4CQLA

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
257
structure length
246
Chain Sequence
LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
total genus 85
structure length 246
sequence length 257
chains with identical sequence D, E, H, I, L, M, P
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqlA00
1WXDA 1X1TA 5TIIA 2HRZA 4NU5A 3JQ9C 1EDOA 1YB4A 1PGPA 2NVUA 2P4HX 5IAAA 3HDQA 3DQPA 4XZ3A 3WQQA 1PL7A 3DC2A 2NQTA 3QJ5A 4XGKA 3SX2A 2WE8A 3FPCA 1Q7BA 4D44A 4U7WA 1U4OA 3KETA 4F45A 4IJWA 2PD3A 2UAGA 4NU6A 3UVEA 3O9ZA 3V5NA 2AMFA 4BO2A 1HYGA 3I9OA 4ZRMA 4GMFA 5HRUA 3PFFA 4XYGA 4L8VA 3RC9A 5JC8A 2PZLA 3A28A 3E03A 4I5GA 4GVLA 1IPEA 5HM8A 2JCVA 3DFZA 4ND2A 2Q4BA 2POQX 3PEFA 4XYMA 1S7CA 3E9QA 2OMEA 3OECA 5EIOA 4M1QA 2I67A 3PYMA 2VOEA 5C37A 2GN8A 3NX4A 4MPDA 2FWMX 1EFLA 2CFCA 3D5TA 1HETA 3RJ5A 1EK6A 1AHIA 5JAMA 2QZZA 3WLFA 5C7LO 3RC2A 4RJTA 3O38A 2OP0A 1YDEA 2FSVA 2V6MA 5FWNA 1ISGA 1PS8A 1CDOA 3GN2A 1PJQA 2VWHA 1UUFA 2VHYA 3ZWPA 1D3AA 1PR3A 4R51A 5DNAA 2RHCA 1GZ4A 4DXHA 1HLDA 2DAPA 1H6DA 2WSBA 2VYVA 3UAGA 3WFJA 4L4SA 4ALMA 4MKZA 4R69A 3DAFA 2W2LA 2X5JO 4BNNA 1UXHA 3QIVA 4INAA 5BSEA 2YHIB 1EVIA 1L1FA 1E3JA 2YV1A 2FPGA 2V6BA 5A3VA 3DEYX 3H4VA 5JCXA 2NU7A 5BSGA 3E8XA 5KJ1A 3PWKA 4D46A 3HADA 2HLPA 2PH5A 2RBEA 3EW7A 3UKOA 1H2BA 9LDTA 4BNMA 3ZWBA 1NQTA 1B3RA 1B0AA 2D5AA 4RPJA 3C24A 1R37A 3GGOA 3MZ0A 4OOFA 4TQGA 1XG5A 1LDNA 2BGKA 3VDQA 3PJDA 2VRCA 4A27A 1DIGA 3KRTA 3DZKA 4J9UE 4R41A 1H2HA 2Q2WA 1E7MA 3F3SA 1VKOA 2IYOA 1LUAA 1YB5A 2AHRA 3KYDA 4CR7A 2O3QA 3D3EA 3JQFC 1ZK0A 3NDIA 4Y9DA 3W8DA 2D3TA 3CZMA 3TZQA 3AM4A 4CQMA 1WWKA 1GADO 5TX7A 3TFQA 1GZ3A 3GDOA 3A4VA 1GCOA 1IHYA 2EW2A 4PZCA 4YB8A 5H83A 1MG5A 3WJ7A 2CVZA 2I9PA 4GBJA 4D42A 4OOEA 2OUIA 3ONEA 4GLOA 3I9LA 1NHWA 3OA0A 4KZPA 2Y1FA 4IMPA 4GI2A 4CLOB 2WMDA 1C1XB 4BUCA 3CINA 1NVGA 3WIDA 2AEJA 4PN3A 3C1OA 1ENOA 5JDIA 1Y7TA 4G5HA 4HWKA 1D1SA 1JWAB 4EUHA 2JAHA 3ONFA 3IS3A 3PZRA 3FNEA 2IRWA 1WZEA 3HNPA 4IJKA 3F47A 3E82A 4LMPA 4EEZA 2YYYA 4AJ1A 4QO8A 2GGSA 3FD8A 1ZIDA 3ZWVA 1MC4A 5IG2A 3AOEC 2YJZA 5JMWA 1MP0A 3TZCA 3VH1A 4CL3A 4IXTA 1YQXA 1PR9A 4XGNA 3KYCA 3NTOA 2X5OA 4RPKA 2A35A 1TT7A 4D3DA 5LDHA 1TI7A 4IQ0A 3JQCA 4F6LA 1I8TA 2OBYA 3H9JA 2A94A 1ZSYA 2J3IA 1GFSA 1NM5A 2SCUA 3W1VA 4EITA 1E1LA 3Q2KA 2NU8A 3GGGA 5ADHA 1IYZA 2B4TO 2IDZA 3WX0A 2ET6A 2GF2A 4YDRA 4ZD6A 5C5IA 3OIGA 5I9MA 4OL9A 3WTBA 1E3EA 1GUZA 1H94A 4CQLA 3D1LA 1UXGA 2QZ9A 1HDGO 4GVXA 3LSYA 1VKNA 1GTMA 2R00C 5AVOA 3GC6A 4ZN6A 2Y1CA 3ULKA 1YS4A 1LRJA 4AL4A 1UZLA 1X0XA 3MTJA 4KTTE 4W82A 5A9RA 3P2OA 1NFQA 3LZ6A 2FSSA 4L73A 3QV1A 4P4LA 3FR7A 4BHTA 1HDOA 3I5MA 3D4NA 4A73A 1MC5A 1D1TA 2Q1UA 4IMRA 3T7EA 1JVSA 4LSMA 2ZCVA 3WWZA 5MDHA 5EN4A 1LJ8A 5K6AC 1F14A 2D1YA 1NAHA 4TKLA 4XWYA 3K31A 4BGEA 4CLXA 5L40A 1P74A 4KUHA 4EZBA 3LU1A 5C7IO 3EZYA 2FP4A 1P1RA 4EI2A 4K28A 3V2HA 4CODB 3QVXA 3GZNA 4OIMA 3T4XA 3MJEA 1PWXA 4XB2A 1M66A 3ETDA 3PZBA 4B3IA 2E6UX 5T6BA 5A03A 4WCDA 2DBVO 3E1KA 4Y6PA 3PIDA 5HBRA 4CM3A 3UICA 5IN4A 3M2TA 2WYVA 4GSLA 5F21A 1QLHA 3ZWNA 2WD7B 4IINA 4M55A 4LK3A 4E32A 1I33A 2DLDA 2AE2A 3DL2A 1YL5A 1GQYA 4E2ZA 4QQRA 1EUZA 3IMFA 1A9ZA 2W8ZA 4CQMB 4FN4A 4PG7A 3JD3A 3LLSA 3K96A 3VZSA 3BMNB 2UUPA 3RUEA 1KVUA 1VM6A 3WWYA 1PJ2A 4GX5A 2W2LD 1Z6ZA 4CJXA 1NAIA 3SC6A 4CM4A 3PHJA 4I08A 2FY8A 3GUCA 1C1XA 4J4TA 4DUPA 3NTQA 3AFNA 1YBMA 5TNXA 4IS2A 3VPHA 2XXJA 3TZKA 1E0DA 4IQGA 2DKNA 4N18A 1ID1A 1U2DA 1I2ZA 1R6DA 5ENDA 3FTNA 2FZWA 5B4VA 2NLOA 3KB6A 3AUSA 4BNKA 1VI2A 4KUGA 2IXAA 4L4RA 1YXMA 3F46A 1EVYA 4IJUA 4RVUA 3V1TC 3IUSA 4CMJA 4FDAA 3W8FA 4KWHA 1LLUA 3U0BA 2VRCD 4GGOA 3MOIA 2YY7A 4XIYA 4C7KA 3GFBA 5KTKA 3C7AA 2VWPA 2VWGA 2H63A 3HFGA 4R54A 1GAEO 3GUYA 3R3SA 3DONA 1T2DA 1SC6A 4P4NA 1I10A 3VTFA 4CPDA 1XHLA 4HFNA 5DP2A 1E3SA 4KUEA 3RUCA 5G2OA 3OHSX 1U28A 1ZSNA 3PGJA 3DBLB 4PIVA 2ZTLA 2HMSA 1P33A 4BS9A 4N7RA 1O89A 2VWQA 2PZKA 5JE8A 1PJTA 1N1GA 5DT9A 1P3DA 3BA1A 5JSFA 1OC2A 1LX6A 1QG6A 3CMMA 3IP1A 2DBRA 3BTUA 4RPGA 4YPOA 2EGHA 5JDCC 2EXXA 4GWKA 2PY6A 4E6PA 4BNGA 3Q3CA 3HUDA 1A71A 3I1JA 2Q2QA 4QUKA 4D7AA 1IB6A 1RM5A 5IFLA 4DIOA 3HG7A 2VT2A 2JL1A 2O3TA 3FSRA 1BVRA 4BO4A 3UOGA 1Q0HA 1MV8A 3H2ZA 3PJEA 4ALIA 4WCFB 1LRLA 2Q45A 4CQMD 1TVEA 1NQ5A 2PK3A 3FHLA 2X9GA 3OEWA 4OMUA 2BHLA 1GQ2A 1VSUA 1ZEMA 3ROPA 3HWRA 4HP8A 1ZMTA 3IC5A 4CLHA 3DZIA 2ZCUA 1XEAA 1BXZA 1P1FA 1JTVA 2E4AA 2PGDA 5JDCA 4TVOA 2FN7A 5B1YA 3JD1A 3OEYA 3O8QA 4ZU3A 2X6TA 3RI3A 1K3TA 5HS6A 3D64A 2W90A 4HFRA 2P9CA 1LLQA 3KYDB 3AFMA 4IIUA 5JXWA 1ADCA 3M2PA 4JJIA 5FFFA 2VZ9A 1T24A 3KM0A 2J8ZA 3K5PA 4OQYA 2Z5LA 4R1NA 4D0RA 1WVGA 1F17A 1YQDA 3O03A 3DTTA 1I01A 3ZV5A 2DPGA 1Y5MA 4ILKA 3RFXA 2BFOA 3HDHA 1ENZA 1HYHA 1DJQA 1T26A 3FRJA 1GDHA 1U3TA 3QHAA 4Y6RA 4H7PA 1U8XX 1V0JA 4DL9A 2EV9A 3TOZA 2IEBA 2G1UA 3DZGA 4I8XA 3QY9A 4Z0PA 1AE1A 3E18A 1EQUA 4GAEA 2PKQP 3Q9UA 4IGFA 5F1OA 3RASA 3TRIA 1NVTA 2EIHA 5K9ZA 2QRKA 4W99A 5U1PA 2PGJA 2HMTA 3W6UA 3JQDA 3ZWYA 1X7HA 4WK6A 3SC4A 1YGYA 2DFVA 4N5MA 4EYEA 3SEFA 3M1LA 2HUNA 5CPBA 3GMSA 4BNUA 3ICPA 3MJTA 1E6EA 3LT2A 3KZVA 2O48X 