A 3I60A 4EHVA 3HEGA 2PUUA 1MP8A 4IBMA 3MGYA 2ITOA 5ANJA 4Z16A 3PP1A 3PE1A 1U54A 3QXPA 5CT7A 5EW8A 4AZTA 4DH8A 4E4XA 2X7FA 5LXMA 4FKVA 2E9OA 4BDFA 5IA5A 3KXGA 4ZXTA 3RM7A 3D7TB 3R2YA 2C1BA 3D2IA 1MQBA 3K3JA 4C57A 4YR8A 5IA3A 1YDSE 5DH3A 3O0GA 5GJDA 4AA4A 2BFYA 3Q4TA 3TIYA 2G9XA 2YM7A 3EFJA 4I21A 4A07A 3FMMA 5IZFA 4EL9A 4ZTMA 4WO5A 1XHAA 3EN4A 3CEKA 4TYJA 3KVXA 3NSZA 2BZHB 3ZCLA 4PDSA 2HENA 5L3AA 4RFMA 3R7EA 4R5YA 2W1CA 5HLNA 4BI2A 3W18A 3CCNA 4E6AA 4ALVA 4C0TA 5DLSA 1T46A 1FINA 4YPDA 4X21A 3UP2A 3T9IA 2W1IA 4FSRA 3KGAA 3KULA 2B55A 2BPMA 5DT0A 5L2IA 1Q8TA 5EI6A 4ASZA 4KKHA 2ITUA 3VBXA 4QP1A 2ITNA 4Y73A 2XM8A 4XG6A 3RZFA 3PIZA 4EKKA 2ITXA 4JBOA 4YJUA 2X8IA 4FV4A 2V55A 4EUUA 4OLIA 2DUVA 3OZ6A 4WHZA 4BDJA 3LQ5A 4DG0E 5E8WA 5EM7A 4RMZA 4EZ3A 3NNXA 1OZ1A 4RIOA 5JGDA 5FLFA 2HK5A 2WTJA 2R0IA 4PMTA 4YPSA 5T6KA 1Q97A 1J91A 3C4ZA 3PRIA 1FOTA 3BV2A 4U5JA 1JOWB 3VUGA 4ALWA 3I6UA 5DA3A 4K8AA 3ZM4A 3NUYA 4PUZA 4PRJA 3DGKA 3GU7A 5CWZA 4UXLA 5HKMA 3FXWA 4Y8DA 2VRXA 2AC3A 2X2MA 3PWYA 2PZ5A 4ZSLA 4FV5A 3D15A 2ZJWA 3PWDA 3WF8A 3QZFA 2HYYA 3GFWA 3V5TA 5CXZA 4NKSA 4Y5QA 3C4EA 4BYIA 4TWCA 5DT4A 4N4SA 4PMSA 2YAAA 4FK6A 2YDJA 4MBIA 2W1HA 4FOCA 3QTQA 4P2KA 3AD4A 2QVSE 3AT4A 1IA8A 3B8QA 3IQ7A 4D4VA 2HWPA 1GZOA 4TRLA 5FP6A 4V0GA 2ETMA 3JYAA 4E4MA 2VTSA 3QGYA 3VF8A 2GCDA 1JVPP 3UE4A 3OUNB 4W9WA 3R30A 4U44A 3F82A 3MVLA 4QYYA 4FVQA 4BCHA 5IUIA 3GCUA 3RINA 2WOTA 3F5PA 4XRLA 1OMWA 4WRSA 4FF8A 4ZLZA 2E9VA 4H1JA 2NRUA 3IOKA 3QWKA 5A6OA 4IDTA 5AUXA 2EUFB 1WBWA 1E1XA 3HV4A 5DWRA 2O3PA 5BVNA 1XH7A 5DHJA 2PVNA 3CD8A 4I22A 4C4JA 2OH0E 4G16A 4QTDA 5CT0A 4F9CA 3DTWA 3Q32A 5DMZA 4ZTLA 4KD1A 4AP7A 4FKUA 4APPA 4E73A 1H25A 3S00A 2BZIB 4J7BA 4EK6A 4H36A 4YNEA 4EZ5A 4QMQA 3DTCA 1YI3A 5ANKA 