4CQLA

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
257
structure length
246
Chain Sequence
LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 85
structure length 246
sequence length 257
chains with identical sequence D, E, H, I, L, M, P
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqlA00
3LZ6A 1QYCA 2B36A 4CLRA 4ALIA 3KLPX 5K9ZA 4PVCA 1CJCA 4M86A 2Q99A 3DOJA 1M67A 5ER9A 2VWPA 3K30A 4FDAA 3TZKA 4EW6A 3DC2A 2LDBA 4Y6PA 4W7HA 4U6QA 3DFUA 4AJHA 4RVFA 4EYEA 5EN4A 2BLLA 5JY6A 1J0XO 1NYTA 1Z73A 2JHGA 4AJIA 5DCYA 4NNJA 3AUUA 3RU7A 4GX1A 2NTVA 4PG6A 4DWVA 3BAZA 3PP8A 3AM3A 3ONDA 1VRWA 3OIDA 4TWRA 3BHIA 1PEDA 3IC5A 1I10A 2O3JA 3A9WA 2TMDA 1OAAA 4Z0HO 4G5HA 5TS3A 2DTXA 5I9NA 1QYXA 2VHXA 3GG2A 1MFPA 1E5LA 1HDCA 1H9AA 4TKMA 5CDYA 5CPBA 1LSUA 5HRUA 1EVZA 1QV6A 2DTDA 3DL2A 1LEHA 3ZZNA 5G4KA 4L76A 5IJZA 4YAIA 3D4PA 3HFGA 1FXSA 1HF3A 1QXSA 1Y8QB 2X58A 3RD5A 3ENKA 4B4OA 2FZEA 3HN7A 5U9CA 3ABIA 1NQ5A 2J3KA 4NJMB 5JAIA 4XCVA 3OM9A 4ND3A 4RLHA 2OL4A 1BMDA 3A4VA 2PZJA 1SAYA 4DREA 4ZU3A 3CXRA 4GX5A 4PLFA 4BV9A 3PWKA 1Y81A 2FR8A 2RCYA 2VHWA 1G6KA 1VL0A 4II2A 1LDMA 3HQ4O 4GPD1 2QW8A 3GUYA 4BUCA 4DBZA 1I24A 3I3OA 4UVHA 3OJEA 1YONA 3RWBA 3E5MA 1NQTA 1U3WA 3PHGA 4O5OA 4Q39A 4LCEA 1PQWA 4W7IA 3RC9A 4CM9D 1IL0A 3AY6A 1EUCA 3DBHB 3AUTA 1ISMA 3W6ZA 3I9LA 2EF1A 4W4TA 2NTJA 3FBGA 4ZQEA 2DUUA 3I9NA 2H9IA 4RDIA 2GRAA 5L3ZA 5KVQA 5KKAA 1GR0A 4HP8A 5IZ4A 4CLDA 1PJBA 4OAQA 1WVGA 2O3QA 4Z3KA 4N18A 1EBFA 3LC2O 1WDLA 4OSPA 2NSDA 3P5SA 4GMGA 1L1FA 1YBAA 4D3FA 1PTJA 3DWFA 1WWKA 3C1TA 4RVSA 3H6KA 1DBVO 4L75A 1E7YA 1U3VA 1H9BA 1PGNA 4BGVA 1V6AA 3DBLA 2DBZA 4GH5A 4D3DA 3P2YA 4R3NA 5TC4A 4DC0A 3JYNA 1R37A 2X86A 2VYVA 3FN4A 2VHYA 2C29D 3NT2A 1DLIA 5K0ZA 1EVJA 3GOHA 3OHSX 4O0LA 1ONPA 3AI3A 4EEZA 2ZYGA 4JJIA 1HRDA 1RYEA 3U49A 5DBIA 3G3EA 4YT2A 1D1SA 2R2GA 1JAXA 5JCJA 2DTEA 3PJDA 4I9UA 1E3WA 1WXDA 2J6IA 2V6GA 1PX0A 2NVWA 4XIYA 2HK7A 4GSLA 2EWMA 4MVJM 1PJQA 4Z9YA 3CMMA 4RPGA 3NT5A 4K9DA 2BGLA 4LSMA 4J90A 5AXAA 3WBBA 1X0VA 3ZHYA 2Y1EA 4A0SA 4CQMB 4PLVA 1PGOA 3E9MA 1BG6A 4HUJA 5A05A 5U1PA 1B8UA 3V5NA 3KUXA 2Q3EA 2W4QA 2C7GA 3WGYA 2NACA 5ICSA 3UF0A 2BFMA 3JQDA 2WMDA 5L9AA 4Y67A 1UR5A 4IQGA 2WYUA 3ITDA 5TLSA 4EJ6A 3PHLA 2SCUA 5G0TA 1WPQA 3VTFA 1N8KA 3PZBA 3ROMA 4YJGA 2BRUA 1U5AA 2DQ4A 1NHGA 2P68A 3Q1LA 1NPDA 1H6DA 4C7KA 4IDFA 1YQDA 3O26A 4B79A 4L9RA 4OHUA 2EGHA 3AU9A 5CEFA 1WZEA 3DR3A 3HHPA 1DIHA 1H5QA 1LRKA 4R68A 3A28A 2UV8A 3QWFA 1U7TA 4CM4B 1P9LA 4WEOA 1PSDA 2E82A 3INGA 2DT5A 4KWHA 2ZTVA 3UOGA 3KRTA 2J5QA 4CM1A 4IQ0A 2X1HA 4ITUA 5JDIC 3LDHA 3G79A 5EESA 3GEGA 3TOXA 4P8RA 2YHIA 4G81A 2ZCUA 4CM5A 1DEHA 1KBZA 1Y1PA 1T25A 4BNFA 3PHIA 3GQVA 4Q3BA 4R1SA 1LDGA 5DBFA 1I3MA 2X9GA 5F21A 1FJHA 3DEYX 5HWSA 1C1XA 4DIOA 1WAMA 4LSWA 1M6WA 3UXYA 1GUYA 1KERA 3NEPX 4PLYA 4K26A 3IJRA 5IZCA 2Y93A 2HJSA 1GEEA 2GGSA 3ZDFA 2WEKA 3JQ9A 4EUHA 4YEDA 4YR9A 1RM0A 2G1UA 1I30A 1MGOA 4FCCA 2GCGA 4UUMA 4WOJA 1XDWA 1VKNA 5C5IA 2GSDA 3W8DA 1LUAA 2GLXA 3NTQA 1GY8A 1YO6A 2O48X 4XYEA 3EMKA 1PWZA 4FFPA 4BNUA 1X14A 4NU5A 2A92A 3DZIA 1V3UA 3NDRA 4JP3A 3KV3O 5IXYA 1W6UA 1CYDA 5A02A 1P0CA 4IDEA 2WE8A 1AN9A 3AJRA 5GY7A 2PGDA 3AOEA 4B4WA 3EHEA 1MG5A 3U9LA 2HSDA 4IGEA 2QYSA 4GBJA 5CDTA 2Q49A 3CMCO 3WFIA 2VHVA 2EP7A 4OYRA 4XR4A 3AW9A 4AJJA 1MX3A 3GZNB 3LT1A 2CMDA 4CUZA 2Z5LA 3AU8A 3LF1A 1K3TA 1MG0A 3FF4A 4BO7A 2RAFA 4L4SA 4EBFA 4HKTA 1GZ3A 2CUKA 4XQGA 1M66A 1BSVA 2O3RA 1R4MA 2YQ4A 1S6YA 1ADGA 4BMVA 1CEQA 2ZYDA 4JJGA 4IY1A 5C7LO 1N2SA 1T26A 3OEWA 5IDQA 4L4XA 4R41A 5T8KA 3DZKA 5L4NA 3ZWWA 2FPIA 5TX7A 2YV1A 3OBBA 1JW9B 4ZVVA 3TNLA 1Q1NA 3MZ0A 1WDKA 1LQUA 1Y5RA 3E82A 4FR5A 3UCXA 4E33A 4Q3CA 3NJ4A 4OIMA 4BQPA 3R3JA 1ZNQO 1I01A 1A27A 5G2OA 4ZJUA 2YV3A 5DF1A 4E32A 3G49A 4DVJA 4L73A 4CMIB 1XELA 4LVCA 3NTOA 2J3JA 4HFRA 2X22A 1HDRA 1DJQA 3ASUA 4FFMA 3OJLA 2O50A 2VT3A 3H3FA 4JLWA 2HRBA 1DAOA 5CG1A 2BFPA 1NM5A 4QTZA 3NTRA 3RC7A 1EE9A 1ISHA 4IINA 5GZ6A 1XQ1A 2X0NA 3WICA 2VZ8A 2A9FA 2C59A 1DXYA 4R54A 2JAHA 3QHAA 1RYDA 3K73O 2EIHA 3PWZA 1VM6A 1VSVA 3K5PA 3KEOA 3D0OA 5HM8A 1N9GB 3BXXA 4PZDA 3JD3A 2BI8A 3ANLA 4M8SA 2HMVA 3WWZA 2H1SA 3MJVA 4OH1A 1YH3A 1GUZA 1DFHA 3M1AA 5F5LA 4ZN6A 4F3YA 3RUEA 1B3RA 2HK8A 3WQSB 5BSEA 4YB8A 3G1TA 4FOOA 3L0DA 4DMLA 2RIRA 4GX0A 2I3AA 3JQFC 3KHUA 2B0JA 4RCVA 2VYVD 3GN2A 3D3WB 1BVRA 4XGIA 5ADHA 3IQDB 4YPOA 3MOIA 3F46A 5EL0A 4YDRA 5K6AA 1EMDA 3O38A 4XYLA 3PZRA 3RFVA 1ZEJA 4RGBA 3JQBC 1SEVA 4E6PA 1KEVA 3O8QA 5I8ZA 3ROQA 4UREA 1YQXA 3WR5A 3ZNOA 1IHXA 1XU7A 4CV3A 1DRWA 2OMEA 2VOJA 3ETEA 3OH8A 3JQGB 5A9TA 4CV0A 1NR1A 2E49A 5G0VA 3ZWXA 4BGIA 4LW8A 5KJ6A 1LJ8A 1ZFNA 2XAAA 3PI7A 3C1OA 1VKOA 1SCUA 1T1SA 4PIVA 2VWQA 1LXCA 3S1LA 1Y9AA 1DRVA 2Q2WA 1R6DA 3WG9A 4UAGA 4O1MA 3VZPA 2NUAA 1UDAA 3ITKA 4XYGA 4KZPA 1LI4A 4B7UA 3PPIA 3TF5A 1HDGO 3PEFA 2CF6A 2E4AA 4J4BA 4AJLA 4H3VA 3PQFA 3ZN2A 1E7RA 3RSHA 2EKPA 3PYXA 2HUNA 3RBXA 4MP6A 4KTVE 3ZNQA 3AOGA 5I9LA 2GN6A 2POQX 1F17A 5TGDA 2PY6A 4ZA2A 1PL7A 5IF3A 2JFFA 1I0ZA 3O4RA 3H9UA 3KBOA 4L74A 4R5HA 3NRCA 2BELA 2PD3A 3I4CA 1WDMA 3H9QA 2ZJ0A 