4CQMB

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
232
Chain Sequence
HHHHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 68
structure length 232
sequence length 241
chains with identical sequence C, F, G, J, K, N, O
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmB00
3NKLA 1PJ3A 1VI2A 1O89A 1U9JA 1ARZA 1T4BA 3CE6A 4YACA 2PD6A 4YJFA 1Q0QA 1ML3A 4BNLA 2JCYA 2YFHA 4B3JA 3VZRA 4AJIA 4J2HA 4AVYA 1XA0A 3IS3A 2OOSA 1XCBA 1H9BA 1Y8QA 2WE7A 2A35A 3L9WA 2ZB3A 4E4YA 1ZIDA 4B3HA 3L0DA 1A7KA 4N5NA 4GX0A 2WYVA 3KRTA 4MP6A 5J23A 1UDAA 5BNFA 3KEQA 2FZWA 4Y6PA 1EBFA 4FFNA 1Q7GA 3A06A 4UAGA 4D0RA 4PLZA 1ZH8A 1ENYA 3QLJA 4UREA 3R1IA 4BO6A 3QVWA 2X9GA 4XJSA 1HE3A 1YXMA 4PG6A 4ESOA 5DP2A 1U2GA 1KIFA 3U09A 1XU9A 2C5AA 3IAHA 4TROA 3FTNA 3OBBA 4LSMA 4DLLA 1I3KA 3R3SA 5BSEA 2YJZA 3GC6A 3F5SA 3OMLA 4XKJA 2QRLA 1N7HA 3DMYA 3IIEA 4R01A 2NVWA 3FWZA 5KTKA 4IDEA 3DTYA 4BQPA 2JKVA 1HTBA 2NUAA 4RF2A 4K1LA 2DU8A 1X1EA 4J1TA 1DIHA 1E6UA 1UXIA 4LRSB 3BTOA 1Y6JA 1KC3A 3DHEA 3PTZA 4IDAA 1XLTA 2X9NA 1G1AA 4K6CA 4XA8A 2IE0A 5JAIA 3FI9A 3MCVA 3GNTA 2OMEA 1LDBA 4J0EA 4J16A 3UFXA 2DT5A 5TQVA 5JAZA 3ORFA 5AVOA 3O38A 1GEGA 3QSGA 4CQMD 4WKGA 1I32A 1YGYA 1PWXA 2V6GA 3A4VA 1Z7EA 2WYWA 3Q2KA 4H3VA 4XYGA 5I8WA 2Y1FA 3DZIA 2ZKLA 3LF2A 4ZJUA 3JQCA 5K9ZA 5EIOA 4MP8A 3F1KA 4RPHA 4WE3A 3JQ7B 1SEVA 3DZBA 4H15A 4L0QA 2WD7A 3NAQA 1R4NA 4U5QA 5U4QA 4MVJA 4P22A 2VN8A 1B7GO 1AHIA 3ETDA 4FDAA 5ES3A 1LBEA 5BT9A 3Q11A 4F6CA 4WCFB 2G1UA 3ZNPA 1MV8A 3TDKA 4E5YA 1HDCA 2C5EA 5T5QA 1Q1NA 3QWHA 4XGIA 1PR3A 3E9MA 4XQCA 2IYOA 3OIFA 1IZ0A 4RLSA 1GV1A 5FEUA 2HJSA 1BW9A 1LDYA 3OEWA 4IINA 1Q0HA 4CL8A 5F1KA 