4J0EA 5U4QA 1WZIA 2I6TA 4RZHA 5G4KA 3FWZA 1FDUA 4RF4A 3DBRA 4TRNA 3NGLA 4IY1A 3V8BA 2NVBA 2P5YA 2P91A 4MVJA 1KEWA 3OQ1A 3EVTA 3GOHA 1H0KA 1H6CA 3QWIA 4MVJE 2HMWA 1KY5A 4XX0A 1Q0LA 4NIMA 4JBGA 3QW2A 3RFVA 3TSCA 2CVOA 3WMXA 1KVSA 3IP3A 3VC7A 4XB1A 3CEAA 1EQ2A 4D43A 4RVFA 4U6QA 4C4OA 2BD0A 3BMOB 3PWSA 3GNQA 1PQUA 3UCEA 2I99A 2CNBA 4PLHA 4BO8A 4RV9A 4MP8A 2CF6A 1DBVO 5T8KA 1NFRA 4ZQGA 2YDYA 2GZ3A 3DXFA 4M54A 3P19A 4DPKA 1VL8A 3WGIA 1OOEA 3V1UA 4NFYA 3ZV3A 3UGKA 2G0TA 3GZNB 3GVIA 3KSUA 4LRSB 4CLEA 1YJQA 3ZWMA 3VH2A 5G0TA 1QSGA 1MLDA 2NVWA 1P1KA 3C1AA 2C82A 2I66A 5B4UA 4PVCA 2HJRA 1PZFA 2G5CA 1WAMA 3UCFA 3NDJA 4I5EA 2B37A 2NVUB 4Q3BA 2GYYA 5BNTA 2ZIZA 1KEVA 1WDLA 3AUUA 4UUPA 2GN6A 1IY8A 2WTBA 3NGXA 3ZW8A 1E5LA 1I3KA 1ENPA 2AG8A 3EY4A 1HT0A 5BQFA 2Y67A 2CVQA 3DBHA 4AJEA 4IZIA 2JJYA 4JN6B 5TJ9A 3B70A 4PLGA 2UV8A 3U09A 1R0SA 3VKVA 1HLPA 4K1LA 2QHXA 5T57A 4J43A 1YDWA 2Y0DA 3D3WA 3HE3A 4UVGA 3I4CA 4CQLB 1CQIA 5CHEA 3JQBA 3TF5A 3GN1A 5LDGA 2Y1EA 4MVJG 4TWRA 1GYPA 3EVNA 3AM5A 4F46A 1SCUA 5BSFA 1DIAA 1BXGB 4IPTA 1LTHR 3KEOA 1W4ZA 5COAA 1PZHA 3HJAA 4BOYA 1MFZA 4MDHA 1KEUA 2LDXA 2GZ1A 3RKUA 3ZNQA 1IULA 1R0LA 3EUWA 1C0PA 5KIAA 4L76A 1UJMA 3P5SA 1V9LA 4LVCA 3W4KA 4ZHSA 5ILGA 4QEDA 3KSDO 1R4MB 3EAGA 4OHUA 4J16A 1HTBA 1ENYA 1PS0A 3AI1A 4GLLA 5L7WA 1Q7CA 1XCBA 1QYXA 4PZEA 1DAPA 4W7IA 5KKAA 1C0IA 2NSDA 4CMAA 4RQTA 3H65A 3S2GA 4CLOA 2DTEA 4MVJF 2EP7A 3MJVA 2FOIA 5IDWA 4PGFA 4MKXA 1C3VA 4XA8A 1LRKA 1HDXA 2Q1WA 2GERA 3F6YA 5GZ3A 3NV9A 1VJ1A 1B15A 1ZSVA 3F5QA 3JCZA 4CM5A 3VH3A 4HFMA 3ICCA 4W4TA 1IE3A 2C20A 4R68A 1YRLA 3IJPA 4JIGA 1XYGA 5KVQA 1KEPA 3WTCA 3KXDA 3IDSA 4E5YA 3LQFA 1ISJA 2R6JA 2P9GA 1F8GA 3D7LA 4XQCA 2R2GA 4JX8A 4ZJUA 1GUYA 1N7GA 2IEDA 5EINA 3G17A 3LT1A 5I7SA 1JU9A 1EUDA 1NWCA 3K92A 2EKQA 1LDBA 4DQUA 5LCXA 4K6CA 1U3UA 3H3JA 5G0UA 4FJ0A 1LC3A 3UXYA 4G65A 1H93A 3ZW9A 1PL6A 4BV9A 1PL8A 3GF4A 3NT2A 4IZHA 4J4BA 3CTMA 4RDIA 1BW9B 2FR0A 1CERA 3VHRA 4AFNA 3H5AA 1HZZA 3ZWXA 4YWJA 4LCJA 4B3JA 4J49A 3WGGA 5CDTA 3P7MA 3M6IA 4UAGA 4L0QA 3RROA 3U4CA 4MVJD 5IDYA 1ONPA 2BFAA 3GVCA 5KVVA 3KVOA 1I0ZA 4MP6A 1X7DA 1ZK2A 1BSVA 2C2YA 2Q2VA 5L9AA 3DMTC 2C54A 4NMHA 2OORA 1KC3A 4RF5A 4XQGA 2ZYDA 3FBTA 3OM9A 1KERA 1WNTA 1DJNA 1ZK4A 3E48A 3GVPA 1NXQA 5ENVA 3IKTA 2QRJA 2NM0A 3I52A 4IBOA 2B35A 1P77A 2FPIA 2OBNA 4KQWA 1NPYA 5DBIA 1PZEA 1H5QA 3P2YA 1J4AA 3RBVA 5CFZA 3WICA 2V65A 4A5OA 4L74A 3L4BC 3L4SO 1Z73A 1QYCA 2FPPA 4J0FA 5F1KA 5I8ZA 2B69A 2PLAA 3I23A 4R3NA 5ICMA 3L6EA 1JWBB 4BO6A 1E7YA 2B4QA 3JQGA 4YJGA 3WGZA 3A9WA 3E5MA 5JO9A 1KOLA 4KP7A 1N1EA 5JCJA 1TXGA 3F9IA 2Y99A 2B5VA 2D8AA 2Y0EA 3UW3A 1LDGA 1AHHA 3DHNA 2WWRA 3BXXA 5DULA 2G82A 3G79A 1FDTA 2ZTVA 4YTEA 2P4QA 5FI3A 2ZK7A 1U9JA 1B16A 3FBGA 4FFMA 5JYDA 4OM8A 4BNFA 1PWZA 3PVZA 4GX1A 1B14A 2HMVA 4BMSA 2GPTA 4MIEA 2QIOA 4IDCA 4UREA 3OFSA 1BG6A 1MA0A 4YAEA 2ZB8A 2YHIA 4O1MA 4R01A 1KVQA 4E5NA 5DCWA 4TSKA 4E5MA 3CH6A 2ZB7A 4FBGA 5TT0A 3ZV4A 1PTJA 1I24A 2WE7A 2EJWA 1UXIA 1B8PA 3KLMX 2C59A 1VJTA 1WDMA 2VHVA 3KEQA 4A10A 2OFPA 3C8MA 3EHEA 4OO3A 3OICA 4XEHA 1ZXLA 3GVHA 1NQAO 5COBA 5DF1A 4RF3A 5CDYA 1T2FA 1G6KA 5BNFA 1DRUA 2DC1A 3ZI0A 4Z6KA 3N74A 4HXYA 4R1TA 2B4RO 2X86A 4AJPA 4FFPA 3V2GA 3PXXA 2RH4A 2A4KA 2DTDA 4J1SA 3Q0EA 1DPGA 2JCYA 2D5CA 3CIFA 3QA9A 4DYVA 4CLRA 5TGDA 1R12A 5KCZA 1GPDG 5K6AA 1V3UA 2ZB3A 1U3VA 2G17A 4CMHA 3DOCA 1QYWA 3H9UA 3HN2A 1YBAA 3FN4A 4XRRA 3Q2IA 5THQA 4OJNA 2NACA 4B4VA 2O2SA 4WLNA 1X14A 3PLNA 5BR7A 4AJHA 4NH4A 5DCYA 5FYDA 1I5RA 5L4LA 1E92A 1E3IA 5JC1A 3OH8A 5HA5A 1JKJA 1O9BA 4GMGA 2ZTMA 3U4HA 4FOOA 1ZFNA 3NKLA 4MJLA 3PK0A 3ZN2A 3FR8A 1H9BA 4E30A 1E1MA 4CMCA 3NRCA 4LMRA 3GY0A 2OHXA 2HRBA 4Q3CA 4S3MA 1Y1PA 3F5SA 4NNJA 1DHTA 4YJFA 1B8UA 5JAIA 7ADHA 3OQ6A 3LLVA 1J5PA 1MG0A 1ML3A 1Y81A 4BNIA 2J6IA 1L7DA 1E5QA 2CDAA 1W73A 3ZHXA 2F1KA 2FR8A 2YV3A 4NPCA 1EUCA 4NZ9A 1OC4A 4HADA 2RCYA 1QR6A 3ZV6A 2I65A 4XQ9A 4JCOA 3RJ9A 3BMOA 3L0DA 4Q3NA 3WGYA 3R6DA 2O3RA 2GCGA 3WGQA 1KYQA 7MDHA 4J1NA 4D3SA 1K6IA 1ZBQA 3TFOA 1ARZA 4ROSA 3DZHA 1Y6JA 4BNVA 1A4IA 1ISFA 2IXBA 5A9TA 3NT5A 2HO5A 4CMIA 2ZQZA 2Y66A 3JYOA 4BNZA 1UXJA 3WXBA 4WECA 1FXSA 1DEHA 3JQAB 4KWIA 3KSZO 5ILOA 8ADHA 2H5LA 4WNIA 1ZJYA 1HE3A 2Q99A 3FPLA 3VZRA 4Y67A 3PDUA 2C7GA 3GQVA 3GDGA 4Z9FA 1UAGA 3OIFA 4DREA 1P9LA 2BFMA 2X5KO 1U8FO 2XAAA 4L75A 5AXCA 3SLGA 4TVBA 4UVIA 2GNAA 3GZ4A 3DBRB 1M6WA 1QKIA 3TL3A 1ZK3A 4UEJA 1DIRA 1YVEI 4YRDA 3KHUA 5CDSA 4QT0A 4ALJA 3SVTA 2HK9A 2VQ3A 3VTZA 4RPHA 1N5DA 3ROMA 3MJ4A 4LGVA 2EWMA 4RLSA 3LDHA 1LQUA 3Q9NA 5F5LA 2Y1DA 3UCXA 4ND4A 1JVBA 1PX0A 4NBVA 3VZPA 5L4NA 4O6VA 3LT0A 1EZ4A 1GY8A 4IIVA 4TRRA 5I9NA 2GZ2A 3JQ9A 3CE6A 5KOIA 2DUWA 4TKMA 1NWHA 2H6EA 3LT4A 4CR6A 4M86A 2ZB4A 3OJEA 3SXPA 2XPCA 1LEHA 5IF3A 4E5KA 4KQXA 3L4BA 3ZU3A 1CWUA 4U5QA 4YT2A 3COSA 3VAZA 3PLRA 1YONA 2BI7A 4BKQA 1XGKA 3WYBA 1ISHA 4PLFA 1G0NA 2RH8A 2VOJA 2NTNA 2C5AA 3ABIA 3N7UA 3NT4A 4LRTB 4ND5A 3JQGB 4YJGB 2DPHA 2WDZA 3WBBA 5IJZA 2Q1SA 1MFPA 2ZJ1A 1W6UA 1DFGA 2PKRA 2Q3EA 4I5DA 1K5HA 3R0IA 3WGTA 1JKFA 3ZWCA 4AJJA 5JAZA 4II2A 1IPFA 4YRBA 3FCOA 