4RVUA 3AWDA 1D7OA 3PFFA 4GI2A 4RV9A 2TMGA 3WLFA 1WMBA 4BMNA 4M49A 4QSMA 1ZJYA 1V0JA 3AY7A 2Z1NA 1KYQA 3DHEA 4CV1A 3EAGA 1VLLA 3OF2A 5JYDA 2YFHA 1ADCA 3Q11A 5A9SA 3JQAB 1TI7A 4DLBA 2NNLD 3QLJA 1K6XA 5DCWA 1HE3A 2FSSA 1Y7TA 4FGWA 1DIBA 1HSOA 2I67A 1R4NB 3P19A 2EV9A 2JD2A 1U7HA 5F1PA 3QV1A 1Q0LA 3BMOA 5L45A 4D41A 4TVOA 1IY8A 4RVHA 1YBVA 3NX4A 4YWJA 2NWQA 1XG5A 3AFNA 5A03A 1ZK2A 1EVYA 1HLPA 1JN0A 3IKVA 3X2EA 2FR1A 3GVPA 3EYWA 1X7DA 4RQUA 3VPHA 1JLLA 4OO3A 4FFLA 2CFCA 4ND1A 4FFRA 2ZB4A 1O95A 7ADHA 1C0KA 1SC6A 1VPDA 3HWRA 1ZK0A 4J4HA 4XQ9A 1GTMA 1EDZA 2ZB8A 3QWAA 4J1QA 4WOKA 1MLDA 1KVTA 1O94A 3DXFA 3K96A 1IE3A 1HETA 3ZWYA 3ORFA 3RBVA 3QSGA 4YAJA 4RO0A 3K6JA 2J8ZA 3TL2A 5DBGA 2AE2A 5GMOA 3RUAA 1ISGA 3FNHA 4WLNA 4Z9FA 4BNHA 4IDAA 3HFSA 1XHLA 1VC2A 2Y1FA 1ZZEA 3H9GA 4KQXA 1YGYA 3LLSA 1LLCA 2R00C 3ZV6A 1MV8A 1L7EA 1R0KA 3OIGA 4GVLA 1C14A 4ILKA 1PGJA 3KXDA 3C7AA 4AJKA 2H6EA 3SX2A 4LCJA 4WCFB 4EUEA 1YJQA 1PZFA 3Q2IA 3VZQA 4CR8A 2QG4A 1ZMOA 5KTKA 3SBOA 3ON5A 1OMOA 2PD6A 4E2YA 2GNAA 1HDYA 7MDHA 5A1TA 4HBGA 1X7GA 4JN6B 2IXAA 4IDGA 1IYZA 1UDBA 3MTJA 1XYGA 2QHXA 4YTEA 3LVFO 1OOEA 1BRMA 3VHRA 1PWXA 1HZZA 1DAPA 2O4UX 1Y5MA 1ONOA 4PVDA 3VKUA 2VT2A 2G0TA 2PZLA 3OMLA 3H7AA 1XQ6A 1CERA 4WPGA 4PZEA 2BMAA 4JBIA 3V2GA 3KM0A 4AJPA 1U3UA 5AOVA 2NLOA 3CTMA 4FOSA 4PG7A 5EERA 3UN1A 1T2EA 1PJ4A 4BB5A 2GZ2A 5JMPA 1LSSA 5TT1A 1NPTO 2GDZA 1NTOA 4YT4A 6LDHA 3GC6A 2ZKLA 1RPNA 3L6OO 2DFVA 1DC3A 3RAJA 1NXQA 3C1AA 1TT7A 1F06A 4KP7A 2WD7A 5HS6A 1U8XX 2Q4BA 3PQEA 4OQZA 2XPCA 4FIZA 3ZV4A 4RQTA 4LK3A 1U4OA 1ZKMA 4DIFA 4JCOA 3R0IA 3K8ZA 4R01A 4Y6SA 3A14A 1GYPA 5A9RA 5KVVA 4AJNA 4FD3A 2ZK7A 1DFIA 4I5DA 1CWUA 2JFHA 3DHYA 4LVUA 9LDBA 1Z82A 2P5YA 2VTDA 4NK5A 4BS9A 4LMPA 4IDDA 3JYLA 3ZH2A 4BO6A 5TF4A 5A04A 3CZMA 5KOIA 2ZCVA 3HB4X 1CIVA 3K92A 4E2ZA 4ALLA 5KJFA 1KC1A 1T4BA 4KQWA 3GPIA 1E1NA 1JTVA 4CLEA 4ZICA 2O3SA 4BQRA 3JQCA 4FW8A 2AQHA 1B3BA 1ML3A 5BNIA 3BHJA 1N7GA 5HTOA 3DBRA 4DPLA 4S1VA 1ENYA 2P91A 1U8FO 3H5RA 3W4IA 2PZKA 3I83A 1H2BA 4G2NA 2UUPA 3VH2A 4BKPA 3VPFA 1YDWA 4W82A 4D46A 4TMFA 1T24A 1Y8RA 3VDQA 4XB2A 3IDSA 3T4EA 3TZQA 4BNLA 4YAGA 1DFGA 4A27A 4BOYA 4JX8A 4YACA 5JC1A 4MKRA 4H7PA 3K31A 1QP8A 1P77A 2NU9A 4Y8VA 2OBNA 1QKIA 2HAEA 1IZ9A 3KTDA 4FQ8A 3FBTA 4FPXA 4QO8A 2FP4A 3JQ8B 3C7DB 1HKUA 4A03A 2FWMX 3OA0A 2YUTA 2NVUA 4ZQBA 3OECA 3WGZA 5THQA 4PRKA 3U4HA 3OETA 1TA4A 1LC3A 4U0JA 3I9MA 2IZZA 1ZK1A 2VRCD 3DMTA 2C7VA 4J49A 4TZKA 3DBLB 3KSUA 4OJNA 4HWKA 4BNWA 1E7WA 4HADA 1FF9A 1Z7EA 3NV9A 1EDOA 1LA2A 2ZB3A 5JSFA 3VKVA 3ZU3A 2C82A 4WJZA 4MIOA 1FDUA 4OXKA 3F4BA 1P1JA 2P9EA 2PGLA 1SB9A 3VVBA 1LTHR 1D3AA 1N7HA 1MC5A 4M89A 3GK3A 5T6BA 4IDCA 1SOWA 4OGWA 3VOSA 4BGEA 4QX6A 1P44A 3BZUA 3JV7A 3DDNA 3KSDO 1LNQA 4MJLA 4R1UA 3RI3A 1M76A 4CL3A 3LQFA 3E18A 5JW6A 2WJPA 3WJAA 1LDEA 1Q7GA 3QWIA 5JLAA 1GUFA 3CE6A 3EUWA 4W9NC 1KVUA 1VJTA 5JAQA 1GDHA 3L6DA 4LISA 4HX5A 4EUFA 1T2FA 4CM6A 4CR6A 4MOWA 4YJGB 3Q3CA 2GR9A 4E30A 3DTYA 1LC0A 1ZMTA 1R0SA 2Y0CA 4WLUA 3FI9A 3ZU2A 2FOIA 1RWBA 5KNLA 1YS4A 2Y1CA 3DAFA 3JQ9C 1HE2A 2CDAA 5C7IO 4ZRNA 3SXPA 4CV2A 1KETA 5CEEA 5H81A 4E5NA 3AK4A 4WNCA 1UXKA 3IIEA 4BO1A 4ZHSA 4XR9A 3GA0A 4EITA 3C3XA 5EINA 5L4LA 5LDHA 4CUJA 2VQ3A 1IPEA 4ROSA 3WTCA 4EI2A 2DFDA 1RM5A 2C20A 1QG6A 3UCFA 1UZMA 3I9OA 2EP5A 3RC1A 4D0SA 2YHIB 1DSSG 1F8FA 4PZCA 3UUWA 1N1GA 1BDBA 3RROA 3FWZA 5A3VA 1BGVA 1HSZA 3QVXA 3T7EA 4XA8A 4BKQA 1W8DA 2QRLA 3GFGA 3PHJA 3PLNA 4EEXA 1J49A 1SB8A 4W6ZA 1G1AA 4FFNA 2IYOA 4Q3DA 3E6AA 1VL8A 1A4IA 3H9JA 4AJ1A 2VYNA 1ISIA 5ENDA 2BGMA 3GAZA 4BNJA 1Y9EA 1Y8QA 1ZK3A 5B4UA 4PG8A 3EDMA 3VDRA 3VH1A 3FR8A 1YB1A 1ZSVA 1UZLA 4ALMA 4CQLB 4NH4A 2AG5A 4Z9XA 5EQDA 3COSA 4Y9DA 5JDCC 2W90A 1I8TA 1RM4A 5CG2A 4DQXA 3OEYA 1KVRA 1P1HA 4ZQGA 3STHA 3A06A 2RH8A 1OZAA 4FB5A 4QO7A 3S2GA 4RLSA 4II3A 5KIAA 3ZGYA 4MP3A 2UDPA 3FPCA 3V1UA 4NU6A 2F00A 4BO4A 2C5EA 4RPLA 1R15A 5T5QA 3CPSA 1ZXBA 3FD8A 1GPJA 3WYCA 2RHCA 1ZH8A 3JD1A 4GWKA 3WLEA 1E1MA 3H2ZA 5DT9A 1GQQA 3DBHA 3NUGA 4OM8A 4FJ2A 4P4GA 3U09A 1NQOA 1NR7A 1U28A 4WKGA 1GV1A 1E3JA 1KOLA 5TJHA 4A7PA 3LC7O 3RUIA 1E77A 2XXJA 4J9UE 3KETA 4JIGA 5L40A 4RZIA 5H82A 8LDHA 3WSWA 3L4BC 1VJ0A 5TRTA 1CF2O 5L53A 2I5PO 1R4MB 1MP0A 3BA1A 2QIOA 2O7QA 3HDYA 4AJEA 3KZVA 3B1FA 1UXGA 4CPDA 1IHYA 1PGQA 4U6SA 4TROA 5KVCA 4NFHA 1J5PA 2EKQA 1KY5A 5L7TA 5DOZA 4YQZA 4RDHA 3HDQA 4XQCA 4TRRA 3WYBA 4FC6A 3P7MA 5KJ1A 4HV4A 4CLOA 4NJOA 4R9SA 3L9WA 2DBVO 4DQVA 3ADPA 1E6EA 1HZJA 3F47A 5JNLA 4E5YA 3WX0A 1MXHA 4DPMA 4HFMA 4XDYA 2DLDA 3UGKA 2VRBA 3IOYA 4Z0TA 3OQ1A 4QXMA 3D7LA 3WIDA 4LRTB 1PZHA 4BV8A 4F45A 4YJHA 5FEUA 1YOVA 3BMNA 3WJ7A 1BTOA 2NVBA 3WXBA 2D4AA 2Z95A 3Q9UA 2FZWA 1E3LA 3GZ4A 3D1LA 2IXBA 4WNIA 5DCUA 1XKQA 3L4SO 4MPDA 1Q7BA 5COAA 3WGOA 4B4UA 1M6HA 4EGFA 1UAGA 3HDHA 5CDUA 3JTMA 1V35A 3BMQA 1YE3A 2WDZA 2BH9A 1L7DA 3BMCB 3I6IA 4FFOA 2IZ0A 2WE7A 4A10A 4YYZA 5IN5A 5IAAA 1SOVA 2GZ3A 4XD2A 3Q9NA 2ZB7A 3GFBA 2I99A 4GL4A 4NDNE 3EK2A 2Y66A 3JD4A 1LDYA 3GDOA 2AQIA 3RUFA 3WNVA 2I76A 4GKVA 4NFYA 2D8AA 4PCVA 3HE3A 3NDIA 2PKRA 2JD1A 1TVEA 1W4ZA 1KC3A 2AQ8A 