3SRVB 2O5KA 5EHLA 3CR0A 1J3HA 4FTQA 4AU8A 3QRUA 1M52A 1VZOA 4Q9SA 3ANRA 5J1VA 4C33A 2EU9A 4HCUA 1YOLA 4NTSA 5A3XA 4JQEA 3R9OA 5M4FA 3D0EA 4HJOA 3LM5A 2ITZA 1ZRZA 1URCA 4FTRA 4NTTA 5EM5A 2VO6A 2I6LA 4E5AX 5I9UA 2CKEA 5TO8A 3W1FA 5CAPA 5AR7A 2HCKA 1PMNA 3RM6A 4B8MA 3QC9A 4PV0A 2FSMX 1OB3A 1BI8A 1H24A 3C0GA 3UVPA 3OD6X 2XNEA 3ORIA 3TNWA 4O4CA 5J7HA 4L7SA 4Y83A 4JNWA 4BC6A 2AQXA 2UZDA 2QOKA 1JPAA 2OIQA 2QD9A 1SNUA 5K0XA 1TZDA 3NUUA 4DEBA 5FWKK 3ZS5A 4YGAA 2XIRA 4FNZA 3R0TA 3BYMA 4DFZE 5CF8A 3DJ5A 3E93A 2XJ0A 4W4XA 4IZAA 3POZA 2YABA 5ITAA 5AV1A 3DNDA 1AQ1A 2I0EA 2R64A 3B2TA 2XNOA 5AV0A 3A4OX 4FZDB 3LFSA 4MH7A 3R7UA 4BZOA 3Q6WA 1O9UA 3EL7A 4HNIA 2Z8CA 4L53A 3D5XA 3K5UA 4RFZA 4HVHA 3QRTA 1JSVA 2J9MA 2X4ZA 4C3FA 4WG5A 2EVAA 3UTOA 2XNBA 3QUEA 2HZ4A 4H58A 3JS2A 1TVOA 3BU6A 4ZTNA 5LVLA 4EUTA 3LM0A 5CY3A 5J95A 4DH1A 2QOOA 2W7XA 4IAAA 4NK9A 4QMPA 1W98A 4I6FA 4BGGA 4JBVA 3G0EA 4PF4A 3FY2A 4GS6A 5C9CA 3BYVA 2XBAA 3ODZX 5BVKA 5CSWA 2Q0BA 1WBOA 2XCKA 3O17A 4M68A 4AFJA 5HD4A 2XK3A 5BVDA 2RL5A 2V0DA 5LARA 4FICA 4K0YA 4K18A 5EW3A 4F0GA 5HOAA 3CQWA 4QMTA 1QPDA 4IQ6A 4JXFA 5FD2A 3IK3A 4QMNA 2ERZE 3TTIA 3VN9A 2QURA 2FSOX 4MQ2A 4CEGA 3SW7A 2C6EA 2VWYA 2W4KA 2ZAZA 4WOVA 5L8LA 2XA4A 3K3IA 4U97A 3QWJA 3ZUVA 3W2RA 5FXRA 4XOYA 4IX4A 5IF1A 3D4QA 3P78A 4FTLA 5JGAA 5LVOA 5CU2A 2C3LA 2UW8A 1PMVA 4GK3A 3R7OA 1IEPA 4FR4A 3EQGA 4ANLA 3IOPA 4JIAA 3R9HA 3WBLA 3OWKA 4Z3VA 3P5KA 3PIXA 4OTPA 1OL6A 4U6RA 4UV0A 4XG7A 3SKCA 5HX6A 3FAAA 3O2MA 4NU1A 4XNEA 4JR3A 3QKMA 5DT3A 4QNYA 4KBCA 5KE0A 3TWJA 1OIUA 4EOMA 3E8CA 3EFLA 3OCGA 4CFFA 5HORA 3WYYA 5TOZA 2UZBA 4ZZMA 3V5WA 4DFLA 5CEPA 4MF0A 4AG8A 4EHZA 3PUPA 4J8MA 5LMKC 3SDJA 3Q4UA 4L00A 3UVQA 3R71A 2CSNA 4CFNA 1R39A 4DG3E 3PYYA 4EK4A 3BZ3A 4G3GA 