1A5ZA 4Q9NA 1R15A 3O8QB 4PG8A 4NBRA 2JFHA 4B4UA 3B1JA 4CM8A 5A04A 2YHUA 4XGIA 1BRMA 2EG9A 4RVSA 3TWOA 4UVDA 2NWQA 2E48A 3VDRA 3ADOA 2RHRA 1LDEA 5TF4A 1TLTA 5KJFA 3AK4A 5DBGA 3TL2A 1IL0A 3I3OA 3NEPX 1LLDA 1X15A 2ZTUA 2RIRA 1IHXA 4B7XA 4UVEA 1F06A 1EBUA 4XR4A 3UN1A 5JO0A 2O3JA 4GX2A 2H1SA 3VKUA 5GY7A 4EUEA 1K2WA 4ZVVA 4N5LA 2CY0A 2JFFA 1JAXA 1Q0QA 4U0JA 3DAPA 4OKIA 3HDJA 4Z9XA 3CPSA 5KJCA 4I5FA 4B4WA 4Z0HO 1ZUD1 1JDJA 3W8EA 4NHEA 5CEEA 1QRRA 2P9EA 4UEOA 4BL5A 3GVXA 2YW9A 1YH3A 1LC0A 1DB3A 4YAJA 3BMQB 1AN9A 4CV3A 3W6ZA 3OIDA 2EGGA 2FHSA 3DBLA 4E33A 1RPNA 4Q3AA 2DT5A 1T1RA 3S2EA 2DQ4A 4BO7A 1NR1A 4EDFA 3ADPA 3EGOA 4R3WA 3ROKA 4OKNA 3PRJA 4PLWA 3A14A 2IZ1A 1PIWA 2W2KA 1KVTA 3GFGA 4LSWA 2VZ0A 1HXHA 3ASVA 2O23A 4B4OA 3ZWWA 1ORRA 2NADA 2I5PO 4BO0A 4WLUA 3ZNPA 4DQVA 2E49A 4XJTA 1C0LA 2BLLA 3FF4A 2CDBA 1K89A 2IZZA 5JPIA 3WNQA 5A4DA 4EJMA 1LSJA 2J5RA 3JQBC 2UYYA 1QXSA 4B8WA 3H3FA 3MOGA 3U4IA 2PZMA 4PRLA 5BNIA 5JYEA 5EJ2A 3T4EA 2PTGA 3OJ0A 1HKUA 3VPFA 4RZIA 3AOEA 1NQOA 1PGNA 1UAYA 1Z45A 1MXHA 3E5RA 1MXFA 4PFJA 4UULA 4DBVO 1CF2O 3AWDA 4FB5A 1KS9A 4NK5A 4YA6A 4Y8VA 1VSVA 2X58A 1E77A 2C2XA 3GK3A 3H5RA 5DOZA 3IUPA 1RM3A 1O0SA 2X1HA 3JD2A 4NG5A 5ER6A 3ZWAA 5THKA 4DC1A 4K9DA 3AW9A 1E1NA 1ZNQO 2D0IA 4XYLA 3LVFO 3WIEA 2HK8A 5KWEA 2AEFA 1JAYA 4JNKA 1LQTA 4O63O 3T7CA 2WD7A 4FGSA 3FNHA 2D4AA 4P4GA 4J90A 1T2CA 2GRAA 3LC1O 1KY4A 3UHAA 2BFPA 4OH1A 3LYLA 3OBBA 5T67A 4ZGWA 1M2WA 4B79A 4YACA 1YL7A 3ZHYA 4DGSA 1OZAA 1ZVMA 3WR5A 1H9AA 3BHMA 1QV7A 3BMCA 5KNLA 2O7QA 3G1TA 3U4DA 3AY3A 3JYQA 3ASUA 5F1PA 1ONNA 1O95A 3JQAA 3RUHA 2BF7A 3BHJA 3MJCA 2FZEA 4HX5A 4ZRNA 4YCAA 2V6GA 3AUTA 3WYEA 1UXKA 3A1NA 2X0RA 4Y6SA 1DC6A 1OAAA 3ZNOA 5IZCA 3WSWA 2IODA 1HF3A 3H8VA 2J3HA 5JAQA 1DC5A 3L9WA 2HSDA 3RBXA 3F4LA 1V3TA 3CZRA 5I9LA 3ROQA 2CD9A 5KVSA 1WW8A 2Q46A 2VCYA 3PQFA 5TLSA 3WDSA 5JDIC 5TJHA 3B1KA 5H81A 1VRWA 1SOWA 4UEKA 4CUKA 4BV8A 4AJIA 3U5TA 1ZJZA 3H6KA 1J0XO 3D4PA 4YT4A 2WEKA 4LVUA 1RYDA 1DFIA 1DLIA 2OGUA 1U7HA 2VUUA 3JQ7A 3K9QO 2W4QA 3JQEA 4RVHA 2ZKLA 1KVRA 1SZJG 4E21A 4YJFB 3U62A 2NQ8A 4GWGA 5JNLA 4IQ8A 5KKCA 4RDHA 3HB4X 1W8DA 3H9GA 3D0OA 1WDKA 2I76A 2TMGA 3AJRA 1PJLA 1GU7A 2AQKA 1YE3A 1O94A 1ZCJA 3CUKA 4YAIA 2ZQYA 3PQEA 1QV6A 2F00A 3RUFA 1U7TA 1O8CA 3L6DA 3ZNNA 3HN7A 2Y68A 4CM7A 3E9MA 4P22A 4E3ZA 1GPJA 1R0KA 5EL0A 1HDRA 3DMTA 4MOWA 5KJEA 4AJ4A 4BVAA 1LI4A 4WEOA 5JS6A 4TROA 4E0BA 3DZBA 1L7EA 4CR8A 1PJ3A 3GNTA 4GL4A 4J6FA 4IGEA 3VVCA 1HYEA 1W0CA 2BI8A 3PDJA 4FQ8A 2GUGA 1FDSA 3O26A 5MGBA 3GMDA 3VPSA 4QFCA 2FMUA 5L95A 4YVFA 5DBFA 5I8WA 2JHFA 2X22A 2V7PA 4H3VA 4FCCA 3PFWO 2CDCA 2HK7A 1V6AA 3EDMA 4BNLA 4A0SA 1ADFA 4BGUA 3UF0A 2O4CA 3I9NA 5JBIA 4KTVE 3X2FA 3OJOA 5A5EA 3OJLA 1BXKA 1U2GA 3RUIA 3DBVO 3ETGA 4J9VA 1HRDA 1ADBA 1I2BA 2BKAA 1PGQA 2Q1TA 2PWZA 4D0SA 1XLTA 2JAPA 1I2CA 2PD6A 3DOOA 4BNYA 3DR3A 2ZATA 4DIFA 5EERA 3CSDA 3NYWA 2D2IA 1WMAA 3I6IA 1TT5A 4PLVA 2E82A 4DC0A 4R1UA 1K0UA 4C7JA 3H9QA 3ST7A 1JW9B 3ANNA 1I3LA 1OI7A 1LSOA 1XDWA 3BAZA 3S8MA 3VZQA 4HNGA 1C1DB 3WBFA 1F12A 3GG2A 4MVJM 4URFA 3FTPA 4IJVA 3LC2O 3JQFA 3QWAA 4BMVA 3JSAA 4CM6A 1GUFA 2HKIA 4PG6A 1VPDA 4MVJP 4TRJA 1P1JA 1SO8A 3GDFA 2A92A 4CV0A 5CG1A 2EHDA 2C29D 4QO7A 4XR9A 4NFSA 3GNSA 3K2BA 4MINA 5C7OO 4BO3A 1RYEA 1TT5B 1RM4A 2X9VA 3K8ZA 2IE0A 1BMDA 4NJMA 3ZWOA 1IUKA 4YRAA 3ENNA 2VHXA 1PJSA 3KV3O 4KDEA 1VC2A 3B20A 3IIEA 1R4NA 3SJUA 4OYRA 4IDGA 2IYPA 4FW8A 1UH5A 2NU9A 4CMKA 4JBHA 1HE5A 1NFFA 3DHEA 4OQZA 1AGNA 4ND1A 1M67A 3OA2A 4FFRA 3RFTA 3RUAA 3JYLA 2PNFA 3ZGYA 4E4YA 1O6ZA 2GASA 2AE1A 1GYRA 1E1KA 4NJOA 4QECA 2Z1MA 1JA9A 2C07A 4Z0TA 1E7RA 4BIIA 1WMBA 3RC1A 2BELA 4CV1A 4RO0A 1B3BA 2BMAA 2Q4EA 4W6ZA 4EEXA 2BRUA 2WYUA 1GEGA 6LDHA 2Q50A 4Q3DA 1U5AA 1R16A 5T64A 5A1TA 4XD2A 4PLYA 4U0KA 3I6QA 3PIIA 1HL3A 4NQZA 1P1HA 2EERA 3JQAD 4P8RA 5GZ1A 1LXCA 4N54A 1ZMOA 4FFLA 5G0VA 4EW6A 1HE4A 5ER9A 3AI3A 4E2YA 4ESOA 3F4BA 4WPGA 3BHIA 3QVWA 1ULUA 2GR9A 3QVSA 5F3RA 1N2SA 1JKIA 4A03A 5DP1A 4PZDA 5CEJA 3HSKA 4R9RA 2YV2A 4JXKA 3JYNA 2GN9A 3HDYA 1E3WA 4E2WA 4EJ0A 2XXBA 1OFGA 5G0WA 2AW5A 4ZQBA 5JMPA 2DFDA 3IKVA 4JP3A 4DA9A 5EQDA 2VTDA 5HWSA 4AJNA 4RVGA 4LN1A 4AICA 2UVDA 2CSUA 5L4SA 3PHLA 3MWDB 1V3VA 4HBGA 1EFKA 1MGOA 1Z7EA 3MJSA 1MX3A 1H6AA 1ZO8A 3CXRA 4R16A 4QX6A 3AU8A 1ZZEA 5L51A 5JCJD 1SPXA 4EBFA 2VTEA 1LA2A 4XYBA 4WOKA 1HSZA 3WNVA 3UUWA 3STHA 1KBZA 3PP8A 1PJ4A 3C7CB 5A9SB 1VJ0A 1QORA 2HU2A 4GSKA 5COQA 1RKXA 2HAEA 4E31A 1BTOA 1HDZA 2NNLD 3GG9A 5B37A 1K6JA 3GEMA 2HJSA 5JY6A 1LDYA 3QVTA 5EESA 1N9GB 5CDGA 1DDOA 3QE3A 4RVDA 2JFGA 3JQ8A 1YO6A 2FRDA 4FC7A 4CMBA 1ZKMA 1UP7A 4M49A 4A26A 4E13A 3K30A 1BVUA 1Z7BA 2PKQO 4WOJA 3JV7A 2DM6A 4OAQA 1PQWA 1SNYA 4YR9A 4BKOA 1SMKA 3OETA 1ZH8A 4MVJI 3DAGA 3KBOA 4FD3A 1V8BA 2EJVA 2NTVA 3BTVA 3MWEB 1RWBA 2C7VA 2EKLA 2DBZA 4PG5A 4WLOA 4YT8A 1EK5A 1N8KA 2X7HA 1YOVB 4AVYA 1Q1NA 3H5NA 3JQ8B 2DBQA 1TB4A 4FSHA 4PG4A 2WJPA 2CUKA 2VHZA 3TZ6A 4IUYA 2OZPA 1XQ1A 4OSPA 3S2FA 4HFJA 4RF2A 5FEUA 9LDBA 3OP4A 1GV0A 2O50A 3C3XA 5HTOA 5T8KC 2ZJ0A 4I9HA 5H82A 1C0KA 3WOHA 1E7WA 4GPD1 4JJFA 4CL8A 4LW8A 