1C1DB 4D42A 3ZV3A 2QRJA 3IUSA 5CP8A 4A5OA 1P1KA 1JA9A 2EJVA 4ZQHA 5B37A 5DZSA 3PWSA 3S2FA 1NP3A 1EVIA 5AQ1A 3OP4A 1YVEI 3B6ZA 4ND2A 2HK9A 1UXHA 4YA6A 1ISJA 4CMEC 1ORRA 1R16A 2I3GA 5ER6A 4P22A 3ZWVA 4I5GA 2HLPA 4CMHA 2JCYA 2Q1UA 2CF5A 4W99A 3A1NA 3PK0A 1G0OA 1XR3A 1A7KA 4GVXA 3U4CA 4FJ1A 4PLGA 2FPPA 4DUPA 1TT5A 1NAHA 3E03A 4E0BA 5C7OO 1BWSA 5A06A 3IUPA 4ZGWA 2IRWA 4RL6A 5JC8A 5L7WA 3GGGA 2J3IA 2VZ0A 2WD8A 3SLKA 2YW9A 2X7HA 2FN7A 1SEPA 2XF8A 4S3MA 2RBEA 2BF7A 3DOOA 2BGKA 4XDZA 4B3HA 4NQZA 1ZEMA 2X9VA 5DP2A 2Y05A 4XRRA 3ZW8A 2BD0A 2HMTA 4YAEA 4OOFA 3VAZA 4MKZA 1QRRA 3D64A 3WGIA 4ALKA 3KO8A 4TSKA 1H6AA 3QVWA 1DHTA 1U2DA 3WS7A 5JS6A 1SBYA 4L8VA 5ITWA 4KTTE 2Y1GA 4YJFA 4D79A 1YB4A 1H6CA 1HDXA 3PTZA 3T4XA 2PKQP 1DC6A 2XXBA 3GRPA 4YRAA 1NVGA 2X6TA 4BNGA 4BL5A 4BNZA 3H8VA 1HTBA 4WGGA 1EE2A 2Q2VA 5JDIA 1XU9A 4CLHA 1UXJA 3TRIA 4IS2A 3NDJA 5F3RA 1JVSA 4J4TA 4KOAA 5CAEA 3MJCA 3QE3A 5JE8A 2JFGA 4IMRA 2C07A 4UULA 3IKTA 4CMCA 3AI2A 3KYCA 4BO3A 3C7CB 5I7FA 1EQ2A 2AEFA 3HN2A 5A9SB 4CLXA 4GAEA 3BTUA 1T2CA 1E3EA 4K28A 2V6MA 2AW5A 3HUDA 4OL9A 3WBFA 5T67A 4QUKA 1LSOA 3B20A 2EXXA 3GZNA 4RVGA 5LC1A 4P4LA 3RKRA 3JD0A 2VNAA 3UFXA 4PG4A 3ZWCA 5TNXA 1U4SA 1F12A 4ZD6A 1D1TA 3EVNA 1HYGA 2VYND 3E9NA 4JP2A 5BNFA 3JQ7B 5B4VA 3CSDA 3OJOA 3FHLA 4CR7A 4MVJE 3WB9A 4J7XA 2E48A 4JJFA 4GGPA 5LCXA 2HMSA 3ZNNA 5I9MA 1ZW1A 2ZIZA 3RKUA 5A3JA 4BO0A 5DP1A 3UHAA 3UVEA 3CZRA 3GG9A 2EW2A 1S7CA 4XX0A 3SC4A 2HRZA 2A4KA 4RF4A 4ALJA 3UH1A 2VRCA 5I7EA 3R1IA 2G17A 1ZUD1 2W2KA 3GF4A 2J5RA 1YDEA 2V6BA 5AYVA 5CFZA 2QYTA 1VE9A 2ZTLA 2Y67A 1LBEA 4IDBA 4G65A 1E1LA 1XCBA 5G0SA 3ZWMA 1FDSA 4FSHA 1P1IA 2XOXA 2VNSA 1ZIDA 4BO8A 3F9IA 3GHYA 1DIGA 3D5TA 2UUOA 1U9JA 2VTEA 1XEAA 1JQBA 4I9HA 3E48A 4BKUA 3DONA 3GPDG 4XYBA 3L07A 1HEUA 2P4QA 4RPJA 3H3JA 1FDTA 2IDZA 1NX6A 4TQGA 1Q2XA 6ADHA 4CMJA 4B3IA 1H0KA 1HT0A 3ANMA 3JQ6A 3HG7A 1ONNA 4K1LA 2WTBA 2VUTA 1N9GA 5G4LA 1YL7A 3ZHZA 4P4NA 4IIUA 3DZGA 4BNXA 2Y99A 3NYWA 4XIJA 1ZSNA 2FR0A 3WNQA 2BHLA 4CUKA 3ZWAA 2CVZA 2GPTA 3W4KA 4H15A 3VC7A 1MB4A 3ANNA 4I5EA 2DPGA 3VPGA 1NWCA 1UH5A 1E5QA 4DTIA 4ND4A 1NWHA 4WCFC 3D3WA 4BO2A 2VUSA 4UUPA 2GUGA 3PHHA 3EZYA 3PGXA 3PJFA 3TQHA 3INTA 3Q2KA 4CM3A 1DJNA 1JWAB 2RH4A 1OI7A 2ZYAA 3I6QA 1G0NA 2PWZA 4N5NA 3HJAA 3LSYA 2ZJ1A 1F8GA 1B0AA 4IPTA 1OC2A 4WLEA 1X7HA 3F6YA 2P2SA 4UVIA 4DRYA 2IZ1A 5DULA 3CINA 5BQFA 3ROPA 1MFZA 3SEFA 1QR6A 1Q7CA 1YJ8A 4LMRA 3GMSA 4BKRA 4J91A 1QORA 2DPHA 3DQPA 3JQGA 5L4SA 3W8FA 1LRJA 1AHHA 2ZQZA 3E9QA 3H5AA 5THKA 3WWYA 3ZWBA 4CMGA 4CQMD 4DA9A 3QVTA 3SJ7A 2A35A 1JDJA 1P1RA 3PJGA 4FC7A 4NMHA 3HSKA 4CM8A 3CH6A 4AJ2A 3FSRA 3QWBA 1XA0A 2AG8A 3LT0A 3KYDB 4TRMA 1GCUA 3JQFA 3BTOA 3VPXA 1I3NA 4E12A 2NU6A 4E5PA 4C4OA 5BR7A 2V6FA 4F46A 1T2AA 4J43A 4B7XA 4EJ0A 1IZ0A 1Y6JA 3C24A 3DMYA 3MWDB 4GMFA 4CLRB 4QFCA 4B8ZA 3JQBA 4XGNA 2VWGA 5CHEA 4ID9A 1BXGA 3MJTA 2OOSA 3G0OA 2WYVA 1Y8RB 2GN8A 3WMWA 1ULSA 3CEAA 3INRA 4PRLA 4DLAA 1U5CA 2Q2QA 5C37A 4IZHA 5IFLA 4R4JA 1C0IA 1C3VA 3GGPA 5COQA 3GT0A 1C0PA 2I65A 4PLHA 3WSVA 1YRLA 3V2HA 1N1EA 1H93A 1V3VA 3FTNA 3I52A 2CVOA 3NAQA 1R4NA 3RUHA 4R9RA 4D7AA 1LRLA 1NASA 2Y68A 4RPHA 3TZHA 5BSGA 2ET6A 1H6BA 4J7UA 1DHRA 3DTTA 3FR7A 4ONEA 1NFRA 1ZO8A 3JD2A 3M2PA 4XB1A 1EQUA 5HA5A 2EGGA 2Q45A 4J1SA 5L95A 4XZ3A 1O5IA 1GQYA 3GRKA 2QZ9A 4BNIA 1AE1A 4BO5A 2GERA 3MEQA 2W2LD 4BNNA 4IM7A 1DC5A 1K89A 2X5KO 3T7CA 4CMBA 5G4KB 1GYQA 4URFA 2AEJA 4JBHA 1DPGA 4WLFA 2DAPA 1QLJA 1SPXA 5JBIA 2BKAA 4J1TA 1DIRA 2V65A 4IGFA 3B1KA 2B5VA 1X13A 4MIEA 2O2SA 2B37A 1K5HA 2E37A 4ESOA 4X54A 4Z6KA 2EG9A 3PRJA 1X1EA 2NV6A 1NHWA 3DZBA 1K2WA 4DYVA 1ADFA 4KUHA 2GD1O 5JCXA 1V8BA 4M87A 2OXIA 4AG3A 4FBGA 3IMFA 3QQPA 2Z1MA 5ILGA 4CM7A 1B14A 1YB5A 3SLGA 3V8BA 4A26A 4CMAA 2Q1SA 3QJ5A 3RFXA 1EK6A 1GZ4A 4MDHA 1R12A 1OC4A 1PGPA 3D4NA 4DYDA 4AVYA 4LGVA 1SZJG 2VCYA 2DBRA 4DPKA 2AXQA 2WSBA 1XGKA 5IN4A 4R1TA 2B35A 2BI7A 3FPLA 2NU8A 4TKLA 3JQEA 3TDKA 1LDBA 3TFOA 3W1VA 1ADBA 1A4UA 2JHFA 2NTNA 4N5LA 4UUNA 2DC1A 3O9ZA 4HNHA 5EPOA 1KY4A 4WK6A 1D4FA 4PFJA 1JKIA 1EFLA 3LT2A 3TL3A 2AHRA 3GEDA 3GVCA 2B4QA 1E6UA 2NQ8A 4YBZA 1GU7A 1VJ1A 2HDHA 4XJSA 1B15A 1OFGA 1I32A 3I23A 4IQ8A 3ZV5A 1CQJA 3HDJA 2GF2A 4J0EA 1U3TA 4E5KA 3VH4A 3F1LA 2QX7A 4FS3A 4XRGA 4OOEA 1A71A 3VTZA 5FI5A 4Q3EA 3JCZA 2R00A 4JNKA 3DZJA 3GVHA 5G0UA 3AM4A 3LLVA 5TJ9A 4WCDA 4XWYA 2D0IA 1RJWA 3PLRA 3WQRA 1BDMA 2P4HX 1O89A 4HFJA 4KUGA 3V2UA 3FNEA 3GY0A 3U4IA 1IUKA 1DRUA 2PGJA 2EHDA 2Y1DA 1BW9A 2HJRA 2O3UA 1T2DA 3UICA 1I33A 1E3WB 1HYHA 2HMUA 5A5FA 4CL8A 3DO5A 3B1JA 1O6ZA 1UUFA 1FMCA 5JFOA 1A72A 3LK7A 1KIFA 4ALNA 3I5MA 3OIFA 5AXCA 1H2HA 1YKFA 1MXFA 2PA3A 1ENPA 4NHEA 2AE1A 3Q6IA 4KUEA 4I1IA 2ZQYA 1U1IA 1PL8A 1CQIA 1KS9A 3ASVA 2AQKA 1Q0HA 1DOHA 4N7RA 4DLLA 4J9VA 3OJFA 3KSZO 3PDUA 1I3KA 3HB5X 1DDOA 4KWIA 2PH3A 2C5AA 1IB6A 2VHZA 1F0YA 3R3SA 2OUIA 3WIEA 3D5QA 3DAPA 3IL2A 1GPDG 4N5MA 3BTSA 5GZ1A 1SNYA 3ST7A 3E5RA 1EZ4A 3PFWO 3M1LA 4NPCA 5IZCC 3WGQA 1B16A 3QP9A 4CODB 2HO5A 4JGBA 4Q9NA 1W0CA 1A9ZA 3N74A 4EJMA 3LYLA 2JAPA 2YQ5A 4MVJH 4A2CA 1I36A 1DC4A 1PL6A 4YT8A 1GEGA 