4BVAA 3GVXA 3GNSA 1KY5A 3KTDA 4B3IA 1TT5A 3W6UA 5IDYA 3RI3A 4BNUA 2A92A 4KZPA 4OM8A 2PD4A 1BWSA 4GI2A 4OL9A 4XQ9A 2GF2A 5EERA 3TWOA 3AU9A 3D3WA 3SXPA 4R9RA 2DUUA 3DBVO 3R0IA 4M8SA 2PZKA 1TEHA 3MJSA 4A73A 2B37A 4WLOA 4AJLA 1QYCA 5DZSA 3LC2O 4G5HA 4MDHA 1V3VA 2C7GA 3K6JA 2DAPA 2EJVA 3PLRA 4L73A 3DFZA 4IDBA 4IJUA 1R66A 4CJXA 1KY4A 4JBIA 4NJOA 2IXBA 4I5DA 4NBUA 5FWNA 3HB5X 4DREA 3ANNA 4JX8A 4UEJA 4R1TA 3ZW8A 4KDFA 5K6AC 1JKFA 1HYHA 3RUEA 5JY1A 3DXFA 5C7IO 1VL6A 1DHTA 3PGXA 4J43A 3T4XA 4DL9A 4L4RA 2DTDA 2YHIB 5G0VA 3QP9A 2O3SA 4MP3A 2HO5A 3IL2A 2R6JA 4NFHA 1XEAA 9LDTA 3DAGA 3WG9A 3W8EA 3ZH2A 4P38A 1DRWA 5EJ2A 5THQA 3M1AA 2EKLA 3ENKA 1D3AA 4BKUA 4E31A 3ZWCA 1HETA 1B8PA 2NTJA 1Q7CA 4TZTA 1IZ9A 1E3WB 3DOCA 3PI7A 2X0JA 4JJGA 1N92A 4YJGB 3CPSA 3WWZA 3EW7A 4XDZA 2VWQA 1Q7BA 3VAZA 1GFSA 3BAZA 4DQVA 4HV4A 3B6ZA 3I83A 3SX2A 4L4SA 1ADBA 1DIBA 3OM9A 4RPGA 1NAHA 1W0CA 2O7SA 3SJ7A 1E1KA 3DBHB 4U6QA 3L6OO 1D7OA 3PRJA 4E2YA 2PA3A 3WNQA 2OO5A 1BGVA 1NR7A 1BXZA 4CR8A 2FHSA 4WK6A 2WWRA 2J5QA 2VRCD 3UCEA 1UZMA 3D0OA 4YA6A 2RIRA 4E5KA 2I76A 1GPJA 2CDBA 1E5QA 4RPLA 1E7WA 3BMOA 4NJMB 2EG9A 3LZ6A 4YAGA 1JKIA 3DMTC 4QTZA 4CUJA 4DBZA 2JHFA 2Q1WA 4PG7A 4NK4A 2EV9A 3WSWA 4P8RA 1U8FO 1G0NA 1GD1O 2NWQA 3RKRA 3EZYA 3RUAA 3MJCA 4CV0A 1DC4A 4EEXA 5CHEA 4F45A 1Z75A 4R51A 4HKTA 4NU6A 7ADHA 3ZWMA 2EKQA 2PY6A 1I24A 3GQVA 1X7HA 1P1JA 4W7HA 4RPJA 1FMCA 1X0XA 1T2AA 4E6PA 1IYZA 3V1TC 4MVJF 4WCFC 3ROMA 3WQQA 1BVUA 5C3MA 3F3SA 1DAPA 2V65A 3RJ5A 4CM4A 2VOJA 5CEJA 3AY3A 1V8BA 1DFIA 4R16A 1VL8A 1VSVA 4WLVA 1EQ2A 3DZGA 3EUWA 4BHTA 1YJQA 2YY7A 4DMLA 4GGPA 3ZWNA 3EC7A 4CM8A 3HQ4O 2VCYA 4YR9A 4EZBA 3AM3A 4Q39A 