1M76A 5TS3A 2I3GA 1FMCA 4ITUA 1ULSA 4DLBA 2X8LA 3QWHA 1A72A 1PSDA 3C85A 3C1TA 5IZCC 1K6XA 3WQRA 1B7GO 3RWBA 3AI2A 3X2EA 1EVJA 3DOJA 1F0YA 2VNAA 4DQXA 1VL6A 5TRTA 4HY3A 1E3WB 4J4HA 3TQHA 4HKTA 3CMCO 3EMKA 4LCEA 4DPLA 2B0JA 1DXYA 3VPXA 4WCFC 4F6CA 4RPLA 2NU6A 4BNTA 1DIHA 1E6WA 1X7GA 5JFOA 4WLEA 2OOSA 3QLJA 4YYZA 4YAKA 4I9UA 1G0OA 2QW8A 3GEDA 1I30A 1BDBA 1I36A 2OO5A 2C5EA 2UDPA 3KYCB 2HMUA 3INRA 4ID9A 2X9NA 4JQCA 4ZA2A 2DVMA 3TNLA 3DB2A 4BNJA 3JD0A 4GGPA 3RAJA 4B7CA 3DTYA 1BDMA 3WFIA 1JN0A 1R4NB 1GYQA 3HZZA 4PRKA 3RC7A 3SJ7A 3K6JA 1CEQA 1VLLA 3AOGA 5I7FA 4NJMB 3G49A 3ZHZA 5TC4A 4Y98A 4GH5A 5ITWA 4CMEA 3PHHA 3GA0A 3IL2A 4AJOA 4GKVA 1GCUA 1M6HA 1P0CA 1Z82A 3QVOA 4YEDA 1YQGA 2V6FA 3QWFA 3GGPA 3OJFA 3JTMA 1DLJA 4NFHA 1T2AA 4DRYA 4D3FA 4GX0A 3FI9A 3GRPA 1E7SA 3OQBA 1P45A 4EUFA 2JD0A 4YQZA 4BQRA 4NBUA 4DPMA 3BTSA 4CM8B 4G81A 2AXQA 3BZUA 1DO8A 1NVMB 3Q1LA 4FJ2A 4J1QA 4ZICA 5AXBA 1U1IA 1XU7A 3AY6A 4MO2A 2NUAA 3NTRA 3KTDA 1IZ0A 1HWYA 3DO5A 2YZ7A 1B26A 3DZJA 2VYVD 1SAYA 4J7CA 3INGA 1U5CA 2HCTA 3M1AA 5IZ4A 4PLPA 2D59A 5IXSA 1UDAA 3GPDG 4PLCA 1U4SA 1BGVA 1X1EA 3ZDFA 4BGIA 3DZFA 3IOYA 3ANLA 2DTXA 3ON5A 1Q7GA 1C1DA 3G3EA 4PVDA 3NAQA 4DMLA 4J7UA 1KC1A 1PGOA 3HQ4O 3HHPA 4O5OA 3K2EA 2P2SA 2B36A 3E9NA 1P44A 3F1LA 4B8ZA 2PZJA 3I4FA 1XQ6A 5ICSA 2Y1GA 1KIFA 1A4UA 1D8AA 1PEDA 1VE9A 3PYXA 4ALKA 2YFHA 3RKRA 2CZCA 4RCVA 4R1SA 4MIOA 3GT0A 3ORFA 1FF9A 5DOVA 5FI5A 1KETA 3GH3A 4OXYA 5G4LA 2YFQA 2OXIA 1T25A 5FF9A 1DRWA 1BW9A 3I83A 4HUJA 3S1LA 1NTOA 3ZH2A 3AY7A 4DVJA 1EMDA 4XJSA 3V2UA 2XOXA 1OMOA 4FFNA 5T5QA 1PS9A 4LISA 1HDCA 1ISIA 3A06A 4ONEA 3TDKA 4CUZA 1PZGA 3GR6A 4BKPA 2X23A 3GHHA 4O59O 4R5MA 4U6SA 1QMGA 5GMOA 3KOUA 3LK7A 5KJ6A 5IN5A 3W4IA 2BGLA 1MUUA 4JLWA 3GPIA 3MCVA 3WSVA 1P31A 1T4BA 5B12A 3ZZNA 1UDCA 3ENKA 5CDUA 3E6AA 1B2LA 4K26A 5JW6A 2BGMA 4BO1A 3ZU4A 2P68A 5EMHA 3W4JA 1LLCA 1MB4A 5IXYA 1XELA 3L77A 1DIBA 1FDVA 1T2EA 1Y8QA 2VT3A 5F5NA 3H7AA 1SB8A 1HE2A 2EKPA 2VYND 1GZ6A 5AYVA 3KLPX 1A7AA 1PJBA 3KUXA 2QX7A 4M89A 1D7OA 4OXKA 4XKJA 2ILTA 1Y9EA 3H2SA 6ADHA 4CM4B 3MTGA 2JCXA 3AU9A 4WASA 3QWBA 2QYTA 1YKFA 3IQDB 1NP3A 1SEPA 3BMNA 4KMSA 4JROA 4R9SA 5AQ1A 1ZXBA 3AUAA 4J2OA 4WLFA 2NV6A 2CF5A 3BMCB 3V1YA 4PCVA 2JKVA 3PHGA 5G0SA 4CLRB 3EYWA 1T4DA 4Z3KA 1C14A 4EGFA 1Y9AA 4AJLA 1DSSG 3PQDA 1DRVA 4DLAA 4XDZA 2GO1A 4S1VA 1EBFA 4QFDA 3F1KA 1EDZA 2EP5A 4FGWA 4FPXA 1OBFO 4WLVA 3VOSA 1NBOA 3WQSB 4TRMA 1E3LA 1PGJA 4I1IA 2DUUA 4WE3A 4WEQA 1Z75A 5TQVA 2O3SA 1I32A 2AQ8A 3ONDA 4NR0A 1SOVA 3WS7A 3WG9A 4HV4A 3RU9A 2QQ5A 3D3WB 3PHIA 1WLYA 3UFXA 5IDXA 4IS3A 1DFHA 5JY1A 4QXMA 3L9XA 2HQ1A 2EEZA 3PJFA 5A9SA 2H9IA 1CETA 4YQYA 2YDXA 4ZQFA 1EE2A 1T1SA 1DHRA 1CYDA 4MKRA 1R66A 4YJHA 4Q39A 4YT5A 4BMNA 5L7TA 3EK2A 4AJKA 3GRKA 1Y8RA 4W7HA 3UH1A 1DOHA 4IDBA 4UUOA 2ZYGA 5JLAA 2Y05A 1GEEA 4UVHA 2X0IA 4DIBA 8LDHA 5DDIP 3TOXA 3VH4A 3NUGA 5A5FA 3U9LA 2OP1A 4MVJH 3RUDA 3PTZA 3HFSA 4OXNA 1NPTO 2TMDA 4EJ6A 3WGHA 1XA0A 1XR3A 4UUNA 2W2KB 3EZLA 4TZKA 5I7EA 3LF1A 1H6BA 2VN8A 2E37A 2Q49A 5DZSA 3D5QA 3KYBA 4FC6A 3DBHB 4A2CA 2Y0CA 4JGBA 4CMGA 4OGWA 3JD4A 4ALNA 4BGVA 1AXGA 1QYVA 4BKUA 2GSDA 4ND3A 1RM0A 4W9NC 5J23A 3WB9A 1Y8QB 2A9FA 5CPFA 1ZEJA 4MIYA 2JD1A 1XIVA 4IDFA 2RAFA 1M75A 2PD4A 3KO8A 3FWNA 1AXEA 4A7PA 3SBOA 4CM9D 2PH3A 5B4TA 1BHSA 3I9JA 2EW8A 5BT9A 1A27A 1A7KA 4YXFA 4TMFA 4FIZA 4XIJA 5EQFA 5KVCA 4BNXA 1Z74A 4RL6A 4D41A 3NJ4A 1HZJA 4PLZA 2GN4A 4DLLA 1PU2A 3RIHA 5C3MA 2Y93A 1GV1A 1DC4A 1Y5RA 1LBEA 3ITKA 4IM7A 4J1TA 3ZU5A 1HSOA 4BKRA 1NR7A 2BH9A 1EVZA 1UZNA 5G4KB 3IAHA 2PA3A 3H9EO 4JJGA 1ISMA 2P5UA 4R5HA 3L07A 5TT1A 4ALLA 1CQJA 1SBYA 3TZHA 1EEHA 3O4RA 3OF2A 2Y1OA 1ADGA 3U49A 5A3JA 1UR5A 1CIVA 1GQQA 4YAGA 1P0FA 1SB9A 1TA4A 1BWSA 4FR5A 2B5WA 3ETEA 1E7QA 3GAZA 4N5NA 1F8FA 3EC7A 3QP9A 3JQ6A 4L4XA 1LDMA 3N58A 1FK8A 3RVDA 3TPCA 4Z3DA 2VNSA 1X0VA 2PFGA 2WM3A 1CJCA 1G1AA 3SLKA 4B7UA 3Q11A 3MEQA 5AXAA 2UUOA 4ZQHA 1YL6A 3IJRA 4R4JA 4J91A 5ES3A 4L9RA 3RBZA 3B1FA 3I9KA 4IDDA 2ZYAA 3INTA 3I9MA 3BIOA 2PR2A 1N7HA 2FR1A 2I3AA 2G76A 4O0LA 4J2HA 5DCUA 3VVBA 3U3XA 3OMLA 4BNWA 4RGBA 2GD1O 1GL3A 3NDRA 5DN9A 3DDNA 3DMYA 5I7VA 1J49A 4DWVA 4CLDA 3PWZA 1ZW1A 4G2NA 2Z1NA 1FDWA 1NHGA 2O3UA 4FOSA 3TN7A 4CMEC 4BB5A 4K6FA 2O2YA 2YQ4A 2Z95A 1HDYA 5CG2A 4JBIA 4F3YA 5AOVA 5L53A 5K0ZA 2C0CA 1BXGA 3BMQA 1XSEA 1WPQA 3S2IA 5TSDA 4NDNE 4RORA 5CEFA 4WCFA 5LC1A 1AUPA 5CAEA 2GLXA 4H16A 2R00A 4KDFA 4CV2A 1QP8A 3WGOA 5A02A 1YJ8A 4J3FA 1EE9A 3VPGA 5A05A 3WYCA 5CP8A 4IDAA 4QTZA 4BB6A 1UP4A 2X0NA 2OL4A 1XKQA 3R3JA 4CUJA 1DAOA 3LF2A 5IDQA 2HDHA 4MP3A 4XCVA 1ZK1A 3OSUA 4ZQEA 1E6UA 2AG5A 2AQIA 3L6OO 1Q2XA 2YUTA 4U8GA 1XU9A 3PPIA 1SEVA 4NBTA 3LC7O 3PI7A 2WD8A 3D4OA 1GD1O 4FS3A 2LDBA 1I3MA 1VL0A 3S55A 4I9NA 4E2XA 4PLTA 2O4UX 1N92A 3RU7A 3NJ8A 1LNQA 4WGGA 1CRWG 1NASA 2IZ0A 3BYZA 4DYDA 3Q6IA 3JQ7B 4W9NA 3RQSA 1QLJA 2XF8A 3RCBA 4XRGA 4XDYA 3RD5A 3HB5X 1I3NA 4GQAA 4CMIB 1JQBA 1ONOA 3PJGA 4E5PA 1LSUA 4FFOA 1QYDA 2B83A 2QG4A 4M8SA 1YB1A 2X0JA 3RSHA 3WJAA 3ZCXA 4DBZA 1FJHA 2VUTA 2WYWA 5GZ6A 1PQPA 3DFUA 1U3WA 4KOAA 4HNHA 3PYLA 1RJWA 