3BIOA 3GMDA 3M2TA 4BNKA 2OFPA 4J16A 2G82A 4YCAA 1PU2A 1GV0A 1KEWA 2W8ZA 3U4DA 2D5AA 3HNPA 1UZNA 1QV7A 4XGKA 5T64A 2CZCA 3S8MA 1FK8A 4U0KA 3WTBA 2PK3A 3R6DA 3MJ4A 1D8AA 2I66A 2B83A 2JCXA 3JQ8A 4I5FA 5CDGA 1P74A 4ZQFA 4FGSA 1WZIA 1NQAO 3H65A 1YWGO 3K2BA 4GSKA 1UXIA 4E4YA 1DIAA 1SMKA 3HZZA 3BYZA 2PD4A 5ITVA 4E5MA 4AJ4A 3AOEC 5COBA 2R6JA 5BNTA 2Y1OA 3PDJA 1AXGA 3RASA 2FPGA 1C1XB 3ONEA 1E3IA 5ICMA 4CLOB 4LN1A 5AXBA 3V1TC 4WASA 3WGGA 4I9NA 5FWNA 2UVDA 2AEMA 3P2OA 5ENVA 3TFQA 5J23A 1B2LA 1HDZA 2PLAA 3GN1A 1E7SA 4YXFA 4OXNA 4NJMA 1OBFO 2WWRA 5HBRA 4MO2A 4YJHB 1U2GA 2IEDA 2QZZA 2CSUA 4L4RA 5F1OA 1YOVB 2AA3A 3BMNB 5FFFA 5L7YA 3GNQA 4J0FA 4GQAA 3UKOA 5T8KC 4INAA 3ZW9A 1TB4A 2GYYA 1ZSYA 1JKFA 3VZSA 1QYDA 3JQAD 4BHTA 1QSGA 4B3JA 3BMQB 3DBVO 3DFZA 3SVTA 2O23A 3NJ8A 4R3WA 5BSHA 4HFNA 1E7MA 3PJEA 1YXMA 1HWYA 4BNTA 1Z45A 2D2IA 5TSDA 5JXWA 2AMFA 5KWEA 4RF3A 5DN9A 3KOUA 1R0LA 3KVOA 4YAKA 4XQEA 3W8EA 4PG5A 3L77A 4MVJA 2VZ9A 4MINA 3FWNA 1KEPA 1GFSA 5G0WA 3H2SA 3TZCA 1KEUA 4NK4A 4PLTA 5KJEA 1IPFA 2IYPA 4NR0A 3QWHA 5CDSA 3MJEA 4WE3A 2X0JA 2VOEA 3HADA 2O2YA 1IOLA 1T1RA 3U0BA 1K6IA 5BSFA 1GCOA 1PS8A 2X5OA 3ETDA 1BXZA 2G76A 3EY4A 4JROA 1GYRA 3WDSA 4C7JA 5L51A 4MP8A 4MIYA 4BNMA 1BVUA 2WYWA 3F1KA 1Z6ZA 3ENNA 1PS0A 2F1KA 1P33A 1E1KA 3SC6A 5EMHA 2YHUA 3K2EA 1TT5B 5LDGA 5KJCA 2HCTA 3S55A 4JXKA 2QQ5A 3GNSA 1TEHA 4W9NA 4PLPA 1QLHA 3ETGA 2C54A 4E13A 4UVGA 4PN3A 2EKLA 3DZHA 4QQRA 3D3EA 1E3SA 4EDFA 3KB6A 3ZWNA 5JAZA 3WMXA 2P9CA 3EZLA 3IAHA 4IJWA 3I9JA 4TRNA 4MVJF 4L0QA 4OSOA 3E8XA 4E31A 4IXWA 2NADA 2HMWA 2O4CA 5K6AC 5EQFA 4CQMA 2DVMA 2FRDA 1JKJA 4U5QA 1EEHA 5B1YA 4CQLA 5I7SA 3AUAA 3WFJA 2C2XA 1Z7BA 3AFMA 3QVSA 1AHIA 2Q1TA 2PNFA 3LU1A 4YJFB 1QYVA 4J6FA 3RFTA 4F6CA 4BNVA 1ENOA 3NGXA 2X0IA 3F4LA 4PLCA 1PZEA 1WLYA 4RF5A 1EK5A 2OP1A 2ZTUA 4RZHA 1PJ3A 3ONFA 3NGLA 4M55A 1J6UA 3PGJA 2NU7A 1HE4A 1B8PA 1ZCJA 5IDWA 2Q46A 3TN7A 1UAYA 4KMSA 3KYCB 3SJUA 4MVJI 1VL6A 4J2HA 4UUOA 2PZMA 4PGFA 3GDGA 3KEQA 1PJLA 1SO8A 1ZBQA 2UYYA 4BGUA 1UP4A 4ND5A 4F6LA 2A94A 1XWFA 5B12A 3GVIA 4CM4A 2PH5A 1N92A 1VSUA 3H9EO 1NVMB 3BTVA 5TIIA 3ZU4A 2X23A 3G1UA 3FNGA 2D3TA 2O3TA 3DZFA 3O8QB 3ZWPA 1HLDA 3TSCA 2OORA 1Q0QA 4O6VA 3K9QO 4YJDA 3U3XA 5JYEA 4AL4A 5JDCA 4BMSA 2Q1WA 3EC7A 2X0RA 2ZATA 2DUWA 3IS3A 1O0SA 3BHMA 4MVJG 4JBGA 3DOCA 3QY9A 1P3DA 4AJOA 4R1NA 3C8MA 4DIBA 2QRKA 1X15A 2O7SA 5MDHA 1P0FA 3FCOA 2IE0A 5TQVA 4OQYA 3NT4A 1UP7A 4J1NA 1AUPA 1LQTA 5HS4A 4Y6RA 5DOVA 3VVCA 4BKOA 2V7PA 5GZ3A 1UDCA 3LC1O 3JYQA 2JL1A 2W2LA 3E1KA 4WUVA 2BFAA 4NBRA 4DGSA 3QA9A 4H16A 2W2KB 1O9BA 1LLUA 1T4DA 4BNYA 5H83A 4RPKA 4E21A 2P9GA 1EUDA 1I2BA 3L9XA 3RBZA 5B4TA 5KVSA 4MVJP 2VN8A 1MUUA 3GUCA 3L4BA 2C0CA 5CEJA 5U4QA 4JQCA 2ZTMA 3PYLA 4K6FA 3VZRA 4LRSB 1QMGA 4IJUA 3IJPA 1GL3A 2CY0A 3LT4A 3ZNPA 2Q4EA 1WP4A 5CPFA 4P38A 1HE5A 2PR2A 3ADOA 3BMCA 3WQQA 3RC2A 3TOZA 1ID1A 1V3TA 4NIMA 4TZTA 3ZHBA 2IODA 1E92A 3B70A 5MGBA 1ZVMA 2OP0A 1J4AA 4CJXA 1EBUA 3FNFA 4TVBA 1PR9A 4GGOA 3BMOB 1C1DA 1ZJZA 3OSUA 2JKVA 5F5NA 2LDXA 3PIDA 4R51A 1PJSA 1PJCA 3RU9A 2DM6A 3KYBA 4HY3A 1JVBA 3W6UA 3WOHA 4E3ZA 4EZBA 3GGOA 1GZ6A 2UAGA 5JPIA 4B4VA 3WGTA 3GDFA 3F3SA 4BVAA 3CKYA 4NBUA 4DC1A 2YY7A 3CUKA 3GNTA 4DQUA 2PFGA 3GH3A 1A7AA 4D0RA 4HXYA 3H4VA 5JCJD 1O8CA 4D45A 2FHSA 4CMKA 3GHHA 2EERA 1X0XA 4N54A 4RF2A 3F5QA 1XLTA 4TRJA 2D1YA 4UEKA 2Q50A 2DU8A 3RJ5A 1LSJA 2G5CA 2I6TA 4UVDA 4CMIA 3I4FA 3KLMX 3LF2A 2HKIA 4QECA 3GLQA 3EGOA 3PQDA 4J3FA 4WLVA 3MTGA 1LDNA 1KVSA 4FN4A 3RJ9A 4CM8B 5KCZA 3L6EA 4KDEA 4XKJA 4RJTA 4XYMA 4D43A 5IXSA 2CDCA 4R69A 2VWHA 4NBWA 4ZRMA 4Z0PA 4IJVA 5JY1A 4MVJD 1LLDA 5A4DA 4CMEA 4YQYA 3MCVA 4GWGA 2JJYA 1N5DA 2GZ1A 2X5JO 3JSAA 2B4TO 1BXKA 3UW3A 1H94A 5AVOA 3OQ6A 3GVXA 4E2WA 5A5EA 1PR3A 2CVQA 3VH3A 2YDXA 3O03A 2X8LA 3UCEA 2FSVA 2X4GA 3RUDA 3GR6A 1BXGB 1A9YA 3VPSA 5C3MA 2JCVA 3AI1A 4U7WA 3I1JA 1RKXA 4U8GA 5I8WA 2YJZA 4IIVA 4R16A 2B5WA 3RIHA 1KVQA 1FDWA 1PS9A 1WNTA 3EVTA 5T57A 3ICCA 2Y0EA 1V9LA 3PXXA 1WW8A 1CRWG 1YBMA 4I08A 3RUCA 1GQ2A 2IEBA 1LX6A 4I8XA 2DKNA 3OFSA 3H5NA 4E2XA 1Z75A 3ROKA 4RORA 3PVZA 4IJKA 4CM9A 2HU2A 1PIWA 2EW8A 3F5SA 3U62A 1E7QA 4Z3DA 1AGNA 2WD7B 3AY3A 4GLOA 5JMWA 3N7UA 1NBOA 4QT0A 4IBOA 1ZK4A 1NFQA 4YRBA 2NM0A 2PV7A 5FYDA 4J2OA 4GLLA 3RVDA 4GX2A 2GASA 5I7VA 3EW7A 3M6IA 4M54A 1PQPA 1HYEA 3JQ7A 4IXTA 4QFDA 3AM5A 4GKBA 1IULA 4OKIA 3OJ0A 2I9PA 4K6CA 4RVDA 5F1KA 1GAEO 8ADHA 3ULKA 1LU9A 5IDXA 1M75A 4UEOA 3IP3A 1VI2A 3ZWOA 1AXEA 2GN4A 3DAGA 4B8WA 4OMUA 9LDTA 1E6WA 2H63A 2CDBA 3RQSA 4DMMA 3MOGA 3TZ6A 2OBYA 1I3LA 4PLWA 3DHNA 2D59A 1A5ZA 1JWBB 1PQUA 3MJSA 3N58A 2X9NA 2OO5A 1F14A 2P5UA 3DB2A 3DBRB 3QIVA 1TXGA 4KDFA 2BFOA 1UP6A 3DMTC 1HDOA 1K6JA 5DDIP 4O59O 4IMPA 3I9KA 3ICPA 2FMUA 1W73A 2GO1A 4NZ9A 3TPCA 3FTPA 2CD9A 2DBQA 3PYMA 4Q3NA 1DLJA 2YDYA 5EJ2A 3ZHXA 5FF9A 1FDVA 5ILOA 1B7GO 2CNBA 3GAFA 2NQTA 2ILTA 4UEJA 3FRJA 5JO0A 1K0UA 1UJMA 1P45A 1CDOA 3JQAA 1M2WA 2D5CA 1HXHA 1P31A 3QW2A 3U5TA 3S2IA 1CETA 3NKLA 4O63O 3CIFA 5FI3A 5BT9A 4NG5A 1ISFA 4UVEA 1GD1O 5AXDA 2YV2A 4BO9A 1NAIA 4NFSA 1JU9A 1LLQA 4JK3A 3ZCXA 