4E7WA 4OBOA 3LCKA 4FKWA 4OTWA 1SVGA 3G5DA 2YM3A 5H9BA 5A46A 3DKCA 4IWDA 3NR9A 4NCTC 4G34A 4TNDA 4WKQA 4YNOA 5M53A 2WTIA 3DKGA 4GJ3A 4D1SA 3LHJA 3AC5A 5E8YA 5LQFA 1VYZA 3AMYA 4XUFA 2XK8A 5K4JA 3EN5A 1GZ8A 2ZM1A 4AN9A 2R3KA 2OICA 3GQLA 5KBQA 1NVRA 3C51A 4ARKA 4AX8A 4BTMA 5TR6A 2E9UA 3KY2A 3BPRA 4GT4A 3ACJA 4YLKA 4FRFA 2QO7A 4MF1A 5A54A 4XHKB 4CKRA 2JDTA 4II5A 4D4SA 2PMNX 2XEZA 4C2VA 1ZOHA 2UZWE 2KULA 5KZIA 1F3MC 3GUBA 2JGZA 3EN7A 3GOPA 4C59A 2C5XA 4FIIA 4CKIA 1ZYJA 4RX5A 5JFXA 4Y72A 3VQUA 1M7NA 4KBAA 2GNLA 4GCJA 3EQBA 3HZTA 4QQ5A 4R8QA 2VWIA 4K6ZA 3L9MA 3L9PA 4FIHA 4WIHA 2BDWA 4IACA 4GK2A 4PY1A 3SD0A 3FMHA 3FZPA 1H1QA 1YVJA 2R4BA 5HX8A 4LQMA 4Q2AA 4P5ZA 1R3CA 2WQBA 4UWBA 4BTFA 5A4LA 3SLSA 2AYPA 2YACA 1WBVA 3FBVA 4P90A 4FNYA 3G90X 3BHHA 1WVYA 4F7LA 1FQ1B 1YOMA 4K77A 4RA5A 5HE0A 5HO7A 4E93A 4FSYA 4U43A 2NO3A 4RIWB 4XP3A 4YSMA 5ANGA 3QC4A 4M67A 3T3UA 3ZO3A 3CGOA 2X7GA 3FV8A 4RIXA 3V04A 4LL5A 2BRHA 2GTNA 1UWHA 3W2SA 1H0VA 3O7LD 5JFWA 3QCXA 4FMQA 4ACCA 4S32A 2R2PA 4ZSJA 3TNIA 5DRDA 5HICA 3KRJA 3SQQA 3RAWA 3IG7A 4NIFB 5A4EA 4KB8A 4I93A 3PJCA 4FNWA 4OTGA 2AC5A 3HKOA 3D14A 3I0OA 3ZXTA 4BI1A 4AT4A 3TZ7A 3Q5IA 2WPAA 5C27A 4BGQA 3CKWA 4WUAA 3E64A 5HVYA 2DS1A 1KV2A 3IECA 3UNJA 4U7ZA 3CTJA 4X2FA 5CX9A 4BGHA 1U59A 3AQVA 1KWPA 3OXZA 4LUEA 5DI1A 1UKHA 5J8IA 4CRLA 4G3FA 4FTTA 2O8YA 3BELA 4BN1A 4IB3A 2QHMA 4DH7A 4BCJA 4I6QA 4U80A 5J87A 3WF7A 2E2BA 2OJGA 2XH5A 4M15A 4EHEA 3PG3A 3HMOA 4EH8A 2VNWA 2OWBA 2WTCA 2YHVA 3MYGA 3R8PA 5K0KA 5CAVA 4YTHA 1Z57A 4WD5A 4K9YA 3L8SA 2A2AA 4CZYB 2J2IB 4QP7A 2WIHA 3RTPA 4FVPA 1ZY4A 4MCVA 2CPKE 4FTMA 4DGLC 3CXWA 3Q96A 4E3CA 5AR5A 1TQIA 3F3UA 3EYGA 5KZ0A 4M69B 3OOMA 5A6NA 2YWPA 3U6JA 3ORPA 1Q99A 3KU2A 3Q04A 3LCDA 2JIIA 4QYHA 4YZDA 3C0IA 