4CQLA

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
257
structure length
246
Chain Sequence
b'LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 85
structure length 246
sequence length 257
chains with identical sequence D, E, H, I, L, M, P
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqlA00
3IQDB 2P5UA 3O4RA 3PRJA 1GYQA 1LDMA 4YQZA 4CLOB 2DU8A 5JAQA 4R1UA 4WLNA 3GPIA 3OA0A 3SLGA 4D7AA 4YT4A 3U3XA 2UVDA 4JN6B 4EUHA 4GX1A 2X8LA 3Q6IA 3ZCXA 3AOEA 1JA9A 1TT5B 4OO3A 1X13A 3WGIA 1QSGA 4CMHA 3OEYA 3QVWA 3D4PA 1I32A 1I10A 4BKOA 4EUEA 2HKIA 3IIEA 1PTJA 3WB9A 2WWRA 2QG4A 4UREA 1H93A 1PGPA 2C2XA 4CMIA 4DBVO 2B83A 4NH4A 3JQAB 4UUOA 3CTMA 3Q9NA 4D3FA 5KNLA 5L53A 5A5EA 3ZHXA 4NK5A 4IMRA 1IE3A 1QYDA 4IDFA 4YT2A 3PHJA 3O9ZA 5HWSA 3GEMA 1VKNA 3EMKA 5JFOA 1GD1O 3PFWO 1QRRA 4URFA 1VE9A 2R00A 4KZPA 2P4QA 2YW9A 1PGJA 1R4MB 3OETA 4CM4B 5EPOA 1A4UA 3N58A 1VRWA 3WWYA 4YT8A 2LDXA 2ZJ0A 4B79A 3N74A 2RH4A 3I83A 1PS0A 1YXMA 2NTJA 4GLOA 1ZH8A 4A5OA 1FDUA 1IZ0A 2RIRA 4PN3A 2EKPA 5BNFA 4ZQGA 1N7HA 4A27A 2GRAA 3GA0A 4UVHA 1RYDA 4YTEA 1NVTA 2VYVD 3H9EO 3ZDFA 4KUEA 4BMSA 1IZ9A 2ZYGA 3H9QA 5A04A 3DOJA 1BXGB 1MXHA 1WZIA 4XYBA 5BQFA 3WBFA 3RVDA 3DHNA 4PLPA 3PK0A 4TWRA 1VI2A 1SEVA 2WE7A 5KKAA 5B4VA 2NWQA 3B1KA 4Y98A 3S8MA 1H9BA 1TT5A 2PY6A 3G1TA 3KLPX 5AXDA 2GSDA 3RD5A 3W6ZA 5TLSA 2A92A 3DZJA 3GF4A 1CIVA 4TROA 2I9PA 1VL8A 2OBYA 4PVDA 4XIYA 1DRVA 1O8CA 2EF1A 2YFQA 1PL6A 2FR0A 5L7TA 1QLJA 2Q50A 3JQBA 1VJ1A 1ADCA 4E6PA 3AU8A 4JROA 3DBRA 1PQPA 3S2IA 1G1AA 4PCVA 1YOVB 3BMCA 1YGYA 3UAGA 1UZLA 3AUUA 3PVZA 3C8MA 4WOJA 4LRTB 4D43A 4QX6A 1T24A 3DAPA 3WYEA 2O4CA 3LF2A 4B3IA 4E5YA 4CLEA 1GY8A 1E3LA 3HSKA 3GOHA 1KETA 4CPDA 1B26A 1HDXA 4IS3A 4EBFA 4OL9A 3UCEA 1A71A 1DRUA 1T2DA 4Z3KA 1WDLA 1D7OA 2QHXA 4XGNA 3ZHYA 4ZA2A 3WYBA 1WDMA 3MZ0A 4BS9A 5L40A 5L45A 2AXQA 2WD8A 3DZIA 4QFCA 4GQAA 3GZNB 3LYLA 4CMEC 5IFLA 2D59A 2FPIA 1NFFA 3PQEA 2VZ9A 1BW9B 3D3EA 5K0ZA 5BSHA 1GV0A 2OORA 3IUPA 4FFMA 3QWAA 4JXKA 5BSFA 5GMOA 5DCYA 4MVJG 1BXGA 4DC0A 3AUTA 4B4OA 2OUIA 3O26A 4II3A 3PGXA 1GZ4A 1V8BA 1LJ8A 1OOEA 4IINA 4MIEA 3E6AA 4BV9A 1KEUA 3D1LA 1LC3A 1SPXA 3OM9A 3RUAA 1PGNA 1J6UA 5G4LA 4ZVVA 1UDCA 4B3HA 4OXNA 4C7JA 5TGDA 2IEBA 4YJGA 2J3HA 3DWFA 3MOGA 3DZFA 3RKRA 5EL0A 1GV1A 1PZGA 2LDBA 3IJRA 4FQ8A 3EC7A 5AXBA 4DBZA 1WDKA 4PLFA 3TPCA 2Q1WA 4DVJA 1C1DB 4X54A 4AL4A 2X0NA 2VZ0A 2FOIA 4R5MA 1M76A 3VKVA 1HT0A 3BYZA 4CLRB 1ISFA 1LQTA 2V7PA 2Y1EA 3QSGA 4XJTA 3HNPA 3OJ0A 4IJKA 3AI3A 2D3TA 4GX5A 4JQCA 3FNGA 1LDEA 1ZK2A 1PL8A 4BOYA 4E5NA 5BSGA 3WICA 3WQRA 4NHEA 1U7HA 4ALJA 4CQLA 1HKUA 1MX3A 1KBZA 2YV2A 2G1UA 1WZEA 2UUOA 2RBEA 3DBLA 4NI5A 4UULA 3RBVA 5JDIA 2AA3A 3UUWA 1EBUA 4EGFA 4AICA 1DFIA 5L7WA 5I8ZA 1Z73A 1E1KA 3WNVA 4BO7A 3FWNA 1R12A 2HSDA 4N18A 1PJ4A 3UVEA 1V3VA 2W98A 1E7QA 1I8TA 2I76A 4RVGA 3NJ4A 4Q3NA 3UCFA 3EGOA 1GUZA 4CLXA 3ENKA 4RF4A 4MP8A 3ON5A 2HK9A 1YVEI 4CR7A 2D4AA 5DCWA 1EVZA 3WLEA 4OYRA 2Y68A 1NQAO 1AXGA 1DFGA 4CMKA 3GAFA 1PX0A 1ZUD1 1X1TA 2IXAA 3UKOA 4M89A 4YJFA 2ZCVA 1FDWA 4QO7A 5LDGA 4YPOA 2CD9A 3RSHA 4NU6A 2Y99A 1UAGA 4Q3BA 1FDTA 3C1OA 1CYDA 5ENDA 4BNTA 3GFGA 2NSDA 4OQYA 1HLPA 2WTBA 3DAGA 4IXWA 3DFZA 3PLRA 3WBBA 4CLRA 4DYDA 4KUGA 2WM3A 2H1SA 2JD2A 1OMOA 1XCBA 4LVUA 3V1UA 5CHEA 2IODA 3C7DB 3HFGA 3PDUA 2AW5A 2EXXA 2UYYA 5G0UA 4L4RA 4XGIA 1Z74A 3VVBA 1ORRA 3WGTA 4Z0PA 3RROA 4YAKA 4YXFA 3KV3O 1X1EA 4YJHB 2E6UX 1TA4A 1A5ZA 4A2CA 3LT0A 2HMVA 1H2HA 4W99A 1HETA 4W6ZA 2QRJA 4J1QA 4BO9A 3C24A 3S2EA 5JDIC 4TRRA 3PP8A 1MV8A 2DTXA 4PVCA 2OGUA 2DTDA 4D0RA 1QV7A 2C59A 5CEJA 3PGJA 4H15A 4RPKA 4IIVA 3I9KA 5EINA 2DVMA 4BO1A 4U7WA 1UZNA 3OIDA 4EJMA 1GFSA 5I7VA 2V65A 3NT5A 1JW9B 1T2FA 4XRRA 4LW8A 1XQ6A 2O2YA 5TS3A 1QG6A 1KYQA 5TX7A 3MJEA 3LF1A 1LA2A 3FPLA 4ZJUA 1EVIA 5IZCA 1Y6JA 2D0IA 2D8AA 2JHGA 1L1FA 4DA9A 5CDUA 4UUMA 5L4NA 1NM5A 1LDGA 1NWHA 4M87A 2EWMA 1O94A 2VOJA 3RCBA 4N5LA 4GSLA 4IZIA 3BZUA 3OECA 2GERA 4PLHA 3CZRA 4P38A 1T2AA 1U2GA 3GNQA 1I3KA 2C5AA 4FFPA 1PGQA 4IS2A 2AE1A 2XAAA 3AY7A 1H5QA 1LSUA 2AQHA 3B1FA 1JWAB 1DXYA 3B6ZA 2BLLA 4BVAA 4TKLA 4XZ3A 3V1TC 3PYXA 5F3RA 4MDHA 2X6TA 5JS6A 1DJNA 3MCVA 4CR6A 4BNHA 2CY0A 1B2LA 1PSDA 3PWKA 5ITWA 2YUTA 3KYCB 5TIIA 2RAFA 1YQDA 4IDAA 2EG9A 1E1MA 1EQUA 2J5KA 1AUPA 4NG5A 1LXCA 2CMDA 3HWRA 5THKA 3IJPA 4BNWA 4HKTA 4KOAA 5U1PA 2EKLA 4JBGA 1HDGO 4IQ0A 3IUSA 1A72A 1R4NB 3Q2IA 4EEXA 2X23A 2CF6A 1WLYA 1J4AA 2HUNA 3A06A 3PHIA 4YJDA 2JFHA 4Z6KA 1JKIA 3N7UA 4IDGA 5BNIA 5KJ6A 4FGSA 3QWIA 2Y1FA 1HE4A 3H8VA 4KWHA 1NHGA 2HRBA 4BIIA 1B8PA 4FIZA 4MVJH 1PZFA 3K6JA 2NTVA 1Z7EA 4L4XA 4P4GA 5MGBA 9LDBA 3FD8A 1T4BA 4OOFA 2Q2WA 4OOEA 1MLDA 1Z45A 3DZGA 3FCOA 1X7DA 2CZCA 3SEFA 4YEDA 4WGGA 4BL5A 1UDBA 1W4ZA 4MVJI 4RF2A 3ZWXA 2JD0A 7ADHA 2OL4A 3G1UA 1ENZA 2VT2A 4RVHA 3K2BA 3JYQA 3ZHBA 1N9GA 3DMTC 4RPJA 1RM5A 4P22A 5COAA 2FWMX 1U5AA 3DZKA 4YQYA 1RPNA 5KTKA 3L6EA 1B16A 3QVOA 4FFNA 3W4KA 4M86A 1M6HA 3F47A 4FCCA 3QVTA 3OBBA 1IYZA 1KVTA 1FF9A 3VPXA 2ZYAA 1IL0A 3PYLA 2VHWA 3JQ8B 1X14A 3DTTA 2PWZA 4L8VA 3CPSA 3EAGA 4LISA 1YO6A 3TF5A 4A03A 4J7XA 1Y1PA 