4NI5A 2PV7A 4CM9A 2X4GA 4RLHA 2AA3A 1IZ9A 2AQHA 3QQPA 1P1IA 3R1IA 4RQUA 3QRWA 4BNHA 3QSGA 4TZTA 1YWGO 3K73O 3G1UA 3WLEA 4AG3A 5HS4A 3ZHBA 4CM1A 2J3JA 4XYEA 1R4MA 2VUSA 3GEGA 1D4FA 1NPDA 1NX6A 3G0OA 1A9YA 1YOVA 3TJRA 5L3ZA 4E12A 3AM3A 1O5IA 2VHWA 4P38A 2J5QA 3C7DB 2AEMA 2J3KA 4IXWA 1Y8RB 1GR0A 2VZ8A 5A06A 4B3HA 2DU8A 4YJHB 4GKBA 2QRLA 2W98A 4YJDA 4H15A 2VRBA 5AXDA 4FJ1A 1HEUA 3DWFA 1DC3A 4YBZA 2QYSA 5U9CA 3B6ZA 3FNGA 3GAFA 5ITVA 3GLQA 1TEHA 1NYTA 1S6YA 2JHGA 4BO5A 3CKYA 2CMDA 1IOLA 4JK3A 2O7SA 1LU9A 1JLLA 1YBVA 2J5KA 4QSMA 4UUMA 4BQPA 3ANMA 1PJCA 2EF1A 4XQEA 3WMWA 1V35A 4II3A 5BSHA 1N9GA 1UP6A 1LSSA 5EPOA 4WKGA 4JP2A 3ZU2A 4DTIA 4OSOA 1J6UA 4BO9A 1B8VA 4M87A 2PGLA 3JYPA 1X13A 4D79A 4Z9YA 4IDEA 4DMMA 4AJ2A 1UDBA 1UZMA 1WP4A 3BTOA 4WNCA 5L45A 1XWFA 2VYNA 3DHYA 3FNFA 4WUVA 4Q3EA 4WJZA 5L7YA 4D45A 3GHYA 2NTJA 4X54A 3ITDA 3PGXA 4NBWA 2JD2A 4J7XA 2YQ5A 4NK4A 2GDZA 1NNUA
chains in the Genus database with same CATH superfamily
3RAEC 1X1TA 1U99A 5CB0A 1O8BA 1UBFA 1OFTA 2GAOA 4ZI7F 3MGGA 5G02A 3C16C 3HCEA 4FMCF 4RKQA 3WQQA 1O5TA 2JJ8A 4D96A 5GVSA 2QAJA 2XUDA 3OM1A 4XGKA 5DM4A 4G0WA 3S7ZA 3OPNA 4OBEA 5EMKA 1MVOA 2G9VA 4EELA 3VKHA 3QTBA 4IJWA 3IT2A 2FQYA 5IAKA 1DADA 1N6HA 1RBYA 4NU6A 2I6XA 5DNDA 3UVEA 4D25A 3M4XA 4BO2A 3NOOA 1CLEA 3IILA 5AJXA 1HYGA 3WLIA 4LJ7A 2QLMA 4OSEA 3OZBA 1EVLA 1JF8A 2C57A 2OWEA 3CUSA 4GMFA 3PFFA 2BCJQ 3NO4A 4UD2A 4XYGA 5EE0A 3RC9A 4D6YA 2BSQA 1TK3A 2XUGA 4I5GA 2XE7A 3KALA 1L4UA 3UAYA 3TH5A 4EG0A 1IPEA 4EX6A 4MWSA 2IYNA 3CNBA 3I1YA 3D0RA 3UYLA 4RULA 2ZUDA 3U81A 6REQA 2CLLB 2RG1A 4ND2A 1K5GA 4MVXA 5KTMA 1YAJA 2AFIA 3PEFA 1J2YA 3AEYA 5LYYA 3K1AA 5KHLB 3NS7A 4LV8B 5EP2A 4TGLA 2IY8A 3I42A 4G1UC 4M1QA 1V5EA 3HU5A 2VOEA 4Q4DA 5C37A 5A62A 3MMXA 5K6RA 5IX8A 1EFLA 3D5TA 1EWVA 4EFMA 1HETA 2CDRA 4G85A 1X1AA 2CLSA 3PICA 5AICA 3WLFA 4YP9A 4S2UA 4F3CA 1EK1A 2IXFA 1UPBA 2K2WA 4EA6A 3C3YA 2VDMB 3F5MA 3SFVA 1GAJA 2UZ3A 3I04A 4HDKA 4N82A 3HS3A 3VDXA 1P61B 5FWNA 1YV9A 3G5MA 3RWMB 1CDOA 1EZ1A 1NJSA 1UC9A 2ZRAA 5JPCA 2P9BA 2VHYA 3OF5A 3BOSA 4QLAA 2QM7A 1M33A 2PGXA 4LQDA 2Z4TA 2WIDA 1NBEA 3TNFA 4BPRA 4FDLA 1F4VA 4MUMA 4UAJA 2WSBA 4Y2SA 1FSFA 3C45A 3WB1A 1MW8X 3H2JA 4LGYA 3RS5A 3DAFA 1B6TA 2IHYA 4RXMA 3QIVA 1AS2A 2OAQ1 5K0BA 1NN0A 4FP9A 1VBNA 3WK7A 3EG9A 4UZFA 1T0JB 1CR1A 1E3JA 1FQWA 5GOTA 4O29A 1L1FA 4DSOA 2V6BA 5JH7B 5FLXA 4P80A 3E3OA 3Q2OA 2G5TA 4P2GA 1K7FB 3DEYX 3JVUA 3VJKA 1EX7A 3GLTA 2ODQA 1CZHA 3ZWDA 1UBTS 2AIRA 1RKUA 1RHMA 4GQIA 3W8NA 1UPCA 5ALWA 1R5JA 2IF2A 3H6GA 1DAFA 3ZQJA 1KZ4A 1Y1LA 4M1ZA 4EA7A 3HDTA 5LXTB 3GGOA 4OOFA 1EX9A 2WPDD 3GRAA 3R3HA 4UDOA 3P0HA 4L72A 2CBXA 3X43A 2VPYA 3TGPA 3CVXA 3THYB 4CTOA 4RD4A 4BVKA 4BB9A 1IOZA 4R41A 1E7MA 4Q1CA 3GFOA 5KYXA 4X66B 1PEYA 3WKEA 2UYOA 1E2IA 2IYOA 5AM1A 2PL5A 3FIJA 5FOWA 4CR7A 1NU8A 4UC0A 3ZJYA 1G98A 1QZTA 2ERYA 4GYJA 1X7YA 4Y9DA 4RZSA 2B6NA 5E6SA 3NVKI 1O0BA 1Y3HA 4R8RA 1RCUA 2JGLA 4ENWA 3TFQA 3C6KA 3H1TA 1DCMA 3GDOA 2QS9A 3GT3A 1LGYA 3LUBA 1GCOA 1IHYA 1W88B 1E89A 1ZH2A 2QAGA 2WW8A 3PFCA 3PE3A 4JH0A 1W4CA 4PZCA 2CVZA 4TVKA 4YB8A 2Y6UA 4D42A 1U2EA 1V16A 1OFIA 2YMPA 3CU5A 3CS3A 3LGSA 3C4QA 3K8OE 1S2IA 2OCAA 4YAUA 1N5KA 1NHWA 2E5FA 4KZPA 2GBFA 4IMPA 3SC2B 3CKLA 1BEUB 1W7AA 1INLA 3EWNA 4LJ4A 4UHHA 4F9TA 1C1XB 1KSGA 2HXSA 1TU4A 3DE3X 4RHCA 1UANA 1WCIB 2B7BA 3W2FA 4P0TA 2BGNA 2AEJA 4PN3A 3C1OA 1ENOA 1TA9A 1DTSA 3NEYA 1J7KA 4DHWA 2ALJA 4M0PA 5AM3A 1D1SA 3EZ9A 4LOKA 4BXOA 4DR3B 4ZJYA 4R6XA 4V39A 3F47A 1YUBA 2KB0A 2ZJAA 4LMPA 1DKMA 4EEZA 5KDDA 3PC2A 2XQKA 2HR1A 2GGSA 1J06A 3FD8A 3B36A 4NS1A 5CYGA 1MC4A 4X1YA 3AOEC 5IG2A 3TZCA 4DY6A 4HB0A 2AFHA 4LXGA 4CL3A 2A5DA 2F8TA 4DMKA 2J67A 5IT5A 3KYCA 2X5OA 1F51E 3EWSA 1RC8A 4W5RA 3M1YA 5LDHA 3NVDA 5ALFA 1TI7A 1SC1A 1SKYB 2YNMD 4CDMA 2WWGA 1LK7A 3FMVA 3H9JA 3PFIA 2A94A 4HH0A 1VG8A 4FHZA 3Q2KA 1BOOA 1T0PA 2NU8A 3T7KA 1IYZA 2C9DA 1RI5A 1M5UA 2K6GA 3WX0A 2O5RA 3OPYA 4TM7A 4YDRA 1NW3A 3T9EA 2QMHA 4ZT6A 5C5IA 4EL5A 2CK3D 3ZOZA 1MR3F 1E3EA 3QMMA 5EAIA 5JQGA 4FE3A 4PNHA 1FLDA 1QQTA 2CXXA 4IWXA 1UXGA 1JIIA 2BHNA 1ZOSA 4GVXA 4F2HA 3GLGA 1Z6AA 2PYZA 1YF3A 1T9DA 4X8MA 4ZN6A 3ULKA 1X70A 1LRJA 4CKBB 2XWQA 3KUCA 3MTJA 1QOZA 5A9RA 5JLAA 5A7HA 1XQXA 3BRWA 3QV1A 1FQKA 5FUVA 2BFBB 1W34A 4BHTA 4HNAB 4MPRA 3IVGA 1Y8AA 1KMHB 1MC5A 2G4LA 3BDVA 3D4NA 4QSHA 4A0FA 1Y7LA 2Q1UA 4HVCA 5JTTA 1XNQB 1UKVY 1ZGCA 4LSMA 4OFWA 3WWZA 3MCZA 5H80A 1LJ8A 1AA9A 2D1YA 3C3AA 1JLSA 3FFTA 4NEQA 2Z9BA 4BGEA 5IJ0B 1G8FA 2WWWA 3PVSA 1IM5A 1ES9A 1YFKA 1VB3A 4XLTA 1P74A 1NW4A 2NG1A 3BD8A 3PHCA 4KUHA 4EZBA 2PUHA 4RIEA 2QV7A 5C7IO 3EYAA 4KGDA 5AVXA 2GEDA 5BW4A 3ESBA 1E63A 3C3BA 3MSXA 1P2GA 4H1UA 2PR7A 2IQ5A 2GF9A 2FZLA 1F3OA 4ZCQA 5AVTA 1U9IA 1ZIXA 2IYAA 4RDCA 1AX9A 4LC0A 4R3UC 3DEAA 2E6UX 4UE2A 4F5ZA 2G1JA 2VSFA 5T6BA 4DLPA 2AFVA 1ZL0A 2DBVO 1F7UA 1OLXA 3PIDA 2OBMA 4EY6A 2CCGA 1UKZA 1T4MA 5DB4A 1M2JA 3M2TA 4K6GA 1VBMA 4OYYA 4IINA 1KE1A 4OFBA 1I33A 2F9FA 3DL2A 3EZGA 3VNQA 2XNCA 4DMUB 1KTIA 4S1PA 1Y4ZA 3LOUA 4HZGA 4NEGA 4MPTA 4FN4A 4FDTA 1Z35A 1AURA 1GZSA 2QX8A 3HY4A 4KI7A 2JKZA 