3R73A 5HEZA 3UO6A 2OXDA 5L6OA 4LGHA 4L6QA 4S30A 4CZUA 1U4DA 2J0JA 3A7HA 3VBYA 2PZYA 1Y6BA 4R3RA 5EM6A 1BMKA 4D5KA 3Q9YA 1KE9A 5AR3A 3TZMA 3BRBA 4AA0A 4BI0A 2BR1A 4I5CA 4IX6A 2XEYA 3VS1A 4IM2A 3VF9A 4RC3A 3VQHA 3R9NA 2H34A 3SW4A 2XZSA 1OECA 3F69A 1V1KA 3KXMA 5BQ0A 4PP7A 1MQ4A 2DQ7X 3PZEA 4H3PA 3KFAA 2VU3A 4O0WA 5CVGA 4EEVA 1J1CA 3LQ8A 4HYHA 3RGFA 3FPMA 4F4PA 2UZTA 3BHVA 3NLBA 3PSCA 4K2RA 4YZMA 3OT3A 1KE7A 3ZDIA 4F9YA 2HW7A 2F9GA 3EN9A 2XNGA 2GSFA 3ZZEA 2WO6A 3LCSA 2J5FA 2GNJA 1Q8UA 2YJRA 4G17A 5CZHA 4DFYA 4IIRA 3HRCA 2IJMA 2GHGA 2OZAA 2UVZA 3QD0A 4JX7A 2OXYA 2UVXA 4L43A 4OTIA 5DG5A 4ZY4A 3CPBA 4ITHA 3R7VA 2I0HA 4XX9A 4P4CA 5M57A 4FSMA 2XIYA 5FDXA 3BQRA 4FT0A 4TL0A 2IVSA 1JWHA 5BVWA 4BKJA 2QG5A 5JKGA 5HE2A 4JX3A 2VX0A 2EB2A 4IAZA 5LCKA 5GJFA 4EH6A 4CFWA 3HP2A 3QTXA 1SMHA 2DYLA 2XMYA 4D2VA 4C62A 1ZZ2A 1CTPE 4BKZA 5BNJA 4QQTA 2C0TA 2G15A 2H6DA 4AS0A 2W17A 3ENHA 4FOBA 4LV8A 4M97A 4O1PA 3MY1A 1CMKE 3CS9A 3F3ZA 3GNIB 3OBJA 4J53A 2R3HA 3FMEA 2GS2A 3EQIA 4MNEB 3WZUA 4W4YA 2Y0AA 4EH7A 4UB7A 5KO1A 4HZSA 5CNOA 3EOCA 4MBJA 3QALE 3BU5A 3OF0A 4AZFA 2JAVA 2B9IA 3GU4A 4AGDA 2IVUA 4C4HA 3ACKA 3VVHA 5M55A 4D1ZA 4BL1A 3LJ1A 2A1AB 4UBAA 1VEBA 5I3RA 5J1WA 5HIBA 4O2PA 4FKGA 4YLLA 4IHPA 2QLUA 4IAFA 3BWJA 3QLGA 3QQKA 5CF6A 2BIKB 3L9LA 3JXWA 3V5PA 3UMWA 3UOJA 4ZJJA 4ASXA 1JSTA 4U79A 4UY9A 5HBHA 5BUIA 3BV3A 2CGWA 2IF8A 3TL8A 3RZBA 3RCJA 3QTSA 3VUKA 2GHMA 3PG1A 3ALNA 4YJVA 2XKCA 3NEWA 4MWIA 2PY3A 1ZYDA 3LFAA 3R63A 5FXSA 2OU7A 4GW8A 4RBLA 3VUHA 3D94A 4Z7HA 5EHYA 4U9AA 3I0QA 2JLDA 4QYGA 5D41A 3FYJX 5BYZA 5IUHA 3KXHA 4QD6A 2UZNA 4IJ9A 1OKWA 4CYJA 3P0MA 2XKFA 4O4FA 2BRMA 1WBTA 3IW8A 5FQDC 3EB0A 3OY1A 4FT9A 3KRRA 2YITA 4JDHA 3V3VA 3FLYA 3FZTA 4PWNA 4MYGA 3MS9A 3ZRLA 3ZYAA 2WOUA 