4CQJA

Fluorinase substrate flexibility enables last step aqueous and ambient 18f fluorination of a rgd peptide for positron emission tomography
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXY-ADENOSINE SYNTHASE
publication title Structure of a Bacterial Fluorinating Enzyme with
rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 76
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 4cqjA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 4cqjA01
2V7TA 2CC2A 2C4UA 5LMZA 2WR8A 2V7XA 5B6IA 2C2WA 2ZBUA 2V7WA 2CW5A 4CQJA 2F4NA 1RQRA 1WU8A 2Q6LA 2Q6KA 2V7UA 2V7VA 2C5HA 2C4TA 5FIUA 2Q6OA 1RQPA 2Q6IA 2ZBVA 2C5BA 2CBXA
chains in the Genus database with same CATH superfamily
3NEPX 3HBAA 3T3MB 2PD3A 1VMKA 4AW9A 4WD3A 4DDUA 4UE6A 2XT9A 1S9HA 2IYYA 2WB4A 5F7ZA 5DXAA 3IP6A 4BB9A 5EWJB 1G2QA 2JLXA 1NWCA 2P9BA 4LE2A 5AJVB 4GOLD 2CKDA 2GTHA 4TS1A 1Y8ZA 4IJ5A 1J6UA 3C3MA 1SBQA 5EQJB 4LHYA 1CIPA 2BFEA 5C31A 4QAJA 5JQGA 2O2IA 1USKA 5HMLA 1A50B 1RLTA 2C5BA 2EZUA 3U4DA 2ZIEA 3HDJA 2K5UA 1V96A 1K06A 3LHFA 5FF9A 3RS2A 2JLQA 2I3ZA 4C7XA 3FCEA 4F04A 2XBMA 1X15A 2BEKA 2ZAMA 2HSGA 4B87A 4N8DA 1ZD3A 2V03A 5F1PA 3KUCA 2VBSA 3IJPA 4CDGA 4JI5B 2ZWOA 1JL3A 3M1LA 1GCGA 4CEIA 1CXZA 4Y9DA 4DLZA 3D6NB 3N2LA 4IHAA 4BNJA 5AW4A 2PE5A 1ICIA 1E5VA 3I28A 1X9HA 2ZLBA 3BFKA 3A3GA 4JSTA 1WMAA 2P5SA 4RDJA 3WB1A 3ZXIA 3BJZA 3U3ZA 3URMA 4DWOA 5KNBA 5EWJA 2B8EA 1VF7A 5LFAA 3I6ZA 2QQEA 4LJRA 5D5QA 3E81A 4QJIA 5FJIA 4F4DA 2CLFB 3FCAA 3OLVA 2CDBA 1GVHA 4WWHA 2AFIB 4FNGA 1C4XA 4Y6SA 3ND6A 1T8UA 4DCCA 1QF9A 2OT3B 2ZJ7A 3KOXA 3D0RA 3BJEA 3UPDA 2I7VA 2HBRA 3H9QA 2HK8A 2QUAA 3VSAA 2GPBA 4PICA 1VZ2A 4JFRA 5F77A 3AILA 1RBZA 1V8PA 2HCJB 4WLNA 2VRWA 2WSIA 3W6NA 3ZY4A 5JCZA 5TPZD 2WJPA 2XWSA 2JIZD 2IZZA 1X92A 2PGLA 1XALA 4OP1A 4RIHA 1T8SA 3BD6A 4EY5A 4LF5B 2V4MA 3V1MA 3E0XA 2FGJA 3SEZA 2XCSB 2Z0MA 3DE2X 1UBSB 3FETA 3TOZA 4BZWA 3HA7A 2RGRA 1V39A 1Z68A 2FQYA 1XLTA 3I8OA 5KWVA 3I2IA 3G9TA 1WSRA 4XWWA 1VIAA 1QVZA 2AZDA 2N3ZA 2JRCA 5DS0A 2X8AA 2Z5GA 3IX7A 2YC2C 4JOCA 3DP9A 1UPXA 1XU9A 3UUGA 1GQYA 5DGXA 4DIEA 2LIVA 3M1AA 3V8BA 3W6ZA 5GINE 2VYNA 4MGEA 1SB8A 3G5LA 4PABA 2HX1A 2PBRA 2KJQA 3TTTA 4XDZA 3NOOA 4DT1B 3ZV6A 2AFIA 2MSWA 3WIVA 1FUUA 2NU6B 2VH2A 3VH4A 2EGUA 3R5XA 1EAYA 4P2GA 3OM8A 1IN5A 4UQPA 4CE6A 3NJRA 4IS2A 1GYPA 3OP1A 2BF7A 2ZDGA 2B1JA 3AFOA 3F46A 2IZOA 4O5AA 5CFMA 3HSKA 5KJ6A 1VHLA 1KC3A 4KJXA 4CMAA 1NKSA 4WL0A 1DZ3A 1XL0A 3LA8A 2JDIA 4YWJA 3O0DA 1K7FB 2H63A 1Y6GA 1XWIA 1ZGCA 3LQRA 4NSNA 3ZJ5A 1N05A 2A8YA 3GEBA 2IXFA 4F3YA 2YTZA 3LUGA 1E4VA 3RHTA 2VI5A 4HY3A 4DWJA 5AD1A 5ICMA 1ND6A 2QYOA 2Y1KA 4P3IA 5LUBA 4NEGA 2WT8A 1CFZA 4QLAA 3W5HA 3LV8A 3QEJA 5DM60 1CB7A 1UPFA 3WYBA 4AIRA 3AR8A 5DTIA 1XELA 5DFAA 1VECA 4U7PB 5A5FA 1MABB 1Y7LA 4AY3A 1TFUA 3A9UA 3TYXA 4LJKA 2WPDA 5LQRA 3C1AA 5B6PA 3TMYA 1KJZA 2N1BA 4OQNA 2V9ZA 4CCWA 4DT1A 4EYOA 3OTIA 1R8XA 3V7FA 4Z7JA 4XM0A 2NU6A 3C5WP 4IGFA 3C24A 4R16A 3DQZA 3TCXB 1KR2A 1ZMTA 4H6PA 4ZFNA 3WYFA 4B34A 3FHJA 2FW1A 3QA3E 4X60A 2HSEA 4XVHA 3VJRA 3A37A 1ZICA 3CJQA 3KV3O 3MLBA 2B6HA 1Q3HA 1FFHA 2OHGA 4I7EA 4NX2A 5B58C 4X65B 2CUZA 3T9DA 1YSCA 1DUVG 2RAVA 1HDYA 2VP0A 3CISA 3KZOA 4RLZA 2QRUA 1BGVA 1J2RA 4F2WA 1UDAA 4D8UA 2JAUA 1AHNA 1GPYA 2BC9A 4QOFA 1N1MA 5A5VA 4UEOA 521PA 5HZHA 2A0YA 4KDEA 3IPLA 1JW9B 4LQ4A 2PT6A 2JAHA 2BD0A 2XMDA 2VKQA 1TEZA 4XOUA 1XQ1A 1ZEMA 1E1YA 3QPUA 1UXIA 4BO8A 3QM1A 1GLGA 4FYKA 5EERA 4AECA 4I50F 1MABA 1KU6A 4B82A 1NN5A 1XE1A 2BBTA 2PEYA 1O77A 2PUEA 2J0QA 4WZAB 2CB0A 4I99A 4MUBA 1ZZEA 5KVCA 5ABPA 2UUPA 3ICPA 1Z06A 3GRCA 4P3PA 3K0BA 3E8MA 1B74A 3BA1A 1U9JA 3B1WA 5K03A 5KWIA 2I1QA 4DC0A 4V1CI 3MUFA 1R0ZA 5CEJA 1EX9A 2G5PA 3HKEA 2J7KA 3NT4A 4FGJA 4GZLA 2NZ2A 2CVFA 1OOEA 4FMDB 2VWPA 3E9MA 1T3HA 5FKJA 1RXVA 5M34A 1ZGZA 5HG0A 3RNOA 4ZTZB 1Y3AA 1OASA 2OYCA 1CZKA 2TECE 4OPSA 1TTTA 1H2FA 2IV7A 2RKWA 1GV0A 1SO8A 2XJ9A 3I37X 2JCGA 4LDNA 6NULA 4HN4B 2RGEA 3DKIA 2ZJ8A 2QVBA 2XNKA 3LO5A 3S5UA 3V97A 4BVKA 1YR3A 4YCDA 7REQB 1Y1QA 2BJWA 4UMVA 2I54A 4JLJA 4KUHA 5KDLA 1VHWA 3G5UA 4TOIA 4NOKA 4FJ1A 2ADFA 4D8TA 5AW3A 1VCHA 2PKEA 3B1VA 4R1TA 4PXYA 1KFJB 2AJBA 2EKLA 2G71A 2WG0A 3TK1A 5CT5A 4DQUA 3KKLA 3EW9A 3UB3A 5CG2A 3RSGA 1TM7E 2HTEA 4Q3BA 1MAWA 1Q77A 4LN1A 1R6BX 2OGTA 4QEKA 1YONA 2D4HA 5EP3A 4MUAA 5LA6F 4BGVA 4EYGA 3IJ5A 4Y9SA 3T1OA 3E7PA 1U6KA 3P9QA 4DG9A 1MJ5A 3JQDA 1SOWA 1K28D 3L1KA 5H82A 5LMNB 1KOFA 4UC0A 4RLQA 5IYQA 2RHJA 2XMPA 1GPDG 1PR9A 3L92A 4O2AB 4F2DA 1B1CA 1LS6A 1JLMA 4YUWA 5BMVB 5BSGA 5C52B 5BOSA 4X20B 3HB4X 1FDOA 2VJYA 3H4VA 3MUNA 1FLDA 1N07A 3GFVA 4PN3A 1I36A 3SU8A 3RWOA 2H8GA 3B89A 4EF6A 4XL9A 2EU8A 4BU0A 5F23A 4C07A 1M7GA 3HUUA 5DU2A 5KPJA 4Q19A 1UK6A 2OKGA 1TJ3A 1ODJA 1ZN8A 4FIZA 4YJ3B 5AFSA 1U9IA 2H0AA 5F3RA 5MDHA 1G3UA 1RTKA 5U9CA 4R41A 3SLDA 1QSGA 1XTQA 4BJ6A 5CP8A 4EA7A 3OT1A 1N0UA 1L4YA 2AZXA 2GXUA 5BNZA 1N6LA 4CQNA 4Z4RA 3K4HA 3V1UA 1WSWA 2C1XA 4NBUA 4O4JB 1OTHA 3LRXA 4HE5A 5JECA 1QE0A 4PE5B 3BFPA 3I12A 1KERA 1SCKA 5H4GA 2CNLA 2G83A 4GEKA 3I3OA 3HUFA 2HN9A 1LDMA 2B35A 1OB0A 3D3EA 1A2OA 2I8LA 3H11B 3O2NA 