3ZU3A 5GZ3A 1R0SA 1DHRA 1Y8RA 2BGMA 3A9WA 2O23A 3AI1A 4NBRA 4OSOA 5TJ9A 4CLHA 1K0UA 1PR9A 2D5AA 3FHLA 3UHAA 1TB4A 3SC4A 1P45A 2V6GA 4R4JA 5L4SA 3NGXA 2J6IA 4GLLA 1BSVA 4E2XA 4MOWA 3TDKA 4R1TA 4XCVA 5T8KC 4GPD1 4DQUA 5G0VA 3F9IA 2DC1A 1NASA 5FI5A 4B7CA 5JYDA 3KLMX 3UN1A 3MJSA 5KOIA 3RU9A 3C1TA 1E3IA 2VNAA 3JQDA 2UAGA 1O0SA 2CVQA 3ICCA 4GVLA 4N54A 1VLLA 4J4TA 4BNUA 2RHCA 2TMGA 4L73A 1Q2XA 5A9TA 3GVHA 2EJVA 2HK8A 4YRAA 1X0VA 4TMFA 4IGFA 3EZYA 4OKIA 2YJZA 2PR2A 4O63O 4AJLA 4AJKA 2AEMA 3I1JA 3ROKA 2BHLA 4ILKA 4CM8B 3NT2A 1WW8A 1RM3A 4OSPA 4RVFA 3PTZA 1ZSNA 3ZWPA 3H5NA 2J3IA 3I4CA 3G79A 4B7UA 1QKIA 4KP7A 4QQRA 3W4IA 4R01A 4NU5A 2JKVA 1B7GO 2PGDA 4OJNA 1BDBA 1XR3A 5AXAA 1GYRA 5FFFA 1R16A 3VPGA 2VUSA 5T57A 2DBQA 3T4EA 1DC5A 5TC4A 1TVEA 4MIYA 4IJWA 3K73O 1B8VA 3GT0A 3KVOA 3DOOA 4UVIA 2Y0DA 4IXTA 1X7HA 3LU1A 4RORA 3TL3A 1W6UA 5F1PA 3X2EA 4J49A 3EHEA 3MEQA 4S1VA 3JQFC 3JYNA 4R9SA 5JDCA 3JQ7A 3TZCA 3A28A 2G5CA 1ZVMA 5FEUA 1VJ0A 1DIAA 3IP1A 4BKPA 3TFQA 4CUKA 3HB5X 5IN4A 3HUDA 4LSWA 4Q3DA 4IDDA 4XGKA 4J4HA 4CM9A 4FOOA 3I3OA 5JO9A 1E6UA 5ER9A 1LLQA 4XA8A 5L9AA 2QIOA 4FJ2A 1MA0A 4BO6A 3ZW8A 4DXHA 3INTA 4UUPA 1DEHA 4J90A 1NFRA 1PL7A 1HSZA 3ZWCA 2YYYA 4KMSA 4E2YA 3L6OO 3I9OA 5C5IA 3G49A 4GKVA 2I3AA 1M66A 1NWCA 1X7GA 3UGKA 1ZXBA 3KZVA 4XRGA 3PHLA 1KEVA 2IXBA 4J43A 2VCYA 1JKJA 1PWXA 4GWKA 2GLXA 4OMUA 4TSKA 2ZYDA 4AJNA 3VDRA 2A94A 1Y5MA 4HFJA 3HDHA 1NBOA 4BGIA 1EDZA 2OFPA 1B3RA 1O89A 3BA1A 3GG9A 4CV2A 4OGWA 3JQAD 3DDNA 5TT1A 1I2BA 4PLVA 2RHRA 3RFVA 1E3WB 5B12A 2ZATA 3ZZNA 4BO3A 3GUYA 5DT9A 1U7TA 3ITKA 4GMFA 3SX2A 1GEGA 1FDVA 1UXGA 2JFFA 3O8QA 4CLDA 5TNXA 3QW2A 4BNGA 1U1IA 3HB4X 4CMBA 1F06A 1T1RA 3U62A 4F6LA 5L3ZA 3M6IA 3PWSA 1ULUA 5I9LA 1EUZA 3TWOA 1Q7GA 3E03A 1P1FA 2BFPA 3KSZO 4RO0A 4Q3EA 3T4XA 4BNYA 1PZEA 3IDSA 1DJQA 5DP1A 3UW3A 2AQIA 2BI8A 3H6KA 1HTBA 3VOSA 3KYDB 4MP6A 3WXBA 3MWDB 4BKQA 2EKQA 1D1TA 4Y8VA 1L7EA 2WMDA 4E0BA 5CAEA 1E5LA 4PZEA 4AJEA 1WMBA 3P2OA 4OIMA 5ADHA 1XLTA 3KHUA 4NFSA 4MVJA 3ZV5A 1QYXA 2A9FA 2QRLA 4BNFA 4RCVA 3E9QA 2O50A 1KEPA 2GNAA 4XYEA 3WGGA 2NVUA 4Z9XA 5TQVA 4CQMA 4YAGA 1VKOA 2IZ1A 4UVDA 1PS8A 4AJ2A 4PLWA 4BKRA 3D3WA 3FTPA 4ND2A 4O5OA 4L76A 4R41A 5H81A 4MP3A 5TF4A 2PZKA 4QUKA 5IF3A 2BFAA 2GPTA 5JCJA 1E3WA 1A9YA 3JD3A 1PZHA 2DTEA 1GTMA 4K1LA 4D3DA 4CL8A 5KCZA 1DRWA 2PFGA 2VWPA 1ISIA 3NT4A 1BDMA 3H9JA 4D46A 1XU7A 4PFJA 1AXEA 2DAPA 4IY1A 3UOGA 4IJUA 4CM6A 1EEHA 1MUUA 4IDBA 5ICMA 3E48A 1U3UA 1GZ6A 4WOKA 3OJFA 2WSBA 2I5PO 2P4HX 1PJ3A 3H7AA 3S1LA 3WNQA 4BO0A 4BNXA 4KQWA 1EQ2A 1YL5A 3B20A 3GMSA 4BMVA 1A7KA 1PU2A 1G0OA 1J0XO 2P68A 3BMNA 4W82A 3JQ9A 1ZBQA 4WJZA 4FN4A 3HDQA 4RZHA 2ZB7A 2PK3A 4EEZA 3JSAA 1NFQA 4ROSA 1E7SA 2C82A 3LVFO 4PZCA 2HU2A 3K31A 4WECA 4XJSA 1I0ZA 4Y6PA 3KRTA 3M2PA 1EE2A 3PQDA 4E3ZA 1F17A 4KWIA 4FJ0A 2BGLA 3EVTA 1AHHA 1I36A 3HN7A 1JLLA 4CLOA 4DMLA 2IE0A 1UJMA 3QP9A 3OFSA 1R66A 4HXYA 1HSOA 5IJZA 3E18A 1DC4A 1JKFA 2X1HA 2AQ8A 2YQ4A 3RUCA 4H3VA 3VH2A 3H9UA 4UVGA 3QWHA 3IAHA 2NADA 2ZB3A 1ENYA 2X4GA 3CINA 1I5RA 4CMGA 3AOEC 2W4QA 5JXWA 4RQTA 4R16A 3WSVA 3ZNQA 1KS9A 1Y8QB 3DBHB 3RJ5A 4HADA 3RKUA 2X5JO 4MKXA 3UFXA 4IMPA 3D64A 2FP4A 3JQAA 2X0JA 5JC1A 1LSSA 1JQBA 4FDAA 4ND5A 4BO8A 2PD3A 3GMDA 4XDYA 1A27A 1GEEA 3FPCA 4WLEA 4C7KA 5A9SB 3KYBA 4I9UA 5CP8A 5KJEA 3R0IA 4DC1A 1XELA 1XG5A 1Y81A 3GAZA 4L75A 3BMOB 4GMGA 4XWYA 4CM4A 1PQUA 1O95A 1R4MA 1Y9EA 5JE8A 3TNLA 4BHTA 3TFOA 1IPEA 4J9UE 4OXKA 4D3SA 1WMAA 1ZJZA 2FPGA 4IJVA 4BGEA 1H2BA 2R00C 3HZZA 4R54A 2HJRA 4QTZA 1F12A 1LDBA 3JCZA 1GUFA 4JP2A 1QYVA 4RJTA 4QEDA 4UUNA 3JQ9C 1LLUA 2NLOA 1YE3A 4CM1A 1DIRA 1BTOA 1ULSA 1AE1A 2FRDA 3NDJA 4Y67A 1PJLA 1U8XX 3NYWA 3VH3A 1EDOA 5BNTA 3FR7A 4MO2A 1ADFA 3L77A 4WCFB 2ZQZA 1D8AA 3Q11A 4GSKA 1LDNA 2DUUA 2VYND 4W7IA 3W6UA 1W8DA 1R0KA 4RF3A 4UEKA 1TEHA 4XR4A 1HRDA 3V2HA 5J23A 2Q1TA 3ZH2A 4ZRMA 4BUCA 4DLLA 4OM8A 4IPTA 5JPIA 3BTUA 3Q9UA 4RLHA 3PIIA 4MKZA 5EMHA 3DAFA 1EVJA 3EDMA 5T64A 4CMAA 3MJCA 4MIOA 4IBOA 1XKQA 3DBHA 5I8WA 4NNJA 1P1IA 4LSMA 4L0QA 1YOVA 2Z1NA 3EY4A 3RC1A 4YYZA 1V0JA 3JQBC 5KVQA 4YRBA 4CM5A 4TRMA 1KVSA 5TSDA 4M8SA 4R3NA 1ONNA 4XQGA 3T7EA 1CWUA 2DPHA 4I8XA 5IAAA 1EZ4A 3KUXA 2DQ4A 3BIOA 2FPPA 4ALIA 2VOEA 1HXHA 4TVOA 4YA6A 2YDXA 3RJ9A 2JAHA 3D4NA 3ORFA 5TJHA 4EDFA 1BHSA 4HUJA 1YBMA 3I52A 3ZWAA 1JWBB 1DHTA 1C1XB 4XDZA 1F8GA 2DBRA 2VTEA 3GZNA 3ICPA 4TQGA 2PZJA 4WASA 5GZ1A 3PZRA 1M6WA 3MWEB 1BW9A 4GX0A 1ZNQO 2CF5A 2YHUA 3Q2KA 4W9NA 2HDHA 2ZQYA 5F5LA 1EMDA 1I3LA 4R1NA 1WWKA 2VWGA 2WDZA 1NQ5A 1PQWA 4AJPA 1P9LA 2V6MA 1L7DA 4P8RA 2I67A 4XB1A 2G82A 1Z82A 2EV9A 1Q7BA 5B37A 3WIEA 1VC2A 1SZJG 3FSRA 2FZWA 2C29D 5C37A 1GAEO 4E5MA 2GUGA 1OC4A 2I99A 4IQ8A 4RZIA 1LUAA 4AJ4A 2PD4A 4DIOA 2OP1A 4D42A 4WKGA 4XIJA 1C1DA 1GU7A 4OAQA 3ENNA 1ISGA 3W1VA 3LZ6A 1XGKA 5IXYA 2AHRA 3DHEA 3NDIA 2GGSA 3RASA 1Y5RA 5JO0A 1DIBA 4B3JA 2ZTUA 4FD3A 4XYGA 5F1KA 4E32A 3KM0A 4J1TA 1YB1A 1HYGA 3FTNA 1DC6A 2I6TA 1PJCA 1U4SA 2E37A 3COSA 3I9MA 1T2CA 1H6CA 4F3YA 5EQFA 2WYWA 2B69A 3OQBA 4Z0HO 3NUGA 4G5HA 5B4UA 5F1OA 2AEFA 2ZKLA 4A7PA 4Z9YA 2IZZA 4ND3A 