3DDPA 3PP0A 3OEFX 1P2AA 3BLHA 4XOZA 4X6RA 4OAUC 3AC2A 3LFFA 1H0WA 4JS8A 2JC6A 5DEWA 3ORTA 4AZEA 2VV9A 3E3BX 4XG9A 5IU2A 3AMBA 2YERA 5CEMA 5CSPA 4S2ZA 2C3KA 4WBOA 2I1MA 3WIKA 3FZSA 4DINA 5CNNA 4GYIA 3V5LA 2Y9QA 1JKKA 2W1ZA 2C4GA 1WMKA 3OW4A 4OBQA 3H4JA 3UOKA 2QR8A 2JDOA 3F7WA 4ZZNA 1YXTA 4O1OA 2XM9A 5ETCA 3BEAA 4ALUA 4B6LA 4DEEA 3F66A 3Q9WA 2C47A 3TTJA 3QZIA 1XH5A 4G5PA 4I5MA 5EM8A 4WRGA 5H8BA 1JBPE 3ORKA 1H26A 3AT3A 4RT7A 2WU7A 2AUHA 3C4XA 4ZK5A 3FPQA 2PVRA 3FZ1A 5JK3A 4RVKA 2VWWA 3QRKA 4I3ZA 4NJ3A 2R3JA 3AC3A 4QMSA 4R7HA 4EH9A 4GVJA 2DWBA 4EOSA 3ULZA 3EWHA 2QHNA 2UVYA 3HECA 2OW3A 1JLUE 3TXOA 2GDOA 3L8PA 3EHAA 4PQNA 5ACKA 3D7TA 1G3NA 3LZBA 3WILA 3ZUUA 3UO5A 4JRNA 3CLYA 3CP9A 4RVLA 3W2QA 3SOAA 4X3FB 2YCFA 3HRFA 1FPUA 4QP8A 5E90A 3SHEA 4E5BA 1H00A 1W82A 4ENYA 4RIYB 3KRXA 4A4OA 5M4UA 1S9JA 3BKBA 3QL8A 2QI8A 5F20A 5L8JA 2VTRA 1ZYSA 1MRUA 2PZPA 2RFEA 5CANA 3VC4A 3VBQA 3PA5A 3QHRA 3O96A 4FUYA 3TCPA 3ZO4A 4N70A 3W32A 4TYHB 3MH0A 4OT5A 2JIVA 5C01A 3HUCA 3FHRA 1PXMA 3PXYA 3UIMA 3FSKA 4A9SA 4O96A 2XRWA 2R7IA 3FWQA 5EOLA 4JRVA 2H9VA 1QL6A 4RJ5A 4IW0A 5AUUA 2ZM4A 3ELJA 2H8HA 1MRYA 4XEYA 5L2WA 4WUNA 3Q9ZA 1JKTA 2HZ0A 3PXRA 5IH6A 5CYIA 2CGVA 4OTDA 3UQCA 3ZLWA 4NW5A 1GNGA 4HPUE 5I0BA 1W2DA 4L3LA 4UMPA 4EHGA 3QFVA 1PYXA 2XRUA 3KEXA 4UMQA 1WAKA 2HY0A 2XKEA 4FG7A 2FB8A 2IW6A 3DB6A 3MFUA 3NW7A 4FZ7A 4XG4A 1V0PA 2WXVA 2RFDA 1O6LA 5EH0A 4MEDA 2E9NA 2P0CA 4NWMA 3ZH8A 3KCKA 4YP8A 4JI9A 4A7CA 1YKRA 4FNXA 3OBGA 1J1BA 1KE6A 3MIAA 3RJCA 4HPTE 2ITVA 1NVQA 5A4TA 2PL0A 4I20A 4ZZOA 3MTLA 5J79A 3IW6A 5F4NA 2PZIA 1IG1A 3UP7A 3K2LA 1WBSA 2CDZA 2V7AA 3DNEA 4EH5A 1K3AA 3OROA 3VBTA 3VHEA 5K3YA 3S3IA 3R01A 2XBJA 4GV1A 4Q5EA 2BILB 2JDVA 5LMKA 2QLQA 3D2KA 4EJNA 1GAGA 1ZYCA 4QQCA 4HGSA 