3QIAA 3QVJA 4PHFA 1JU9A 3SZMA 1WIWA 1MO2A 3D81A 1P33A 1XMIA 4Z9XA 5JSUA 3ZWXA 2XDWA 3AGPA 1US8A 1QRUA 5F98A 4G26A 1LPSA 2QGZA 2QW8A 3KJZA 5JS8A 4D79A 2IELA 4MW6A 4OHUA 4X20A 3TD6A 3VGJA 1FJHA 1FU8A 3OLCX 4DQXA 1CRPA 1H2RS 4KG7A 3UJ7A 2QA4B 2HA6A 2J3KA 5IYZB 5G0WA 1QGUB 3CU5A 3UTDA 1VMEA 1DEXA 1D2NA 2XH8A 1GGKA 1XG5A 4N0QA 4ZODA 1JE0A 2XUJA 4BTLA 5AXAA 5IDQA 1JFTA 2G5TA 2VATA 3NVAA 5ALZA 3ZU3A 2R6ZA 5LYYA 3PQEA 4A4DA 1L4HA 4GL2A 1KU0A 2FPRA 4QGHA 3U7FB 1YC5A 2C97A 5LR6A 3A1DA 2VVTA 2G9ZA 1UBKS 2A5FA 2FFAA 2VUIB 3II6X 3GFBA 4RF5A 5JSHA 5A02A 1FX0A 3AERA 3E3LA 2PRYA 4F6RB 2QM8A 3GBVA 4IH4A 3D26A 3RJ5A 3ZWAA 4EECA 4EJ0A 1IZ8A 1T2FA 1A9SA 2R96A 3BYZA 1ZOLA 3O6VA 1NAHA 1RW4A 1X3LA 1EBUA 3A58B 3CPXA 2LCIA 3H11A 2AW3A 3NC1C 1OAOA 3WX0A 1ZXLA 4GI5A 3L6OO 1GG2A 1RI3A 3NM4A 5A04A 1LNZA 3GJ5A 5DNDA 3LLCA 3TZQA 2GWRA 2OBYA 3AF3A 4FBLA 1Z2CA 5FWDA 4PYKA 2AG0A 1LZKA 2CVOA 5ICCA 1D6SA 1ZAKA 1PFWA 3GLGB 3GIWA 4PGFA 1M1NB 2F3SA 4OD0A 3ZCRA 1CR0A 1THTA 1QGUA 2IYZA 1KQ3A 1L4FA 4QECA 2C1EA 3PICA 4ZN6A 4KUGA 3LC2O 2QUJA 5F1OA 3BEDA 2ZBDA 3DE1X 3NFYA 3KR2A 3FRJA 4UNRA 3KUKA 3AF6A 2GTIA 1JR6A 2C4WA 4QELA 1ODTC 2A9VA 2OB2A 1ISIA 1XOIA 2AEJA 3EIUA 2Q5CA 2ZSDA 3MT8A 3GRVA 3FKSA 5HGJA 3ULKA 3GJ0A 4OXNA 3AZQA 3FTFA 1S3SA 2EGHA 4GMKA 1DKMA 4AP5A 4RW0A 5CW2A 3RIHA 5K0ZA 4QLOA 1F3OA 1NVUQ 2AN4A 4WZAE 1J25A 1CUBA 2XNDD 3L0DA 2CVHA 5F9FA 2B94A 1VQOB 3A3KA 1UKAA 5KQLA 2Q2OA 3OH8A 4RKWA 3OURA 4GC5A 4E70A 1F8UA 2I8CA 3CWZA 2LWIA 1SCBA 2E4ZA 2WWXA 4TX1A 3U4CA 4DSNA 4GM0A 4TRMA 5AW2A 5E3HA 1I13A 2OXFA 1J2YA 4FKZA 4HDMA 1M3SA 4OB7A 5FTWA 3R0JA 2B5VA 4ZA2A 1R7RA 2ZI7A 1N2OA 1ZL0A 2B8TA 2Q62A 5HQ3B 3ZDYB 1WD5A 2TMDA 3ANMA 3O9VA 4X1IB 3MELA 1O94D 3E82A 4Z51A 1V3UA 3IP8A 2B4TO 3AY6A 1M1NA 3GLGA 1U28A 3OW2B 4RCZA 4OOXA 2CXXA 2SHKA 3B5JA 1W49A 3E1GA 5D3MB 5B6IA 4GAEA 2P30A 4L8GA 5TV2A 3VNVA 1Q6ZA 2D8MA 3ZR4B 2BMEA 1Y6JA 2ZTVA 3QYAA 4UDOA 1TB4A 2ATXA 3DBOB 3H5TA 3WGZA 4TM7A 4J6EA 2H2AA 2JLUA 3U44A 1BGWA 1XRNA 2D5LA 4IUBS 4P34A 1KDOA 5E9WA 4LXGA 2Q4RA 5TE9A 1NRWA 5CT6A 4WOBA 5IAKA 3CGGA 1MX5A 1B2RA 2R4QA 2RSLA 3HCDA 4P2BA 3SBOA 3EMVA 4IAOA 1ZI6A 2QU7A 1TZCA 1MDBA 1N6OA 3CTPA 3ETJA 4FLEA 4L5YA 4MVXA 4PZ9A 5CLLA 3K73O 1WCIA 3CRMA 3QFRA 1QG2A 4FKBA 1FFWA 3SR4A 1VI5A 3W1WA 3RS9A 1PJAA 1QV9A 5E38A 2FZ5A 4L9RA 3R5TA 4X7RA 2ZB3A 2NACA 4YRJA 4EJ2A 4KLAA 1KF0A 4QUAA 1U3FA 3NCTA 3GRFA 4V0LA 2J67A 4B7UA 3P0JA 4QTTB 2MDTA 1A95A 4YQZA 3UMMA 2IK8A 2BGIA 3KKKA 3OPQA 3IEVA 1M34A 2J32A 4J7XA 4KWTA 4EHLA 1R5OA 2VZLA 2QP4A 4X1IA 1N2BA 2VBGA 1FJ2A 3D6JA 1ULBA 4OFZA 4RZ2A 4YMHA 1KEUA 3UICA 3VR4A 1XLWA 2W2OA 5K4GA 4UTXA 3OPYB 4WRRA 2PZBA 1OF1A 3KX2A 3N53A 1KZ6A 5TQVA 2HRQA 4DMKA 4Q4AA 2PSEA 3MMXA 4H1WA 3MMPA 1S7GA 1UADA 4J91A 3KHSA 2Y27A 1CQIA 1ZY2A 4YRBA 4X3OA 4ENVA 4YXFA 1C29B 3LT5A 4BQNA 1DG1G 2ZL5A 1X9GA 3NCHA 4MS4B 3LBIA 4CIDA 1B4DA 4P4GA 4PZPA 1O8BA 4US1R 4A5SA 4ZJPA 1IBLB 4NCBA 4LJ9A 4KQMA 3CO5A 3WYEA 4NBRA 4XXHA 2OPHA 3LQ2A 3AHDA 3SF8A 4EF4A 2FUNB 3I6YA 2JD1A 4TT3D 3MAAC 2X0EA 1E2LA 2DSNA 3R0IA 1KBOA 3WYGA 4WZKA 4AI6A 1LPNA 4I3HA 4X7FA 1PGNA 3M9LA 3OCWA 4UUQA 3WHIA 4AP6A 3LL7A 1HDXA 3O4RA 5FAXA 2QM3A 3CLVA 1B14A 1CZUA 2IYWA 2NO0A 1JEAA 3CH6A 3FYTA 2R8YA 3JWGA 4AMVA 1XD8A 3RM3A 1JWLA 2DYIA 2YNMC 2BL4A 4J1SA 4UUMA 4DLBA 2JLWA 2FW8A 4DABA 5KHAA 2IF2A 1W4ZA 2A0UA 2EFCB 3LVFO 3T4UA 2C61A 3CVUA 1QGAA 5AI4A 2P3SA 3STVA 4XN0A 3V2GA 1CZHA 5A3RA 1IEVA 5JNSA 3Q8KA 1NQUA 4C7MA 3OPYA 4CM9A 3RAPR 5ANRB 2E37A 1QOPB 2D1SA 2ENUA 3ONYA 4L27A 3T4XA 5LD2C 3KELA 3VPHA 4DK1A 3R3YA 4YV1A 1E9VA 4TMFA 4YPOA 1NGSA 4BCBA 4KQJA 2D0PB 4AS1A 5HFAA 4OAPA 1I6MA 1J07A 3H7AA 3SNHA 4XLFA 3NORA 2FPUA 3OAAA 4AULA 1XVTA 3EULA 1OI2A 3O2QB 4CKZA 4HH1A 1N3LA 4B0PA 5JYEA 2JC3A 1F48A 1H65A 5EIBC 1VLJA 2XNSA 3CB4A 4BFLA 3DVRX 1W2HA 1KZ7B 3AF1A 5I5EA 1JBEA 5EE0A 2MOKA 4N3NA 3ZE2B 1H2BA 1CEYA 4HKTA 5FUYA 1I2AA 4FYHA 4BGIA 3M5CA 1F06A 3QG5A 4E7PA 4ZARA 5FOWA 5B1EA 3QPAA 1ORTA 4EFMA 2XYPA 5EZ5A 4YJDA 5A4IS 4UMDA 2FUG1 2EW1A 2BISA 1Q84A 4AJOA 4RD4A 1H05A 1DKQA 2OXEA 1DRJA 4WECA 5DLYA 1U1EA 1UD4A 4OFWA 5DV9A 3V7YA 4AP9A 1LD3A 1BXZA 1FS4A 2ZTHA 1BJKA 3TN7A 2DE0X 3OO0A 3BDVA 2D5IA 5B7QA 4G86A 5JMPA 4FW9A 1JFSA 1J1UA 5AHWA 2ZT6A 1A9ZA 1KQGA 4KDFA 4ARCA 1UQTA 5E7JA 4KFRA 4LC1A 2A35A 5FHQA 3UV3A 3I1FA 1IHYA 4MCJA 1GQFA 1XEAA 5IX8A 2C82A 2CBZA 3E1YE 1E6WA 3FRIA 4KFUA 5A05A 3JQRA 3VZCA 3BZWA 2BFOA 2M2IA 3EOZA 3JX9A 1F9EA 1XPRA 1UT8A 3LDGA 1K73D 2XMBA 5JO0A 2PLAA 5DHPA 3OO1A 3MTIA 3HWRA 4FPXA 2E48A 3JVIA 3PSAA 2PMEA 3SYRA 4RSMA 3NEJA 1URPA 4LXTA 5TGZA 1UH5A 4RQTA 3D8BA 2FB9A 3KQUA 1YHYA 4NK4A 1F17A 3GZNB 3LECA 1A7JA 1XXHA 4FHFA 4ILKA 3QLVA 2CZCA 2PSHA 1N06A 2JANA 1CF4A 1NVXQ 2J41A 4CFSA 1D1SA 3EQZA 4Y7CA 3SJUA 1P19A 5IKPA 1GEGA 4NFSA 3R7AA 4GX2A 5JJCA 1D03A 4GRAA 4FCCA 3ROQA 2RKOA 3OPOA 4BBJA 3AF2A 3I04A 4HFRA 1H4QA 1O3YA 2V98A 1W581 3LUPA 3CSSA 4HO1X 4MMYB 5CXSA 3JPWA 3KAQA 1GV1A 1QWOA 1YZTA 3F6BX 1A9RA 5L3ZA 5TMBA 1SG9A 1P61B 2GN6A 3H9UA 2AMLA 1A9XB 2MMCA 2X86A 3ENWA 3MINA 4FSXA 5AJYA 3VZDA 4BBAA 5I9NA 1PG0A 2Q3DA 3O5AA 1UP4A 4JQZA 