3I1JA 3QV1A 2BFOA 1P0FA 5IN5A 5A04A 1G0OA 1ZW1A 2RH8A 1H9AA 4NR0A 3LDHA 2C54A 4OIMA 2UAGA 1X14A 4IDFA 3ZWYA 1OMOA 4E13A 3IC5A 3AW9A 5COQA 1ZMTA 2R2GA 5TF4A 5JDIC 4O6VA 4LVUA 1R4MA 4NBVA 2X22A 4CQMA 3DL2A 5I7VA 4WCDA 4PCVA 4CLOA 1C3VA 1J0XO 1N9GA 2B0JA 3ROPA 3MZ0A 3W4IA 3KV3O 5JYDA 2HDHA 3R6DA 4L9RA 5G4LA 2E6UX 1XGKA 1FDSA 4B4WA 5TSDA 3W6ZA 3GFGA 4PLWA 1ORRA 3H9GA 4N54A 2BMAA 2Y1OA 2PGDA 3KZVA 3MTGA 3H2SA 3TZ6A 2ZCUA 3IUPA 2O2YA 4YT5A 1DBVO 1X15A 1Z7BA 2C59A 4M49A 2OORA 4IGFA 3JD1A 4IQ0A 4YJHB 5I9LA 2B4QA 1DHRA 2CFCA 2OZPA 3T7EA 3OICA 3ZGYA 4A26A 3ZV5A 2C7VA 4OJNA 2WEKA 3F47A 3FBGA 3D5TA 4CLRB 3KYBA 4ZGWA 4HUJA 4OH1A 3JQ9A 2JL1A 5A4DA 3IDSA 4J7XA 5JPIA 2IODA 2JFFA 1IOLA 1ZK1A 2GPTA 4BKPA 4ZN6A 4W6ZA 4R41A 3EGOA 4B8ZA 4WJZA 1WZEA 4PG8A 1E1NA 2QRKA 1HSOA 4DUPA 2HMSA 4YJFB 3GPIA 2CZCA 2W90A 2D4AA 2HLPA 3ZV4A 1V0JA 3B1KA 5HS4A 4L74A 1GUYA 3CIFA 2NU8A 1PZFA 4YT4A 3W8FA 1E7QA 3ON5A 2GN9A 2NQTA 1YOVB 2ZK7A 2VYVA 4CLEA 1CF2O 4M1QA 3NT2A 1YBAA 3V1YA 2OUIA 3KLPX 5AOVA 5U1PA 4BL5A 3Q9NA 3WIEA 4C4OA 5T8KC 2RHRA 1KEWA 5ICSA 2Q45A 3AU8A 3E03A 1ONPA 4CM1A 1E7MA 3E5MA 4LW8A 1B16A 1CJCA 4WLFA 1B26A 3RVDA 2AHRA 3E9QA 2G5CA 3CEAA 2RHCA 3CXRA 4PG4A 3GF4A 5L9AA 4UUPA 3JQFC 4BQRA 4J4TA 1HF3A 5F21A 5FF9A 3I52A 3TJRA 1WWKA 3WYBA 4FGWA 1UJMA 4XIYA 3K96A 3O8QB 2JAHA 1WW8A 5LDHA 2VUTA 4BGVA 4MOWA 1LDNA 1CETA 4DYVA 3GVPA 3ZV6A 4TZKA 1UP7A 4WGGA 4CODB 3NT4A 1EFKA 5TT1A 1YB5A 1DRVA 5CEFA 3PFWO 5GY7A 1DIAA 5DBFA 4HP8A 4J4BA 1GZ3A 1NBOA 1W4ZA 1CQJA 1GYPA 3RFXA 3G49A 3I4FA 1O8CA 3M2PA 3JQ6A 3TRIA 3D4NA 3NJ4A 5JCJA 5BSGA 2ZATA 3OJLA 1HRDA 3DOJA 3JD2A 1JAXA 4F3YA 3KETA 1JDJA 2ZQZA 3GDGA 