1GADO 3ZI0A 4WECA 4AICA 5IDYA 1PZGA 3Q0EA 1B26A 3G17A 4YRDA 4DBVO 2OHXA 3MWEB 4AFNA 2GN9A 3D4OA 1ULUA 1NFFA 3GEMA 1NVTA 2NVUB 4IZIA 2EEZA 5KKCA 4IS3A 4DL9A 1YL5A 2HQ1A 5JO9A 4BIIA 1DO8A 3JYOA 1JAYA 2C2YA 1ARZA 2YYYA 1Z74A 1YL6A 3W4JA 2PKQO 2B4RO 2JD0A 4YVFA 1PJTA 4OXYA 1P1FA 3OICA 5ES3A 4FJ0A 3OQBA 4WEQA 5EIOA 1PJ2A 4XEHA 1NPYA 1C0LA 2RHRA 3QVOA 1EFKA 4HNGA 3OA2A 1BW9B 1DB3A 1EUZA 1I2CA 3ZU5A 3WGHA 3AUSA 3RCBA 4J7CA 3X2FA 4B7CA 1B8VA 1YQGA 1NNUA 4BB6A 4MKXA 4OKNA 1E0DA 2FY8A 3UAGA 3IP1A 1I5RA 3WYEA 1R66A 2WM3A 2VUUA 1I2ZA 4IUYA 4Q3AA 1BHSA 4QEDA 2H5LA 3QRWA 2PTGA 3C85A 4NI5A 1RM3A 1XIVA 2EJWA 3PIIA 1MA0A 5IG2A 4NBTA 1MC4A 4D3SA 2W98A 4XJTA 3TJRA 5JAMA 2J3HA 1XSEA 3KYDA 3V1YA 4PLZA 4WLOA 2Y0DA 1TLTA 1X1TA 2YFQA 2YZ7A 4WCFA 1ZXLA 4D44A 3JYPA 1WMAA 4DXHA 2B69A 1ENZA 1QYWA 2E6UX 2OZPA 4R5MA 2OGUA 4Y98A 5DNAA 3S2EA 4NBVA 4YT5A 4M1QA 3TWOA 4A73A 2J5KA 1HL3A 5TT0A
chains in the Genus database with same CATH superfamily
3NHMA 1SZPA 3OE1A 3ZHTA 2JJ2A 5GVRA 3REFA 5H80A 2OGZA 4ALIA 2IXFA 2WU3A 4CEIB 1MAAA 2TS1A 1OB5A 2ON6A 1KJIA 3TOSA 3K30A 1JG6A 4RE5A 1PJRA 4IFIA 4PY2A 3RGWS 1RQNA 2HHHB 4WOBA 3S4YA 3ROZA 3BWDD 1FP4B 2OSBA 2ZXUA 1S8FA 3AERA 3WYFA 3SICE 4K8OA 5DSZA 4ZI7F 5EN4A 2BLLA 3WYNA 1TL7C 3O73A 2A9QA 5I51A 5JY6A 1J0XO 3GLSA 1X7WA 3AFGA 3CR8A 3UV3A 4QDUA 5KYKA 4R98A 4NNJA 1E2MA 3RU7A 2FQWA 3TCNA 4LDPA 5BSKA 5C4MA 1VCHA 5FJIA 4DWVA 5CB6A 1YJXA 1KMHB 5FDFA 3KDPA 4K0RA 3C3CA 1MO5A 4R9VA 3EYAA 4WY5A 3OIDA 2EQ5A 4B81A 1ZGZA 2YRWA 3DD1A 3KKZA 2F67A 3EGIA 4GEGA 2A3NA 5EEHA 4W63A 4MQBA 1PEDA 1YAHA 4POAA 3D6HA 1J97A 1G6Q1 5MHTA 2UZ1B 3IODA 4G5RA 4F0JA 1CUHA 1JDZA 1CQPA 3IUBA 2R7KA 4YJKA 2HZ7A 1MH1A 4WVFA 4G5XA 4FFBA 5B1IA 4TKMA 1H9AA 5CDYA 5HRUA 5CPBA 1QV6A 4HS4A 4L72A 4ZZ3A 5G4KA 1TRHA 3WHKA 2I7VA 4G1MB 3Q8WA 3T4UA 3KAQA 3U61B 3D4PA 3C3YA 4MGEA 1DT5A 3C8HA 4GOJA 1XEWX 4HX9A 1N0VC 2F9MA 2QD4A 1I9GA 4G0QA 3RD5A 1KFBB 4ENSA 4N7RA 4AY2A 2VTKA 2YMPA 3SHQA 1NQ5A 4ZOCA 3KFVA 2UYCA 1QVVA 4IR7A 4KI0A 3I1IA 4XCVA 3VR3A 1BQ3A 2INGX 3U16A 2O2ZA 1NF3A 1JFRA 2H16A 3PPWA 3O4FA 2MIIA 4N5IX 1V47A 2WUDA 3ZVMA 3CXRA 4YMWA 1QYIA 4PLFA 4EUNA 1SWWA 4RTKA 2VSFA 3N07A 4Y2XA 4UHEA 3M0EA 5IHXA 3EVEA 4CF4A 1K98A 3R9XA 1MA3A 2O1EA 1YKGA 1LDMA 4ZYVA 4DLSA 4GPD1 2QW8A 3GUYA 1UBMS 1KO1A 1TJ3A 1NR5A 1NQTA 1U2PA 3KLNA 3BL8A 3OZWA 4Q39A 4NBLA 3RC9A 3ZIAD 1AU9A 2C3PA 5LSAA 2Q5QA 1EINA 3P9KA 1EUCA 4MUMA 5EUMA 3F9CA 4R7TA 5MGBA 5EMJA 1PWEA 2ZROA 1OYOA 2FN4A 4YRIA 3ZX4A 3I9LA 4NCJA 2VP9A 4FSDA 1Q57A 4S1OA 2CXTA 3RJZA 3BE6A 4ODIA 5AVTA 3M6VA 4GPTA 3NU1A 4ZT7A 1H1LA 3VGJA 2D7CA 1XZGA 2ODQA 3I9NA 2G40A 2YVKA 3KK0A 3NTLA 3O1JC 1XRQA 4L8FA 2ZYIA 3G8YA 4V2IA 1SKUA 1TADA 4BXOB 3BKXA 2AL7A 2O3QA 2P9FA 4N18A 3ZCVA 1IM5A 4F4IA 1R10A 4OSPA 1CJUC 2AV6A 5IUKC 3AG5A 3JYHA 2HV8A 5SV2A 1PTJA 1VQ1A 1TW3A 3FYDA 5DI3A 2ZM5A 1FX1A 1P1BA 2O52A 1T3ZA 3H6KA 4IOMA 3N76A 2YFKA 1MH9A 2XYHA 2L18A 1M8FA 1GQRA 2F3SA 1EIWA 1AS0A 1EGVB 3EWNA 3QOYA 1R0XA 3WLHA 2P0YA 4AKGA 4EH1A 4DDUA 1EP3B 4DC0A 4ZP1A 4O4LB 5GIOE 2WC1A 3FN4A 5CD1A 5FUYA 5HKAA 5AKZA 1RI3A 5JZOA 4U8HA 1DLIA 1TDJA 1GCAA 3R3VA 1EVJA 3TIVA 3EDOA 1P0QA 1R0ZA 2ALJA 3CF6R 2ZYGA 3WHPA 2IA5A 2IXEA 1UBUS 4QOEA 2G7ZA 1PT7A 4H7FA 2QD1A 2PX4A 4I9UA 3I53A 1WXDA 1Y37A 3V4LA 3VO2A 1RTTA 2D5LA 2WKSA 3O74A 1KZHA 4MVJM 5CNKA 4BNDA 1R00A 2PXCA 4RPGA 3ZE0B 4G86A 2PLWA 2MT9A 2WKWA 5FTJA 5JEEA 5FLKA 5P21A 1QRSA 1IQRA 4F7WA 1X0VA 3JS5A 2Y1EA 4Q4LA 3ZHYA 4A0SA 2AK3A 3OX2A 4TM7A 4B3GA 4KX5A 4X6YA 1EX6A 4HUJA 4TUYB 5A05A 1F2TB 1YU9A 3N6XA 3OOJA 4DSAA 1B8UA 3V5NA 3KUXA 5IBQA 4R2XA 2W4QA 3RRFA 3WGYA 1E9DA 5ICSA 1GTJ1 5T3YA 2LR0A 3EBLA 5K3FA 3UF0A 4JGGA 2DKFA 3TXXA 5D3QA 1FUYB 4AQYB 2A5JA 3HI4A 1KO7A 4LXTA 2IU4A 3AX6A 1RXIA 4JP8A 2BKLA 3OPYA 1VP9A 3NKFA 3LVRE 3QVVA 1YRBA 4P82A 4EY6A 4L8GA 2DQ4A 2Q0HA 3NC0C 3HJCA 4B6QA 2CHQA 4IDFA 1ORWA 8GPBA 1SXHA 4B79A 2VDJA 1BKDR 1MT0A 4L9RA 4EB6B 3FPEA 2WF7A 5JAUA 3HGMA 3PE4A 5EZ5A 3CKLA 1A8IA 1DIHA 3RC8A 4IRUB 1NVKA 3OT5A 4RSGA 2HR1A 1FYEA 3P52A 3L46A 4QEKA 3TR0A 3W0LB 1LRKA 4DAOA 1PN3A 5CA0A 2YFYA 2WINI 4R68A 2J9FB 2BT4A 2VP6A 3IXQA 4NAUA 3B5JA 3PSHA 2Y9PB 4W5NA 1YMQA 5TARA 3INGA 3D0KA 3LVQE 2DT5A 2ZTVA 3S0JA 2PJRA 2BJHA 2EL7A 3VU1A 1G5QA 2QJOA 3KT6A 1OHHD 1C9KA 2VF4X 4AUNA 5CB4A 3OMWA 2CVFA 2V8BA 3GRUA 3GEGA 1LS6A 1V39A 2YHIA 3AEQA 3M89A 4POOA 1DEHA 1KBZA 2VJPA 5A03A 5FNVA 4BNFA 1A82A 1EB9A 2ZIGA 3BWVA 2I2XB 1ZYUA 4ARIA 3QI2A 3RANA 4F4DA 5B3KA 4CKZA 5K6RA 3VYUB 1C1XA 3QELB 2G0AA 4LSWA 5DKFA 2PMDA 1KERA 1RI1A 5I7AA 3IJRA 2Y93A 4KN8A 3CPHA 5DTIA 4KR9A 4Z3OA 1YDFA 1K06A 2XOKD 5DK6A 3V80A 1NJ6A 4NS1A 2MYPA 3CLHA 4YEDA 1NBME 2G1UA 2H7XA 4KVZA 4YR9A 1I30A 4R2JA 3TECE 3KPUA 4INPA 1GUDA 4NATA 4FCCA 4NRDA 2D5IA 3G2JA 4G1UC 1U1FA 4PO9A 3W8DA 4RTLA 2ZYTX 2VFAA 1KDTA 3IAS1 4H7EA 4BFVA 3CNQS 1GZVA 2JHPA 2IEIA 5BQOA 3UJDA 5J4KA 1V2HE 4IYRA 4DG9A 2EDCA 2XRYA 4XYEA 3I6ZA 1VLZA 3LX6A 4B76A 2JGAA 2GPYA 3GLHB 4WFJA 2W6JA 2DGDA 3BDIA 1ZZGA 3CX7A 4QGFA 4X20B 2C7OA 3DE6X 3AQIA 1C7ZA 4NU5A 1XV5A 2F8MA 2XD4A 1T13A 1W25A 4Q4DA 3NDRA 