3E6AA 3BRWD 1QG6A 4Z7QB 3QBDA 3Q7IA 3D5EA 4X1KB 3G13A 5DBOA 3WB9A 1EVIA 2OUIA 1IG3A 1XZAA 4LTMA 2O8CA 2X9QA 3UMRA 1M54A 2Q6IA 5JI2E 1QQ7A 4POOA 2X15A 3B8EA 4R7ZA 1TMOA 2AV6A 1DIRA 1CUYA 3FN4A 4REOA 3WS7A 4ARAA 1ML3A 1N5DA 3CEHA 4UMFA 2JNWA 3LFUA 4KIJA 2HA7A 5AN9A 1CDOA 1ZHHA 2JIMA 3GZNA 4JYZA 4MKXA 1I7NA 3QVMA 3KKNA 1SZCA 3DMFA 3N2YA 5BWBA 3LX4A 3E9QA 5A89A 1XMSA 4OQLA 1EXWA 2IIVA 2J9GA 2G40A 3HU5A 2H85A 3FI0A 1YQTA 4FFSA 2WUVA 4L8FA 4N3GA 1E1NA 1G4AE 3CRVA 1JYSA 3SEQA 2WQ6A 2QLMA 1P1JA 5LZ5A 3RK0A 3TQSA 3WKAA 3OPVA 5EJ8A 3A9WA 2YINC 4LF6B 5BWNA 4JVMA 1E3EA 3PJFA 1YJCA 3TLCA 2H1OA 5LXTF 3B78A 1HZZA 5HZKA 2KVOA 3L4KA 3NDPA 5MN5A 3DA8A 1LFDB 2Y1EA 3ZWVA 3GK3A 2DFKB 3ILHA 5L95A 1A9XA 2C58A 5U1PA 3F2VA 4KQGA 4YCCA 3O7MA 3U61B 1FTYA 2XHEA 4U2FA 1P2SA 4GXQA 3DMTA 3F9IA 4H27A 4X1KA 5IDXA 1C7RA 2AHOA 1DI0A 3QUAA 4YAOA 2IX3A 5A0TA 1CUXA 1QFSA 5DH9A 1YL5A 1XZIA 1VYUA 2IY9A 1CIJA 2QZZA 4Y2XA 1XNHA 1RTTA 2BDTA 1NOKA 1AA9A 3EUEA 3KFVA 2IH4A 1Q7TA 1N2EA 1BVUA 3NC4A 4JBNA 4F5DA 3KKPA 1XKTA 1MEJA 2QIOA 2FSIA 4J76A 5TX7A 5CB4F 1OC2A 1XAJA 2C2GA 3WAJA 5IN4A 1MX1A 1XDUA 3UB2A 1JSCA 1A4UA 1X1BA 3UT6A 2YOGA 3HABA 4KW7A 4TKMA 5EJ7A 2ONZA 4F45A 2Q5JA 2BPOA 1K5HA 3MWDB 1OVMA 3MWFA 3TL3A 3KT8A 1OLUA 5AKIA 1GQRA 1V8BA 3WOHA 1P1IA 1UDCA 2PS0A 3PGXA 2VOEA 3ZWCA 4MK4A 4NZMA 3TKAA 3EH2A 1LBSA 1EFRD 2OBFA 1R6XA 2PMKA 3G6KA 2PT9A 3UXEA 3H2HA 4CN9A 2P4SA 5EEHA 9GPBA 2AGVA 3BPSA 1FNCA 4OSOA 4A8JC 4O2BB 1U98A 4NZZA 2VJLA 4YFVA 4AVZA 1Z0KA 1A98A 4B3MB 1LK0A 3HAGA 1ABEA 1BX3A 2IYOA 3BTVA 5HF9A 2OV3A 2V7UA 3KL2A 3JQ8B 4N47A 4A15A 2C7QA 3AEUB 4JT4A 2GCIA 4OYRA 1AUOA 3N8KA 3EAFA 3ZZUA 1NVEA 3KKEA 5BWOA 1U63A 3RUEA 4M1EA 2Z30A 3SSOA 2X2FA 3DE5X 3KD3A 3PD7A 1YUMA 3OZGA 5JQGF 3THWB 1G5TA 4IR7A 4E2ZA 2FHPA 5THQA 1D2CA 5F2EA 3WE7A 3L0SA 4KU4A 5IJXA 1OVGA 2YV1A 4I6EA 1FYXA 3B9RA 3OPYI 4IBOA 2CXHA 1KI6B 4TSKA 1PZGA 4M1MA 1DINA 2QG6A 4X00A 2WWVD 4NXMB 2CD9A 4TL8A 5JAOA 1WDKA 1LV7A 1UANA 1C0KA 2G63A 3MZ0A 4PCVA 2OAQ1 4BMVA 2O8NA 1VQ6B 1JA9A 1EX1A 2CD7A 3E3MA 3MWDA 4KK3A 2YZMA 3U3DA 4Y3UA 1FDRA 3DYIA 1RVDA 4WVFA 4HHEA 4CHGA 4LF9B 3DULA 3QKIA 4BN0A 2J6CA 3AF4A 4GMDA 4XM1A 3V2IA 2GESA 3QHQA 4RE5A 5JIBA 3PPVA 1BQ4A 4NCXA 1W35A 2ORWA 2YIMA 5EKUA 3I53A 4NIMA 4IFIA 4D6YA 4O2BA 1AXRA 3LBHA 4R2KA 4GRDA 1SBNE 2CNOA 3R3WA 1PT7A 3PENA 1RLMA 4CMJA 5JR3A 2OFFA 1SCUA 3ED5A 1BE6A 2JLBA 3RG8A 3G49A 3RTEA 3CO0S 4QFCA 1VQ1A 3DOEA 2PH3A 3GMIA 3JQ8A 3AEUA 3RFUA 2OA0A 2AOTA 1T0JB 1W87A 1BOOA 3WWYA 6LDHA 2B3DA 4I36A 4JOQA 4HP8A 1F14A 2R9VA 1QHEA 4Q16A 2GN0A 4Q9IA 1UJMA 1P4RA 3KZNA 3TZCA 2QGGA 1BOFA 1JP7A 3Q6IA 4OH1A 4CODB 4YV7A 1E0KA 3ZVNA 1FYEA 2Q9BA 3VGPA 1ZMXA 4EOGA 1X80A 3EIWA 3VR2A 1KI6A 1R0BA 2PMBA 4BLTA 4CMEA 3EQ7A 3PTZA 3RS4A 5LNK1 2FQQA 5CVCA 3HBNA 4B76A 2QTZA 1CE8B 3O4VA 4WLEA 2FSFA 5BNTA 1P6QA 1I9GA 2E9SA 3H87A 2MT9A 5LD2B 4ZI7A 1NU6A 2VBIA 1BKSB 2RGNA 3BGDA 3BGWA 3I9V1 4A7PA 1J7KA 4O4HB 2CZGA 3AEQB 4W8HA 4XSVA 4YDSA 4N9WA 4ZVMA 1N2CB 3PEWA 4KNYA 1Q1QA 2ATVA 2YX1A 1W5BA 1PEKE 4R5HA 4R8MA 1SRQA 2PX8A 4L08A 4L4ZA 4N3CA 5CCDA 3CVVA 3DW1X 5ALEA 2BUAA 2ZBFA 3AHFA 3X1KA 2Z57A 1E2GA 4I1VA 4TRRA 1KORA 3KPVA 2J0SA 1JIUA 1VP9A 4CKYA 3ZY6A 4J07A 2WWHA 4WE3A 3ZQUA 1UOOA 4NBVA 1WXHA 3FSEA 4KEAA 2YV5A 3HEMA 3VSBA 4E0FA 1ENOA 3DTYA 4Q39A 4O8CA 4EATA 4W63A 3A4LA 1HFKA 3FKSD 3H3JA 3BWXA 1PT5A 1R4AA 1NPDA 2W70A 3FTQA 3BQ9A 2WR8A 1NWHA 3ONEA 3SBEA 4HVTA 5JPCA 1YQEA 2F1IA 2F9FA 3PC4A 1NG1A 3O1LA 3FNEA 4PZUA 1T2DA 1CE8A 3IKJA 3ZD7A 3R41A 5IAEA 4ZGQB 2ZB8A 4HQOA 5CW1A 1UD5A 5JEEA 2NUPA 3S2YA 1OFVA 3G2JA 1XZPA 3ZHUA 2D0OB 4M8SA 3UAVA 1P91A 2EKZA 1ZOPA 2AQKA 1NTOA 2H29A 2WP0A 5HKKD 1YKFA 3P2OA 3RYCB 4BNXA 3MLEA 2AI3A 3AEQA 1Q57A 5EP2A 3SK0A 2X19A 4LJLA 1GFSA 5CEFA 4MWCA 4IEIA 4WKCA 3UPTA 3IIKA 4ROSA 2JKZA 4EHAA 3NAGA 1FSFA 1NPTO 4JXJA 2VDMB 3HQ4O 4ZRMA 1UJ6A 2F1OA 4HWKA 5EI5A 1QGDA 5FO1A 3GG9A 3OG9A 4BEJA 4XR9A 4EY6A 1IN1A 2VT3A 2C94A 5IZCA 4MW2A 3ACDA 4LVOA 5M29A 5KJCA 4K9LA 1VLVA 4B3CA 4CVNA 3VFDA 5TRDA 3LZDA 5KJ1A 3M0EA 3KALA 1BU8A 5DP2A 1VRVA 2FVGA 5ALUA 2PZEA 1PR0A 4JBXA 1WX1A 1FSGA 2JIBA 2O1WA 3VNAA 5EHQA 3NWJA 2RB4A 3UV7A 4RO0A 2Y6VA 1X7DA 4H6XA 3MB8A 1ZGBA 3M5WA 3LCMA 4XEUA 5CFQA 1OCEA 2XCOA 3C7CB 3IQDB 5IANA 1P1CA 2FJPA 2H18A 3EEBA 4OUDB 1GITA 3SDBA 3DLHA 2HO5A 4RPKA 3SBXA 3WGVA 2W93A 2ZRGA 5CJ2A 2G7MC 5C1BA 1W47A 3R40A 2BZ0A 2W0SA 4JY7A 3BJRA 1IIRA 2MTBA 4PYOA 5G3YA 3P1JA 5BQOA 3NONA 4UATA 1TJ5A 3RYCA 3I04M 2JBWA 4GF5A 2VCYA 4RGQA 4DDKA 1D8TA 5ALGA 5FBLB 3CX6A 1E69A 2BFMA 1V5IA 1YT5A 2WZBA 3KR1A 4TLDA 3OIWA 3SIWA 3P19A 2XWJI 2V4ZA 1UBLS 1NUPA 1SUCA 2ZROA 3K94A 3ORQA 4HAVA 2JGDB 4HEA1 3S99A 1NXXA 1Q22A 1YCDA 2OPBA 1CJCA 1EE1A 4IGEA 4G23A 1P6UA 4IOJA 5FOTA 5BXYA 3H42B 2OV1A 3A05A 3GFSA 2V55B 1HL3A 3A06A 1RAFA 3PLRA 3S6JA 2GARA 4X44A 2GR9A 4U9UA 1ZVMA 2OP0A 4HDAA 3UB4A 2RHWA 3T3EA 4N03A 5F3WB 4KAAA 4XEHA 4JVSB 4ZT4A 3ZTYA 2X6XA 1YS9A 1NNEA 3FF1A 2O19A 4JNCA 4GYKA 1WRBA 3GDFA 3RHZA 4LSMA 3NS7A 4DLYA 2Y1FA 2YUTA 4EHJA 5CA1B 4JP8A 4GPEA 1R5NA 2HWUA 2B20A 2IHJA 1SUSA 3JCZA 3QKTA 4QVAA 1A9PA 