4NCTA 4EOOA 2JDRA 4XG2A 4YC3A 3VS4A 5H8EA 5DNRA 3EZVA 4IWOA 3R8ZA 1BLXA 4QO9A 1WVWA 2C6DA 4PPCA 1ZY5A 4IWPA 3UZPA 3GC0A 3EQDA 3H10A 4A4XA 4UEUA 4DGMA 3QRJA 3D7ZA 4JVGA 3JUHA 3ORNA 5FEQA 1I44A 2OK1A 4QTCA 2YM5A 5EG3A 5GZ9A 2QKWB 3E7VA 4EQUA 5BPYA 1Q3DA 2CGXA 5HG5A 5BVOA 3GCSA 1SNXA 3R1YA 2UW0A 4E5WA 4ZOGA 5CSHA 5EK7A 3EN6A 3OCTA 1UU7A 3BU3A 4RZWA 5IDNA 4O2ZA 3RMFA 5CENA 2YIRA 2UW5A 4YJTA 4QT1A 3RPYA 3COKA 1JAMA 2WQNA 3AXWA 5H2UA 5HHWA 4L9IA 4S31A 3P4KA 2YEXA 3FI4A 2F7XE 4FKQA 4C36A 1CKIA 1IASA 5CI6A 5EFQA 2OJFE 1YI6A 1PKGA 3I79A 3SRVA 3BGPA 4EK8A 2P4IA 3E87A 3ZMMA 2PVHA 3PSDA 5I3OA 2WMRA 5KMJA 4JQ7A 5E91A 1UNHA 3MSSA 5EI2A 2QOQA 1X8BA 2WEIA 3V6RA 2ZV9A 4RJ3A 3FL5A 4MKCA 4QMLA 4F65A 3CIKA 4YURA 3MWUA 3QD2B 4GYGA 2QKRA 2BROA 4DTKA 2WFYA 3JY9A 5BVFA 3MA3A 3GENA 2YJSA 3DK6A 4PPBA 4V04A 3RNYA 1HCLA 3F3TA 2JDSA 2VAGA 3CD3A 4EK5A 2X0OA 3EMGA 2BTRA 4FKIA 2UW9A 3UQFA 1RDQE 2F49A 3B8RA 1O6KA 3EKKA 1URWA 2ETRA 5L2SA 3ZDUA 3Q5ZA 2LAVA 3HUBA 3NW6A 5H8GA 4YJQA 3ROCA 4C38A 5HCXA 4B4LA 5I9XA 4QYFA 4JDIA 4X2NA 3CBLA 5FEEA 2F7ZE 2EWAA 3N9XA 4QPSA 1QPJA 4CMOA 3DFCB 3ET7A 4UX9A 2W5AA 3QA0A 5ETIA 3PY0A 2V5QA 4PL5A 5AA9A 2HW6A 2WZJA 3F7ZA 1JKSA 4EC9A 4IC8A 3ZLXA 4BDDA 4LOOA 5ETFA 5KMLA 3MH3A 4KWPA 4AN2A 4X3FC 5L2TA 1PYEA 4CSVA 2GS7A 3WE4A 1TQPA 2ZV2A 4EH3A 2JKMA 5AWMA 4R6VA 4CNHA 4O0UA 1W7HA 4KSPA 4BCNA 5F9EA 5KMIA 1RJBA 2O65A 4F70A 2WMBA 1APME 2XK7A 4ENXA 3OVVA 4IFCA 5JZJA 3BX5A 3ITZA 3F5GA 4J98A 4AF3A 4YHJA 1OITA 3TEIA 5CVHA 3D5WA 3RCDA 4O0XA 1YHSA 4X6QC 4BF2A 4KKGA 2J6MA 5AUWA 4D1XA 2JAMA 2CLXA 5AP1A 4C61A 2C6MA 4USEA 4LI5A 3SA0A 3SXFA 2YAKA 4LV5A 4TWPA 3FLSA 3OT8A 4DLJA 1LEWA 5AM6A 4NFNA 3H0YA 2C3IB 1Q24A 2J90A 4N6ZA 4O27B 3WF9A 1Y57A 3GU6A 5E8XA 2VD5A 4C35A 