1U9CA 3OE7A 1QF9A 3KV3O 5IXYA 1SBTA 1CYDA 1WSBA 2QLLA 1G21A 5A02A 1JDSA 4YCSA 1NXPA 1XLVA 4JQYA 2I3BA 4NMXB 4WXMA 3OPYI 4FOPA 5DYWA 5IT4A 2OD9A 4ZI5A 3MWGA 4FS8A 1T15A 4MEJA 4B4WA 3U9LA 2HSDA 1NNEA 4IGEA 3GJQA 1B0UA 2JG3A 1TEZA 3AVXA 3H19A 1XDGA 1NF8A 3WFIA 3U1BA 4XR4A 2ZPUA 3JASB 3DUFB 2Q3LA 3LT1A 1NBMD 2E89A 1CB0A 1ZM7A 2P9ZA 5DE3A 3TM4A 1CCWA 4QU0A 1MG0A 3HABA 4EPWA 3UFXB 3ND6A 5IKOA 2RAFA 3NORA 1O57A 1NXSA 3H0CA 4JITA 4KAFA 5DT2A 2Y8EA 3IP5A 2ASVA 2FHPA 2VQSA 4XQGA 4FE3A 1HYQA 3KL4A 1ADGA 2IS6A 2Y0PA 2YRFA 2XDYA 4MA5A 2R44A 5FL7A 3JZDA 2NUPB 4YRQA 4GOND 2QJWA 5IDQA 3N5KA 3C3KA 4KH1A 3DZKA 4DJAA 3BT7A 5L4NA 3P1JA 2QTNA 2FPIA 2WWWA 4Q1BA 4C07A 1EUQA 2QGNA 3TNLA 1Q1NA 5IVIA 1B2RA 2JLCA 4EA6A 4EZEA 4ZQCB 3E82A 3UCXA 4E33A 3MT7A 4P3YA 3NJ4A 4MXDA 4H35A 4Q3CA 1AV6A 2AX4A 3P9NA 5EIFA 1DV2A 4NZZA 2G3YA 2JI6A 4G0NA 3U7IA 2GA9A 2FWBA 2OR3A 2RJ3A 3A37A 3C0KA 1TJNA 3DNMA 1NZDA 2P4EA 4UM7A 5DF1A 4DVJA 1VYUA 3L6UA 1FUKA 1XZCA 1AURA 1SELA 2ZE6A 4V0QA 2J3JA 4V2UA 3O8LA 2OZEA 1JIUA 2VBIA 1BWQA 1IEQA 2A0YA 2IEYA 3CRNA 3EGVA 4FFMA 3TIIA 4A2PA 4DXAA 1A9RA 2QPLA 2VT3A 3BE5A 2C4VA 3DHVA 3MPUA 1JH8A 2HRBA 2P7IA 2YWJA 3VFDA 2W43A 5CG1A 3D54D 4A0RA 1Y3HA 3D8BA 4U2DA 1W5TA 4M9RA 4Z5XA 5KOYA 5FWDA 1N33B 1EE9A 3SG0A 1QBKC 5AK5A 3ZWKA 5LQKA 1ISHA 5GZ6A 1XQ1A 4LXXA 4RS4A 2X0NA 5FOWA 2CLLB 2CZQA 2VZ8A 2C59A 1DXYA 2YC4C 3EG5A 3G2KA 3E15A 4YASA 3T3PB 2W00A 1RKBA 3B85A 1YZQA 1H2FA 1DUIA 1RYDA 2Q62A 3M83A 1T0BA 1L6IA 1PT5A 3KEOA 5ALHA 5CK5A 5IAJA 3BXXA 5IYZA 5EXEA 3X43A 2CJYA 2LW7A 2HMVA 4M8SA 4OI4A 5HDBB 4GKKB 4C01A 4WESA 2DWOA 2H1SA 3H5TA 1T5DX 3JWEA 5EFZA 4MLCA 1TQDA 4ZN6A 2Q5HA 2ID4A 2W4IA 4MA0A 3WQSB 3ZY3A 4DV7B 3UHFA 2WZDA 3UMRA 1ZWKA 2QA5A 5LVAA 2I3AA 3F49S 2VTBB 5GJCA 1UPXA 4XWTA 4MAMA 2VYVD 1JJVA 3WZ2A 4PZ0A 3G89A 1UBKS 2Z04A 4RIGA 4Q1CA 3RTBA 2ZYWX 3W7AA 1J99A 1FP6A 3L2OB 1FL9A 1UJ2A 1BMTA 1M2GA 4YPOA 3QPUA 5EL0A 1SUFA 1UJ5A 2NZXA 3RFVA 3CCFA 3OZBA 4EAQA 1R5NA 4MR9B 4YDSA 3ROQA 5M29A 2V5VA 3WR5A 1Z88A 1QUEA 1XU7A 4CV3A 1GSOA 5KWJA 2D3WA 1G6HA 5KNCD 2CV1A 2OMEA 3ETEA 3JQGB 2IP2A 1UEIA 4DLRA 1PKXA 3KQKA 1ZFNA 2XUPA 1TAQA 1OA0A 1NN5A 2HOQA 2VWQA 1KJNA 1E3TA 3IDAA 4OHPA 3S1LA 2G28A 3TD6A 1SKAA 1DRVA 4QUGA 3WRYA 4F8JA 2K7ZA 3P4YA 5BSVA 1ZVVA 2A86A 2J9XB 3QV2A 4I6GA 3UNXA 1K1EA 4QT4A 1GGFA 2NUAA 1R8YA 3KFLA 3L0PA 3OFVA 5EOVA 3EUAA 1II8B 4XYGA 4WZBA 2C9MA 3FB1A 4UATA 3TF5A 3CJRA 3U81A 4YRCA 3SS9X 1CE8B 4JJ7A 3ZDRA 1MB2A 1MRZA 1NIJA 3RBXA 5GTDA 2W2OA 2NU6B 4KTVE 4KV9A 1EXDA 5I9LA 2KYRA 1F17A 1YIAA 1W88B 3Q41A 5TGDA 1D5CA 1JPUA 3AJ9A 1EGAA 2NUTB 2AMJA 3LRPA 4NEHB 2BELA 1PI3A 5EVCA 2PD3A 3N2NA 1NOKA 4JC8A 4FDLA 2ZJ0A 3QFCA 4INJA 5G1NA 2PNJA 1D7OA 2HPAA 1M34B 1CS4C 4DLUA 4RV9A 2TMGA 1P0PA 1WUKS 2XMSA 3ZGNA 4LPSA 4QSMA 2ZANA 4LJRA 2Z3WA 1CSEE 4P3OA 5C1IA 3I0ZA 1FXUA 3P9SA 3HXMA 1FUEA 2W6OA 3O6VA 2YFHA 1ADCA 2F1OA 4J3NA 4ZVTA 6NULA 2PAFA 3RFFA 1TUGA 1PNTA 1FW6A 1FMTA 2XCUA 1UQTA 4KGVA 5KYNA 1SQ0A 4XUDA 1QGYA 1TCCA 2UVPB 5LYJA 1LVGA 2I67A 1RW4A 2ZSJA 3RBAA 3ZV7A 3PR1A 4UKDA 2WT8A 5F1PA 3T99A 1DKRA 3BMOA 3HJFA 2X0EA 2GRUA 4TV8F 7GPBA 2A8YA 4B1FA 2B9VA 1DOAA 2AOWA 4FQ7A 3ZCRA 4I4TF 4M1ZA 4PC1A 3WYAA 4DHWA 1CUGA 2EU8A 2VPZA 2BMWA 4YLEA 5EJEA 3M5DA 2WJVA 2CNWD 4X62B 3ZW7A 4ES6A 1N57A 3NHSA 3VPHA 4D57A 1F5NA 1JLLA 4OO3A 2YYAA 3JZFA 1L8XA 3CJQA 3DW1X 3D9QX 3OLCX 1YFZA 4ND1A 3A6DA 4RK6A 1YZHA 1AKUA 4YP6A 2IK8A 3TW8B 4KXUA 1O95A 6YASA 1SC6A 4PV7A 1U9YA 1AGXA 4HO1X 2ZB8A 3KB1A 4DR1B 1WKVA 2J9GA 1KVTA 3ZQUA 5I7EA 4UE6A 2XNDD 2C9CA 1IE3A 4ZI7B 2VJYA 2FUCA 2PL5A 4YAJA 3TL2A 1VFNA 4RSHA 2FN9A 2YBEA 4UDOA 1H3EA 4MS4A 2J9YB 4Z4CA 4BNHA 3RHSA 3SJZA 4RK0A 2AC2A 1LKZA 3HFSA 1XHLA 4IIHA 1NMSA 3WMFA 4G23A 3VVLA 1OV4A 2QYHA 3EDQA 2ZG6A 1EZZA 1YGYA 3LLSA 4KQXA 4CQJA 3VR4H 4LOIA 1MV8A 1WA5A 4FYIA 4B74A 3OF5A 1PG5A 1U9ZA 4C2AA 5B64A 1XMXA 3H1TA 2VPQA 5LB4A 2ZRHA 4KN6A 1EK1A 1AQYA 1E61A 3VZQA 1W19A 2QG4A 3MK31 4EVRA 2FP3A 4FXOA 4OB6A 1W1WA 4JUIA 5I8PA 2R6FA 4QLAA 3OIUA 7MDHA 5AW2A 2YOGA 1BO6A 4NMLA 4C1BA 4CTKA 2OB2A 1UM9B 4PYJA 4FYKA 3H83A 1UDBA 4JDPA 5DM2A 5TE9A 1ZISA 2YYSA 4X1IA 5IH7A 4YTEA 2GKGA 1OOEA 1USIA 2A6PA 4NSNA 4ZVKA 2I6UA 1RWVA 4DJTA 1HZZA 3S1SA 1KEKA 5IX8A 2PZLA 1LZLA 4URXR 1K5GA 2H11A 1CERA 4TXMA 1H4VB 1BE1A 4WPGA 1DT3A 1SOMA 2BCGY 4KNWA 4PW0A 5F7XA 2JARA 3R7NA 3WWPA 4LV8B 4X3PA 4DM7A 3CTMA 3DMFA 5EERA 5AVQA 4OGLA 3UN1A 5JMPA 1AQ6A 1LSSA 3RHFA 1NXVA 1ISSA 2H1OA 3W9UA 5DFAA 2ZKLA 3K70B 1RPNA 3LQ2A 2Y1XA 3KEFA 3EN0A 1DC3A 3FMGA 3LCRA 1SCKA 4J0DA 4MWTA 3RT1A 2ZIVB 2DPXA 1ECJA 1F06A 1E1YA 2ZUWA 3C6XA 3KKNA 4KP7A 4QLOA 5JT1A 4WADA 1Y4SA 3H5IA 3VO9A 3G9TA 3RJTA 1I4WA 3T5AA 4RQTA 4QJ4A 3NAGA 4ZCSA 3QNMA 4HF7A 3F71A 4FB4A 1PZNA 4JCOA 5EY5B 1L5VA 1HY3A 4R01A 4HDRA 3A14A 1GYPA 2BJWA 3TNYA 1E1RD 4G8CA 2ZK7A 4TTVA 2F8TA 3M6UA 1WU7A 1G4AE 1FFBA 4QDKA 3DHYA 3KVYA 4TMXA 1UEXC 2C95A 3E2PA 1M2KA 1YIDA 4HXFB 2NAFA 3V4FA 1BDIA 2YC2C 2GSWA 2E0IA 3QEJA 4NK5A 1AKMA 4AK9A 3HP1A 1CVIA 1D1QA 4LX0A 1ZAKA 3MTIA 1P5HA 4IDDA 4K9PA 4LMPA 2AJLI 3PEEA 4BO6A 3CZMA 4NLLA 