1W8IA 1Y98A 1IWOA 4BL5A 2I22A 3K4QA 4IJ6A 3G2KA 2IBMA 4RPIA 3PWTA 1TQ6A 1XRLA 2V97A 1P7YA 4DLVA 4AQYB 4GEGA 1E5TA 1XB2A 1TQ2A 1F4PA 2XTAA 3D1JA 3NH9A 1C8LA 1UKEA 3I0NA 4R2MA 4B2IA 3RADC 1L7OA 7GPBA 1WBJB 1FLAA 2JGDA 1YJAA 1OH7A 5K0FA 1H6DA 1GGFA 4ZICA 4QFDA 2XE6A 3CLRC 4XQGA 2QAJA 1U3GA 1WXWA 3QNMA 1W1IA 1PG5A 3QEMA 4R40A 3Q3JB 1LPMA 5BNWA 3RYFB 1POXA 1PNOA 1Q15A 3OAAD 4OF4A 3F3KA 3C39A 4FMDF 5EE9A 5K3CA 2P8SA 2R87A 1A96A 1YDGA 4LXIA 4C6SA 2CMGA 2VZ0A 1LX7A 3CXUA 4RZ3A 6ABPA 2H59A 3TVYA 1CWUA 5CA1A 2BMAA 1E1RD 4MRPA 1NQXA 3OZTA 4MUXA 3RUPA 1BDIA 5TEWA 3H5VA 4MVJP 5KKAA 3AVUA 1MENA 2E6KA 3CUUA 1RLIA 1ESCA 2QR3A 4JROA 1UZLA 4P0PB 4A8JB 2EFGA 1N2CE 2WMNB 1GUAA 4LZOA 5A2QA 3EXFB 5AT1A 3FCOA 3WQZA 4UAUA 1S8AA 3DYBA 4RHXA 5EVCA 4QUZA 5EAIA 4C6TB 4B74A 3QKUA 1SD2A 4P7KA 3NBMA 4I4TB 5I3ZA 4WOJA 3PR3A 1VCIA 1U8EA 5K6TA 1DQPA 4X06A 1RYDA 4KKXB 2HYIC 4P5EA 2EIXA 3Q9LA 2A7XA 1P4AA 3B3AA 2P0AA 4M8LA 4DQDA 4IIDA 3VDNB 1WB9A 3ZQKA 2GJPA 1UXHA 2F1LA 4MEBA 3I39X 4G6IA 3RAGA 3VR6D 3ZHCA 1JXOA 2PUJA 2WMDA 4M54A 1BIFA 3ROTA 1DC5A 1GZSA 1UEJA 1YOVB 3EG5A 3WB0A 4C76A 4G8CA 4PTYA 3DDWA 5IJ9A 5I51A 2Y68A 3INTA 1SVSA 3N2ZB 3COVA 4KYUA 1Z62A 2KWIA 4MUEA 4UBLA 3LKZA 2FEAA 3IOCA 1C80A 1QTNA 3UY4A 1ZH0A 3MM4A 1HI9A 2C3YA 4G0ZA 4JBHA 4MVJA 3F3SA 1KBZA 1M1YA 2OFPA 2GN1A 1H2WA 4HB3A 5GQSA 5LUAA 3LQEA 1I51A 4ZXPA 4CQMD 1YS2X 2ZI3A 2PFSA 3GRPA 3IOMA 3JAWB 4WN3A 4BO5A 3FVTA 4EB6B 2XZPA 2CHGA 3TIXB 1W75A 3FPCA 3MJSA 4BBPA 5AM5A 3OHSX 3MAJA 2BLLA 2VK4A 3NT2A 4C6TA 1T1GA 4CUJA 1NFQA 1T13A 3N59A 4G24A 2VBTA 3MTAA 1MEOA 4P3OA 4R1MA 1O0BA 4I4TA 2QVGA 1YZFA 3SS8A 1B0AA 2C3MA 3RI3A 1NRIA 4HVCA 1E3MA 1NATA 1G8YA 5BR7A 1XHLA 3EEFA 2PFGA 4GMFA 3TAXA 3TSWA 3T5AA 1O6ZA 3KYBA 2ONCA 1NBWB 3CX4A 5EZYB 1XVVA 2IX9A 3ECAA 3WQRA 2YBEA 2H4FA 1N8RD 4QA9A 5T5QA 1AMUA 1Y8AA 3A1CA 4UM9B 2D54A 3QUBA 7ABPA 3Q6NA 4DIFA 5CLHA 4UXHA 1JDZA 1GPKA 1BU5A 1PEDA 1ORWA 4L6CA 1QYIA 3WQQA 1YOVA 4D99A 5I7SA 2Y1WA 2VHVA 5KNDD 1NB9A 3E5MA 1JQEA 1XRRA 2FZGA 2R1VA 2QTAA 4MI1A 4JLBA 1ISJA 4ZEWA 1IXRC 1Y5LA 5EXEA 3VHXA 1U8CB 2EW2A 5JS1A 1ULHA 3O4IA 3TSOA 2AG5A 1M5TA 2FEKA 1AKWA 2A59A 3PJGA 4TYMA 1W4LA 4D9IA 4NBWA 4G5RA 1FW6A 3BB1A 4DLSA 5HIMA 2VTVA 4OHPA 5LP6C 5E9AA 4U9HS 4XJXA 3N6VA 4LF4B 4HUTA 3JAWA 1W0KA 4DMUB 5I45A 4EB6A 1JG7A 2O7RA 1LPAB 2H5EA 2QGNA 3I9OA 3VA7A 3VH1A 3TNJA 3BXOA 3IHWA 1NRKA 3OW7A 2VWGA 1PFUA 2Z8XA 1KQFA 1AXEA 2X8WA 2H8KA 1E7RA 1ZIXA 4C0XA 3HS3A 4DA8A 1R6AA 3JAMA 4H3HB 2WAXA 3QWBA 2JHCA 2W8BB 2Q4TA 4MUYA 1HR0B 5CNMA 4KR7A 5ALFA 5EZYA 3ZQ4A 2Z9BA 1KC8D 1NNSA 2I67A 1VRWA 3C41J 4YK7A 2WU1A 4BMYA 4EK9A 2QRVB 1XCBA 2Q3FA 3B1XA 1AKVA 1X6VA 1XTIA 2DF8A 1WUHS 2RGWA 3G2NA 3PP8A 3Q2IA 3WLIA 4BE9A 3HLTA 4EA9A 1OE0A 2AVDA 2NNLD 2QTRA 5IABA 3W2EA 1EK1A 4DLPA 4U7WA 3D7RA 3IQZA 2ZJAA 1XLVA 2H7CA 1N57A 1WKVA 1VQ7B 2AIRA 2EF0A 4GSLA 2ZR7A 1KO5A 4L5JA 4NE2A 5CCXA 4TTSA 4K9MA 4QYTA 2FWPA 4RYDA 5FPSA 3PV0A 5E6RA 1HYQA 4Z9YA 1EP2B 2Y9PB 5L45A 1NV8A 5D8DA 1YMVA 2EZ9A 2FX5A 3FMPB 3PQ8A 2QZ4A 1AQNA 1JT9A 4MI3A 5JNTA 2NAFA 4DR5B 3NNNA 3EQ9A 5ALXA 1XKQA 3LYUA 1A9OA 5DCWA 4Z4GA 1OV6A 2ZREA 4EUNA 4E5DA 4S0ZA 3QOXA 4RZHA 2Y8EA 1YR8A 3P26A 4WEQA 1FBNA 1ZMRA 2LNDA 5ED4A 1T0PA 3E7XA 3D1LA 2REBA 2Q1TA 3ET4A 5LP1A 2XIJA 1V3TA 1CIVA 1CK4A 2JFGA 1F8FA 3JZAA 5A8AA 3K7EA 3T9AA 5HR5A 3ESAA 1DCTA 1NW4A 5G4KB 1D04A 4WXPA 1N6KA 1Y4DE 3DHNA 4G07A 1YIOA 3KZMA 1LW6E 3NBXX 1U31A 3RTCA 3SG0A 5KVVA 4ZI3A 4N6OA 3S8YA 3SYTA 2C2MA 4FC6A 4AJLA 5AYVA 1I1QB 3AKEA 5F76A 4XIFA 3BWMA 2BKEA 3NIFB 4KSYA 2CCJA 2LZ0A 2ONJA 1TKBA 5FPQA 2GK4A 2ZCJA 1JTFA 3B1JA 3KOOA 1JIJA 1I32A 4QICA 3UMJA 4JLVA 4XPIB 2DHCA 5H7XA 3B1KA 5TJ9A 4DV6B 1PRYA 3TEFA 1XA0A 2CFRA 3ZPNA 3FAZA 3ZWKA 2VUSA 3FNQA 4DVGA 2CEKA 4N8EA 1IVYA 4AKTA 2NUAB 3ISTA 1DDOA 4XR6A 4DZRA 4F93B 3QQ5A 1DWUA 1MB4A 2P3MA 3AU9A 5FBKA 3C48A 4DEXA 3N2EA 1HTBA 1M2KA 1J22A 4HRVA 4KSCA 1KYTA 1U7OA 2NO5A 3ROFA 1GSHA 3GLQA 3TB6A 4U0KA 2CMFA 5LM3A 1WBDA 2FR8A 1HURA 1U8AA 1XO1A 4D4MA 1G5PA 3K6KA 2V5VA 2HA4A 1FBTA 1U6JA 3DMGA 1L7NA 2H57A 3G3EA 2N46A 1RWNA 4NFHA 4CKBB 1WVIA 3HGMA 4IDAA 5AVUA 5CH3A 1RI1A 1PZHA 4U00A 4CYMA 3GJQA 3EA5A 4BAUA 3MMZA 3PIIA 1GPWB 3LT0A 1HGXA 1XIVA 3GJ6A 2FN7A 4G41A 4D26A 4E6EA 5G4KA 5CTAA 2VJKA 4M98A 3WLHA 4MGZR 1R9MA 4V3BA 2D00A 1HLGA 3GQVA 4MWGA 3VDQA 4F84A 3DP7A 2DTEA 3DVLA 3FNGA 3GIRA 4HTFA 4PPYA 4AAYA 2DHRA 5CM2Z 1AKQA 1A8UA 1R10A 4DDWA 3R0QA 3H1FA 1S2NA 1QHFA 4Q00A 1YVUA 1IDN1 2ATEA 3OZWA 1GIAA 1P5RA 3C6QA 1TCBA 3ELWA 4XPIA 5A0VA 1EFCA 3EIHA 4X84A 1M6NA 2FPSA 1UFQA 3TLEA 3V1TC 2NUAA 1ML4A 3E2MA 4Q5IA 2H2FA 3EEOA 3E1SA 1ODLA 3HBMA 3HVIA 5B55A 3D6HA 3KE9A 4C7OB 2NSHA 3O94A 1EEHA 1R3UA 4UFOA 4QOEA 4R1SA 5K2MA 3AB8A 1ZUWA 2Z6UA 4NZOA 1AKTA 2X4LA 2ZSBA 4P6YA 1AGNA 1E4YA 5GJWC 5AHKA 3ZE7A 4B5KA 4CKBA 3LXMA 4N7BA 3UMYA 1DHTA 5I7HA 3N28A 3ORYA 2C2WA 1KEVA 4P53A 2ESRA 3N0XA 5AESA 2XXAB 3PS9A 3EGDA 1N0HA 3OZIA 2XDAA 1MLDA 2GVNA 3GP3A 1WU7A 4MVJI 1V9LA 2ZYTX 1W34A 1JR4A 1DBPA 3MJCA 1TFRA 4LUCA 3GZ4A 1QTRA 4HXYA 3OJLA 2IWHA 2P75A 4JJ8A 4KMRA 3GYBA 4WJKB 4OQEA 4YXWA 4JCOA 5IWAB 