2XF8A 4EZBA 1E1NA 2VNSA 2H6EA 4HFRA 1YS4A 4JIGA 4WCDA 4XYMA 4INAA 4LRSB 4ZQFA 1EK5A 2GZ2A 2YV3A 3DB2A 3AFMA 3RFTA 3GK3A 3DZHA 2BKAA 1P1RA 4BQPA 1AHIA 3E82A 3F6YA 4LK3A 1M75A 2GN8A 2JFGA 2CFCA 3VAZA 4PG5A 3IMFA 3RFXA 5HS4A 2ZCUA 5A02A 4FFRA 3F4LA 5B4TA 3X2FA 1EUCA 2VYNA 1LNQA 1M67A 2HLPA 4RVDA 2EERA 4E31A 7MDHA 4RL6A 2BD0A 1J49A 3PDJA 3ZV3A 3D0OA 1DIHA 1HWYA 4J91A 2JCYA 4JK3A 5A06A 2I3GA 1FDSA 2WD7B 1I3NA 4Y6SA 1RJWA 1VJTA 4Q39A 1G6KA 4Q3CA 1QXSA 1VPDA 1Z7BA 1KERA 4KTTE 3Q1LA 1ZK4A 3WJAA 2G0TA 1C0IA 4BNVA 2GN9A 1YB4A 3VZPA 4AJJA 2QZ9A 1PJTA 1LQUA 3RUDA 1VSUA 3WGOA 5A4DA 2JCVA 1P31A 5ILGA 1ZCJA 4G65A 2GO1A 1K6JA 3U5TA 2A35A 1LLCA 3CH6A 5I7EA 3RAJA 4PZDA 2UV8A 4IGEA 4YJHA 1NHWA 3INRA 4EJ6A 4TRJA 4K9DA 4WEOA 4A73A 4LCJA 3BTOA 4WEQA 2FR1A 3AW9A 5BSEA 3SBOA 3JTMA 4BGUA 3WSWA 1ZJYA 5ER6A 1GCUA 1BXZA 4GH5A 2B36A 4FC7A 3ONFA 1HEUA 4YDRA 1QR6A 3L9XA 4CM9D 1KC1A 5DNAA 4TZTA 5JSFA 4DIFA 3WGHA 1N5DA 2VHXA 1FJHA 4NPCA 3TZQA 2GN6A 3RWBA 1H0KA 5LCXA 6LDHA 2YHIB 3C1AA 3FWZA 3GVPA 4J4BA 3WG9A 2GASA 1ZKMA 3QVXA 1B14A 3C85A 3E8XA 4N5MA 3VPHA 3CZMA 2BELA 3HG7A 1KIFA 1W0CA 1ZSVA 3AI2A 3AY3A 5CPFA 1JAXA 1FXSA 4J16A 1YL7A 1W73A 3OQ6A 4BNIA 4BQRA 1UXJA 2P9CA 2HMSA 3G3EA 3JQGB 4LMRA 4J7CA 4BKUA 4ZHSA 5T5QA 4L74A 2CVZA 2ZIZA 5IZCC 1YL6A 3WGQA 5T67A 2B35A 5AVOA 1UAYA 4KUHA 2AE2A 1HDYA 1V6AA 4RPGA 1PGOA 3D5TA 4QFDA 3AWDA 2G76A 1UP4A 3WS7A 1BXKA 1DLIA 2Y67A 5KJ1A 5I7SA 2V6FA 1TI7A 1Z75A 2O2SA 4MVJP 1YDWA 2X86A 3ZWVA 3QWFA 4BNNA 1DO8A 1K6XA 4WNIA 5IZ4A 1HE2A 4RGBA 3I23A 3KYCA 2EP7A 1NQTA 4ID9A 1XU9A 5CDGA 3ASUA 4I5GA 1B8UA 1EVYA 2DM6A 2GR9A 3JQ6A 3JD4A 4FC6A 1HZJA 3VKUA 1C3VA 4DQVA 4DWVA 1N1EA 8LDHA 1U3VA 4BO4A 5CEEA 1WXDA 2E49A 2H63A 4TVBA 2EJWA 1R4NA 2GCGA 3SLKA 4WLVA 4E2ZA 3R3JA 1CERA 4GWGA 5K6AA 1N1GA 3RIHA 1LSJA 4FPXA 5G4KB 3QRWA 2VT3A 1X0XA 4QXMA 1U2DA 3ONDA 3CIFA 3OJEA 6ADHA 2W2KB 5KVVA 3R3SA 2VHZA 2WJPA 3QJ5A 2UDPA 5THQA 3PHGA 1K6IA 4CMJA 1SB9A 1LRJA 4DYVA 2YDYA 4MVJD 3L4BA 1NPYA 2ZK7A 4PLCA 2OO5A 3OQ1A 3GVXA 4MPDA 4J6FA 2DFVA 4DMMA 3EVNA 1IY8A 4CQMD 3GHYA 5B1YA 1B0AA 1GZ3A 2GZ1A 2EEZA 3K30A 5G0TA 5IDYA 1I2CA 3F1KA 3GH3A 4XB2A 1UZMA 1E6EA 1OZAA 3E5RA 5JAMA 4EW6A 2H9IA 3BMQB 5JCJD 4BMNA 1YKFA 4GKBA 3JQ8A 3EK2A 5ENVA 4QSMA 1WP4A 3W8EA 5U4QA 4GGPA 5DCUA 4UEOA 5U9CA 2F00A 2Y1GA 3OH8A 4GL4A 1R0LA 4B7XA 2PNFA 5EERA 4CODB 3IS3A 3KEQA 2J5RA 1I2ZA 3PIDA 3PJDA 2NU7A 4R69A 3ZWBA 1O6ZA 3D4OA 1GPDG 1CQIA 4RV9A 3MJ4A 1MFPA 3I4FA 2E48A 4NQZA 4PRKA 1BRMA 1A7AA 3WGYA 5JYEA 4CM7A 1K5HA 4DRYA 2WYUA 1C0LA 5FI3A 1ZMOA 1SB8A 2X22A 4D41A 2OHXA 2O3RA 4NJMB 1DB3A 3DMYA 3HHPA 2GDZA 4WUVA 1NXQA 3PPIA 1NR7A 3C3XA 2C20A 3TZHA 2CNBA 3E9NA 2X7HA 1NR1A 2EP5A 5CPBA 1CRWG 1CF2O 3BHMA 1P1JA 4CM8A 3OP4A 5EIOA 1P1KA 3INGA 1IHXA 3FNHA 3ZWNA 3KSDO 3IOYA 5JAZA 2ZTMA 4J0FA 3WQSB 3LLVA 4B4VA 3NTQA 2BGKA 1UXIA 1JDJA 4CUZA 3U4IA 1V3TA 1E7MA 3GEGA 1FMCA 3AM4A 2Z1MA 5JMPA 3SJUA 1ZMTA 4XEHA 3PWZA 4JBHA 5LC1A 3ST7A 4TKMA 4R68A 4YR9A 4XR9A 3KETA 2I66A 1YBVA 1LSOA 3PJEA 1BG6A 1NP3A 1S7CA 1F14A 2ZB4A 1IB6A 1Z6ZA 1LU9A 5CG1A 4GGOA 3OICA 4JCOA 4E5KA 4DPKA 4EITA 2C7GA 3I9NA 2CDAA 4AJOA 3KOUA 4PGFA 5DDIP 2JL1A 3GVCA 1YH3A 4HP8A 1SO8A 4K6CA 1VM6A 5JDCC 4J9VA 3ETGA 4NBTA 3RC9A 3ZV6A 3LT1A 1UXKA 1JVBA 2J3JA 4I9HA 1QYWA 1U4OA 4WPGA 4ND4A 5F21A 3WMWA 4CMIB 5L51A 4XYLA 3VH1A 4FOSA 4Z0TA 4A26A 4WLUA 5G0SA 5I7FA 3PXXA 3TSCA 2VRCA 1SNYA 3TL2A 3ZNPA 2FSVA 1ZEJA 2IZ0A 2NU6A 3LDHA 3QQPA 2B5VA 1IOLA 1GUYA 3L9WA 2O3JA 3WFJA 4Y6RA 2BMAA 1MC4A 4G2NA 3VPSA 3DC2A 3F4BA 4EI2A 5JNLA 4MINA 1H6DA 1JN0A 4GBJA 2ILTA 1JVSA 2HRZA 2O7SA 2PKQP 2YZ7A 2FZEA 1E7WA 4JNKA 2NV6A 4YAIA 2D2IA 3VHRA 4A10A 1LLDA 2GD1O 3K2EA 1I24A 3C7AA 1HZZA 4YB8A 5TT0A 4ZQHA 4XKJA 2XOXA 1UP6A 4OHUA 2EGHA 3ZWWA 3NV9A 1NTOA 3CMMA 3MTJA 1WVGA 2AEJA 2QYTA 1E1LA 4XQCA 1QV6A 4NBUA 4HNGA 3AK4A 4NK4A 4PIVA 4YVFA 5IG2A 1PS9A 1RKXA 1H6AA 3NEPX 2QRKA 2PH3A 5CFZA 2C5EA 2Y1CA 4YAJA 1MG0A 9LDTA 3DL2A 3DZBA 5ITVA 4UVEA 3TRIA 3WOHA 5LDHA 1WNTA 2GN4A 1GADO 4RQUA 4JJFA 3JQCA 3DBRB 3WWZA 3KYDA 1U9JA 1CEQA 3BMCB 5JY6A 3WTCA 3HDJA 4K6FA 1YWGO 3I6QA 3TZKA 4NMHA 1UDAA 1KVQA 3DR3A 3I6IA 3F5SA 2G17A 1E7RA 1KY5A 2OP0A 1J5PA 2B4RO 4IUYA 3GG2A 3U4HA 2AG8A 1LDYA 1A9ZA 2YFHA 2Q4BA 5HRUA 1NVGA 4I5EA 1MFZA 3ROMA 1P77A 5BT9A 2ET6A 5JBIA 3UCXA 1JTVA 3H5AA 1ZIDA 4P4NA 4CM3A 3KTDA 3HDYA 2A4KA 4HWKA 4PLTA 2EHDA 4CMEA 1P0CA 1IULA 2FHSA 3WIDA 3KB6A 4B8ZA 5AOVA 4RPHA 1BVUA 1HF3A 2OOSA 4D44A 3Q3CA 3MJVA 2DPGA 1ZXLA 2VZ8A 4O1MA 1NYTA 4JGBA 4UEJA 3GDOA 3U9LA 1EUDA 5IDXA 2NUAA 4NR0A 3DBVO 2PH5A 3IKTA 2B4QA 1YQXA 2B4TO 3RQSA 1NVMB 3WX0A 1Q7CA 3KSUA 2VHYA 3LK7A 2C0CA 3PQFA 2PLAA 2HJSA 3RC7A 1U8FO 1F0YA 3MTGA 2ZB8A 3VC7A 4D79A 2CDCA 4LGVA 2I65A 3BTSA 2Y93A 3GGPA 3ANLA 2CDBA 3K8ZA 3PZBA 3ZNNA 4ZQEA 2J3KA 2WYVA 1SEPA 1KY4A 2C54A 1JAYA 2IRWA 3GZ4A 1A4IA 3GNSA 1C0PA 4YJGB 5ILOA 2NTNA 2O3QA 2O3SA 4NZ9A 3ZU4A 1ENOA 3HE3A 4ZGWA 1MG5A 2QQ5A 4YWJA 4ALMA 1D4FA 2BI7A 4WNCA 2NQTA 5A05A 3S2FA 5BR7A 3V1YA 3V2GA 5KKCA 1S6YA 3AM3A 3BHIA 3M2TA 1YQGA 2Q3EA 4NFHA 1T2EA 4FB5A 3OMLA 4J2OA 