4UEOA 2WYUA 4PFJA 1GZ6A 3PZBA 3IKTA 2VRCA 2EF1A 2YUTA 2WD7B 4M86A 2J3KA 3JQGA 3B70A 2DBRA 4E3ZA 2BGMA 4CV2A 1DPGA 2G0TA 5HA5A 1Y5MA 2TMGA 1BRMA 1GTMA 3H3JA 2AQ8A 3OEYA 2EW8A 1DFGA 2V6BA 4DVJA 3DC2A 2D1YA 1KVRA 2DLDA 3KYDA 1NR1A 2E48A 3GUCA 2AEJA 3H9QA 4LCJA 4XIJA 5G0WA 2EW2A 1H6DA 3HFSA 4ZHSA 5C37A 1LLCA 5AYVA 1ZO8A 5KJ6A 1GZ4A 1W6UA 4TRMA 4MVJH 4RVUA 1XDWA 4CQLB 1Y9EA 4ID9A 4IBOA 5A9SA 3VZSA 4R69A 4BO5A 5EESA 4NZ9A 1IL0A 1E92A 1WP4A 4D44A 5MDHA 3DBRA 2Q1UA 4BMSA 2ZB7A 3VKUA 1E77A 4O63O 3TOZA 4JJIA 2GZ2A 4DWVA 3ZWXA 3JYPA 3GY0A 5BQFA 1NHGA 4NFSA 2Q1TA 3CUKA 1F8GA 3FNFA 2R00C 5CDSA 1DLIA 1KEUA 4BO4A 2AMFA 5CAEA 3OQBA 1UXHA 1H6BA 4D43A 4ND5A 4I8XA 4RVFA 1MC5A 1ZCJA 3BMCA 4AJOA 4MINA 3TZQA 1WDMA 4FJ2A 3S8MA 1P44A 5H81A 2YQ4A 2Y1GA 2XAAA 2B4TO 2BD0A 4GVLA 1PQWA 1SPXA 4RF3A 1UDBA 5MGBA 2CDAA 2J5KA 5TC4A 4DC0A 5CPBA 2BI8A 5BR7A 1D1SA 3GDOA 3RC7A 2PNFA 3NTQA 2WJPA 3PWZA 3HDHA 4KUHA 3GEDA 4KTVE 2D2IA 1PL6A 2D3TA 4BS9A 3BTSA 3UICA 4RF5A 2OGUA 2NV6A 1BDBA 5T57A 5ICMA 3VPGA 3JQDA 5H82A 2UV8A 1DDOA 2HSDA 4ALMA 1J5PA 3JSAA 1EFLA 1FDWA 4R4JA 4RDHA 1EQUA 1Y7TA 5L95A 9LDBA 3FRJA 3PQFA 3H7AA 4QSMA 2GERA 1IHYA 2EWMA 3EHEA 5FI5A 3HUDA 3VDQA 1CYDA 1R16A 3LT4A 5DCWA 3CMCO 1C1XA 3NYWA 3CZRA 1MXHA 3W8DA 2AQHA 1F06A 4NBTA 2JFHA 1T2DA 3AY6A 5T64A 1M76A 1HLPA 3ETGA 1E3EA 4N5LA 4AJNA 3W4KA 4DA9A 4RL6A 5A02A 4D3FA 2NACA 3I6QA 2BF7A 3VPSA 2D5AA 1HDOA 1JW9B 1PIWA 4O5OA 3OP4A 1LSSA 1N8KA 4DPMA 3G17A 2YFQA 3BMOB 3PFFA 4E30A 2AA3A 4XX0A 4EDFA 1W73A 1TA4A 1YB4A 2BH9A 1DC6A 1GU7A 3V2UA 2AG8A 3PP8A 4OXYA 2OP0A 1EDOA 3PPIA 1E5LA 2Q49A 1QG6A 4DIFA 1PTJA 1IPFA 4D7AA 3I4CA 3TPCA 1RM4A 3QVXA 4HFNA 