4WKNA 2M6RA 2C5SA 2EX0A 3I8SA 1V6AA 1TM4E 1H22A 3ZBPA 1XPUA 4KYIB 3V46A 2I99A 4JLWA 3B7GA 2QUZA 4M7WA 2OL4A 4AN1A 3HDHA 4AF7A 5JDCC 3RPEA 4G25A 3NE5B 2J33A 1ZH8A 5ICFA 1EX6A 1PHPA 1TKRA 1TA9A 4UTZA 4LJAA 4J1QA 2OV6A 2ZI4A 1VFPA 3RGGA 3FPEA 1O6GA 1XZFA 8OHMA 1UDRA 2LDXA 1WXGA 4LXQA 2GAFA 1Z4NA 3QV2A 3DOOA 4XGKA 4AKGA 3LCJA 3WRVA 1ZSVA 4RZXA 5IMBA 4OBBA 1HNWB 2VP6A 2FPOA 2XCLA 2XE4A 3TTVA 1TM1E 1RXYA 2J9ZB 1EH5A 1R6DA 2LPMA 2QE6A 2QUHA 3CY6A 5EIBD 1TE2A 2H2IA 3KOWA 3QE3A 3ZHQA 1V7QA 4W5NA 5F78A 3L7KA 2PRKA 3A32A 3ZDDA 1ZIOA 4LISA 1EI9A 1Q0QA 4PZCA 1MB3A 1N9GB 3IPCA 4CL8A 4N3BA 4BX0A 3COPA 3LQ6A 1QC5B 2FQ1A 3KSBC 1YQWA 3NKFA 4PGAA 3LC7O 4F2GA 1TK9A 1OX6A 3VXKA 2D0IA 3HGTA 1KEEA 3K0FB 3ZQ6A 5HFJA 3TZEA 4Z2YA 3AWDA 1E5DA 4ZJZA 4YIHA 4KR9A 1XEXB 2UYGA 3BY1A 4ZQEA 2GEDA 2ZJ2A 4P9NA 3TAUA 1UD3A 2VQ3A 2W00A 2O2XA 5DCYA 3HJBA 2JI7A 1K9MD 4MVJM 4TTVA 4QO8A 1JV2B 3LTNC 3GY0A 1JHPA 3VZPA 3CNQS 1XMOB 3OIDA 3IKLA 3JR3A 3VC2A 1BWSA 2BDUA 2QD1A 3GLRA 3V7AA 3T9EA 2HT6A 4II3A 1SHTX 3H5RA 4DG5A 1CP2A 2Y71A 3UG6A 4B3SB 4C5AA 1DCKA 1Y9EA 3NV7A 4L0CA 5CGZA 1IHPA 1T3TA 1KDTA 1ZKMA 3CCMB 2IZ0A 2G04A 1SKYE 3ETDA 1E1CA 1YMQA 4Q9NA 1CNMA 5FV7A 3ZXXA 3G0HA 3EXG2 2BVNA 2WF6A 3GPLA 1GOTA 4KTTE 1ULTA 1YR6A 3OIVA 2OOKA 3IUBA 2DIEA 3IBSA 3GVJA 4I8IA 4N7JA 5FLKA 1BKDR 4J1TC 3E5RA 1WULS 1QV6A 4LK2A 1N9GA 4I0WB 3D2LA 4AYTA 4DYDA 3CCEB 3K92A 4E2XA 2C77A 1UKCA 3RC7A 3GLFB 3ZGZA 1QC5A 5LP6B 1SZPA 3KUDA 5DM2A 5GIPE 1DT5A 1U94A 3H2ZA 2Y0BA 3OWOA 2V7BA 2XDYA 4OJQA 4MEJA 1OUMA 13PKA 4RM0A 3V8MA 1QHHA 1DJPA 3WBJA 3FTEA 1BN7A 3L4JA 4NFLA 2FUG6 3NBAA 1EQ2A 4RSRA 4DGQA 4TYYA 1CFJA 2AB0A 3WK5A 1B8OA 3HFJA 1QK3A 1Z3IX 5JPDA 4RJIA 3A6DA 3UGTA 1PS9A 2CL7X 2B1GA 3UK0A 1C9NA 1NLMA 4YP9A 1AZSC 3JSXA 1JIIA 1E63A 2GA9A 3LYAA 5I7UA 1YU9A 4C3VA 2OP1A 1II8B 1XZ8A 3VSEA 1DQSA 1OWOA 3B6ZA 4LDJA 2GYVA 1J0DA 1VCMA 1QIKA 2XB4A 3D8HA 3S8EA 3CVYA 1AB6A 2ZPAA 4MS1A 2OQVA 3CZPA 5KVSA 3FUXA 3BXXA 1LK5A 2LVBA 4FYWA 2CNDA 1LSUA 5J2TB 2C7PA 5CVDA 4WZLA 1JG4A 4OOFA 5F33A 2JJ8A 4UEWA 3T7TA 3DMDA 4F4FA 4JELA 3AFMA 1DX6A 3GLFA 1HEYA 1N6HA 3FOBA 3R7WB 4IS3A 3F47A 4KRFA 1WQ1R 3UH0A 1L5KA 1T6XA 4KE6A 3BSWA 4DBVO 5HM6A 3EFBA 3WLTA 4K9PA 4UAGA 3IL2A 2A86A 3QEAZ 1QH9A 3ZD6A 4P92A 2RARA 2BHLA 2ZATA 4PF1A 3VVMA 1YB6A 5LWHA 5EXDA 4G4JA 3UXMA 2VP9A 2VDJA 4B6PA 3WMXA 3SLRA 4F86A 4LYYA 4P9SA 5EQDA 1MC5A 1TMYA 2BJVA 3ZZNA 1YQXA 2AC4A 2XHZA 3AHCA 2V31A 3HB5X 5JAQA 4DJDC 3V4FA 4FYXA 2WJ4A 3LVQE 1DXOA 3N0WA 3BAZA 3QXJA 5DKFA 2MU1A 3M6VA 3GCZA 1QDEA 1W0JA 4LCBA 4R3UC 1E2KA 2MINA 3R6JA 1JQ3A 4DHWA 2XZLA 4L28A 1SXGA 4WCDA 2HD4A 5AI8A 2RAFA 3OA0A 4GICA 3V8VA 3HFSA 1HOTA 2Q8NA 2I6TA 3MFYA 3N6XA 5F4MA 2GLUA 1NJ6A 3R23A 4KV7A 5J2TA 4Y2UA 3AJAA 2VT2A 3IE2A 2Z2IA 3DEHA 4GC9A 4I1RA 5AW5A 1CR2A 4WASA 1Z18A 4U63A 5JS6A 3R7WA 3TVTA 3UJDA 1C8KA 3L8HA 3FYDA 4KOAA 4WOCA 1NQVA 4QUIA 1G16A 1OXXK 3I83A 1DX4A 1HRDA 1YO6A 2AJLI 2CJYA 2PX5A 4YP0A 4G0UA 1XYVA 2QLJA 4FE3A 3UJ6A 3PRKE 3GB9A 1GGEA 4O2BF 4L4SA 4UTPA 1QLHA 3LQ4A 1ZVQA 3HJGA 1AKYA 4NS4A 4TXJA 1IBCA 1CUIA 1P5ZB 4BQRA 2RJ3A 1R5BA 1AUVA 2SCUB 2CY0A 2MSEB 5B4UA 4P4UA 1TLTA 4YGYA 4LJSA 4MJ7A 5LQMA 2QJTA 1GAQA 4MLCA 1NY5A 1XQYA 4WNCA 3LT1A 1NVBA 5BT9A 1ZD1A 1QV7A 3M6XA 4P82A 1NF9A 4KO4S 4B31A 4EB0A 2YHIB 3G8YA 2B61A 3C3CA 5FUVA 4CMBA 5BQPA 5ES4B 3R6DA 2WEKA 3FOEC 3K6JA 2YFKA 1YJ9B 4ARZB 1XD2B 3SVTA 2Q4DA 4ZU1X 1VQ4B 1R0XA 5A2GA 5KYUB 1E43A 2BM8A 1P2GA 4MKFA 1T1JA 5LOVB 1E6MA 2P2ZA 1IXSB 4HUJA 2FZKA 4ZI7F 2FWJA 5ILGA 3V80A 3GP5A 2O0JA 4G0NA 4GIBA 1ACLA 1ESEA 1L8XA 1TC1A 1GSAA 3AHIA 3I92A 4BVHA 4ZAXA 5ITVA 3FZGA 5AUNB 3W4JA 2Q9CA 4UNSA 4MICA 4CIXA 4HH4A 3E84A 1PS8A 1FFAA 4OCZA 1U1FA 4QU8A 1F0NA 2Z5FA 2WA1A 1O8CA 3CF0A 1IONA 4K9OA 4NBNA 2HJGA 1X9IA 2WAMA 3LF2A 3ROPA 3IAXA 4IO0A 4YI5A 4ZAYA 3ONWA 2HCTA 2CHVA 2ZYDA 2B4AA 1GQ2A 2VTEA 1G3MA 3M34A 3ZK7A 4Z0PA 5HKLA 4CF4A 4ZJUA 3DL2A 4UHFA 3PXCX 1LVUA 4CLDA 4DHEA 4Y9RA 4JHLA 4YRGA 5IM4A 5IVHA 3OA2A 3EZLA 4LJ8A 4RKFA 5ECGC 1YL6A 3KQMA 4AD8A 1E9AA 4IJVA 3WLLA 4EQZA 2WWYA 1JJFA 1LW7A 2CK3D 2FJUA 2QX8A 2YHIA 1YASA 3DEYX 1PT9A 1YRWA 3LXUX 4HDNA 4K3VA 4M37A 5IJZA 2K2WA 1YI8A 5I9IA 1SEPA 1NMEA 1Q0PA 2NO6A 2R00A 3A3NA 4MW9A 3AUFA 2BR4A 2HJVA 3BK7A 4G85A 1B73A 1Y8RB 1WE2A 4GBGA 4QXMA 4MPPA 1XD2A 5CA0B 2ZRIA 3FOZA 2FWRA 3PE4A 2EIHA 4ASUA 4TLEA 5DK6A 4DN6A 1VKHA 1U0NA 4YJFA 4WJZA 3GLFE 2OCYC 3ICQB 4U2GA 3D4PA 5D3QA 1T34A 2ATIA 3KR0A 1KYXA 2EEZA 5FA8A 5FJJA 3ASRA 3SOZA 4O4HF 3V1LA 5KU1A 5AVTA 5AJXA 4DFDA 4R51A 1EWTA 1Y89A 2WZPP 4IWNA 5EHGA 3U4IA 2QVCA 3GN1A 4BNZA 3WI7A 2FUCA 3UJ9A 4ALJA 1J0CA 3EPPA 1CRWG 4CIVA 1EQUA 1YH3A 2DUJA 1XVLA 4YT5A 5E4TA 3SIRA 1PNTA 2X8LA 1NYQA 3OMXA 4EFLA 1QMPA 2EYQA 2QENA 2R7NA 3R4CA 1OU4A 4GBJA 1T4MA 4MV9A 1AK9A 1LJUA 3RTGA 4MI9A 4Q37A 3WYCA 4ZIRB 4Q1DA 1VLOA 2LXNA 2ONKA 1JHVA 1VJRA 3KJIA 4GZ3A 5KIAA 3GT4A 1C7JA 1DC7A 1FIUA 2QB5A 4QPPA 4OQZA 2PJDA 1SA0B 4HWRA 3DVQX 1U2RA 1WHTB 2VJAA 3I0ZA 3K9GA 2YOFA 3IR6A 3RVJA 3UCFA 1U2DC 3SKYA 1YQQA 2I1WA 4UPDA 1RM3A 5M7EA 4L78A 2GEUA 2QMYA 5DYYA 5KWSA 1IYZA 1N1DA 3DR5A 5IAGA 4XLCA 