1CQIB 1Y8ZA 4C5AA 5A2GA 2YWJA 2RGXA 2UUPA 5HJ2A 1KVUA 4L4ZA 5KOYA 1VM6A 1HQDA 1YZHA 4Q4HB 4B5KA 2C5FA 3K5IA 1T8SA 3H19A 3NAGA 3BWVA 3AHGA 1OXTA 4CJXA 3F7MA 2RONA 2F9LA 2J48A 1DKUA 1G7TA 1ZS9A 3GUCA 4S0ZA 3W6NA 1JPJA 3SXUB 1XZDA 3BM5A 3MB8A 3NTQA 1FMFA 3AFNA 4FWTA 2ZEJA 5FV4A 5TNXA 4IS2A 1QH8B 1UFRA 4QLOA 1QJ4A 1Z17A 2C4KA 3ODPA 4J0IA 3GRZA 3TZKA 4IQGA 1QHHA 2EC5A 2DKNA 3G5TA 4OHKA 5BVHB 5ICCA 5F2KA 5ENDA 4HPWA 4FVTA 4CI9A 2QT9A 16PKA 1T3ZA 3AUSA 1Z0AA 4DEVA 1D0VA 4KUGA 5AJHA 3F46A 5BSFA 3HV2A 2R7LA 1EHIA 3E7XA 1K3FA 3G7UA 4FDAA 3KE9A 1U8AA 3V1TC 3ZU6A 1V5GA 4HZIA 4KWHA 3LBIA 5EJEA 4GGOA 4FHFA 4ZI3A 4JBLA 3GCZA 4MUYA 1IEWA 2JPDA 2BHSA 2PE5A 2NSYA 2VWPA 2VWGA 4U7TB 1C1HA 4RH3A 5HP4A 2FVXA 2B8TA 3SMQA 2AZMA 3U4AA 4XW2A 3DONA 1T2DA 3GP5A 1PI3A 2OO7A 4P4NA 4BLPA 1HZZC 1EXWA 1P9RA 3V2IA 3VTFA 3G13A 1E3SA 2AK2A 4JP5A 3OJCA 3KYJB 5DRYA 1F4PA 3UUFA 2GESA 3PNPA 1N3IA 1NM5C 2PTHA 1X42A 4EKGA 1ZSNA 2B5OA 3B6MA 1SR8A 3B2NA 5DN6A 2Q9BA 2C1XA 6PFKA 3IAEA 5DX1A 3KKNA 4A82A 4PIVA 1DDGA 2ZTLA 4AYTA 8ATCA 2VDNB 4N7RA 4M37A 4G0MA 2VWQA 1ZR4A 2PZKA 1I7DA 3UWMA 1CFZA 3NC1C 4WQMA 4H4DA 5JSFA 3BA1A 4GS5A 3W3AH 1E5DA 2GK4A 3KT3A 4URYR 4BE4A 1PR2A 1KAGA 4WUTA 5JDCC 1RHRA 2VEOA 4JB3A 4X7PA 3W05A 3PRYA 1VA4A 2PY6A 4TWJA 3BPSA 1OD6A 4BNGA 4E6PA 1DAGA 3HUDA 3I1JA 3OLWA 2Q2QA 4I66A 5BXQC 1RM5A 4NS4A 3UJHA 1O6GA 4ZOLA 1L4NA 2JL1A 2O3TA 4CDNA 2GHQA 3DPUA 4LV6A 2YY6A 1DBRA 4HNVA 4BO4A 4UMVA 1W2HA 1UEIA 1Q0HA 2G9UA 3A9CA 3FOCA 4QICA 1ZU5A 1TMYA 5C0OE 1DBIA 1UFVA 4WCFB 4RHXA 1RXYA 2ZVJA 3H87A 5I7UA 2Q45A 1J20A 4TKUB 5C8DA 1YIAA 5LQKA 3QW4B 3DLIA 4OMUA 2V7TA 3ELBA 2GPYA 3ROPA 1VBKA 5E2IA 3HWRA 5E38A 1HLGA 3PF8A 3QVUA 4PYLA 2FQXA 1PFUA 1NUHA 2KPOA 4X97A 5TQ2B 1JTVA 3U3ZA 1KDOA 4NNOA 2Z8YA 1Z9BA 4PYKA 1Y1TA 1C9MA 3HP7A 4IDQA 5SY4A 1EDEA 2FN7A 3M4NA 1SD2A 2R2AA 2DPXA 2W43A 4GOND 2UXDB 1MH1A 1FP7A 4ZU3A 3H11B 3MRXA 1Q2UA 1OIVA 4O8ZA 3D64A 2W90A 2P9CA 1LLQA 3DE0X 5JXWA 3M2PA 5MHTA 2XNDA 2V7VA 2WJ3A 3VR5H 2QD3A 5JCOC 2BUCA 2H4JA 3KM0A 4I1OA 4L6CA 1XZIA 3SSAA 1YE5A 2ZWIA 3DLBA 2YCLA 1VE6A 3OFNA 3DTTA 4C6RA 1N5MA 1Y1QA 3L6BA 3ZVKA 1QQ7A 2FFHA 1UMDB 3GUVA 4RV5A 3RFXA 4A8JB 2Q3JA 3HWWA 3ZX5A 4Q05A 4NZYA 5E6RA 2DLCX 1DJQA 1LWNA 3EMDA 3GCXA 3OJWA 4HLNA 1BYIA 4ZOAA 1KYXA 1U8XX 4DL9A 7YASA 2ANCA 2EV9A 2JG3A 3RR2A 1FFSA 1OYWA 3NBKA 4BVJA 4Z0PA 1JILA 2WZQA 1EQUA 1QRSA 2PANA 4XEUA 3TRIA 4ETWA 1NVTA 4W99A 1QRDA 1RRGA 2NT4A 4L8WB 1G4UR 4LYEA 4XUEA 3W5JA 4BFZA 1NQXA 2DFVA 2GFIA 1BWPA 1YJXA 3WL8A 2ZYUX 4NENB 3SEFA 2HUNA 2Z43A 3OZ7A 5CPBA 2V4MA 3MJTA 4I4TF 3PUWA 5EWMA 4TMKA 1DMSA 1IMOA 4QHYA 5U4QA 1X1SA 1RLOA 2Q6VA 4RZHA 5H3HA 3S3TA 4ZMSA 1ZVVA 3FWZA 4I9GA 5CVDA 1Z62A 1KJWA 4G1CA 2OPHA 4QIHA 3ZJVA 3I12A 4AB1A 2DWUA 3C5WP 1QH8A 3EEIA 4GUAA 2O8EA 1HTWA 2DETA 1N6OA 3QEJA 3WLNA 5LVAA 3TI9A 1PF7E 3KJFA 5FI0B 4RZ3A 5F2NA 3ZDXB 2I3BA 1IEVA 2GLUA 5K3EA 2IHNA 2XDYA 1LW6E 1OT3A 4S05A 3MGKA 5JYBA 1RVDA 5J4KA 3FVRA 2MYPA 2PN1A 2WSSA 2NTEA 1Q11A 3GRUA 2HMWA 2P90A 4XX0A 1XK6A 5EXXA 1TGVA 4Z4EA 3O7MA 4FNOA 4QL3A 1ZGGA 4E5DA 4E5SA 2B2CA 4WAUA 3TSCA 4GOKA 4QDUA 4RH1A 4IHJA 1KZ6A 3KQOA 4M0DA 5K3DA 3WMXA 1KVSA 1OXKB 4BNDA 5BRAA 3E2PA 2EDCA 2GEUA 1JEDA 4R0VA 4D43A 3I8XA 3QFSA 4LXQA 1J33A 2HNBA 3BSFA 2PVCA 2RBGA 4E46A 3DEHA 2VDJA 4OGFA 3II6X 3ROGA 1NZJA 1XZFA 1YU9A 2OGTA 1K4MA 1KH2A 3RT7A 1P7WA 3ZK8A 4BO8A 3EA5A 2A9QA 4GXTA 4H0NA 4N9QA 4FMBB 521PA 4F7DA 4WBNA 3LY8A 2ECOA 2GZ3A 4M54A 1RRVA 3P19A 4RE6A 5K8UA 3WGIA 4N76A 3V1UA 3AR2A 3NBUA 3NXSA 1ANKA 5KREA 1VRCA 2O5VA 2WU3A 1YJQA 3O4GA 1EWQA 3I32A 4X7MA 3VH2A 4RWEA 4EL0A 4KO4S 3D1JA 2HJRA 3DXYA 3FYUA 3EPRA 3UCFA 1NW7A 5EIEA 1H8HD 2HHCA 5KOJA 5BNTA 3AUJB 3HBLA 3O95A 5CIQA 1KEVA 2ZROA 1OQAA 4TX1A 4ZAYA 2DHRA 2P5SA 3IDFA 4ENQA 5AVRA 1EESA 2GN6A 3CEHA 1J8FA 1XRQA 1PYDA 3HYNA 2KI5A 3NGXA 3TOCA 1I3KA 1ENPA 5K4HA 4PEVA 1HT0A 2BPOA 3PU6A 2Y67A 2QK4A 2OV6A 3NJRA 1IHOA 2CXTA 3QKRA 1KO8A 4MR9A 1UINA 3EFOA 4GICA 2HA4A 2REXB 1ISSA 1WIWA 4P5EA 4P53A 4LGCA 1FNNA 2UV8A 4DR5B 1QFYA 3DF7A 3U09A 5KAPA 2E7ZA 3VKVA 4U7FA 2J7PD 4CCYB 4HAYA 4AMGA 1J8MF 2KX7A 1YDWA 3D3WA 4IR7A 4GIBA 3CRVA 3I4CA 4FBLA 4KG7A 4DQ0A 2BP7A 1WV1A 5CHEA 1SELA 1QFJA 1DQNA 1GCGA 1P91A 4C1NA 4HQOA 3PEYA 4CG3A 1L5LA 5EHNA 2WAYA 3PGVA 3GN1A 1XMSA 2K7ZA 2OBBA 3BQ9A 3KEFA 5DI3B 3OCUA 4TWRA 3CRMA 1GYPA 3EVNA 4NZPA 3T4UA 4RYDA 2DX7A 3CUTA 1SCUA 1WX1A 1NVFA 1FQOA 4FKZA 1BXGB 1EIZA 2FN3A 3PB3A 1W4ZA 4MAAA 5IJAA 4BN5A 1CEYA 3ZDYB 4WNYA 3A36A 1ICIA 4LJAA 3IUBA 1Y63A 1KHTA 2BM9A 2OCLA 4MDHA 3TE6A 1DWPA 3ETJA 2W7TA 3RKUA 4URVR 3EUWA 3B8HA 2FJ0A 2RI0A 4PHFA 2K2QB 4RACA 1UJMA 5BT8A 5KSYA 3FUWA 5HIJA 3IEVA 3VGPA 1YULA 3O4IA 4EB8A 5KQLA 3ZD7A 3KSDO 1N2IA 3DM9B 3EAGA 3B7PA 4MQFB 1XAJA 4G84A 5EPEA 1HTBA 2XYPA 4L5JA 1ENYA 1PS0A 3U1TA 4YRZA 4LOAA 3AERA 4AU1A 1GFWA 4QJ5A 4NHOA 1QYXA 1UK9A 1DAPA 1M7HA 4NXMB 2JLUA 2R8YA 4HLDA 2VZEA 4X8HA 5KQSA 3QXXA 3QEAZ 4D1YA 1FZTA 5BNZA 4PHTA 1Y89A 1PG5A 4DWJA 3IA7A 1W0JD 4GECA 4P58A 4HCJA 1YHNA 3F5DA 4HEA6 4V1CB 3BIXA 4MKXA 3P0RA 1W4LA 3UJAA 1SHTX 1Y6FA 1DCFA 1HDXA 