4O0LA 3WQQA 1UUFA 4MJLA 3FNEA 4E13A 3ASVA 3RI3A 2NVWA 2CUKA 4H7PA 1N92A 4TRNA 5A03A 1GYPA 3MJTA 2OXIA 3ZWMA 4CQLB 1ZEMA 4ND1A 3QLJA 2POQX 1D1SA 3LC1O 1DAOA 3DBLB 3W4JA 3JYOA 2OZPA 3GC6A 4O6VA 3R6DA 4IIUA 4CMCA 2WE8A 3QIVA 2NACA 1O9BA 5EN4A 4B8WA 4DL9A 5IDQA 2AMFA 2D1YA 3PLNA 3IC5A 4JX8A 5ICSA 3GDFA 2YV1A 3IL2A 5JCXA 3ANNA 4N5NA 3O38A 3ZWYA 3STHA 2X9GA 3V2UA 4I9NA 1K2WA 1Y8QA 2QX7A 3UH1A 1N8KA 4I5DA 2Y1OA 2X58A 1SCUA 2Y66A 4H16A 3GR6A 1Q0HA 1XA0A 4AJ1A 4R51A 1HYHA 3WFIA 5KJCA 2W2LA 3P7MA 4BNMA 1XEAA 3MOIA 3VDQA 5A9SA 3C7CB 1Q1NA 1BWSA 1GPJA 1VL6A 2Z5LA 3GGGA 1CQJA 1Y7TA 4YJFB 3BMOA 1ID1A 5F5NA 1MGOA 2SCUA 5TRTA 5DZSA 4B4UA 2VWQA 5A9RA 3E1KA 3UXYA 3RUIA 3HJAA 1YB5A 4NIMA 1RM0A 1C0KA 1CJCA 1DPGA 2X0RA 3S2GA 4OH1A 2O3TA 4ITUA 1CDOA 2P9EA 4JLWA 4M54A 2IYOA 4MVJE 4PLYA 4YBZA 1P44A 3NDRA 4KQXA 5KVSA 4BB6A 1PJQA 3TQHA 3W8FA 3L07A 4U8GA 3KBOA 1GCOA 3DHYA 3AFNA 4P4LA 4F45A 2YQ5A 2FY8A 1SMKA 3D7LA 4CUJA 3TJRA 4WCFA 2XPCA 3WR5A 3VZRA 3FBGA 1HYEA 4C4OA 4FS3A 5DN9A 2VUUA 1U3WA 4DIBA 1ISMA 1YRLA 2X5OA 5CEFA 1K3TA 4YCAA 5CDYA 2DFDA 5EQDA 3GQVA 4NBVA 1E92A 3K96A 5HTOA 1E6WA 2EW2A 4RLSA 4L9RA 5KIAA 4RVUA 3F5QA 1GQQA 1GDHA 3AY6A 4ESOA 1X15A 5DBFA 1ARZA 2Q46A 3V5NA 1PJ2A 1SBYA 2XXJA 4J2HA 4IDEA 4R5HA 4N7RA 3OA2A 4RDHA 4R3WA 4U0KA 1U28A 4ZRNA 1ZSYA 3UICA 2PGLA 2VYVA 1DOHA 4DLBA 1NAHA 4MKRA 2DUWA 1E3SA 1SOWA 2HMTA 5KWEA 3GGOA 4BGVA 4OQZA 4E4YA 4Z3DA 3M1LA 3AUAA 2J5QA 5IN5A 3AJRA 4UAGA 4LMPA 4E5PA 4J1NA 1I30A 2DKNA 2OMEA 3K9QO 3EYWA 1ML3A 4PLZA 5EJ2A 2NQ8A 3ZN2A 3V8BA 5HBRA 4YAEA 1DSSG 3ZI0A 4W7HA 1DFHA 1C1XA 1LRLA 3FBTA 4WLFA 3U4DA 3P5SA 4LCEA 1YJ8A 5T6BA 4BNJA 3Q0EA 1ZK3A 4XX0A 4ZU3A 4ZD6A 3U49A 3HFSA 3ZGYA 2PTGA 2RH8A 1SAYA 2VHVA 5AYVA 2HQ1A 1P3DA 4D45A 3FF4A 4MVJF 3F46A 3WDSA 5HM8A 1AN9A 5I9MA 4BNZA 3GY0A 4FR5A 1XWFA 4PG8A 2BH9A 1WPQA 5GY7A 1R37A 1BVRA 4W9NC 3UF0A 2C2YA 1KVUA 4A0SA 1LX6A 5AQ1A 4RF5A 1SC6A 4GX2A 4WCFC 4BB5A 4D0SA 2IYPA 2JHFA 2PGJA 2O4UX 1D3AA 3NRCA 4J3FA 3H3JA 3DONA 5JLAA 4TZKA 3ADOA 3GRKA 4HFMA 5JC8A 2Q2QA 3F3SA 1BMDA 1UXHA 3M1AA 4DPLA 2B0JA 1B3BA 3SJ7A 1DIGA 2O7QA 4XQ9A 3U4CA 1OBFO 2JD1A 3JQEA 3E9MA 3DOCA 1HL3A 1H94A 5G0WA 4HX5A 4XQEA 3H9GA 1ZO8A 4QECA 3ROQA 4CV3A 3L4SO 1P74A 2Q2VA 1P33A 3IP3A 3R1IA 3U0BA 1DDOA 1PR3A 3GHHA 5JAIA 5A5FA 1XIVA 2CVOA 2B37A 4QT0A 3KXDA 2O48X 4FFOA 3ITDA 1R15A 2QYSA 3HADA 4FGWA 4DPMA 3PI7A 5COQA 5G2OA 1DC3A 2CSUA 2P91A 3OJLA 5DULA 5A3VA 2C07A 1AGNA 2JCXA 5C7OO 3DMTA 3EW7A 4JP3A 2W90A 2GZ3A 2ZJ1A 3RC2A 3OIFA 4QO8A 4U0JA 1N9GB 3P2YA 3DTYA 1M2WA 1QLHA 1E5QA 1ONPA 1TT7A 2X9NA 3OHSX 3SC6A 2NVBA 4ALKA 1NAIA 1U5CA 2Q99A 1I01A 2Q4EA 1PEDA 4GVXA 3G0OA 4YT5A 3AOGA 1HDOA 3KEOA 3FRJA 1MB4A 1Q0QA 2Q1UA 3NTRA 1IUKA 2Q1SA 3QE3A 4HBGA 2JJYA 1QMGA 4JBIA 1V9LA 1UH5A 3GN1A 3LC2O 3BXXA 3H65A 2ZTLA 3I9LA 1HLDA 3PEFA 3WGZA 1K89A 4PLGA 1XQ1A 2DT5A 1Y8RB 1RYEA 1OAAA 1GQYA 1KC3A 1EFKA 1I3MA 3A14A 4KDEA 1LC0A 4GAEA 2DBVO 3GLQA 3JYPA 5T8KA 3RUEA 1YONA 3ETDA 2WEKA 4O59O 1N7GA 2HMUA 2WD7A 3NX4A 4M49A 3ETEA 1RM4A 5DOZA 5GZ6A 2UUPA 4BNLA 4LVCA 1EFLA 2BRUA 4I5FA 4IQGA 3ZNOA 2HK7A 4K28A 3NTOA 5K9ZA 2VN8A 3LQFA 3GEDA 1SOVA 5H82A 3W8DA 3CXRA 3JV7A 1DBVO 1ADBA 1LI4A 1OC2A 3QA9A 4E2WA 1CETA 2NU8A 3WYCA 1MXFA 3TZ6A 3DFUA 2JAPA 3I5MA 2Q49A 1G0NA 3H5RA 4IZHA 4E21A 2FMUA 1Q0LA 4BV8A 4I1IA 1T4DA 2YY7A 1ZW1A 4E30A 1HDRA 1HDZA 4FJ1A 3ONEA 4NBWA 2P5YA 3VZQA 4DQXA 1E7YA 2PKRA 3K5PA 1ENPA 4CL3A 4G81A 1T25A 5DF1A 4R1SA 3WMXA 2B5WA 2TMDA 3GPDG 5C7LO 5L7YA 1ISJA 3ABIA 3H3FA 3K92A 3RBZA 4GI2A 3GDGA 4NFYA 4S3MA 1Y9AA 3VPFA 5KJFA 2YHIA 3I9JA 4HY3A 4PRLA 2IEDA 4IM7A 2VUTA 4Q9NA 3RUHA 3RUFA 1PWZA 5KVCA 1NPDA 3AU9A 2VRCD 3BTVA 3CEAA 2NU9A 1NPTO 3H2SA 1KVRA 3JD0A 3JQFA 4KDFA 4CJXA 4DLAA 1TXGA 4W4TA 5IDWA 2NM0A 4DTIA 4M1QA 3NKLA 3GUCA 3ZWOA 1ZK1A 1YBAA 2XXBA 2PKQO 3OSUA 3OJOA 5ES3A 3PJFA 3VVCA 3JQ7B 1DAPA 1EBFA 3VTZA 3JQGA 3JYLA 1NX6A 1ZK0A 4J0EA 4ALNA 3U09A 1YDEA 3O03A 1WAMA 3D5QA 2BFOA 5DOVA 3QVSA 2FN7A 4AVYA 5IXSA 3L0DA 4B4WA 5JY1A 2FSSA 2X5KO 2DLDA 1E0DA 1UP7A 3LSYA 4PG6A 1N2SA 2FR8A 3PYMA 4JJIA 5DBGA 1T26A 1H6BA 3WJ7A 2HO5A 2O3UA 3ULKA 1LBEA 8ADHA 3VH4A 3EUWA 1T1SA 3CKYA 1MC5A 1MP0A 3ZU5A 1R6DA 1LTHR 1ONOA 1YJQA 5FYDA 5COBA 4DREA 3A1NA 4EJ0A 4FSHA 4K26A 3DQPA 2QZZA 1GL3A 1VL0A 3SVTA 4ZQBA 3TOXA 5MDHA 2IDZA 3WTBA 2OBNA 5HA5A 2Y0CA 4ZICA 3ZHZA 2EW8A 5FWNA 2GYYA 4Y9DA 2E4AA 3E5MA 4YRDA 2PZMA 4EUFA 4J1SA 1XSEA 3NGLA 3QY9A 1XDWA 2PV7A 3NJ8A 4PG4A 2PA3A 4AJHA 3CSDA 1EK6A 2Y1DA 3TN7A 2H5LA 3BHJA 1HDCA 1H9AA 2QW8A 3FR8A 4OXYA 2C7VA 4PG7A 4F6CA 5C3MA 1GR0A 1RWBA 1UR5A 1O5IA 3LT2A 3JD1A 4WK6A 5G4KA 4M55A 2Z95A 2HCTA 3IKVA 1XYGA 1ZFNA 2J8ZA 3LT4A 1QORA 4OKNA 3ANMA 3KO8A 2W2KA 3JD2A 3CMCO 3TOZA 4AJIA 2VQ3A 1IPFA 4U6QA 3A4VA 5CDTA 5K6AC 3WLFA 2X0IA 4NDNE 2R6JA 5L95A 1LRKA 4ALLA 2AG5A 1VSVA 2VWHA 3GVIA 5EESA 1C14A 1HE3A 1U3TA 3O8QB 3LC7O 5AXCA 3FI9A 5L4LA 4FW8A 4U5QA 1HE5A 1DLJA 5I9NA 2ZTVA 2PD6A 3HN2A 2DBZA 3LLSA 3S55A 3OEWA 3VZSA 5CG2A 2R2GA 3L4BC 4II2A 1KEWA 3ZW9A 2X9VA 5JMWA 2AQKA 1OI7A 1P1HA 2NNLD 1V35A 4RDIA 5H83A 3SXPA 1OFGA 5CDSA 