1JAZA 2NG1A 2ZCVA 3AEUA 1PCXA 1GQSA 3ES9A 4ALLA 4CCWA 1T4BA 1M2NA 3A4TA 2A67A 3KWFA 6GPBA 1NY6A 2F6RA 5LUAA 2O3SA 3FWHA 3OURA 1JTFA 4FW8A 3UV6A 4I1RA 1ZJ6A 4YIKA 1B3BA 4MGYR 3MTQA 1ML3A 3NAZA 4R2WA 4CKYA 4B48A 1N7GA 2C04A 4HXEB 1IRIA 1U3DA 3M9WA 4DCNA 5JRZA 3GOQA 2W0MA 4QPDA 1GFWA 1PJ8A 2QBYB 5A2QA 1ACJA 3VKFA 4ZT6A 1U8FO 2H7YA 4IF6A 4M0FA 3D1VA 4DUZB 1S9HA 3I83A 3FF1A 2UUPA 1JEDA 2IE8A 1QGUB 3SZ3A 3T4PA 1YS9A 4CF3A 3QUTA 4OHFA 2PLNA 4UBJA 1YDWA 2G88A 4ARZB 3X44A 2PGOA 1T24A 2WFLA 2ZFUA 1B00A 1VKZA 3NYQA 2RHGB 2JBWA 1Y8RA 4L9AA 5H3HA 2PJZA 1A9PA 5CT5A 3IDSA 4CWAA 5DPMA 4EUFA 1WV0A 4QUBA 3EOAI 1DFGA 4RTJA 4OHBA 1YFJA 3PD7A 3KIPA 4YACA 421PA 1U2GC 3E3AA 1ST2A 2YWXA 3ABZA 2HTEA 4H7PA 4O2BF 1UBLS 2OFXA 1QP8A 3L8FA 1IN8A 1KYZA 2MYTA 4J29A 4PHTA 4U02A 4RELA 3V3KA 2JBHA 4BMCA 2YH2A 4P81A 1XKXA 1VCMA 4G6ZA 3UMGA 2FP4A 1PSZA 3VNRA 1TW2A 4A03A 2OV6A 1NI4A 1GVNB 1X19A 3AEKB 2JGIA 1O97D 1RD4A 5THQA 3RREA 1NT2A 4GQIA 1GR1A 3WWEA 3I9MA 4B9AA 1D09A 1F1JA 1QGAA 1ZK1A 2EKDA 4IILA 3EXFA 5F64A 3QJYA 5BYBA 3KSUA 1YE5A 1E1DA 1KDVA 3SR0A 4DRZA 3QH4A 3U3OA 2QXYA 1TKBA 1EDOA 2PU7A 5CW2A 4L08A 3RK1A 4DT1B 2MSCB 1XL1A 1XTRA 3HP7A 1AK2A 1K8ZB 4IH4A 4F86A 5IULC 4L4UA 5FBWB 2P9EA 3VBEA 2F17A 2GM3A 2ZPTX 3TW0A 4BKMA 4UQLA 3FPAA 3B1WA 4Q21A 3CW9A 1A4RA 1O1YA 1LB1B 1N7HA 4M89A 5T6BA 3N3AC 4WOCA 1SOWA 3SNHA 2Q8NA 2WU4A 5B1DA 1NSFA 2GA8A 1KAGA 4P92A 4OGWA 3PCTA 4QX6A 1ODTC 4Y2QA 1K7FB 2X0KA 3BZUA 4BGEA 5HKKA 1X8KA 4RA9B 3SQDA 1DAMA 3THOA 4JGIA 2JAOA 4L02A 4R1UA 3ZK9A 4DCOA 2HIAA 1OREA 2K5UA 5CR9A 1BVHA 5CVCA 4OQMA 1XCJA 3QUQA 1NVBA 2XHZA 3WGNA 4DIEA 5HK8A 2QTGA 1BCSA 1OGJA 2M32A 1O03A 1XEXA 5C9ZA 2IYAA 1GU1A 4HNRA 4C0QC 1OAOA 1WPXA 4D3XA 5LM3A 2ZAOA 1KMMA 1QFZA 2B3DA 2ZBGA 1IDOA 4MVWA 1IXYA 4BJ5A 3N5CA 2V0CA 3SF8B 3CUWA 1L7AA 4E30A 1FVHA 1TKAA 3NDBB 1SRQA 3EAFA 3QOWA 1WEKA 3FX2A 3G2PA 2NZ2A 3FI9A 3ZU2A 1RWBA 1Y7PA 2J45A 1FEZA 3RS2A 4RD0A 4BV3A 3IQWA 3Q1KA 4X92A 2Y1CA 4GZ3A 1WTAA 1ZRNA 1N5RA 2JK1A 2VATA 3LY8A 3JQ9C 5KOJA 3CHYA 3QBEA 3WISA 2XWPA 3A58B 3L4EA 5AVVA 1XD8A 1KETA 2WJ3A 3QUCA 5H81A 4MH0R 1NVUQ 1RWPA 1TJYA 1UXKA 3JY6A 4ABYA 3RSSA 2O8DA 1VCOA 1D6SA 3D5EA 1PEYA 5L4LA 5JEDA 4WXEA 1Q84A 3V4VB 2RH5A 3EUEA 2RB5A 3AVPA 4X95A 5DNYB 1KI7A 4LMBA 4D98A 3V3TA 1SN7A 3GBVA 4PNHA 4I55A 3BWMA 1QG6A 3BX1A 4K05A 5J9FA 1IWBB 3R6LA 3KTAA 3VV3A 2LIPA 2XYPA 4MHTA 2EP5A 3H8WA 3RC1A 4CBVA 4E07A 3V7YA 4CEHA 3X1WA 4LOAA 1BA2A 1F8FA 4GP6A 5JCPA 5GWXA 3UUWA 5IPFA 1XPJA 3LPDA 3RROA 4M9XA 4UAJA 4PZAA 2IITA 3EFHA 4M3NA 4MVYA 4RHEA 4F93B 3SIRA 3PHJA 3GFGA 4EECA 2ZSEA 4FVTA 4WN9A 4W6ZA 1MPXA 4JXXA 1G1AA 4M36A 4PAWA 4B7ZA 2IYOA 2OKCA 2BFDA 3E6AA 3O9VA 4MRAA 2QSYA 2JGNA 2X4IA 4OMCA 2TMYA 3DHWC 4YP5A 4BNJA 1Y8QA 5FX2A 2NZWA 3RTEA 1UK8A 4G0OA 5LLTA 3FRHA 1TKRA 3KKLA 1YB1A 1ZSVA 1YRYE 4CQLB 3X1MA 1WSWA 3RVNA 5FB3A 2AG5A 3U7FB 4IDNA 5LPNA 1O7JA 1PDOA 4M8IA 4Y9DA 2QUJA 4XIIA 3MAAC 1RM4A 3EZFA 5FQNA 3FMVA 3OEYA 5HILA 4Q6BA 3PU6A 2GESA 5AVJA 2IGBA 3QMVA 4WIAA 2P2LA 1GTL1 3RHZA 1OZAA 3ACBA 1S2DA 2IOYA 3N70A 4Z8XA 5IVKA 3FPBA 4QO7A 4WXPA 5LP6A 1A9QA 2GF0A 4JMPA 4CZ2A 1AF7A 4AKIA 1YR9A 3GZJA 1JQAA 3K72B 4XUEA 3KZCA 5KTOA 2ENWA 3V1UA 3IAFA 4MPPA 4NU6A 2F00A 2QAIA 1CHDA 2IYFA 2O9JA 3CPSA 4BLWA 3EVCA 4GFDA 4CEJB 3L1HA 3MGGA 3JD1A 4GWKA 3TSWA 1YQ9A 2ZULA 1AB5A 3AETB 5DT9A 5CFOA 1V1MA 1W4RA 4OM8A 1TVKB 4K1XA 3M9LA 3TX2A 5B6IA 5FTLA 3U09A 7MHTA 4EKIA 1NR7A 5FV4A 3O3NB 1TM5E 1E3JA 1S8AA 1IOZA 3UB2A 2VP4A 3L3BA 4A7PA 3ABSB 1M7BA 2A7QA 3OO1A 3T7KA 5BUCA 5IABA 1E77A 2BV3A 2XXJA 3ZDBA 1B74A 5H82A 4G1FA 4HGYA 4DSTA 5LMCA 3DW3X 1VJ0A 2HHAA 1ZKDA 3ECCA 2PZ8A 5AJUA 4KAAA 1SU4A 4N8DA 5L53A 1NW3A 2ATIA 3IA2A 4NNPA 1CDEA 3PENA 2TMKA 4IF4A 3PL5A 3I1FA 3I04A 4P4UA 1ZD2P 2B82A 3NH6A 1O4WA 3KZVA 4XFJA 1YCHA 1X7XB 1ZH6A 2AYXA 5KDLA 3UMMA 1B6TA 2QL9A 2IUUA 5JASA 3HVIA 5A3RA 1SKMA 1IHYA 4YLGA 2LKCA 4L4ZA 1JEQA 3SVZA 1UKVY 4V39A 3TVTA 4O3MA 5A2GA 3JAWB 3MM4A 4NFHA 2EKQA 2OXFA 4CL0A 4D4LA 3L7YA 1OU0A 1KY5A 1V8ZA 2WA2A 5FPYA 4NZMA 5UKDA 3T9AA 1T8SA 4I3HA 4I1VA 1F7VA 2P9BA 4CLOA 2QMOA 1GAQA 2APJA 1T8UA 2ATCA 3L9WA 2DBVO 2GILA 3Q8MA 3TAUA 2CNDA 3ADPA 3K32A 2HWWA 4E5YA 1JXAA 1D2AA 1XKTA 2EHJA 4LBZA 4HFMA 1GJRA 4JBLA 1Q22A 4TVKA 3MRSA 4Z0TA 4QXMA 3WLIA 1JHVA 3D7LA 2JJ1A 2ZSFA 2HU7A 3H11A 2QOEA 5FEUA 3HWX1 4LJYA 1E9EA 1J8YF 4MW7A 1BTOA 2NVBA 2VHQA 5CA0F 2EOAA 1NIPA 1V4BA 1XVUA 2FZWA 3WL6A 1E2DA 1EGMB 5FFMA 2QZPA 3DV0A 1MJHA 4NCBA 4F4FA 1KI2A 4MPDA 2YHBA 3WGOA 4KQ6A 1M6HA 1R8XA 3FETA 1WUHS 1UAGA 3OCXA 3P9CA 4K2AA 3JTMA 4J7AA 5BR8B 3LOUA 2VQDA 3QXSA 4WZZA 3T95A 3ILSA 3BMCB 3I6IA 4E2FA 4YYZA 1TVMA 2IZ0A 1JUDA 5TB5A 2GZ3A 4UNRA 3ER8A 4KMRA 4NDNE 5DX1A 3AKDA 1LDYA 1X39A 3LFTA 5FNVF 3SEZA 4EJSB 3MINA 3FLMA 4GKVA 4NFYA 2XCQA 4PCVA 5AKYA 1BDJA 4B3SB 1VBKA 1B93A 5BVGB 4CIWA 3BIXA 1W4ZA 1TJ5A 2VPWA 3WDLA 4D42A 5A04A 3IEMA 1YZYA 1KDOA 3HWSA 1Z7YA 4FGZA 5JNRA 2OM6A 1BD4A 3GIWA 4UARA 3T9DA 1P1KA 4ZQHA 4GQBA 2G9QA 3UIEA 2D0DA 1EAYA 2NSYA 1EVIA 2A9JA 2PYIA 1BMFD 3KQLA 1UXHA 4YA6A 1HNNA 4X91A 4CMEC 5C2JB 5ER6A 4CKWA 