1V4BA 4RHTA 4MX8A 1DAEA 4NZOA 3F6YA 3UJPA 2DFLA 3FAZA 4WBSA 3NV9A 2JGJA 4HGRA 4K7JA 1B15A 1YK0A 3JCZA 2GRUA 2QT0A 4OHPA 1XJQA 3ELWA 1EM8A 3O2SB 1N0VC 2VQDA 3G7SA 2GCOB 3ITEA 5CFRA 1CBUA 2C20A 4IH1A 1PFYA 4R68A 4F4HA 5A2QA 1FIUA 2CMKA 4X1IA 3QFRA 2V96A 2D7CA 2F64A 3EXIB 1I1QB 2JLRA 2FPXA 2WWTA 5EGSA 4MW6A 1IY0A 3D7LA 4XQCA 4ZJUA 4ERNA 4HQKA 1GUYA 1ESCA 1N7GA 3RVQA 4D8WA 2IEDA 1JHXA 5EINA 2FOXA 3NP9A 4F3RA 4XUDA 2GTIA 5I7SA 5HQJA 2DJ5A 4EMSA 5HKKA 2C3PA 4ISCA 3QEBZ 1U3UA 1TAQA 2IBMA 1A69A 1ZHFA 1MIHA 2RB5A 2UZAA 4FJ0A 5G0UA 4DANA 3ZZ1A 1JKMA 3FKQA 2JKYA 3FPKA 4G65A 5CLLA 4EBBA 3PFBA 5GONB 3A2NA 1W52X 3BQMB 1QIMA 1RKVA 3O8LA 1TM5E 3GDWA 2FEWB 4G1EB 3HYLA 5T6MA 1L1EA 2W93A 1G5HA 3CTMA 3MK31 4O02B 1CERA 4LDAA 1MOZA 1UL1X 4TV9B 1VP3A 2BMWA 2XB8A 2ZYIA 3AIIA 1AQJA 1PDVA 1J23A 4KSYA 3ZDZB 1XROA 4MWTA 1SHUX 2O07A 2ZETA 4HZUA 2A6PA 3LDGA 4YWJA 4COOA 4DT1B 5A4JA 5BSKA 5CDSA 5CU7A 5HUHA 1COWD 3SYRA 4DV2B 1R9GA 4UAGA 5DT2A 3RROA 5J9FA 3R7NA 5JFTA 4HB2A 2WG2A 1U6KA 3IQWA 1Z5PA 5DIZA 1ONPA 3GVCA 1JEQA 5LN1A 3CG0A 5J4VA 2NYAA 3D8BA 4DC9A 3PXUA 4DDHA 4YCBA 2AMYA 4B74A 5AI5A 3DMTC 1NATA 2OORA 4Q4AA 1RXCA 3OEED 3FBTA 1R50A 2XQFA 3DYVA 3OM9A 4QKQA 3LXXA 1W1WA 4Y2TA 4QASA 4AY3A 1DJNA 1KP9A 2QW0X 2QXYA 3AJDA 3GVPA 1NXQA 4H6PA 4PQYA 1Z6QA 5ENVA 5KHAA 1CRLA 4EG5A 3I52A 5LNK6 3RSGA 1P77A 3N0WA 3U4GA 1QYIA 2OBNA 4TWAA 5AVVA 4MCHA 1NR5A 1NPYA 4KV7A 5C8YB 3UMYA 1ESEA 1KL7A 1TZJA 1QVWA 1NI4A 4LHWA 1CZRA 1E9CA 2W0MA 1S01A 2AN9A 2V65A 3LHDA 3OTGA 3AVUA 4RY2A 1Z8NA 1EUYA 4DABA 3KV1A 3L4SO 3MMZA 4PX5A 1QYCA 2FPPA 2WVAA 1E0JA 3BGVA 3L92A 4XD7D 2PLAA 4GWLA 5F1KA 5CFOA 5HKBA 3U4QB 1DJLA 3L02A 4LYYA 1CY1A 1SWWA 2BFCA 2H2DA 3U3JA 4AF8A 4A2QA 4YJGA 3WGZA 3R5KA 5IVHA 2Y77A 1V48A 1KOLA 1ZLXA 5J3JA 1QK5A 1N1EA 1R9MA 1YDHA 1TXGA 2WT4A 2ZVPX 2INGX 3QFTA 2D8AA 2J08A 2Y0EA 3UW3A 821PA 4TXJA 4BX9A 3DHNA 3AYXB 2JBHA 4FR0A 5AJYA 5DULA 3HVHA 4Y9TA 1KWGA 4YTEA 5FI3A 2XRMA 4ENTA 3GROA 1L4GA 1JE0A 4G8CA 3UT5B 5JYDA 2AOWA 3E8MA 5EVCA 4UD6A 5H16A 4GLFA 2H8GA 3N2LA 4MPPA 3HXOA 3ESRA 3N2YA 4B7AA 5B3AA 3OFSA 2ZU6A 2B0CA 3TR6A 4F4JA 2OFXA 1W5TA 4KQ1A 3OTHA 3LP8A 2O1XA 3EVDA 4IDOA 2HU5A 4OLJA 2CLCX 3QMPA 4R2IA 1ZISA 4F93B 5DCWA 3DUFA 5HZMA 3IJ5A 1Z63A 1KOGA 2ZUEA 3B6EA 5TQJA 4AT1A 3NOXA 3C2QA 1DX6A 3INNA 2C59A 1WL8A 2C8LA 2EU8A 2VHVA 3KEQA 3PNQA 2JLQA 3EHEA 1CUSA 1H65A 3OICA 4XEHA 1U0FA 2X76A 3GVHA 3LHFA 4NYJR 4AROA 2FPOA 3JZFA 5E1MA 3K9NA 3VHXB 4NBLA 2JVIA 5BNFA 3ZI0A 5J2UA 5LUBA 2D5BA 2XMGA 2IYZA 5DYNA 1ZRNA 2GNOA 4HXYA 1XDSA 1CJBA 2X86A 2X7XA 2PLFA 4FFPA 2H4WA 4AJPA 1XK7A 2Y76A 4OB6A 1UKAA 3H2GA 1DIOB 2OFWA 2R751 2JCYA 2MHCA 3HNOA 4B8YA 2JB9A 5B6IA 4ZC1A 4QDKA 1GPDG 2A9KA 2QMOA 1N2CA 1KK1A 1L5OA 1R10A 4UUBA 1U3VA 4BQSA 4R71A 3DOCA 4P33A 5KNBD 2ZSHA 2VSXA 3UWKA 3SJAA 1N32B 5UKDA 4EP1A 3Q2IA 4AUKA 2OXCA 3ZZTA 5THQA 1FEZA 2NACA 1ODTC 1PV1A 2O2SA 3MXOA 3PFHA 4MV1A 5IJ0A 5BR7A 2FNAA 3C87A 3TMYA 4EHJA 3ICQB 1WS6A 2XODA 2OR3A 1EWYA 5LU9A 1DTWA 1TM1E 1U98A 1I5RA 4TTJA 4B87A 2HBZA 5L4LA 4MR9B 1CP2A 1E3IA 1ZMXA 2R47A 4I6JA 4M38A 2RHMA 5H1YA 2P78A 4IV0A 4XVQA 4KWTA 1FFHA 1FB5A 5B3KA 2OXTA 1O9BA 1J0DA 2CW5A 1KKUA 4KIUA 4M0EA 4FOOA 3RHZA 1TW3A 1U28C 2VF7A 2Z2KA 3K09C 3SKXA 3TSWA 3FR8A 1H9BA 4QTUB 1OWPA 1TVCA 5K6TA 2BZ0A 3BKWA 3IMGA 2B94A 3GJXC 3BE5A 1OB5A 4HSGA 5CFPA 2YINC 4PO3X 2ZCJA 2ZUCA 3F5SA 1TDJA 2MYUA 3P2JA 3LLVA 2II6A 4G0UA 5HQ3A 1GG2A 1ML3A 1L5SA 2C96A 1T9KA 3ENWA 1ZAYA 1G9XA 4INOA 1E5QA 4MGHA 3O4FA 5FBLB 4OJQA 5NULA 1IN5A 5H3LA 3ZHXA 2FW1A 1FP4A 4CE6A 4WOBA 3GJRA 1EUCA 1P2DA 2NUPB 2WQ6A 5B30A 2ONKA 2ZUWA 1XYYA 5EKXA 4Q03A 3ZV6A 5LZ2A 1KOFA 3IVAA 4DLVA 4QGBA 5D3QA 4XX1A 2WJHA 5DU2A 3R6DA 2O3RA 2GCGA 3HJNA 7MDHA 1BFUA 4IIJB 2ODPA 3N75A 3PDWA 3TFOA 3EF3A 1ARZA 4KAJA 3QNUA 3ZVLA 1A4IA 1ISFA 1MB9A 2IHZA 3NT5A 1GUBA 4OV6B 3JYOA 3K5HA 4PAQA 3FY4A 4RMJA 2H0QA 3UAOA 3U19A 3JQAB 4X24A 3E70C 5IASA 4RTRA 4MICA 2JANA 2H5LA 1WKCA 2Q3BA 1E2GA 3MJFA 1CJUC 3PDCA 3G8DA 4G56A 3SE7A 3TMAA 2DCUA 1QHEA 1YUMA 3LS2A 3UPTA 1HE3A 3R09A 5ALYA 3DMRA 3WLQA 3VZRA 4ECAA 4Y67A 2G6BA 3CN9A 1GPMA 3GQVA 1WY7A 1JQ3A 4LYDA 4FOPA 1MX9A 3OIFA 3OE4A 5JR3A 2X5KO 1H3NA 2XAAA 3MTBA 1D4OA 2XYQA 3EUAA 4UVIA 4NONA 4DZTA 3X1JA 3IX7A 3T0FA 1Q7RA 2JA2A 2MYTA 2VFAA 1FSZA 2HLNA 3QKSA 1CUGA 1ZAKA 2ZT5A 3R9XA 5LOVA 3ZGNA 4I4TB 1DIRA 2VI5A 2FFBA 4KVFA 2WWFA 4RTJA 2AJBA 3RU2A 3KOWA 4YRDA 2FB9A 2WBLC 1JEAA 2AC2A 3BRSA 2HK9A 3GRCA 3K9GA 3PV0A 3SM9A 4E2FA 4IIHA 4OCZA 4LJRA 3MJ4A 4LGVA 1Q84A 1KAOA 3DL0A 3LDHA 4A3SA 3Q9NA 1GDTA 4XOIA 3UCXA 2AFIE 5CA0B 5A3RA 2PJZA 4DKJA 1L5MA 2JW5A 3AEKB 3DAOA 4X41A 3WZMA 5EXSA 2QT1A 3R0ZA 5FO0A 3RNOA 4IIVA 3TE7A 4CDRA 3GA7A 5I9NA 5IJ9B 4KMMA 3CE6A 3WK9A 4AK9A 1J24A 1GU1A 1A9PA 2YYSA 4TKMA 2EBWA 2H6EA 3TIXB 3ZGZA 4UTPA 1P0PA 4JEMA 4Y0NA 1VIAA 3KAJA 3OJEA 2XX3A 2XPCA 3SIWA 1KHHA 3SXPA 4E5KA 1XEWX 1MPTA 4KQXA 4ZYTA 5IF3A 2HPVA 3BSYA 3HZHA 1KAHA 4YT2A 1AKRA 1OIWA 1C7EA 3LZCA 3PLRA 3UBTA 2IYLD 3JALB 3KKQA 2QRGA 3OY2A 3OZSA 4MKHA 3ADBA 2NTNA 3ABIA 3N7UA 4AZTA 4PZAA 1CKEA 4FLEA 1ZWLA 3RSCA 