4K6MA 2I0FA 3CM0A 3BGIA 4DCSA 2FX3A 4M1TA 2VT7A 3PQ2A 4Q7KA 2IUSA 1KXJA 3PVSA 2H5IA 4JIGA 1X87A 3BGOS 4BFYA 2P35A 2UVPB 1OXSC 3EW7A 4KWIA 2FEOA 2JCSA 4J43A 4KPGA 1I6KA 3UBTA 4XLTA 5MFPA 3HYRA 3A4TA 4A73A 1EVYA 1GSOA 2IGBA 4TQGA 3T4PA 3W8DA 2JGJA 4F1KA 1A7AA 3EEYA 1ZK4A 5H70A 3I58A 4TN1A 1DP4A 1U2TA 2BOVA 4FS8A 1SBTA 4Q02A 5JY6A 4FHEA 1IJFA 4P3YA 4ZIRA 3CZ4A 3ODPA 2PIAA 1O5IA 2WJIA 3I9JA 3PJDA 1I3KA 2J45A 1VHQA 1L8LA 3GT3A 3GV0A 1MD9A 4MA4A 4OATA 5E3JA 3WJ1A 4EW3A 2C5FA 1SA0A 4P0TA 4YGXB 1JFVA 3D5TA 3T0GA 1G6OA 4Z4VA 1WHTA 3IHTA 4J0KA 4CLEA 4XLAA 2P9CA 1NU8A 1UQRA 3GC6A 2I4TA 1Q44A 3A9RA 3SZUA 2W11A 3PWZA 2VDKB 1U3CA 3AYZB 3K3PA 5L7WA 4OQXA 4LFCB 4RPCA 1HM5A 2CGEA 4YAFA 3VAAA 2BBOA 3ETLA 4OMUA 3VI3B 2UXDB 4LDAA 4ZVSA 5F64A 5GVRA 2W6CX 2JB9A 3DO5A 1ZCAA 4ZDWA 1DEKA 2B0CA 3WISA 5CD9A 2JCYA 3KQTA 2UVPA 3WGGA 3PXBA 5FD8A 1POWA 4PY2A 5P8WA 3C7TA 3THSA 3JD0A 5JJIA 1BQEA 1RZUA 3HGQA 1JRLA 3LU1A 5A1TA 3GJRA 3SHVA 3C3JA 4DIOA 1VBKA 1WP9A 4MS3B 1UUFA 3JQBA 4DMCA 1HG1A 2YWHA 4XB6B 2JI4A 2YXNA 4CV1A 3M6WA 3I1JA 2CT8A 3DCNA 4TMXA 2WD7B 3G9QA 4MRMB 1I2MA 3EWSA 4AO7A 3TOXA 3KE8A 4B4WA 9ABPA 2H5JA 3AOEC 3VJLA 1VJTA 4LAFA 2W48A 3GAAA 4YRDA 3M70A 3U7QB 5JAUA 4Q24A 3W2IA 4PC6A 3EN0A 4HAUA 1Z28A 3OFNA 4HRYA 4EX6A 5CA1F 1QCZA 2JFOA 2OGZA 1LB1B 4NDZA 3SJBA 3VUEA 5GJCA 1VQ9B 2V7GA 2ZJOA 3Q6QA 3IA2A 1SY7A 1FU7A 4QTYA 1P73A 2AWOA 2YBDA 5JNVA 2QSJA 4KXWA 5E95A 4IZ6A 3ZDZB 2VH1A 4E3WA 3FFWA 4OXRA 5CFOA 1ODIA 2FDRA 1A5BB 3IQHX 2ODEA 5B3AA 2WJVA 1KA9H 1YUNA 1BCRB 16PKA 2R751 4M21A 4M8NE 5KREA 1C7IA 4MWOA 2BI8A 2VFAA 2ZCVA 1QR6A 2J1LA 3TAHA 1KHHA 4BVFA 1YB5A 4MS3A 3C0KA 5D87A 2OC9A 4LGVA 2YHBA 5ITSA 2FMKA 3HNOA 3O74A 2X40A 2B2XA 3HO1A 4M3NA 4Q0MA 4OL9A 3NWEA 1Y5MA 1NN3A 2WD7A 5DBHX 3DZHA 3F6RA 4CM8B 2ZYSA 1RDFA 1OWPA 4HGZA 1I6LA 3CLRD 1D4ZA 2RHHA 4N5DA 2CFSA 4HEA6 1GPH1 2W7TA 4WV3A 3SS9X 3Q3HA 1ILEA 4RF4A 1RYNA 3HMKA 1NE7A 4I5DA 3HFRA 4CPDA 5KHOC 1IZ7A 2FWAA 4K6OA 2ZUWA 5PGMA 1ECGA 3KAPA 1ZD5A 5IT0A 4LSZA 4MVJF 1KIMA 4L73A 2RGYA 3ABSB 4GVXA 1D4FA 3GEGA 3R44A 3U4MA 1UBHS 4X7BA 5ALDA 3TX2A 1P4JA 3KJFA 3EGVA 1EDDA 4JNKA 4M9ZA 1XTTA 1E0SA 4ZO7A 4EX7A 3D8NA 4P08A 3OX4A 5ESWA 4A0SA 1RKXA 2P41A 4KX5A 3S1LA 4TT8A 4DBLC 2FFJA 4DG8A 1JA1A 1YDMA 2EBWA 4ZWNA 4EO9A 1B6RA 2IT1A 3KAJA 4I4TF 4CCAA 3RTAA 1G60A 3DBIA 4WXYB 4O0LA 2JG3A 1R4NB 2F9LA 5I9TA 1YJWB 2W90A 3PQ6A 4R7TA 2W6ZA 3E9DA 4RFSB 1SQSA 4MWBA 1Z7GA 5D00A 2XMZA 4QBFA 3OOWA 4B9EA 5BNFA 2O8VA 3EEQA 3U60B 1Y3HA 3VPDA 3V6MA 3ASUA 1OBFO 5TS3A 2E1RA 2H0QA 4ROTA 3DW3X 3N0RA 3BH6A 1X8JA 2E4YA 4WSOA 3QLJA 2QTTA 3TDMA 2GA8A 2H3EA 4I14A 1HNXB 5FA6A 1CS0B 4QASA 1TPZA 3DHYA 1BXKA 5WRFA 1ZBQA 3DOUA 4L8LA 1PQYA 2BH2A 3EC2A 3GNQA 3EBOA 2XTZA 3PQDA 2ETXA 2TS1A 3AV0B 2YFQA 3SFZA 4E15A 2PYDA 2ZDHA 4IYJA 2RH5A 1KVTA 1S9DA 2EQBA 5DO9A 1QHGA 1ONSA 3UJAA 3BIWA 1E3TA 1NN1A 4LDZA 3TVDA 3TUZC 4OXKA 5CCEA 4NVRA 2A1TR 2BGUA 1RI5A 1XZCA 3G2LA 3S70A 2H08A 1CUVA 4H77A 3AONB 4ARSA 4BLUA 3AF0A 2BFBA 2Q27A 4R5MA 4HX2A 3H3FA 1J56A 1ZRSA 2BR3A 1KS2A 1R4NA 4MYUA 3JYOA 1IRIA 3Q9SA 4GFDA 5B37A 4OLBA 1ZM9A 1MN6A 1OY1A 3HBFA 2G72A 3SQXA 5B3KA 2A57A 1P2BA 5EZYF 5FFNA 3AUKA 1T4GA 5F7OA 1QQAA 1Z9BA 1M33A 4L9WA 1PJ7A 1U8ZA 2NGRA 5DASA 2WWFA 3C7AA 3HVHA 5JATA 1LXCA 3LT4A 3KEGA 2EX4A 1R50A 2HF2A 5T6BA 5IJWA 1EHYA 1NVTA 2J09A 3AUJB 1WV1A 3HV0A 5A6SB 3BICA 1CS0A 3PXGA 3SIPA 3ZE8A 4AXXA 6PFKA 2V0CA 3G0BA 4Z4IA 4LTNA 1W85B 5HSGA 4D4HA 5HEKA 3LP6A 4PPNA 1EJ6A 4WKBA 3EOBI 3O3CA 1KPIA 3LWDA 4C6HA 4I1PA 3OZRA 2XMCA 3DDZX 3DL0A 5ARDA 2N1MA 4RK5A 4IXMA 3ZV3A 2BEWA 1E0JA 5J5CA 4ESOA 2IIPA 1TQ4A 4HLUC 2VJCA 3MA0A 4YCJA 4YECA 1DMSA 1YZQA 5C34B 4ND4A 3BE6A 1P6XA 3RVKA 3UHJA 2IITA 1JNYA 3QG1A 3TSYA 2C57A 5DNVA 4QDTA 2CFOA 5DNCA 3DFMA 3U3KA 5DJ5A 5EFZA 3NYIA 5FBVB 3GEHA 3EFHA 3PR2B 3GRUA 2FPWA 2R68A 1MA0A 3HUDA 3V4ZA 1KVUA 1JLLA 3R3ZA 2WV9A 4TWBA 1GZHB 1Z26A 4LHWA 4RIGA 3OWHA 4BYMA 4DJAA 4GOMD 4S05A 2YQZA 4LTDA 1YNOA 3CCJB 1E6KA 1AXGA 1Y1SA 5DBEX 3SJ7A 2QTVB 4FNOA 3T7RA 5C3MA 1M6WA 3D8RA 3H4TA 4HADA 1GZVA 8ADHA 3FDJA 3F0TA 3WLEA 4NL4H 4TL9A 1EM6A 1M6YA 1TZBA 1F2VA 3AEYA 2ZE7A 3H4MA 3W2HA 4BO4A 1T8TA 3CF2A 4RX1A 4YDQA 1I4TD 3FIJA 4QGBA 1G3RA 2KW5A 3COZA 1C0EA 5DM1A 3LPMA 4F5ZA 4KUEA 5JE8A 4HNAB 2P6PA 3L40A 2RHMA 2ZWPA 3KB8A 4UULA 2GREA 3TRFA 4EG7A 1QJ4A 3ZNOA 3R20A 3TOSA 5FUBA 3PPWA 2R8OA 1YA8A 1EZ4A 1VKJA 4DQLA 2Z3WA 2FQXA 3CW8X 4CGYA 3T5PA 1OV4A 2I7XA 2X0IA 3AETB 4J7CA 4ZQCB 1F12A 3PFKA 1KVQA 4QX6A 4KXLA 1QYCA 1ZRNA 1HOXA 4KACA 1QFZA 2BCEA 2VQ6A 2ZSHA 4YCSA 1TOAA 4ZHSA 1LWNA 4MO2A 4WUVA 2GZSA 2YFHA 1QS0B 1USVA 3CLKA 4LIPD 4LYGA 1UFVA 3PVCA 5K7SA 4RK0A 3LBAA 4M0UA 4W9NC 2XGSA 1QOZA 1TGVA 3LP8A 4IMJB 1COWA 1RP7A 1E8NA 2B83A 2QTVA 2W4MA 3C4VA 4N40A 4N3AA 4QQKA 5SYNA 3T3HA 5HFNA 2AD1A 4CIWA 5GJBA 4MDEA 1OIVA 1FTSA 2Z2YA 3NALA 3RWMB 1E8MA 1B6TA 5DP1A 2ZYHA 3O8CA 3KYJB 5HF8A 1LRJA 2C8KA 4WKPA 4B17A 3UJNA 1XEWY 2F43B 4FN4A 1EUCA 3ZU6A 1Q0LA 3BX1A 2X4DA 5KTTA 3VR6H 1MKYA 2QI9F 5FBWB 4HNAA 2ZJ6A 1SXIA 4JUIA 4KN6A 3AR5A 5JOQA 1WY5A 4AJIA 3HLKA 1NUHA 1UZMA 4I6JA 5A6VA 5BVHA 