3PA4A 2Z7QA 3V5QA 3TJCA 3ZXZA 2BAJA 4F63A 3PY1A 1ZLTA 4IB5A 1W84A 4DBNA 5HG7A 2C5OA 4CT1A 2R3FA 3QLFA 4RPVA 3LPBA 2C0IA 5EOBA 1QPCA 3MDYA 4RWIA 4GVAA 1MUOA 2IZSA 4G3CA 4ANBA 3PJ8A 4ZLOA 2O63A 4BDKA 4EQMA 2J4ZA 5EKOA 4XG8A 5B7VA 3CQUA 4GU6A 4FX3A 4R3PA 1WCCA 3NUSA 4UYNA 5AR2A 5HU9A 2V22A 3OCSA 3ORZA 5HCYA 3RPRA 1Z9XA 4FIEA 2J0MB 4BTKA 3ZO2A 1GIHA 5I9WA 1Z5MA 4FV2A 2X2LA 4FUXA 3W16A 2P2IA 3NGAA 1NY3A 5FDPA 3RK5A 3C0HA 3F3WA 4IZ5A 2ZOQA 4O4DA 4YTFA 4XV1A 1OGUA 4BCPA 2VWUA 4HVIA 2QODA 3TKIA 3UPXA 2BHHA 2PTKA 3MVHA 3ZZWA 2F7EE 2FSLX 4LRMA 1LPUA 3E7OA 1U46A 2GQGA 2OFVA 3LXPA 3VW6A 3KA0A 3KVWA 3R7GA 5LVNA 3DQXA 5ANEA 4D28A 3WI6A 3R8UA 2C68A 3IPHA 4NW6A 3PJ1A 3MY5A 4C4FA 4BIDA 2X2KA 4C58A 4CQGA 4FIFA 3FKOA 3ZU7A 4GFOA 1YDTE 4RG0A 3MH1A 3QTWA 3GCVA 5D7VA 5LWMA 5IMEA 1SVEA 3OXTA 3W2PA 2CCIA 4S34A 3PFQA 4RFYA 4F6WA 1YWNA 1PMEA 2BZJA 1DI8A 1ZMWA 3LOKA 2W06A 3MFRA 3PJ2A 4XG3A 1V0BA 4YO6A 4NEUA 5D7AA 3ZSGA 4YJSA 1K9AA 3ORLA 2XB7A 4HVSA 3PY3A 2UZUE 3NCZA 4RX8A 3DAEA 3NYNA 3TZ8A 3UNKA 4E6CA 3QTIA 1L3RE 1OVEA 2ITTA 4U3ZA 1OI9A 4XS2A 3TZ9A 2OJIA 2WHBA 3HRBA 4GH2A 3C4FA 3LE6A 3RK7A 4G9RA 5AM7A 1YHVA 2CN8A 3RWPA 1P4FA 3EKNA 5HD7A 4BHZA 4J1RA 4MD9E 4RIWA 1NXKA 1H28A 4BIEA 3DOGA 4YUQA 5AAGA 4XRJA 5E1SA 5AP2A 4CV8A 5LMAA 1U5RA 4FTCA 4EQCA 4BVUA 3UMXA 4FIGA 3E8NA 3QQGA 3I7BA 4L01A 4RX7A 3POOA 4NM7A 4F6SA 3EL8A 2BDJA 2PZRA 1YWRA 3COHA 3ANQA 4BBEA 3S4QA 3UQGA 4KS7A 3NW5A 4NIFA 4HZRA 1XBBA 2X6EA 2J50A 2YM4A 4C3RA 3ZC5A 1HCKA 1REJA 2QO9A 4WNPA 2C6KA 2WMSA 3Q52A 2BTSA 3KF7A 4EYJA 3SXRA 4EH2A 3OW3A 4IADA 4MTAA 3T3VA 5CU0A 4EOPA 1XH4A 4CTBA 2F2CB 3L8XA 4TY1A 1R0PA 4FL2A 5A9UA 4KBKA 3I5ZA 3BE9A 4HW7A 3MPMA 3GCQA 4JAIA 4FV8A 2ITPA 5I9VA 3PVUA 4EONA 4ZY6A 3TNQB 5FTQA 5BMMA 4ZSGA 