3TLEA 5M2QA 5IJZA 5B7PA 1ZLYA 1JIJA 1MFPA 3QK7A 4JB8A 3ZWCA 1K5HA 5I01A 3WGTA 4OK6A 4AJJA 3VGJA 1WZ2A 1D04A 3T1VA 3FCOA 2HLHA 4K1XA 1XZLA 3B12A 4Q4JA 5K3FA 4NBRA 1JLKA 1BN6A 3B1JA 4B4UA 4LBVA 3VOTA 4DWOA 4EY7A 3WLHA 1PZXA 4YRGA 4BCBA 1QHGA 4L6AA 3TWOA 5C80A 3QYAA 4KSBA 3V4PB 4UVDA 3FCSB 2H4XA 3M9LA 2QVGA 2V9CA 4OHFA 3TZLA 3OOWA 4KGZA 1TLTA 4PR0A 2LRHA 5DBGA 5KJFA 1HOXA 1RI4A 1IL0A 5B3JA 3I3OA 5E9WA 4MK4A 2ZB2A 5E8RA 4Q7QA 1LLDA 3NBYC 4G4IA 1IBMB 2D0PB 3KZXA 4NKRA 3F98A 2FN4A 3DQZA 4AN4A 4WKNA 2WY2D 4F72A 5G1OA 5DIFA 1F06A 1IRIA 3DCIA 4A0QA 3A0RB 3BGOS 1QCYA 5GY7A 3RRZA 4X3PA 4ZVVA 3RF7A 2X77A 2N75A 4LF7B 4H6VA 4OKIA 1PLLA 2ACWA 3VC3A 1PWEA 4B6OA 1TQ2A 2FZKA 4Z9XA 4MW4A 3WWDA 1LF5A 3CNHA 4I5FA 1RWQA 1T43A 1JDJA 2GX6A 4LRWA 4B4WA 1WHSA 1NLZA 3ZLTA 4DADA 3HO6A 3I61A 4CEHB 2ZWAA 1XCLA 3IOCA 2OCYC 3V4FA 3GFRA 4YAJA 2QENA 1IY1A 1WQ3A 2CJYA 3AF5A 4C4XA 4JEHA 1CRZA 1FTGA 4EVQA 3X1MA 1D6NA 2FHSA 3OIDA 3SICE 4E33A 3KDAA 3LUDA 4HAUA 5EMJA 5DCLA 2DQ4A 2PWAA 5DISB 1SXQA 3DD1A 4B4DA 2Q8NA 5EHGA 3HRKA 2PNJA 3WP1B 1GGHA 2H57A 4C4SA 4WRRA 1EFCA 1KVTA 4G1MB 4N8DA 1X19A 2VZ0A 1HXHA 1V4NA 3ASVA 1A7JA 4FNGA 2ZJ5A 2M6KA 1NVKA 6YASA 1E9DA 2EWVA 3LECA 3HI6A 1ORRA 2A1UA 4LFBB 2I5PO 4BO0A 4MHTA 1Q0RA 5EHZA 1GFZA 1AU9A 2HBQA 3D6TB 3E2MA 4QUDA 4KR9A 3U44A 4ITRC 2BI4A 2BLLA 1V45E 4O2AB 2CDBA 2RHWA 5D87A 5FP0A 4ZK2A 2WF7A 5JI2E 3B7WA 3LOPA 4KWEA 1QHHB 2PZMA 1JXQA 3B5EA 4EPWA 1OVMA 2B9VA 1JMKC 2P30A 2YWDA 4KPGA 4X3OA 4OM7A 4X92A 1VB5A 4HVTA 2LP4Y 3PTLA 3CLKA 2IIBA 1H05A 4C9BA 1MIOA 3AOEA 4TUYA 1NQOA 5IBCA 2UVQA 2WU0A 4QLBA 1A50B 3AVXA 1MXHA 1KARA 1KS9A 2YH2A 3BL5A 2BMEA 4N40A 3C1UA 4NK5A 4BAZA 4X65B 1J1UA 2E5LB 5LR6A 1FA9A 2Q2NA 3DT8A 2VVTA 1X1BA 3GLHA 2X58A 2VTBB 1E77A 2VNHA 2Q1YA 4DOMA 2ZI3A 5CJPA 4PPQA 4C5CA 2QPOA 3IAUA 2IW1A 3KLNA 4NG5A 5THKA 1UJCA 1X92A 1I2AA 3E9CA 5I3CA 2HYIC 1Z4QA 1NULA 1E1NA 2D0IA 3F90A 3N87A 4JR2A 4XYLA 1CDDA 4KVAA 2G63A 3P9XA 5KPJA 1QYRA 1AO3A 2WD7A 4N5HX 1GN9A 5MN5A 4BJHB 3K94A 4J90A 1T2CA 2GRAA 3MC1A 4QHTA 4OH1A 1ABFA 3PCRB 3WWCA 2DP4E 1S4QA 3L49A 4UHKA 5E6SB 4GM0A 4B79A 4RLFA 4YACA 5HF6A 1U6JA 2WJ6A 1ZVMA 3WR5A 1H9AA 4A16A 5LD2B 2HB6A 2O7QA 3G1TA 4G0NA 4R1MA 5LOVF 3RYIA 4DV1B 4TKVB 4GF5A 4TQ9A 1J8DA 3USCS 1SVMA 5F1PA 2WV9A 1BQ4A 1ONNA 1XOIA 1O95A 3JQAA 3TR0A 5JNUA 2FG7C 2PAFA 2BFEA 3LRXA 1U3FA 1L1QA 3BHJA 4XM1A 3FDIA 5ITZA 5K4GA 2V6GA 4WH0A 2WSSD 3A1NA 1DC6A 1OAAA 2EARA 5IBQA 4EG6A 3RC3A 4JGIA 4NMXB 4QU5A 5CCDA 3F6BX 3TVYA 2IODA 1HF3A 2FUCA 2VRWA 1BMFD 3H8VA 1M34E 2WUVA 3RJMA 3L9WA 3PC4A 4MAMA 4BEJA 4DSZA 5F23A 4YCCA 3RBAA 1EAMA 5C8ZA 3ER9A 3CZRA 1JBQA 4ZT3A 3EODA 3UG7A 1G3UA 2I6SA 4R31A 3W9SA 5G53C 3RFFA 4JLMA 2VDVE 5REQA 3WNZA 2XD9A 1SXJA 3L8FA 4PSCA 2WT9A 3B1KA 5H81A 3C6BA 4I2NA 3VR4H 1WXWA 4OP3A 5DVZA 1OI4A 2ZJ6A 4MHOA 1MPXA 3H6KA 4JQOA 5I4IA 1F60A 4QA9A 2ACKA 5FUXA 1VSQA 1KBOA 3SIXA 4OHWA 4N6OA 3H5TA 2MSWA 1Q22A 2CSXA 2PRIA 3KWFA 5K8IA 4B6SA 3JQEA 4ZVQA 1KVRA 4TN5A 3L3BA 5CM8B 3WGJA 4GWGA 5BRNA 4FSDA 4E21A 3HB4X 4LJ6A 4QZVA 5LWHA 3LSTA 5FWYA 1GU7A 3BB3A 3MUNA 1XRRA 2ATCA 1YE3A 1G5PA 4OK3A 1TIBA 4CTKA 4YAIA 2CUNA 4PPGA 4MUHA 3L1UA 2F00A 5JAOA 4J29A 2ZSBA 2KS6A 3AV0B 1KMQA 3RPEA 1U7TA 2AFHB 1O8CA 2IOFK 1P62B 1WQ1R 3F3YA 3ZNNA 3JU3A 1EGQA 1NE2A 2JAQA 3BF8A 3E9MA 4OBBA 4N65A 4M1SA 1R0KA 5EL0A 3OMWA 1QE0A 1HDRA 3I39X 4HYQA 5KJEA 3VU3A 4BU0A 3PEWA 1LI4A 4L07A 4WEOA 2V1UA 3E5HA 5FUQA 2JGEA 1EFUA 4E0BA 1SUAA 4CR8A 1CVLA 4GL4A 4OD0A 2VBCA 3VVCA 1HYEA 1W0CA 5LMUB 3PDJA 5A5DA 1SC4A 2Q5QA 2Q5LA 1HH4A 4ZV7A 1JB9A 4I7EA 1M1NB 2FN8A 2HLDD 2H16A 2PMFA 3EY9A 3HJBA 4QFCA 3RVBA 5H4GA 3CZCA 2FMUA 2Y9MB 3A8TA 1IWPB 2FRXA 2GQ0A 3KJGA 4YVFA 3UMRA 3ZQ4A 5I8WA 4PX3A 4Q47A 3UA4A 2JHFA 5B1SA 1R6UA 4F5DA 4OAPA 2XWPA 2V7PA 4H3VA 2XE8A 4GSYA 4IGAA 2CDCA 3LHSA 1Q1QA 1NRWA 4AYXA 2HLDA 4ZVRA 4YJ3A 3ZJ4A 4DB2A 4LHXA 3UWDA 4A6DA 1VJDA 2PO5A 2IP4A 4MA0A 4W1SA 3D6UA 3TG2A 3KL2A 5T3YA 1WUYA 3OJLA 5AK6A 1BXKA 4H08A 2IOFA 1QHFA 3OO1A 2BKAA 3OCYA 2VHQA 1GAWA 2PWZA 2ANBA 1S8OA 4XCQA 5F9MA 3SZLA 4D0SA 1WMDA 1OTYA 2YRWA 3LG2A 3R3YA 4BNYA 1XEWY 1PAUA 3TGLA 5ALUA 1M8GA 4DIFA 3CSDA 3NYWA 4YPVA 4F60A 1CS4C 4F04A 4FWIB 2UUCB 1Z36A 3B51X 4BVHA 3C41J 2FMTA 5H5JA 1RC0A 3FWYA 2P62A 5BYBA 1NLYA 4RH0A 4TUYB 4UJ5A 1XDWA 3S8MA 3VZQA 3THYA 2ZUVA 5KMGA 2NZXA 3EQ2A 5JYCA 5BV1A 4OLAA 1F12A 3RTGA 2RARA 4B2IA 4URFA 1LI7A 3FTPA 1TD1A 1OWMA 2H17A 3L8ZA 4IJVA 4CNBA 5BWLA 2CJXA 2CEAA 3TJMA 1DZ3A 1TADA 2GZAA 1BQEA 4BMVA 5MFZA 2HKIA 1P18A 2PBLA 1JHAA 1T6XA 2PEYA 2B2NA 3A32A 3QNMA 4RKRA 4TRJA 2N3ZA 3AH8A 2HY7A 4TL6A 4UARA 4MV8A 4D57A 1EPUA 3M0EA 1YSCA 3V4LA 1T36B 4OP2A 3TGWA 3EBOA 5GJBA 2A2ZA 4NP6A 4NFSA 1TYDE 2YCBA 3GNSA 1IFXA 2CXPA 1O9GA 3IOBA 1RM4A 3K8ZA 2AR0A 2ZAYA 3E58A 3LHIA 4NJMA 4ML3A 2Q0HA 4DJEC 2XTMA 2VHXA 3IODA 3PDIA 3HKDA 3KV3O 4KDEA 2YR0A 3I01M 1F2UA 4QYMA 3B20A 5I8PA 2BR4A 4OYRA 3B5JA 5EEGA 2NU9A 3PNYA 2QTMA 2IL1A 2ZS8A 4ND1A 5K8TA 1SXJC 4YMTA 4C0KA 1TTQB 2Y2VA 2YWEA 5BSUA 2Q6LA 4DARA 4MMXB 3NATA 5CURA 3RFTA 5DSTA 1MO4A 2EKBA 4YI3A 2PNFA 3ZGYA 4C78A