2BF7A 5A1TA 5JW6A 3F1LA 4E12A 4Q3AA 3BMQA 3L6DA 4CV0A 4L4SA 1E3EA 4J7UA 1GQ2A 4ZN6A 1XHLA 3OF2A 1ADGA 1EE9A 3RBXA 1P0FA 4RPLA 4NJOA 1LEHA 4XD2A 3GRPA 2P2SA 2BFMA 3DXFA 2W8ZA 3PFFA 4U6SA 3NAQA 4EYEA 3G17A 4IDCA 1JU9A 3AUSA 3RU7A 3ZU2A 2NVUB 3PHHA 4CQMB 5DP2A 4DGSA 4CR8A 3D3WB 1V3UA 1QP8A 3FN4A 4HNHA 4DUPA 4WE3A 2PZLA 1E77A 4Z9FA 1QYCA 3FNFA 1F8FA 4AG3A 3VTFA 4FFLA 5HS6A 2F1KA 3T7CA 4KTVE 2D5CA 2E82A 2EIHA 3QWBA 4AFNA 4HV4A 1TLTA 4MVJM 2Q45A 1FK8A 3OIGA 4NJMA 2GF2A 1B15A 2P9GA 2Y0EA 2HAEA 3DEYX 3H2ZA 4BO2A 3B70A 3QHAA 3HQ4O 1PJSA 1I33A 1ZZEA 3CE6A 3P19A 4FBGA 4HFNA 4RVSA 4WLOA 3CUKA 1ISHA 3EZLA 4F46A 4R9RA 5A3JA 2Y05A 1PIWA 4BNKA 3PJGA 5C7IO 4E33A 1NNUA 4BO5A 3GFBA 3BMNB 3H4VA 1E3JA 4ONEA 3QV1A 2RCYA 3ROPA 2VRBA 3ZV4A 3GN2A 2HMWA 1PJBA 4YACA 3ADPA 3B1JA 5FF9A 1KOLA 4CV1A 2VTDA 5DBIA 3GNTA 2V6BA 4I08A 1NQOA 4LN1A 2EGGA 3DO5A 2W2LD 1IHYA 3AM5A 3BAZA 4JJGA 1BGVA
chains in the Genus database with same CATH superfamily
1ZOOA 3I2GA 1GYQA 1RRVA 3LRTA 3GJZA 3FGOA 3AHEA 3UMBA 3QYFA 3UXMA 1OIWA 2LTAA 3SLGA 4F4IA 1M33A 4YT4A 3DG9A 4EW2A 4GP9A 5E7QA 1MABB 5FBVB 3CUEF 4GX1A 2ZBVA 1O4WA 2PDAA 5DWVA 4QUDA 3C70A 4ZPJA 3CUSA 3A58B 1JA9A 2X1VA 5ESXA 3FB1A 4OO3A 1QGUA 2GB4A 3RS2A 1X13A 2GRJA 3WGIA 1BEEA 2WHQA 5JCOC 4A8JA 5IJ9A 3FE2A 3HY4A 3D6NB 3FUTA 1PTJA 2PSEA 3MG9A 4RXUA 3ZTWA 1X1RA 2QG4A 1Z06A 1UM8A 1GG5A 3FUUA 5HKKA 3SZOA 3OU6A 5G41A 5JS8A 1XDGA 1MIOB 4R8LA 3LUJA 3FUWA 2FP4B 2NGRA 1TM7E 2F1IA 3H2GA 4NH4A 4Q66C 3Q9NA 5FPPA 3L7JA 4ES6A 1MV5A 5FTLA 5L53A 3FSJX 3ZHXA 2RFLA 3T4UA 2CV2A 3SSMA 2QPTA 2GPWA 3C41J 2F9MA 5I7RA 4CXMA 3O9ZA 3NVAA 1GLVA 3GEMA 3IQFA 5JFOA 1GD1O 4LFAB 4XUDA 1CVLA 4URFA 3O2NA 3X1JA 1QGOA 5AHRA 3WL8A 1OWLA 2FQQA 4CM4B 1W19A 4M60A 2ID8A 5EPOA 1HKHA 2F8SA 2Q9BA 1EUYA 3N58A 1L6RA 3WLPA 5FBRB 4HMPA 4HEHA 3ITEA 5LMNB 2RH4A 2X2EA 2NTJA 3KVRA 3L1VA 5F9MA 3RABA 3MM4A 5K3FB 1Y89A 4LHWA 5DFAA 3K5IA 2PT5A 2EKPA 4B6GA 5BSUA 1KO4A 1OJLA 3A3YA 5BWCA 1E2NA 1ZYUA 2HWYA 3JRWA 3T9AA 4DWJA 4YQFA 3GA0A 1GFIA 1UEJA 1CQPA 1NVTA 3B3AA 3ZDFA 2UYCA 4BMSA 1IZ9A 1RRGA 1Z62A 3K0AA 3UENA 2O8VA 4UDNA 2O5VA 3G82C 3G0GA 3GLGE 2NXWA 4L08A 1XAIA 4A23A 5GP1A 1BRTA 3RVDA 4FEYA 1KP3A 1L7QA 4NONA 1PNTA 1ZM3A 2GTHA 4JA2A 3BGSA 4DWOA 1V96A 5CA0A 1ODSA 3MILA 3QE0A 2QRVA 4RAQA 1DCTA 1H9BA 3ED5A 5AXDA 4BP3A 2GCPA 3FX2A 3HJHA 3JW8A 3DZJA 3CGGA 4GPEA 1JQLB 4NF2A 3V42A 4CDGA 3OUTA 5K0CA 4PVDA 4JLJA 4XIYA 1O8CA 1R64A 2EF1A 2JB9A 3DFMA 4KXVA 1TIKA 1RIIA 4YASA 3SKYA 5L7TA 3JQBA 3WKAA 2C8VA 5A0TA 1VJ1A 2Y9MB 3QPBA 4JROA 2I7VA 1XZNA 4U9IS 1FX0B 1G1AA 1OZFA 1RCFA 5CVVA 3UPUA 4UM9B 1WD5A 2ZJOA 3BDAA 3PVZA 4XFKA 4LRTB 4J03A 1G5QA 4YV7A 4MQBA 2O6LA 2F90A 2W6IA 3NIFB 3GPCA 1XMQB 1E3LA 1N7JA 3Q1KA 2H1IA 4GOMD 5WRFA 2XCLA 3ABOB 1HDXA 3WZ2A 3TJMA 3DDZX 1XZAA 1T2DA 1TVKA 4HQLA 5HFNA 1L7RA 2OD2A 4YJKA 4ZA2A 2HLDD 1P2BA 4QYMA 4EHIA 5L45A 5FWYB 4DS3A 2PBZA 3DZIA 4RL4A 1XTUA 4C04A 1HFKA 1ZCZA 3GZNB 4CMEC 1CZLA 1QGZA 2D59A 4OHZA 2HFJA 2HLNA 2JH9A 4J94A 4MEAA 3W9UA 3P8ZA 4TWJA 4AMYA 3W9BA 3PQEA 2VZ9A 2NW6A 3D3EA 1Z8HA 5BSHA 2WU4A 3TVTA 1GPNA 3H7IA 1YS2X 3IUPA 5EMKA 5ALQA 2BMEA 2H7VA 1SCNE 2PJUA 5BSFA 4XPIA 5DCYA 3LVBA 5JEEA 5IWAB 4TXHA 5CURA 4RK4A 4MJ3A 4RWEA 4YJ2B 3WKEA 5CDHA 4DNXA 5FEMA 3GBSA 3VR2D 2P69A 3PGVA 2R86A 4BV9A 4EUKA 4YV1A 5IARA 5BWOA 1LC3A 1Q6ZA 1SPXA 3ME5A 3MXTA 3K1TA 3OM9A 3WO0A 1R0RE 4X6YA 3KVYA 5EHQA 4ZVVA 2ODPA 4M1MA 1YSCA 4YJGA 1I7PA 3R4VA 4IFBA 2VYQA 2X42A 1TZJA 2FZ4A 2QRUA 4GGMX 2ZTHA 1BXRB 4AB1A 1BN6A 3L46A 3TXYA 2Y2UA 1J0EA 1N5LA 4AL4A 5KNBH 2CFIA 1GTVA 1P73A 4XVHA 1M76A 4KK4A 2PL1A 1YI1A 1K7XB 4BGDA 3K94A 4YRIA 1QO9A 4LC9A 3BYZA 1GPH1 1H2FA 2M6KA 2YNMC 2Y1EA 4UQOA 3BRCA 1CNFA 1OYVA 3BK2A 3AI3A 1BCSB 1K98A 1KDVA 3VHXA 4KAAA 3K9WA 1X39A 2G9QA 3FNGA 1G4UR 1PL8A 4AXXA 3QYJA 4K9RA 4UEWA 5AI5A 3OM0A 4KV7A 1U7HA 2VQSA 4DQDA 1HKUA 1GRNA 1GG2A 1NDHA 2YV2A 4N8DA 4NI5A 3BWXA 4RY9A 3HNOA 3G88A 5EYPA 5HPYB 3EYAA 3WDKA 5DHSA 1V5IA 3SDZA 121PA 5I8ZA 1PG2A 3DMPA 3Q6NA 2JJ2A 1I3CA 3FHJA 5JNTA 3MWKA 1M5UA 4UZEA 3NH6A 4JDUA 1NDQA 3R3WA 4WY5A 5H7XA 3VKWA 1NZFA 4WAUA 2WTEA 2W98A 3G23A 4EB0A 4WZAA 1RPZA 4PZ0A 1ZGAA 3K70C 1E7QA 1NG1A 5FWDA 5TY0A 2XWSA 2CHUA 2O54A 2QRQA 4TWBA 3NJ4A 4BDTA 3LIPA 3OAAA 4WN3A 4RF4A 1KEEB 2GPJA 1N6OA 2JW5A 2OZKA 2ZW9A 4V1CB 2XQIA 5DJ5A 2W2PA 1KI3A 3WISA 4QT4A 2O7RA 3H4TA 4BZZA 3DP7A 6Q21A 3GAFA 2GN2A 1PX0A 1ZUD1 1X1TA 2CL0X 3PB3A 2IXAA 1SHKA 2HMYB 4MS3A 4M89A 4ZHQF 3UG6A 3WLIA 2FPRA 5EWJB 3ED1A 2PH1A 3PITA 4H7FA 3O8BA 2QM8A 3FZNA 5BN1A 4OP2A 1AGPA 3KLNA 4G8CA 3HVHA 3EF3A 1NLUA 2QNRA 3AESA 1CYDA 3ZGVA 3B6IA 4BNTA 1IHPA 4BPBA 5ECDA 1MU0A 1T15A 3ZHSA 3DAGA 3R7SA 3HO1A 4FZRA 1Q14A 4CLRA 1OBHA 3HH8A 5DMXA 3TTXA 2HWWA 1DQRA 2PLRA 2E85A 3DEZA 1SELA 2H1SA 4LVUA 5F4ZA 1XCBA 1T1IA 2FPSA 3DE4X 1GPMA 3UJ8A 3D0QA 3TIGA 5BY2A 2EXXA 3MGBA 5G0UA 3TLJA 1Z74A 1H8HA 1EX9A 3OLVA 3RF7A 1KDYA 1ZVKA 5E7JA 4O1HA 2EC5A 3INNA 3A6HA 3KWJA 4YAKA 1YS9A 4YXFA 2YZ2A 4JCCA 1E4EA 4A2CA 5BORA 3LT0A 2HMVA 1SC1A 4G63A 1L4EA 2ZYUX 1BYUA 3LZDA 4JGIA 1OY1A 4R2XA 5GADl 5KKNB 