1AD5A 3COIA 2OJJA 3RKBA 1ZZLA 5KKRB 4EI4A 5DRBA 3IW5A 2OJ9A 3PPKA 3ZFMA 5HVKA 3RK9A 2VO0A 4D2SA 5HTBA 4WT6A 3MW1A 4AFEA 1XH9A 3R9DA 3IDCA 5ANOA 3AC1A 3MBLA 1AGWA 4ASEA 1LP4A 4RJ6A 3VUTA 4GT3A 1OIYA 4FTNA 2QC6A 2RKUA 4CVAA 2J0LA 4AE6A 4R7IA 1B39A 4X0MA 2X6DA 3UODA 2UZLA 3OFMA 2R3GA 4TPTA 5HI2A 3NS9A 4M69A 2HY81 3HNGA 3P7BA 5E8ZA 3S1HA 3OG7A 5FP5A 2YIYA 4KIQA 4L8MA 4W9XA 3EQPA 1UWJA 3Q3BA 3MFTA 4MXOA 4XV3A 1OPJA 2B4SB 3FLNC 3PXQA 2ETKA 4M3QA 5L6WL 5HLWA 1LUFA 2WIPA 3PPJA 4FV7A 4FI1A 3KMWA 1XH6A 5J7BA 1ZARA 3UGCA 3KMUA 2CN5A 5AP4A 4B8LA 2HXQA 4UWYA 3TI1A 1YQJA 4MBLA 4YJPA 4O91A 1HOWA 5I5ZA 4IAIA 5DE2A 2BRBA 2EB3A 5L6PA 3REPA 4LMUA 4AW2A 4D9TA 5HTCA 5F94A 2W9ZB 4XP2A 5FRIA 3QQHA 4ERWA 4FL3A 5LVMA 2GMXA 3I7CA 4FKSA 4IEBA 4AW0A 3I6WA 3BHTA 3VHKA 3E63A 2ZM3A 1QCFA 5E7RA 2RIOA 4O4EA 4D55A 1UA2A 3QQFA 4DEAA 2WQEA 3BYSA 3SOCA 4YHTA 2W1EA 5JFVA 3OTUA 1CSNA 4FZ6A 2QO2A 4X2JA 2YA9A 1XQZA 3NYOA 2HIWA 4J95A 4JQ8A 4Y5HA 4YC8A 5EDRA 4IANA 5D1JA 3OCBA 4GT5A 4ZJVA 3QU0A 3R00A 4Q5HA 2WMVA 4APCA 1CM8A 3HGKA 3O7LB 2VO7A 1ZWSA 5T68A 3BIZA 5C8MA 4KIKB 3BYUA 3V8TA 3SVVA 3AGLA 2GTMA 1OKYA 4Y46A 2ITYA 4B0GA 4TWNA 4I23A 4AN3A 4A4LA 4ID7A 4O22A 2C6LA 3QYZA 5C26A 3V51A 5EYMA 4MNEA 2Y7JA 4FTJA 2XVDA 3E62A 4L46A 2Z7RA 4NZWB 2BRGA 3F2AA 4BIBA 2V7OA 3R6XA 4PL4A 3ZEPA 2OIDA 2VO3A 2F4JA 5AX9A 3V01A 2JKKA 5C8NA 4DITA 4U42A 1M2QA 5HG8A 2O2UA 1FGKA 4O4BB 4PL3A 2WMUA 4FA2A 2WU6A 4U40A 3I81A 1OUKA 4AQCA 5J9ZA 2JEDA 2ERKA 2X81A 4FTAA 2QOLA 1FMKA 3EQCA 2R3PA 3CQEA 5GNKA 4A9RA 4L68A 3VAPA 4OTFA 4PX6A 2XJ1A 3P79A 1PXKA 3TN8A 3DK3A 4C34A 2A98A 2JFMA 3FXXA 4C4EA 5JT2A 4MD8E 5G6VA 3A4PA 2NPQA 2GNHA 3D5UA 3WYXA 1KOBA 3FLWA 5LVPA 2OBJA 2GNIA 4GUBA 2Z2WA 3WZDA 3H0ZA 4TZRA 1WZYA 4ANOA 5JQ8A 4IB0A