2VHYA 5DBGA 1T1RA 3G3EA 1UXJA 3EYWA 3LT0A 3GZNA 4INAA 2PH5A 3I9JA 3ZU5A 1VSUA 3KYCA 4NBWA 3TNLA 1R12A 2PLAA 3E48A 1J49A 5EINA 3RWBA 3HB4X 4Z3DA 4BNXA 1CEQA 5A05A 4FFMA 2BELA 3RD5A 4CM4B 3K2EA 4PIVA 5I7EA 3ROQA 3K73O 1FK8A 4GX1A 1L7DA 4G81A 4JJFA 4J7CA 2EIHA 4MIEA 1U4SA 2JD0A 4P4GA 4BV8A 4MVJM 1HZZA 1C14A 3K92A 4CM8B 2EJWA 1TXGA 2C20A 2DC1A 2AW5A 3ADPA 3GVIA 1L1FA 2AE2A 2CVZA 2GN6A 4J1QA 4DIOA 1QKIA 1NWCA 1UUFA 1ONOA 3LQFA 1D4FA 3RAJA 1H93A 3WMWA 4M54A 3WR5A 4KWIA 2HUNA 3PVZA 3U4CA 1MB4A 1ZK4A 4CMBA 1LLQA 4XYMA 4YT8A 1R0LA 1R37A 4D3DA 4L75A 3VZPA 3GOHA 1P3DA 4GAEA 1N5DA 4ND3A 4FD3A 2VUSA 4MIOA 5F3RA 1VJ1A 2PZMA 4YT2A 1JLLA 2AEFA 2C29D 2FWMX 1NPYA 1PGJA 1KS9A 3KBOA 1I3LA 4WASA 3ZNOA 1EVIA 3KUXA 3D64A 1R4MB 4QQRA 4WEOA 1FDTA 2BHLA 4CQMB 2VT3A 1E1MA 4I5FA 1GEEA 1AXEA 4X54A 4HBGA 4XB1A 1N9GB 3ITDA 2I9PA 5KNLA 1NAIA 1ZKMA 3GA0A 4GSLA 4DIBA 5KIAA 3E8XA 1NHWA 4FC6A 2GASA 4E2ZA 1DIGA 4DC1A 4PLGA 2OBYA 4NMHA 2NTNA 4Y9DA 3GFBA 4PZDA 1T2EA 4OMUA 4BO8A 2NTVA 4XDYA 3DZFA 2V6FA 3UN1A 4FQ8A 1QV6A 1PGOA 2ZB8A 3VH1A 3C24A 4A7PA 4ZQFA 4ZU3A 4GL4A 4KUGA 3RQSA 4BNHA 1M67A 1K6XA 1TT7A 4QX6A 3DEYX 4W82A 2IEBA 1Z45A 2RCYA 3FNHA 1VRWA 5B4VA 1O95A 4J1SA 1C0PA 2DM6A 1T4DA 3UH1A 4W9NA 1HLDA 5L40A 1Z6ZA 3H4VA 1T26A 2A9FA 1LXCA 3VKVA 4FR5A 3A1NA 4JP2A 5L51A 1HDRA 4JROA 3RBZA 3DQPA 4IZIA 5AXBA 2H9IA 2NU9A 4CMEC 2AQKA 1HT0A 4BGUA 3GK3A 1E3SA 1F14A 3GRKA 1MFZA 3U62A 3GH3A 3Q2IA 5CPFA 1HDZA 3H5AA 4RVGA 3IJPA 2XF8A 1I2CA 2CNBA 3UCFA 3SC6A 3BZUA 1LUAA 3PYMA 5I9MA 3WJAA 3FD8A 4L4XA 3ZU2A 3C7AA 3FWNA 1QRRA 3V2GA 1XYGA 2JD2A 3P2YA 4RV9A 3D4PA 1Y5RA 1KC1A 1F17A 3GMDA 4CV1A 3D3EA 1Z74A 1PGQA 