3C24A 1W5SA 3WGKA 1CRLA 3DAHA 4N7BA 4ZDWA 3E7XA 3L0ZA 3RS7A 1FNNA 4ZCIA 3PEEA 1SVIA 2VK2A 1QFZA 4PVCA 4QNMA 3TLYA 3T1TA 1QV7A 4GDMA 3CX4A 3KHSA 4H15A 3ECCA 5CEJA 1UBGA 1QF9A 4XLLA 3NBQA 4IIVA 1OAOC 3DR5A 2CCGA 2VNJA 5BXYA 2PO5A 2DVMA 1M74A 1VCOA 2H9YA 4H4DA 4U7WA 1E0AA 4A15A 2QZJA 2PTHA 4EJMA 2DR2A 3GXOA 3NT5A 1Z0FA 5FV4A 1T2FA 1QK3A 4XRRA 1P6XA 2AJTA 2H2GA 2XCSB 4U63A 3BBPA 1O6BA 3MJEA 2ECFA 2XYPA 3LF1A 1TK2A 4EL0A 2HCBA 5EJ9A 1H4QA 3IPAA 5CCXA 3FPLA 1DVRA 4DIDA 4ZT5A 1EVIA 4DUYB 5SZHB 5CDUA 2QENA 2VVTA 3UG7A 4U6NA 5C52B 1NM5A 4N7JA 5DTRA 1NWHA 1XHFA 4M87A 2EWMA 1BMFA 2IPAB 3JAKA 3JY6A 3W5BA 4R1QA 4U9UA 2JGEA 1L4UA 4GSLA 1PFKA 4EF5A 4IZIA 4JENA 2R11A 4XARA 1X19A 4WDQA 3TH5A 4ACAA 2P67A 2YWXA 2A7QA 3F2VA 4HXEB 4TUYB 1T2AA 4NC9A 4PAOA 5E6UA 1U2GA 5KB3A 3OZAA 1ZNYA 4G97A 1RXWA 1NT2A 3CV3A 3PCTA 2XMDA 2XYRA 1EM8A 1VHTA 2QD1A 2WTXA 5M2QA 3NONA 3AY7A 3B1FA 3KAJA 3IXMA 1GFWA 1DXYA 1UBCA 1XCOA 4INZA 3QJGA 5KO2A 4YO7A 2BLLA 1EXMA 3JWEA 1NJ1A 4TKLA 4HDQB 2QTVB 3B1XA 4XZ3A 2QMOA 3VJLA 3OQVA 1YZNA 4KE9A 4C0AC 3KOMA 4RKRA 1LVUA 2XUOA 1OIVA 3IOEA 3MCVA 5JXHA 2DB3A 1ZD1A 2YUIA 4PEVA 5J47A 1SULA 3WLNA 3KJNA 1Z12A 3UA3A 4I1YA 1DTWA 2EG9A 2ONKA 4IDAA 3U56A 4HTFA 4Q4JA 5B1DA 3AXTA 1ZOIA 4C2BA 7AT1A 2BEVB 2WAXA 2XMPA 2CMDA 4NG5A 3SMVA 3TEJA 4HKTA 3OWOA 3R20A 1P8JA 5U1PA 2EKLA 1RWQA 3V46A 4F9EA 4IQ0A 2H16A 3R3XA 1A72A 1YMQA 1DEXA 3I6YA 1R4NB 3HBMA 5D5PA 1NLZA 2CF6A 3VZBA 4EVSA 4ZVUA 1WLYA 1J4AA 2HUNA 3I0NA 4UD6A 4AIRA 2BBWA 3ZD6A 3ID6C 4Z6KA 1AZWA 2VATA 2HF2A 3N7UA 1SN7A 1W52X 2F59A 2WMYA 1FFHA 2XYHA 3RYFB 3I4LA 2JAXA 3LI2A 4FGSA 3FDIA 4EG1A 5KJ6A 2DERA 2Y1FA 2IU6A 1QANA 2IYYA 4EW1A 2F3PA 2O06A 3AI7A 3KB1A 3TR6A 3K6JA 3UWOA 3EGXB 1XPRA 3UJAA 3HTXA 3FD8A 4M3NA 2W6NA 3UAVA 4YCSA 3L8FA 5HM6A 4AI6A 4IGIA 2CZCA 1P62B 3VJRA 2BLNA 2RC5A 1V26A 1W4ZA 3QX8A 2QW0X 3VC2A 2EQ5A 2OL4A 3E81A 2P40A 4ZZIA 1Z4MA 2F55A 1XD9A 3AFOA 1N9GA 1OH6A 4A8TA 3A7DA 1ZM4A 1Z5OA 4F72A 1XRRA 3QVOA 4FFNA 3EEQA 4M86A 3CZQA 4QLOA 4LXIA 3UTCA 3PV0A 5E4YA 5F52A 3IFSA 3VMFA 3ZIDA 2NUTA 1XTVA 3OBBA 3NOQA 4ZZ1A 2R9VA 4JJEA 5B1IA 5FCDA 1FF9A 1L2TA 1QB7A 2HN9A 4HX9A 3PFNA 4KMOA 2KW5A 4LKRA 3VPXA 5LOVB 3GLFA 3FYSA 5J3JA 2Q21A 4II7A 2CB9A 3ZS8A 1X14A 1E2MA 4YYEA 1DG9A 4NBNA 4LISA 3TD6A 3DS8A 4O4HF 1VGRA 1DTSA 1IAQA 1FJXA 4ARVA 2LD4A 1W0JD 4CDMA 1N3YA 4D9MA 1CUHA 2RAPA 2YHAA 1O9GA 3PRYA 4WZAE 1BNCA 1DHRA 1Y8RA 4WN9B 2OBMA 4P32A 3UAZA 2EATA 4Q05A 4ZMRA 3UHAA 1TB4A 1Y3CE 2DPXA 2CBGA 1P45A 5CXXA 4KR9A 3RYHB 3LTEA 4AMUA 1JQ3A 4ZVPA 2EX1A 3Q8LA 4TT8A 1E96A 1K97A 1SUEA 1HOTA 2H1LA 2L42A 1Q74A 3SSOA 1BSVA 2HR1A 2X2PA 1CQIB 4E2XA 1KORA 1TC2A 4WESA 2FRXA 3AF1A 4ZYVA 3TDKA 3JALA 3KZXA 4DQUA 5G0VA 4HNVA 2BFEB 2PIDA 3KLMX 2XNHA 3ANTA 4QPPA 3B53X 4NECA 5KOIA 3KQUA 5K7SA 1SBCA 2UAGA 1ZGBA 1JZSA 3Q12A 4GVLA 1WW2A 4Z2YA 3P71T 3WLJA 1OU0A 4O4JF 2QTZA 4QRHA 4BNUA 1BS2A 2RHCA 2C7PA 5J9FA 3R8XA 2TMGA 1S0UA 2Y76A 1Q2XA 2P3QA 5LP6B 3WK4A 1E1CA 2CDRA 3C3KA 1UM9B 1JI3A 2EJVA 2AUMA 3CNQS 1P8AA 5EXTA 4I4TB 4PONA 4OKIA 5AVVA 1FTSA 3V80A 1FTQA 2EAUA 4YRPA 1ZUNB 5GGYA 2Z04A 5ELLA 7REQB 3AZPA 4UARA 2V7TA 3O9MA 3W2HA 3I4CA 4UD2A 3G79A 1ECPA 2F62A 3AO0B 3IHTA 5KDOA 4JJ7A 4QQRA 5ED0A 5GGXA 4EY6A 4M9QA 3RK4A 5J1SB 3W4IA 4JOBA 4NPHA 1CEEA 4L0CA 1HC7A 3WOVA 1R50A 2OAQ1 2RMKA 4OJNA 1BDBA 3QPCA 3A1CA 5AXAA 5IHPA 3B6JA 5FFFA 2VUSA 1OFVA 4X63A 4K9OA 5FAXA 2PAFA 1MAUA 3Q2OA 2P2GA 1RLUA 1SXIA 3VR6H 4W5RA 3J7TA 3LCCA 2G1JA 2HBRA 3KVOA 5IPFA 3CW9A 2VP9A 2Y0DA 3EXG1 1X7HA 3NTLA 3C7KA 3OQPA 2PQ0A 4RORA 5JJLA 3R7DA 3I2FA 4AY5A 2ZIXB 1CDZA 5F9FA 2VDWB 2A14A 3JQFC 4BEJA 4R9SA 3TQQA 1XJ0A 3FHCB 4ETIA 2C7RA 3A28A 4RJKA 4OLJA 1ZVMA 1E2BA 5FEUA 3SN6A 2OG1A 3DXXA 2AN3A 2AOWA 4FR2A 1VL2A 4Q3DA 3SS9X 1L7AA 3OO0A 1NKSA 4N3NA 4XUGB 3RF6A 4NV1A 5JU6A 2WM8A 4C6SA 3OQJA 5FHQA 1LLQA 1XMPA 2A6PA 1KDPA 2AFVA 2AX4A 3ROZA 5DNWA 3DE7X 3IAS1 2Q8QA 2FP3A 1XCGB 2IUEA 2GXSA 3INTA 5DGTA 1U0GA 2J0UB 2H1RA 5IF9A 4UUPA 1KE2A 5IC6A 4K6KA 5JISA 4LF7B 5KYGA 4ND7A 2ZWMA 1PL7A 2GESA 2JBAA 4G5FA 3ZWCA 1N5IA 2YYYA 4KMSA 2I8CA 4Q4HA 2ZS7A 2RK6A 2QSZA 2QP4A 4JI8B 4RENA 4JVLA 4QUHA 4UM5A 4YV2A 2BOVA 3AP2A 3SE0A 1NWCA 1IAVA 4XRGA 1GO2A 3KZVA 2MSWA 1UKBA 1TJPB 2D1TA 3FDZB 5CBKA 1ULZA 4J43A 2BGGA 1JKJA 1GPAA 1PWXA 1Z0DA 2D74A 3FUXA 5TQ2A 2ZYDA 2AG6A 1EU1A 2A94A 4GEGA 4IRXA 1XL0A 4IGEA 1Y5MA 2WAOA 4JSRA 4RD3A 3UV7A 2KBEA 5FPKA 2IH2A 2WWWA 1NBOA 1FFGA 2FWNA 2PSDA 3DEAA 4L72A 2RBKA 2W2MA 4FFVA 3T1QA 3VSBA 4D4JA 5JHGB 3BA1A 5ESWA 2WHEA 1EFPA 4N3AA 4KYTA 5K01A 1R6XA 1XQYA 2YWEA 4MKHA 5EQTA 1URPA 4EECA 2HFKA 3WJ1A 2G3YA 2W6JD 1EGAA 1ECJA 1ZH6A 2CYCA 2GM9A 3IOCA 1PV4A 1P2TA 1S3SA 2AJ8A 3GLTA 4BUJA 5B12A 5D5QA 3GUYA 3AVVA 5DT9A 5ES4B 1XTQA 4OU4A 1USKA 1U7TA 2IYQA 3SX2A 1QGDA 1Z36A 3PC3A 4LMAA 1TZCA 4IIJB 2C92A 3UMVA 4BAGA 4C7MA 3O8QA 3F67A 5G1PA 1K6EA 4DN6A 1RMYA 4RJJA 3RYCA 1T1RA 5DN6A 4MNTA 4YMIA 5BVHA 1JV2B 1ULUA 1KMHB 4GT1A 3TWOA 1T3TA 4JMPA 4C29A 1QC5A 1XT6A 1Q7GA 3E03A 3IT1A 4J0QA 3GJ6A 4W9RA 4ENPA 3LBIA 3KSZO 3T4XA 4IVQA 3MUOA 3BRQA 1PZEA 2GJSA 