3MOSA 1OREA 2JW5A 2Z95A 2O2GA 2I6QA 4PZ0A 4FI3C 1NTRA 3AETA 3WDMA 2ZTMA 3PD1A 1B26A 3DV0B 5HCUA 3NVDA 2B8NA 1E2EA 4XSGA 5JCOC 1IE3A 4FCVA 1FQOA 2V7VA 1JILA 4J2OA 5FRDA 4NAVA 1P39A 1KY2A 3OZ7A 3TLKA 3ZOZA 3PGKA 5AK5A 4CTJA 2XKKA 5CLIA 1NOIA 1DKNA 2VIIA 1IBKB 3HJHA 3S7ZA 3WIBA 1E59A 1QS0A 2NTEA 3D8SA 3L43A 4DR2B 3TX6A 1R6VA 1BE8A 2FLVA 4YR9A 3EZFA 5L6MB 1ITZA 3GD7A 3LZ6A 1ZUNB 3U6BA 1QXSA 2YY7A 3LDAA 4GO1A 4IF6A 3TR6A 3UCEA 3VYRB 3ZCXA 3TRKA 5J4HA 4E1VA 2CMHA 3G8BA 4R68A 5K99A 3N39C 2ISQA 2CUNA 3OBBA 4BEVA 1BDBA 1JJ7A 1LJLA 4BQSA 3CWQA 3DKRA 4DTCA 3TE7A 3S40A 1NF3A 2YCLA 4HZGA 3PJEA 2GS9A 1MF7A 2F43A 1GLVA 2BBSA 5IYWA 2ECQA 2FJ0A 4ZCIA 1QBGA 2FSVC 2ORVA 3TL2A 3D3KA 3X1YA 9MHTA 2ZQYA 4V38A 3K53A 4CLOB 3AWIA 3DR3A 1RAGA 4X8IA 3L6UA 2BMDA 5T4EA 3K20A 2NZYA 1F2TB 3RVSA 5KNDH 3LY8A 1KQSB 2TRSB 4UBKA 2VQEB 3ZZTA 1IEWA 4PYNA 1X7HA 5JMTA 4WESB 1PFKA 5FI0B 3TRJA 3DV0A 2QT9A 3FW1A 4W5WA 4B9AA 1WMDA 1ZKDA 3LQ1A 2V7QA 3U3XA 3PC3A 4IDPA 4TKVB 5K45A 5AJHA 2JGIA 3N8IA 5KQGA 4R1PA 4AN4A 1G8KA 4EGCB 5IK2D 2AI2A 3DTVB 3WQBA 2ZSIA 2ES4A 1IY1A 1U0RA 1M2JA 1CBUA 1XX6A 2O7QA 2V3VA 1ICEA 3JZDA 3KWJA 3S2SA 1ZUNA 3OZVA 3W1EA 4U7DA 1EJBA 3MWJA 4NEHB 4UUAA 4XFDA 4IQ8A 4UEQA 4WLUA 4YYEA 3NFRA 1LRLA 4C7JA 3P7MA 2UKDA 1O96A 1UC4B 2E5FA 3ZNQA 1Z88A 3AP1A 4UASA 4BVJA 2NP6A 1CYEA 2VNHA 4TTAA 3JQGA 1RJGA 1QP4A 1V3VA 5C8YA 2D1TA 4PVCA 5EKDA 1MTZA 3MGAA 3U4AA 3IDOA 4UE3S 2ZWVA 1SFRA 4CLOA 2ZCUA 4URZR 1HRKA 3RH0A 4B4KA 3FY4A 3ZWYA 4GGOA 1EBBA 1PWXA 1TKCA 2WYIA 3FUWA 4FDTA 2IUFA 4N9QA 2Q5LA 5BV2P 3H8VA 5JZVA 1UC8A 3U16A 3GXOA 1I3NA 1L7RA 2B21A 4Y2QA 4FYYA 3F1LA 5E3IA 1JDNA 3PA1A 1YI1A 4TKVA 4BQIA 4ER3A 1ESZA 4Z3OA 1KYWA 4L8YA 2V6GA 1MAVA 5H3CA 3P4UA 3DTVA 4H7DA 1XHEA 2HK7A 4OQYA 4ZREA 4D3SA 3V34A 4OMDA 3JQFA 4QFMA 4K9RA 1EZ1A 2VZEA 3R0ZA 3STHA 2V7EA 1TVCA 3CMAB 2OSBA 1NLYA 4ZV9A 1QPBA 4B7AA 3I5XA 4FGLA 1J0AA 4EARA 1TD1A 1WKCA 1IATA 2R2GA 5T8KC 1JKFA 4I1IA 3SXUB 2IIQA 4TWAA 1C9JA 3UKDA 2J8ZA 2G4LA 3U48A 1H4VB 2B0JA 3O84A 4G2NA 4XZ3A 4ES6A 1P4SA 1LU9A 4TXHA 1U0HC 3QPVA 4GXTA 4RHFA 3LGAA 4TVKA 3QI2A 4DF3A 4R2WA 4E2FA 2O8DB 4G5YA 3S2EA 3FJ1A 4GX1A 2PO7A 3HVJA 1JDBB 3C5CA 4IF4A 5HNKA 1DCFA 2WRZA 2YJGA 5A4DA 2EXXA 1TUGA 3R5SA 2IEGA 2Q5OA 2JS7A 1PZFA 1K8XB 4HZUB 2E1BA 4N5MA 5IP5A 2Z1DA 3SKBA 1NJID 1NNUA 1ZOIA 4G0XA 1GYQA 2EJBA 2IPNA 3CX8A 3V1YA 1SN7A 2MMGA 3WHPA 1XC7A 4DILA 3W9UA 3N3AC 2O9JA 3UA4A 1QAQA 5BSTA 3DLTA 3UKJA 1HBJA 2PEZA 1E6UA 1ZLYA 2AT1A 1ZONA 4WGFA 7AT1A 4CNQA 3AIIA 1CNEA 1Q7CA 4P83A 1MU0A 1WG8A 2KYRA 1PGOA 2D6FA 2NT3A 3T6KA 4FFPA 1WPRA 3ANYB 3IODA 3Q2KA 5CVTA 2R62A 4AG5A 3SXUA 4RTLA 1IAVA 1XBTA 4X7EA 4ENRA 4AYXA 4ER5A 2LIPA 3PIRA 4I19A 5G1OA 4DCUA 1II0A 1ADBA 2PLWA 1PYGA 1Z6QA 1E2IA 2CWWA 5H9VA 3VOBA 5A1JA 5I47A 2G1AA 4LZPA 3ZDQA 4MV6A 3NM5A 1KC1A 4WY5A 5B1DA 3K8ZA 3UN1A 2NVUA 4G4IA 2PKXA 1TAQA 4KK4A 4PQFA 4Y1FA 1KDZA 3TKLA 4B3IA 1NUUA 3QHPA 2O8DA 4B43A 4EFKA 5KBYA 2IBSA 5DPMA 1IZYA 1OX5A 3B5IA 1MHTA 2GCNA 4N8SA 3SX4A 3L8DA 2IVFA 3L84A 4EHDA 2YHSA 1SBCA 3COYA 3SHWA 2VSFA 4A2PA 4S12A 1ZAYA 4HZUA 5BN4B 2NUBA 1OBCA 1V1MA 2X76A 3H86A 4F38A 5JRZA 3CR7A 3IBFA 1KS9A 3KTAA 3B60A 4L0QA 1EK5A 3FMOB 3N8HA 5FT9A 4C0BA 4ZVOA 4YUAA 5AXBA 1GO2A 4HQ0A 2BHSA 2BGNA 5HTOA 1TVEA 1O6BA 1Z3CA 5J2TF 3PQFA 3AKZA 1KKMA 1KJWA 2ZI9A 2Z4SA 3CNNA 2ZR0A 4CMKA 1CY2A 1R3DA 1ZIDA 4RAQA 4WNAB 3DFIA 3T94A 2BFDB 2P1RA 2YH2A 2ETVA 3CNHA 1AN0A 5IC5A 5LVAA 5IM4F 4JUBA 3AR3A 2G7ZA 3CH4B 2GJ9A 3SI7A 5KYYA 5IXJA 2NW6A 2IE8A 4JP2A 4IICA 3TNYA 5ELMA 3WGIA 3GEIA 3AY7A 4YUXA 1DEHA 2HU8A 1XI2A 1Y1TA 3SXPA 3DFUA 3R5FA 2FCRA 1L7PA 4NCAA 2Q45A 3DHVA 3ID6C 2H4YA 4RULA 1QP0A 1Q74A 3PJRA 2UXCB 2D1RA 3FDZB 5JJLA 3E7WA 4DJEC 2QEXB 4PC2A 2XZOA 1VSUA 3GLUA 3LWZA 4GM1A 3SGLA 3MBOA 2O7SA 1D1PA 2O5EA 3VO2A 1P1KA 4MARA 2VPTA 3E9NA 4HLNA 4XYGA 4PN7A 4AKHA 4B6FA 3EVGA 1UMBB 4XYBA 3T15A 2JLZA 4JWTA 1E58A 2W22A 3GLSA 2Q07A 5B1SA 1NUTA 3QI7A 2GZMA 3FCXA 3O8BA 2ZL7A 4MGHA 5HDQA 3G5TA 1W4CA 4DGSA 4OI4A 2BGRA 2BFDA 4KXFB 5FFFA 1YZUA 2HRRA 2DTXA 2IKQA 5LQDA 3EF3A 2P9QA 3OPNA 1B3BA 1Z5GA 3WGHA 1FMTA 2EV9A 4YEJA 3F7OA 3ST7A 4B47A 4RSGA 4R8RA 2P2YA 1GZ3A 3MGGA 4IEFB 2QD5A 4QT0A 1YHQB 1P1RA 3A1EA 1ID1A 3CLHA 3GROA 4WK0B 3TTSA 2QMOA 5LQNA 3HVRA 1N7GA 3W6UA 1MCZA 3WL3A 4OP3A 2ZRPA 1AKRA 4IHJB 1FDUA 3CUTA 4PU0A 2UUCB 3E3NA 4BFSA 1A7KA 5IAJA 4NS1A 4EZEA 4E4TA 2VPWA 3FDZA 4EUHA 2NVWA 4ZGNB 3CVOA 2PK3A 2PXCA 1VJ5A 1H0RA 2VS1A 1EE2A 2QWXA 1S5PA 3E9RA 4OHYA 4NU0A 5DBFA 1BDHA 3R9XB 1X42A 1NP6A 1D0IA 1Q5PA 4YRKA 1NHWA 4HWPA 4BO6A 3G85A 3PUZA 3IUEA 1CY0A 1UMBA 3DEIA 5E9JA 4IRXA 3ZHBA 4CLXA 3VZBA 4KKSA 2XE8A 2Q1XA 3DBLB 1YULA 3L1JA 2WAYA 3K9FC 1YR2A 2AJCA 3L01A 3OKFA 3FPJA 2FG7C 1RMYA 5LOVF 1G3QA 2Z04A 2CDCA 4TRNA 3U7GA 3U19A 1T9KA 1GA1A 1QVRA 3KSZO 5AVXA 1Z6YA 1LLUA 3NHAA 1AQJA 1DOZA 1I2BA 2ZK7A 3R7SA 4H3KB 3OQBA 3BWBA 2V6JA 2H52A 3OQHA 1OI4A 1PFQA 2BIFA 3AF5A 3WWOA 4QZVA 1UXOA 2VHUA 2CLEB 3G23A 1K68A 2H4ZA 2BZ1A 3QOWA 3VBEA 2FEPA 2HNKA 3A27A 4DA7A 3RO7A 3HTXA 1UWVA 2V65A 3A3OA 1A88A 3AUAA 1GL6A 2CYAA 1A4RA 2IPXA 4WA8A 1ZRMA 4IHJA 