1VYTA 2JIBA 4GVPA 4CMHA 4DWOA 1JFTA 2Q1UA 2EARA 2HA2A 2V5AA 2ZTSA 3AZQA 3CRVA 3R23A 5JD6A 2NV0A 4FKBA 1FS4A 3MMSA 5BVHB 1I14A 3RRYA 2QTLA 5CXXA 3A6GA 1GUBA 1G0OA 1XR3A 5KHOC 4PLGA 3STYA 3EGDB 1PK7A 4K7JA 4B6PA 1EFTA 1TT5A 2GBFA 2I4RA 1R88A 3PUJA 3E03A 5C7OO 4Q9AA 4OLHA 1RSZA 1YD7A 5FT9A 1MX9A 2F1RA 5EJ6A 3CVUA 1KHTA 2IVZA 4OHOA 4RL6A 1GL7A 5AH0A 5L7WA 3GGGA 2J3IA 1HNWB 2VZ0A 1DAEA 2WD8A 4BE4A 2X7HA 2FN7A 3FTQA 4G0ZA 5BNZA 5LFAA 1MJFA 2NZUG 5EWJA 5KI6A 2RBEA 1LPOA 2NXWA 1CQXA 3CPJB 3HKDA 2BL4A 3HA2A 4NQZA 4B3HA 2Y05A 1CBUA 1U1CA 1OJLA 2Y4NA 4TV8B 1T0JB 2OBMA 1XVTA 3A25A 4EHLA 2HMTA 2C7QA 4FYWA 1BJKA 4G36A 4I4TB 4Y2UA 2WM8A 4MKZA 3I8SA 3QPCA 2ODEA 2J07A 2UYHA 3SHVA 4WUTA 1RJ9B 2Q8QA 1H6AA 7REQB 2B8NA 1FRVA 4UBMA 3E4CA 4L8VA 3I8XA 3V8EA 1Z13A 1EXWA 2Y1GA 2HU8A 1XZJA 1YB4A 3AVQA 4D79A 1WZUA 3T4XA 2V6IA 2ZM6B 5LB2A 4M60A 1SVWA 5A7FA 1SUEA 3H8VA 2ATXA 4K9SA 3ENZA 4G4SP 1KL7A 4YI5A 3PT5A 4OHKA 3NDJA 1G2PA 2JGLA 3C6KA 3LXRA 3MTEA 2YJ6A 3PG5A 5F3RA 3T38A 1AZTA 4ER3A 4KOAA 4TSFA 5CAEA 3QE3A 5AI8A 5JE8A 4Z2YA 1CJSA 1JZQA 4IMRA 2H92A 1D04A 4UULA 5LXTA 2RGRA 2BM1A 3CUUA 3KQSA 1WS6A 2I7TA 2JBAA 4GAEA 5ANRB 5KYGA 1P5ZB 3D43A 3PXCX 5SZJA 1JJAA 4ZJYA 2OG2A 1NBWB 2C1XA 2AW5A 1X9GA 2XTZA 4G8DA 2W2QA 3T0FA 3I61A 3OP1A 2VA9A 3GEEA 3LPMA 4E7OA 5KDOA 5DBOA 4ZMBA 5LC1A 2PBFA 4MGZR 2B4YA 5BWLA 1U4NA 1RC0A 3NHBA 1YZNA 4MEBA 3UKJA 4IX1A 2VNAA 4JB0A 2WYHA 3UWSA 3NHUA 1ZAYA 4C0SA 4D8XA 4XWOA 1OY1A 2IYQA 1NE2A 1ZL2A 2H54A 2RHDA 3NVAA 3FH0A 3UPTA 1YZTA 3E9NA 4ZDJA 1U8CB 3JQ7B 1H2XA 4JL8A 4M88A 4Q3LA 5LLSA 4R71A 5B4VA 1WX1A 3OJOA 4WZ6A 2W2TA 3FHLA 4LZAA 1V43A 3SMVA 1UFOA 2E48A 4J7XA 2WUVA 2HY7A 3MWYW 4GBGA 4JHXA 4MCIA 3EEYA 1ESEA 4D8UA 1XZBA 5KYWA 4J0KA 1NG9A 2A5GA 4FIDA 3HPQA 5IYZF 4EO4A 5DP1A 3UHAA 3RPEA 2EW2A 1RJDA 4XX0A 4ZO4A 1KZ7B 3GO4A 2A4KA 4C0JA 5FWYA 3C3PA 1ZJ4A 3UH1A 2CDRA 4ALJA 1OLXB 2GHIA 1RAEA 2W2KA 4KDCA 2JI8A 2Z5GA 4MUIA 3DAHA 3TTVA 4ZZIA 2V6BA 2IIBA 1OAKA 3OE5A 5AYVA 3ZDXB 5CFZA 2KBFA 2XZPA 2QYTA 3SAJA 2YCBA 1G63A 1TFRA 2YTZA 2ZTLA 3I58A 4RVOA 4UBLA 1C4XA 4IDBA 2YICA 2MSWA 4OHZA 2COEA 1B41A 3O7WA 2DUMA 2GPSA 4CKBA 1CR4A 2VNSA 3IERA 5EJ7A 5B3JA 1SOUA 4HDKA 1P7CA 3L84A 1DIGA 5FPKA 2UUOA 1U9JA 5CX4A 4DTCA 3TMYA 3LRTA 5K0JA 1U63A 1RLOA 3PB3A 4L9WA 4PSAA 1WBBA 1XEAA 5A7HA 4Y0AA 2HGSA 1Z8FA 4GE0A 5BR1A 2KI5A 2AZDA 3H3XA 3UUFA 4WACA 4XYBA 4RPJA 3FZEA 2IF2A 3ITEA 2BUCA 1N2XA 3H4IA 1L5FA 1E79A 2IDZA 2J09A 4J76A 1Q2XA 3DF9A 4TQGA 4CMJA 2ONKA 4G26A 4M0PA 1SC1A 1ZN9A 1GKIA 1HT0A 3JQ6A 5KQLA 2WTBA 13PKA 2R6GA 2C7PA 5G4LA 5HP4A 3SC3A 3N8KA 1L7VC 4JT9A 4P4NA 1ZCFA 3N2LA 3UOAB 3NYWA 4HK4A 4KWEA 5J40A 3WNQA 1V16B 2XYGA 3VUEA 3T1QA 1AT1A 1O58A 4GMDA 4UW9A 2H1LA 3ANNA 2WWYA 4I5EA 3VPGA 5CK4A 4BZWA 3VSBA 1ORDA 4UBIA 1E5QA 2ZKIA 1V8FA 4DTIA 1TTHA 1VLMA 1TCAA 1VDMA 4ND4A 3T41A 3D3WA 2FMIA 3EZYA 3I32A 3TQHA 3Q2KA 2R85A 1Y3CE 2QMYA 1DJNA 2QX8A 4PC6A 3QUSA 1URPA 2JVJA 2V4MA 4EATA 2A33A 3F7TA 3CVVA 1G0NA 3LCVB 3ASZA 5ULLA 5A4AA 1F8GA 1B0AA 4IPTA 4WLEA 4QU5A 3F6YA 2Q3MA 1T36A 2PSFA 4DXDA 2IZ1A 1NLMA 4DA4A 1T1GA 4QWWA 5BQFA 5ALZA 4FSXA 1MFZA 1P91A 1Y6QA 1QR6A 1Q7CA 1YJ8A 2X9LA 4LMRA 3GMSA 5KSPA 5IJWA 3ZCTA 1G3QA 4IIJF 3UMBA 3ZTYA 1NN3A 1AHHA 3E9QA 5E6UB 2NUBA 4YDHB 5THKA 4CMGA 3WI7A 4O2BB 4PPYA 3SJ7A 2A35A 2BEVA 4MI9A 5FOTA 3RIMA 4FC7A 5LLDA 5CYGA 4KLRA 2Z0MA 1TC1A 1SCAA 3NRBA 1WOYA 3C3WA 4AKHA 1NJ2A 1JQ5A 4MB0A 1T4MA 2OV4A 3AUXA 4JJ8A 4MTCA 3HYCA 5FUBA 4KL8S 4EMSA 4YGXB 3WKEA 4MDFA 1VI6A 2MJLA 2IPXA 3KYDB 1WSAA 2XTNA 3OU6A 4ZAXA 1B4DA 1EB8A 2ZBEA 1FSGA 2ID9A 2Z2IA 2Z8XA 3OT4A 3G5UA 3O8OB 3VPXA 4JLJA 1IHPA 2HGZA 2I2BA 2AFHA 2B25A 4X64B 4PEVA 5FWAA 1U0RA 3DJYA 4RZUA 4B5KA 1SUCA 1S0UA 1RADA 3GUUA 3P9PA 2QPOA 4JOSA 1G3UA 4XQ0A 5G02A 1NONA 3AR9A 3G9XA 1QO7A 1Z22A 1U9IA 3BRWD 3ZIUA 4QFCA 4B8ZA 3U4GA 4DCTA 1XTZA 2VRWA 3DDCA 1EUYA 1U3CA 1FLDA 1BXGA 1RLUA 2NT3A 3BGVA 4IOLA 3OWXA 5A7GA 3VDXA 4C2UA 5BW5A 1N5IA 3E58A 3GA5A 1IN1A 2GN8A 1SXIA 1YS6A 3WMWA 4L0DA 2R25B 1GCGA 3R77A 1JIIA 4URZR 4JXJA 4DLAA 2LCQA 2DH5A 1ZM4A 2I6GA 3ZDZB 1C0IA 4WBNA 3A2MA 3GGPA 1WXIA 5E7JA 5E3JA 1E59A 2F62A 4K8RB 1O4VA 4PLHA 3WSVA 2QTTA 4IYJA 1N1EA 1XZDA 3FTNA 2GZMA 1ACLA 2BLNA 3GLHE 1V8DA 3I52A 2B7LA 4I5IA 4PQEA 2IT1A 1T34A 5LZ7A 2DZDA 1LRLA 2XMDA 3R7FA 3L8HA 4RPHA 1FIUA 4ZVMA 2J6CA 2P8JA 4J7UA 3VKGA 3N2GA 4DIMA 2J85A 2XUOA 3DTTA 4ONEA 4JASB 3BFKA 1ZO8A 1PFQA 4L22A 3UJ9A 1Z2NX 5K8VA 3KVNA 3AR5A 3M2PA 2EYUA 2EGGA 4RANA 2G72A 2G1JA 1FFAA 4XZ3A 5IXJA 2IH4A 4BO5A 3QEMA 2QTZA 1N9ZA 4HTFA 3MEQA 3NTUA 2HQRA 2XD9A 4AD8A 2W2LD 3A6KA 1JB1A 1SD5A 3PR2B 4IM7A 4CMBA 4HNVA 5G4KB 1GYQA 2HU5A 4JKYA 2AEJA 1D4ZA 4WLFA 2DAPA 4X41A 3UK6A 1QLJA 5BYJA 2VKTA 2D00A 1AQUA 2V65A 1RKVA 4ARVA 1X13A 4CG0A 1CUDA 2B37A 2E37A 4IHQA 2PRKA 4XM1A 4Z6KA 1JHOA 2W2NA 1DCMA 1ZD8A 1P6QA 1ADFA 4BLRA 5IVHA 2XUGA 1DTSA 1QIFA 4JT2A 5AICA 1TU0A 2OXIA 2WJZB 3A26A 3AHEA 3I73A 1KI6A 1P7VA 4G89A 2VRNA 5KOHA 5ILGA 1PTJC 3GB9A 4ZVRA 3RV3A 4CM7A 1ZIXA 2Q3BA 3IUEA 1N4DA 3K0FB 3LO8A 3SK0A 4FYXA 3G1WA 2R48A 3ZXSA 1JAHA 2ZR9A 1SD1A