3IDSA 1N2BA 4MROA 1CUXA 2HIAA 2I03A 5FUYA 1XJ5A 1ADJA 3ZXXA 5AVUA 5SY4A 2CE2X 1RJEA 2FK7A 2EKQA 4KWTA 1D1TA 4Y8VA 2I1QA 3AC0A 3RTEA 5GJBA 2WMDA 1RLJA 1RMTA 2AD1A 5DPMA 2VAXA 4YGXB 2WPNA 3HWWA 2ZJZA 1D09A 4Q1DA 4IYJA 4QPDA 3BIWA 3IPYA 4TN1A 4PZAA 5AI4A 2W22A 5EPUA 2P4SA 2ZR8A 1ZA2A 5BSVA 1T2VA 4CF3A 2QTAA 1Y6RA 1TJ5A 1XLTA 2LNDA 2W5UA 3HGQA 3GAMA 3KHUA 3QH4A 4MVJA 4NFSA 4RHYA 4ITVA 1M2OA 4D80A 5E3IA 3IEPA 2YIMA 4XYEA 1TCCA 3MC1A 3E5NA 3IESA 2QXYA 3I28A 1O97D 1OI3A 2GEDA 3A36A 4FKMA 3U3KA 3PXBA 5JZVA 3IDFA 2I4IA 2Q3DA 3HRKA 4YAGA 2VH2A 3KOZA 3NTUA 1PS8A 3GBVA 3IMGA 3WSTA 4NEGA 3CT4A 3I04M 1A2KC 4IO1A 2F1HA 4AJ2A 5A0VA 5JVDF 1NBIA 1ODKA 2NVOA 3FTPA 4RKFA 4QGGA 5CX1B 3VX3A 4GZ6A 3WYDA 2GTPA 2RK3A 4ND2A 5AJTA 3OPXA 2VJCA 1YV9A 5H81A 3MS7A 2BDEA 4LNAA 2J30A 4L9WA 3L0CA 1G2IA 2BFAA 2GKSA 2JIZA 1G5HA 2V5AA 3CSUA 1A9YA 3HCDA 4GW3A 4JLKA 1KI9A 1THZA 2DTEA 1O6CA 2IXTA 4K1LA 3ND9A 4BMZA 5AP9A 4ZEVA 2V3CC 3IQGX 2HYDA 4DCMA 1RQXA 1Y1KE 1I1QB 4L3VA 1OXSC 4N9WA 2R6HA 1S4MA 4B74A 1X87A 4N9QA 2FUKA 4JI5B 3L8YA 1SHJA 3BWMA 5LU8A 2WSBA 5JI3E 1AQYA 1YC2A 3H7AA 1RQGA 2EZ8A 3WNQA 4BNXA 1ZM2A 2ZM5A 1YL5A 3JQQA 3ZDAA 4QNNA 1VA5A 1R6UA 2XLBA 3ZW7A 1XCMA 4UTNA 2BMVA 1X94A 2Q5IA 5CUQA 1SCBA 1R00A 1TU3A 3EZ2A 4OXIA 4YRKA 2CFOA 5ELMA 5JMOA 4RZHA 4IZ6A 4WKBA 1JTFA 3S44A 4D4MA 1SRRA 1FPMA 2MSLA 4EEZA 2JHCA 4ROSA 5IH7A 5IKOA 3ZDBA 1I0ZA 2GWHA 3SD7A 4Y6PA 2Z6QA 1RHUA 4EENA 2LR0A 1QVAA 2PUTA 5CDFA 2QM3A 4Y9TA 1ISRA 1K8QA 4KWIA 3T5GA 4E88A 2Q6LA 3FOBA 1AHHA 4R83A 3T0IA 4FCVA 2ONCA 4LHEA 3T9FA 1LY1A 3AR9A 4CLOA 3HU2A 5CT8A 1Z6TA 4EPTA 2IC5A 2WM2A 2HY7A 1HI9A 1RJ9B 4IOMA 2E5FA 2Q41A 2YJGA 4H7KA 3EWNA 2FUCA 2QUKA 1A5BB 2XX3A 4QATA 1ZINA 1XROA 2PPLA 4FHZA 4HRYA 4Q03A 3EDCA 1YZYA 3JZDA 1Z22A 2X1HA 1N5OX 2AQ8A 2PXAA 4H3VA 4WZBA 5DEIA 3H9UA 3RUCA 4BP8A 1ISPA 3DO8A 4UVGA 5H16A 2NADA 4J0IA 6CHYA 4PZLA 5F2NA 3AOEC 5JXWA 3FW1A 1J7JA 1MN6A 3ZNQA 3IEMA 2VBGA 1OVMA 4DTCA 4EG5A 3PPYA 1AK1A 3WB2A 3V8MA 2YQZA 3T9CA 1SCUB 4AW9A 2PL5A 2UU9B 4ZARA 3UFXA 5EHIA 1BDHA 3HB9A 2XVMA 1PNQA 1J8FA 1PFYA 4C6RA 2AOXA 2P2CA 4PR3A 1VCMA 4L5IA 4F5WA 5LJIA 1KJQA 4XDYA 2H5JA 4B0OA 4GPAA 1UKEA 5GONB 4M1YA 1Q92A 3U16A 2RI0A 1XELA 1CQJB 1Y81A 1AQUA 4P5EA 5T4HA 2NIPA 1R4MA 1HT3A 5IBRA 1GKUB 3IXLA 3NBUA 5DLYA 2X76A 4EEKA 3KSBC 2BGIA 1RWNA 2ZE5A 3EA0A 4EVRA 3L1UA 3NBKA 3D8NA 1J1UA 1ZJZA 4P34A 4BGEA 1H2BA 4R54A 2HJRA 2ASVA 4YFYA 2QGNA 3NOXA 1U3GA 1TFRA 1QYVA 221PA 1IN1A 3IHWA 4ZXFA 4P84A 1LLUA 2E4ZA 3WLKX 3WLSA 2Z5GA 1DIRA 3GLHB 2FQWA 2KLHA 3FPHA 4L4YA 4BVGA 2V5UA 3NYWA 2VF8A 3FR7A 4ZOAA 1EVQA 3ESAA 4WCFB 2ZRPA 1JH9A 5DEOA 3T3OA 3RVNA 4W7IA 3W6UA 3LD9A 4RF3A 3HYLA 4JLNA 2OV8A 5DTIA 4AYWA 3AONB 1OI4A 1HRDA 3BSSA 1MAWA 1YD7A 4MCIA 4PSCA 1PKEA 4Y1EA 2JFVA 4LYFA 4ZCSA 2Q1TA 3ZH2A 4JXZA 3H1PA 3RRYA 1V7PC 4DDHA 1M2HA 4ZT6A 3SKXA 1BGWA 3H8WA 2GHTA 3P96A 4LF8B 1XD2B 4OVKA 1V1RA 4IGAA 4JL6A 5BW5A 4HDSB 2JI7A 1D07A 2V7VA 4GD3Q 4RLHA 2EZ9A 5FOSA 3PIIA 1PKXA 4O2AF 4HRAA 5T64A 4ARAA 3MJCA 4BZPA 1BHJA 1XKQA 3DBHA 5JRZA 3LK6A 4OTZA 5IT0A 4L8WB 3UJPA 5KYKA 2Z1NA 3EY4A 5ALJA 1V16B 2OLKA 3ZLTA 1AVTA 4YRBA 4YRJA 1KZ7B 2H11A 3L7AA 1U3DA 3W79A 1KVSA 3MCUA 4DB4A 3EBOA 4GNKA 1U0LA 4Z3OA 1UKCA 2B4YA 2G83A 1ONNA 4INPA 2HNAA 2W6QA 4UTVA 4I46A 1QGED 3Q15C 1MEOA 2WJGA 4I8XA 5IAAA 3RTCA 3KUXA 5JAHA 4Z86A 2DQ4A 2F8MA 2FPPA 3DNFA 4A92A 4ALIA 4OGKA 5B36A 2JAHA 5TJHA 5K20A 2XZOA 4EDFA 3GCGA 1SVOA 1YBMA 3NHRA 3OURA 1A1SA 1QWOA 2RC6A 2W7TA 1JQDA 1JWBB 3NC1C 4FBMA 3E0QA 3C3YA 1NUQA 5HF6A 3CX7A 1F8GA 4JLVA 3RS5A 1Z5NA 1ZQ9A 2DBRA 4L2IB 3ZQUA 1BX3A 5FNVB 4BBJA 4J76A 2PCLA 4UFPA 2PZJA 4R2MA 2E5LB 2Z9CA 3CNOA 1GLGA 4GX0A 1ZNQO 5CHYA 2WIFA 1MPXA 2CF5A 2W9XA 3BSYA 4PYIA 4UHBA 4W9NA 4UQPA 1Q20A 1KF0A 1II0A 2V3WA 1TM3E 3IRUA 5IYZB 1XXHB 3G0HA 3ELWA 3K5WA 3DUFB 3QVLA 4OHRA 1N5RA 3C6BA 1ZU4A 1ORVA 2OORC 1MC8A 4FX2A 2GTIA 4NOLA 3TLGA 5FDFA 3CNHA 1DMSA 1L7DA 1M0TA 1PYGA 1S9DA 4P8RA 4X1IA 2HIMA 1K7FB 3CB2A 4ZO4A 5AOCA 5DTEA 4A0HA 2MU1A 4BQNA 2HPVA 1Z82A 5FLEX 3SQOA 1AA9A 2QNIA 1V9SA 1VC2A 4CCYB 4BZWA 3EEIA 4HH1A 2FZWA 2KYRA 5EAIA 4RTKA 2JLYA 4E5MA 2PXCA 3SHQA 2I99A 3GGCA 4IQ8A 4IUBS 3TG2A 2AVDA 4GWLA 2HCRA 3TAHA 3VGPA 2PD4A 4DIOA 2J0SA 2Q7XA 4LXYA 1J0CA 2OP1A 3KFXA 4L07A 4MS1A 4US1R 2PMWB 2Q29A 1C1DA 3TIXB 4EHNA 4NQRA 3FH0A 3KWMA 1ZS9A 3ENNA 5DGXA 5UKDA 3UK7A 4Z4CA 1ISGA 3EWAA 1XGKA 4TL9A 4C7BA 2P7IA 2JGDB 3DHEA 3GA5A 2P77A 3BGIA 3PPWA 4ZOEA 4CHTA 5MN6A 4JR0A 4OMDA 1FTGA 5JAUA 4KHPB 4LYYA 2P1ZA 5ITZB 4B3JA 2FAXA 3SXUB 4Y1RB 4QVKA 2J1LA 2M1ZA 3P0FA 1DXQA 1QYIA 4J1TA 1VLHA 1W36D 2BEUA 1NMXA 2JIPA 1JPUA 3G02A 5I9SA 1XNJA 2VQ6A 5KYWA 2GAJA 3GCZA 2W8BB 3RE1A 2J9ZB 4YP1A 3VU0A 3I9MA 4F3YA 1IN4A 1H6CA 3B8EA 1RHQA 2FG6C 5CDFE 1W4RA 2R97A 2V74B 3QUAA 4E94A 1N9ZA 4IIHA 1XVUA 2O2CA 3KWLA 1FC0A 3V3TA 4WCDA 4JIGA 2H6EA 1U3CA 4UE3S 2IYVA 4KN9S 4DDWA 4G4IA 3PEVA 1U99A 2FYTA 2XNCA 4MWTA 4QOEA 4Y0NA 4N0DA 3DZHA 3LZCA 1A9QA 4N82A 1KJ8A 3E82A 2COEA 3F6YA 2XQJA 1Q21A 2GN8A 2A59A 4ZOLF 1U2TA 3A6LA 3UK6A 2ILVA 3IMFA 4O3MA 2R1ZA 4HAOA 1KRWA 1OFUA 