5IZ4A 3LK7A 3VC7A 4TWRA 1WMAA 2Y0DA 4Y6RA 4GQAA 4PLHA 3UGKA 5CDUA 2QG4A 5L3ZA 4JLWA 4DPLA 4IS2A 1UXKA 1P74A 1SOWA 4E5PA 2GCGA 5BSHA 2OBNA 4IQ8A 3C7DB 4RQTA 2RAFA 3CTMA 4ND2A 1I10A 3D7LA 4Z0PA 2WDZA 5EQFA 1RWBA 3DZHA 2NSDA 3OA0A 2VYVD 3C1OA 2YDXA 1JVBA 1PJ4A 3FR7A 5FFFA 3VHRA 4B4VA 2AXQA 1OOEA 1PSDA 1RPNA 2DKNA 2YHUA 3S2EA 3GGGA 3K5PA 4TVBA 1KYQA 5L7WA 4MJLA 1XWFA 5KOIA 1WPQA 2B5WA 4II2A 5B1YA 2FR0A 3WDSA 1SB8A 1L7EA 2J3JA 4XQEA 5JC1A 4CM6A 1QLHA 4PLVA 3GHYA 4FCCA 4IIVA 1EUCA 4UUNA 5TJHA 3WB9A 5JY6A 3GLQA 4LMPA 5JDCA 1LJ8A 4TKMA 1HEUA 3OETA 3PIDA 3ZWOA 3H5NA 1MGOA 2P9EA 2ZJ1A 2HRBA 3F46A 3UW3A 5IJZA 2X6TA 4TKLA 2J6IA 3C1AA 1QMGA 2W2KB 4OOFA 5EMHA 2FPGA 3K31A 4BV9A 3IJRA 4HY3A 5DBIA 5JSFA 2HK9A 3E18A 3F4LA 2P4QA 4I1IA 1P1FA 4RF4A 2HU2A 4PZCA 3JQGB 4Z9XA 1VKOA 2ZIZA 3NV9A 4BO7A 2BRUA 1ZXLA 1AHHA 2VYNA 3BMQA 2X5JO 5JCJD 3BHJA 4BMVA 2VHZA 4Q3BA 3M1LA 4XRGA 1PJTA 1DC5A 4BNKA 3KYDB 3C3XA 4XB2A 1X13A 4WLEA 3G1TA 1PS9A 2VZ9A 5KVSA 1MX3A 1AE1A 1ZXBA 4NIMA 2I6TA 2W2LD 1NWHA 1IB6A 2HMWA 4A2CA 5TLSA 4WNCA 5KJ1A 4YBZA 1PJQA 4CM3A 3N7UA 2FOIA 3I6IA 3Q6IA 1O5IA 1H5QA 1MLDA 4FPXA 4QFDA 1HDXA 4KWHA 2D5CA 3JD0A 1AN9A 5GZ1A 1YBVA 4NPCA 1YE3A 4KQWA 1J4AA 1EBUA 1FF9A 3K2BA 1TB4A 5EPOA 3S2FA 5FYDA 2ZTLA 3TL2A 5LC1A 3KOUA 5C7LO 3JQ9C 4L76A 4LCEA 3PYLA 4B4UA 3OSUA 3MJTA 4J0FA 4K6FA 2B69A 1EZ4A 2Q99A 3EVNA 3JQ8A 4OGWA 2FY8A 3VH2A 4U8GA 5KVQA 1KEPA 3BMCB 4WECA 5JLAA 4P4LA 4C7KA 4EBFA 1V9LA 2GDZA 1PEDA 4J90A 4Z9YA 3F4BA 3G1UA 3KSDO 1C0KA 5T6BA 4I5GA 1DAOA 1IULA 1DO8A 1MUUA 1U7TA 1BXGA 4OYRA 4CPDA 2PD3A 4LVCA 3ICPA 3JQBA 1N7GA 1U5CA 1YJ8A 2QQ5A 4IJWA 4TSKA 5CP8A 1LU9A 1YDEA 3MJ4A 4XCVA 