5F52A 3T3OA 2BTOA 2ASVA 4KDCA 1JJAA 5DYTA 4BO1A 3FWYA 4M1YA 1ZOOA 4II7A 1G1AA 1TEXA 1UDBA 4UZFA 2OBSA 2GM3A 5AK0A 4D80A 2O0LA 2WIDA 3D4BA 1NA5A 1U2EA 1WAMA 3CR8A 3MT7A 5CG1A 3T1TA 2JFWA 3R9XA 3COJA 2QG4A 1H5QA 1EE9A 2H1SA 3A1SA 4B33A 3SX2A 2GD2A 4NJEB 4A1FA 5BXQC 1E60A 1PR3A 2HLNA 4FIDA 4J90A 1FRQA 1A5AB 2FW6A 4M0DA 4IDFA 1GZ5A 1Q7EA 3DBLA 3HYLA 4R54A 4B75A 2RDMA 3P9XA 4JGGA 3P2KA 1E9DA 5AXDA 2IW3A 4GWLA 4FWTA 2VPXA 3DTTA 3NPMA 4M60A 4M22A 2C84A 1G8MA 4J75A 2AYYA 1PR1A 3DONA 3RUIA 5C8ZA 3TLAA 2J0UB 2QVZX 1NBHA 1ZJYA 3B3GA 2PUGA 3WNDA 3SSMA 2AEMA 1NMQA 3PNLA 3DAYA 1HLDA 1C3LA 1T4DA 2BGKA 2NOAA 1WDTA 2I2DA 3IMGA 2H5LA 5A7HA 4B6SA 4C3UA 2RGXA 2X6YA 4OB8A 2JFXA 5EL0A 3RR2A 2H51A 2JH8A 5KI6A 4DJ5X 1GPUA 1MFPA 4MUJA 5FL7D 5HK8A 2VJJA 4E7OA 1IDOA 3SC3A 1AU9A 2H06A 2H3HA 2GBPA 3QVVA 5DSZA 1J8VA 1M8GA 3HY3A 3K05A 3KSMA 4GSYA 1Z38A 1WM1A 5HUQA 3TSAA 2DAPA 2D13A 3UFXA 2WSSD 1V41E 3W05A 4OXIA 5B2EA 4LZJA 2L2QA 2WFMA 3TNDA 2JLYA 3H5AA 1H8HD 5BPFA 1G7CA 4GR4A 5FO0A 1W96A 3ISVA 2WTAA 2QLTA 2BGTA 3G0DA 3JWHA 4BB5A 4RDXA 1X3SA 1Z0IA 1B6GA 2X85A 1AGXA 1SU4A 3GAMA 3OE7D 3PRYA 2D5CA 3KXKA 2WSLA 1DRKA 2X5NA 1J8DA 3JZIA 3T9FA 4W5OA 4R9RA 3BNWA 2J0UA 3K9BA 2OD2A 5E0OA 2G4CA 1JA0A 4TYQA 4XQEA 3SE0A 4IGKA 4CZ2A 1OTYA 3VNRA 2FPIA 1YKSA 2D2EA 2PVCA 2A78A 3WGYA 1COWD 3QW2A 3IOEA 1DQRA 4C88A 1Y42X 4ZMRA 1LK7A 4FBGA 1OWMA 1H2ZA 3GAFA 1NMXA 5G4LA 2ERXA 1G5QA 2AEEA 1N75A 4PO9A 5M5BA 2Z8YM 2EC5A 2RC6A 1LI4A 2X5OA 3CRW1 1AKMA 2ZZGA 2PMDA 3RABA 1NZDA 3WNBA 3SC2A 5K4HA 3IOYA 1ETUA 1W4BA 5F5LA 2B30A 3D1VA 2P3LA 2IOFK 2V4UA 3KTDA 1AOXA 2OD7A 4A27A 1RRGA 3DBHB 4EKNB 1GCIA 1P2UA 3D6VA 4DRZA 2AN5A 2JD2A 1BROA 2O0HA 4BC0A 4KXUA 3MEQA 4Y30A 2O5VA 3ASTA 2BP7B 3B36A 3FYUA 4H7PA 1M2OB 4AF6A 1D07A 1PWEA 2IDJA 4I5GA 4X3PA 4IUYA 4XVRA 5DE3A 4DLLA 4EY4A 1QPZA 3DPSA 3MNFA 2G4VA 1DX9A 1IWBB 5DSXA 4U7FA 1KAGA 2NM0A 3N87A 4FYVA 4QE3A 3AR6A 3QE2A 2GMWA 2EF1A 3M6LA 2QA5A 3COSA 4TV9B 4ZOEA 2FDCA 3ZDFA 3ZWPA 1PDVA 3NAMA 3T35A 3BFVA 4L51A 5BSXA 4ZCRA 2OXCA 1UD6A 1JSRA 1YI0A 2YUIA 5AHOA 4AYWA 5HW0A 2FPPB 3RU9A 3UBMA 4EKYA 1U7PA 1VZ3A 1E9SA 2OAP1 1W2GA 2IJGX 3IT0A 1AHHA 4OU5A 2WM8A 4QTXA 4C4YA 4LMPA 5EIFA 3OFSA 1JR3A 3F7NA 4MKGA 2G82A 1TC2A 2BI7A 3IS3A 2BKLA 3O9ZA 1OFIA 1WY7A 4NDAA 2CBGA 3X2FA 1UK7A 3NETA 2X9GA 4XYMA 3SEFA 4MKHA 3R74A 1WTAA 1SCJA 3ZDRA 1TK3A 2AMYA 2ECOA 2NT4A 2PRSA 4F2PA 5HIKA 2UXBB 5L3QA 3DBHA 1TLLA 4OA5A 2PUTA 2VHZA 5EIHA 4W9MC 3YASA 3A8KA 2PUFA 1JPJA 3PQCA 3Q6RA 1RAEA 2QOEA 1Y33E 1M2OA 2BBWA 2R79A 1E4EB 2ALJA 3NT5A 1NF2A 2V7QD 4OQFA 4C4AA 5TMDA 4TRJA 3I62A 2GKGA 5IEJA 4DSAA 1NVDA 4I9GA 4ZVUA 3ZCTA 2A1IA 4QUHA 1GGVA 3QFFA 4WNIA 4TV9A 3UCXA 4DYHA 4CKWA 2C4VA 3GCGA 5F7XA 2UZ4A 3T4EA 3JRWA 5H4HA 2NQTA 3FNRA 1K2WA 3CUYA 2VJOA 1FW8A 3WL7A 3EG9B 2FPPA 2B98A 4JVOA 5C7IO 1BTOA 4LYHA 3P0IA 2IH5A 1ZQ1A 3KR9A 3ZU4A 1SM4A 5TPWB 1B23P 4PC7A 3TINA 5B3LA 1X7WB 2ZIWB 1VL1A 3ILXA 3OOEA 4UCQA 3VU1A 4OOSA 3Q85A 3H2KA 4INPA 1ISHA 3OF5A 4ZDIA 3BHIA 5ENDA 2FE1A 1F2UB 1GKKA 3ZCVA 5K6RA 4LCEA 5DT9A 2QM0A 2NN3C 3CLTD 5JY1A 5L4NA 2O3TA 3BIOA 3VBCA 3QPDA 4IKPA 3A1PA 5I8ZA 2Q3JA 4KN9S 1SVOA 1G98A 2XWPA 1RP1A 2SICE 1E0DA 3L1UA 2QE7A 4MWEA 2GHQA 2H1IA 2G3YA 1E3XA 2NTVA 5EMMA 9LDTA 4YUZA 1E4EA 1UAAA 2NU7A 5KOHA 1RQNA 1Q17A 2WE7A 1QYRA 1SU8A 3F1KA 3GDHA 5SYMA 1N08A 1MOQA 1YB1A 2R7AA 1TW2A 2O2JA 4X91A 1EFKA 2AS0A 4GVLA 2HPAA 4Q21A 5BQFA 4TKOB 4YA6A 1WZIA 5AVJA 1G6Q1 2FYTA 4F4JA 5FLEX 5JT1A 4Q3AA 5EXSA 3GGPA 3V48A 1ZJ4A 3TW8B 3RJTA 4BX2A 1WCXA 4KGVA 5I7WA 3GVLA 1EGVB 1VP3A 5EHIA 4BE4A 4Z4SA 2WJHA 5A4MS 2QBYA 3DB1A 4B3BA 1MAHA 3CYFA 1N2XA 1RQ7A 1TF5A 4QLBA 5GZ3A 1U2SA 4IX9A 1PHRA 3DZBA 1W5SA 1C8BA 5TPWA 3SYKA 3CRQA 4BLOA 5JSZB 1JFFA 3KPYA 3TGPA 4QHYA 4JU8A 4C3OB 4UFNA 4Y2YA 1U7WA 2XDQB 2VYQA 2A0KA 1F2UA 4CMCA 3GFGA 5DMXA 4HEJA 4JJGA 2C4HA 3RU2A 2Y93A 1GZ7A 2WWRA 4JEIA 2EJTA 4E3ZA 5L3SA 4RZUA 3GW8A 3J81A 4HDSB 2PZ8A 2F1HA 4BQQA 5F4OA 4JUDX 1OX4B 1D5WA 3OJCA 4Y6OA 3TDNA 3KQHA 3IXQA 4KXQA 1ECJA 3MLAA 4ICIA 4LG1A 4LEIA 2GHIA 4YMVA 4G1CA 3DYVA 2PFKA 4RQAA 3IT3A 3WYDA 1AV6A 4EA6A 2O8EA 1OBOA 2KX7A 5KYUA 1GL9B 3RHSA 4ND1A 1X2BA 2O06A 1Z5PA 3FLBA 5GP1A 3TQRA 4F4UA 3R7NA 2N75A 1K5DA 4TXMA 1C2YA 3B6KA 5HF5A 2I29A 4BFCA 4AY5A 3MCVA 4MPDA 3MYYA 4EVSA 1KSGA 5KTYA 5LSAA 3C5VA 3ZLBA 2XVAA 4EW1A 3ZVLA 4EUEA 4I5FA 1U11A 1XCGB 2JAWA 4TLAA 3TW8A 5I6DA 3GOQA 2E5WA 3Q2OA 1XEFA 2CMDA 1VYTA 3PDJA 4AZ3B 1G7TA 2EBUA 2HRDA 4NH4A 3UXYA 1IFXA 1T8YA 3GLHE 2JJMA 3QMMA 2V3CC 2GWHA 5EESA 5FA5A 4B79A 1OIXA 4NBKA 2Y67A 1T2UA 2P4QA 4LBVA 3NEAA 4FZVA 5HQTA 2NAPA 2QAGA 4LV6A 5AW0A 5ITWA 1T0BA 1M74A 2OUKA 4L2IB 4TQUS 4Q3NA 1B8UA 4A0GA 4G9GA 1WORA 1G3IA 3AHGA 5BURA 4X07A 4JLMA 3ZJVA 4XSHA 1KIAA 1O95A 2R1UA 3BRSA 1XAHA 3EIFA 1S2GA 1IQUA 3BXFA 1A27A 4OMFG 4HDSA 2G8NA 4IO1A 5DOZA 1ZR2A 1XVUA 1OX4A 1BVYF 4Q18A 5EMLA 1PWYE 3HVKA 4PYMA 5F1YA 2XGJA 3ZVRA 4PX3A 1Z56C 2YW2A 3V6LA 3ILSA 4XLLA 2CLSA 2V0GA 4BJ1A 3JQ9A 4MNTA 3HM2A 4ZZ3A 3K1YA 3BSYA 3CJRA 1F6BA 3GT7A 1WUJS 4EI7A 3THXA 1ZZGA 3WSWA 3SQOA 1TO6A 3OX1A 3WIEA 5CCBA 2W42A 2DQZA 4B2PA