1T1GA 2ZCUA 3NS7A 5D7NA 3F4LA 1BH2A 1O1YA 1UF9A 2B98A 1TKBA 5B4TA 1EP9A 2AFIA 3SE7A 1DEOA 4DE5A 4PX2A 5KWJA 1M67A 2HLPA 4RVDA 2EERA 4E31A 1KAGA 5AUQA 2YHSA 3ZJ4A 3COWA 3GUZA 2IIVA 1GGHA 1HWYA 2JCYA 4JK3A 2J4FA 1E1RD 4A0QA 2I3GA 3QHPA 4QOFA 4CTJA 5CRIA 2FOLA 1NJ2A 1I3NA 3BREA 1W4CA 5KTSA 4FWTA 1FSZA 3HA5A 4B3SB 1Q22A 2X2FA 1G6KA 3LKVA 4P4TA 3SR0A 1Z7BA 2H7XA 2Q07A 2ZUDA 3TLZA 3CUVA 1ZK4A 3Q1LA 3WJAA 5F64A 4MQLA 2QDKA 5J2TF 1YB4A 1D03A 3NHBA 5KU1A 2XBMA 2QZ9A 5G3ZA 1PJTA 1LQUA 3WGOA 3OD5A 4Q9DA 1PT8A 3NZEA 1F4VA 4KBYA 1K6JA 1M3SA 1R27A 3T9DA 2P90A 3T06B 1LLCA 4BBZA 4OBEA 5I7EA 2FEKA 3RV3A 1RC1A 3AR4A 4YJHA 4KPFC 1NHWA 1XP8A 1RFLA 1ULBA 3QYPA 3FPFA 4A73A 1WV0A 3BTOA 3TSAA 2FR1A 3T7IA 2B6HA 3V33A 5BSEA 3SBOA 3R9XB 3JTMA 3WLHA 3WSWA 4QJ3A 1QCZA 1RCUA 3EQ6A 4PC6A 1BXZA 4LHVA 4FC7A 3ONFA 4NP6A 1Z6QA 4UUAA 4ZCTA 4DMUB 2P9TA 3QEJA 2AMLA 1S3IA 3WRXA 2CK3A 4B71A 1ODCA 4DYHA 1N5DA 2VHXA 1FJHA 1H2AS 4GZ5A 1SCKA 1O7JA 3EXFA 3RWBA 3IURA 4UPEA 2J3DA 4I4CA 4J4BA 1X1AA 4WNAA 2EG5A 5FIUA 3KT8A 3O8NA 2C99A 1B14A 2BM8A 3QF4B 1D0SA 3PXUA 3CZMA 4WFKA 2BELA 3WZMA 2HWKA 4O2BF 1W0CA 4RYLA 2NU9B 3CVUA 2LKDA 4LJ6A 4HYQA 5KEIA 3KQHA 1JIXA 4COKA 2B9VA 2XTMA 1YQ9A 2CNLA 3LLMA 3D6VA 3CWQA 3OQ6A 4RKEA 2C4MA 5IAJA 2YFYA 5KNCH 2HNBA 2QL9A 1OQAA 3CF4A 1PFWA 1PK9A 1VE5A 3G3EA 5C9ZA 3JQGB 2G1AA 2VJBA 2XA2A 4J7CA 5T5QA 3A4MA 3CH4B 1AGYA 3LWDA 4L74A 2B9EA 4OUKX 1A9RA 1Q3KA 1EFVA 1JFLA 2PGAA 2V7XA 1ZXXA 1ESEA 2B35A 4ZEMA 2PJZA 5AVOA 2I4LA 1C3OB 4C0JA 1O94C 1LTKA 1TL7C 2AE2A 1HDYA 2GYUA 2DZDA 2EJCA 3BQMB 4KGXA 4RPGA 1VCNA 3QUSA 1KTVA 2FFRA 2AIRA 2EDCA 3UWPA 4DSZA 3ELDA 4EKIA 3DPIA 2YINC 1RZRA 4BX8A 1CRZA 2HGSA 2ZYRA 2Y67A 3CTPA 3LHKA 1SUCA 5AKGA 5KJ1A 2JK0A 2AKEA 1VL5A 4POAA 5J1TB 2WA1A 2BW0A 3QLUA 4G3XA 3SY8A 4D6XA 5EWMA 2X86A 3H16A 4HXGA 5EKTA 3ZWVA 3ZGZA 4LWQA 3PXDA 5T3YA 1C4KA 1OH5A 2NP6A 1TZKA 3WKCA 4WFIA 2VK1A 3UJ6A 1B73A 1OLUA 4HS9A 2RE8A 3K2QA 2ZAMA 3H2HA 3BF8A 2XUJA 3KB2A 1XU9A 1SCQA 3QUCA 1XZMA 4Q19A 2ZUWA 4U8HA 2OA0A 4YUXA 4NYJQ 3NXKA 5F78A 4EELA 5K8LA 2GR9A 5JS7A 1YFKA 4DWVA 1N1EA 5BUSA 1JX6A 4FYMA 1U3VA 5AW7A 5C18A 3D2AA 3G7NA 2BN4A 4EKGA 4S0XA 3KJIA 1DJLA 3V9AA 3MK31 1V5GA 4G4GA 3ZYZA 1H9CA 1MQSA 4WLVA 2WV9A 3KL2A 4E2ZA 1YDMA 2JAOA 2N75A 1G59A 1RQNA 5FBHA 4UHCA 2EFHB 5FUMA 3ZIAA 3EQ7A 3P0HA 5AVYA 4FPXA 4UM8B 1O58A 4E11A 4DDTA 3QXXA 3PL1A 4LBYA 4BY9E 4QXMA 2NZUG 5LNK6 4IH9A 2AK3A 3V7UA 3AYZB 6ADHA 4C4TA 1Z63A 4MVXA 3R3SA 1A4XA 1CZNA 2VHZA 2WJPA 4LHXA 1RZUA 1NNI1 1ONBA 1TJYA 3PHGA 3N8KA 3PFCA 4ENSA 4CKZA 4F4DA 1SB9A 2DFNA 2PNJA 4AQDA 1FFEA 6GPBA 2C1EA 3GYGA 1TO2E 3QG5A 4FD2A 5KNDD 3L6RA 4PLCA 2OO5A 3EIFA 4NYJR 1RBYA 2IZ6A 3C14C 3GVXA 3GLSA 3II6X 5LSAA 4R2HA 5E2BA 2ONJA 2IQ5A 5JNRA 1KFEB 1DXOA 1S2LA 4F5YA 1FQJA 2X15A 1A3CA 3AWIA 3ITNA 4IRUB 5PGMA 3GHYA 3KHTA 4TLDA 4CQMD 3T7DA 1GZ3A 16PKA 3SEZA 3K30A 3F9RA 4RYDA 3W2IA 4B4KA 1WZNA 2BEKA 5IDYA 1JE0A 1ODLA 3JVUA 3LYHA 4P0TA 1UZMA 1H2ZA 3EODA 2XHZA 5AJUA 5I7UA 5KSWB 4LTMA 4EW6A 1ZGCA 1N8TA 1UBHS 2H9IA 1QHEA 3M6XA 1M2EA 3AP3A 3H4IA 3G2KA 4NBLA 5JCJD 1C9JA 1IM5A 4GKBA 2A9VA 4EH1A 3S27A 1RAIA 4F21A 3QKUA 4JJZA 4M98A 3FMVA 3S40A 2HDOA 2IXFA 2PX5A 4BVJA 4RD4A 1PK7A 1JXMA 3DOIA 4RM3A 1J8YF 1G21B 4PAMA 4UEOA 2BKLA 1J70A 1NOJA 5LL6P 1DAEA 1T4GA 3ELUA 4CDNA 4BWGA 4BUZA 2ZJ2A 2H1OA 5EERA 3CUYA 5JCPA 1DJPA 4UM7A 4AURA 2J5RA 1Z6XA 4DJDC 1ZDMA 5KX5B 1NBMA 3PJDA 3TINA 2NU7A 3AHFA 3ZWBA 2QSUA 1CZHA 1GZSA 4HB3A 4C2TA 2B82A 1CDEA 2SKDA 2E48A 1A9OA 2WHYA 1W85A 5EGSA 4DCSA 1C7QA 3REGA 1BRMA 4AJ9A 5I8PA 1NRIA 3DMDA 4GQIA 3H5WA 1EH5A 2Q27A 4M9XA 5ARDA 1C0LA 2IYZA 3O21A 1SB8A 1E0JA 1RLTA 3HC7A 4HZIA 2X22A 4AQ7A 1LWNA 1TO1E 2G88A 3HLKA 4NV3A 3F6SA 3H5TA 2HWXA 5AJZA 1K8ZB 4FYXA 2O3RA 4UBLA 2E7ZA 3QVGA 4HB0A 2GDZA 1DV2A 4BU0A 1ZN7A 2WFZA 5EE0A 1W88A 4HUTA 5AVKA 4Y2SA 2AB0A 1NR7A 4LBWA 3C3XA 4GPZA 5CGZA 3KNZA 3ZTTA 2VIIA 2UUBB 2Z2JA 3QKSB 2O8FB 5DSXA 3CLRC 1TU0A 2ZI4A 2EP5A 4PQRA 4Y2QA 3THOA 3KR2A 3IQXA 5CPBA 1WUJS 1OT3A 5HNKA 3H18A 1CRWG 1NONA 1CF2O 3BHMA 4DPLA 3OMXA 5CVTA 1JH8A 3EXHC 2Z6VA 3AERB 1P29A 2ECQA 1IJFA 1TAHA 1EZ1A 3AXSA 4E14A 5EIOA 4UFOA 2I1WA 4Z99A 2DSNA 3VUFA 4KO3S 1IHXA 1U04A 2PSHA 3FNHA 4HAZA 4X92A 3VO1A 5K03A 4RFSA 4KPEC 2GD2A 3UGJA 2QTBA 5KVAA 1M0WA 1XTZA 2ZTMA 4KEAA 3WQSB 3NTQA 4B7ZA 1DZ3A 1SUDA 3WK6A 1UXIA 1QHGA 3TOCA 4RK7A 2CXUA 4RAOA 2SNIE 1KI6B 1FMCA 3SZLA 1HUQA 2FLVA 1ZMTA 3QOXA 4D4LA 1MDBA 4Z9AA 5BVGA 1KNXA 2AR7A 1QH0A 4JVOA 4LF9B 5LC1A 1FSPA 1WE2A 4G67A 5EKUA 3ZJUA 5IVIA 3QKRA 1B6GA 2H00A 1ATZA 2VBIA 3HJRA 1BG6A 1NU6A 1RWMA 2WU0A 3IBYA 3IP9A 3GUVA 4K87A 2BCEA 2ZUVA 2ZB4A 3IIKA 1IB6A 5DW3A 4ENUA 2JLCA 4ZFNA 1Z6ZA 1LU9A 5CG1A 4NDZA 3GJSA 3B3QA 4L95C 4DQKA 4EITA 1NDUA 1O95D 1BWQA 1ECCA 4DOMA 1MEEA 1J8MF 4PGFA 4X24A 2C3UA 3EF0A 3IPRA 4C78A 3GVCA 4HP8A 2JJ8A 2CYAA 3H0EA 4G5GA 4K6CA 5AKLA 3B89A 1H2WA 1S1MA 4B3RB 3NHYA 1QLWA 5BSMA 3Q7PA 1W96A 3SIPA 4UU8A 4G26A 1IN7A 1YCDA 2YV5A 3RC9A 4DAOA 4ZHQA 3SFZA 1RI4A 4ZDJA 3ZV6A 2AYZA 1SWWA 1JR3A 3LC0A 4AY2A 4I9HA 4R2JA 1U63A 4WPGA 5F21A 3M5WA 5HYVA