2WTBA 4J49A 2I66A 1UAGA 3MWDB 3AUAA 2DTEA 2X23A 1SOVA 3LT1A 3TOXA 5CDGA 2BI7A 4GMGA 4JXKA 3A14A 3RUHA 2UUPA 3HSKA 1I33A 5JO9A 5L4SA 5TIIA 1HYGA 2VTEA 3H8VA 3P5SA 2ZYAA 3KM0A 3WGZA 5JXWA 4EITA 4QO8A 3BTUA 2HMTA 3RBVA 2VHWA 2XOXA 1BDMA 3HG7A 4JQCA 1DIRA 2Y1CA 2QHXA 1PQUA 4DQXA 4YAIA 4HFRA 2ILTA 4OXKA 1B8UA 5IXYA 3H3FA 3H65A 3O26A 4BNWA 1F8FA 3WGOA 4BO1A 3RUIA 3GUYA 3N74A 1C1XB 4IMRA 3GT0A 4KUEA 4UVEA 1YVEI 4EW6A 1KOLA 2Q2QA 3ZNQA 4IPTA 3NGXA 4IM7A 4YRDA 3C8MA 3QVSA 1PR9A 1PZEA 3LLVA 1FJHA 1B3BA 3L9XA 4G65A 2X5KO 2DBVO 1IUKA 4MKRA 1E7YA 2GN4A 3BMNB 1P33A 4AL4A 1D8AA 1E6EA 3JQEA 3OA2A 3IOYA 5A3VA 2DPHA 3ZWVA 1YB1A 2E49A 2CMDA 2UVDA 3HDJA 2VTDA 1DJNA 5GMOA 4FJ0A 3WJ7A 1YL7A 2Q2VA 4FIZA 1LQTA 3L6EA 4MVJI 4BNIA 1FDUA 1U1IA 3KB6A 5HRUA 5EN4A 4FFLA 4D41A 2ZB4A 3DBLA 4AJ4A 4DTIA 4M55A 2CF5A 5TX7A 4EUEA 4WUVA 1ENPA 4GKVA 1ZEJA 2P5UA 3TSCA 1EK5A 3TZCA 4ALIA 4BO2A 2VZ0A 3GZNB 4PZEA 4UUOA 4Z0HO 1SO8A 3GEMA 4AJEA 1A4UA 4R1UA 1GADO 1YS4A 4PLTA 2IRWA 4R1NA 2VOEA 5ADHA 3P2OA 2X5OA 3PYXA 1GY8A 1RM3A 4D46A 1H94A 2G82A 5GZ3A 3JQ7A 1LC0A 4PGFA 2GN8A 3SEFA 2QW8A 1ZJYA 3EVTA 1Y8QB 3ZN2A 1AGNA 3P19A 3WBFA 4YWJA 3HE3A 5DN9A 3ONFA 1I01A 5IDWA 1PZHA 3EK2A 1FXSA 1LA2A 4ZRNA 1GQ2A 4Y67A 3JYQA 1N1EA 4IDDA 1I2BA 1MA0A 3SLKA 1K89A 3GN2A 1I5RA 2X4GA 5ENVA 2HJRA 4I9UA 1LLUA 5G0UA 1A4IA 1CERA 4J1NA 1Y8RA 5T67A 1WDLA 3JYNA 3QHAA 2H63A 4ALJA 4C7JA 4EJ6A 3B20A 3UVEA 5BNIA 3NGLA 2GZ3A 4JK3A 1DSSG 3QW2A 5TRTA 3RCBA 1ZK0A 4BGIA 1U8XX 4AJKA 3HDQA 4RZHA 4CUZA 4DLBA 3U0BA 4B4OA 1PJBA 1RM5A 3A9WA 4QO7A 3WYEA 2GZ1A 4DQUA 4RORA 2HCTA 5K0ZA 4JBHA 4N18A 2DPGA 4PRLA 2FSSA 5JDIA 1MP0A 4I08A 4IXTA 4U0JA 2NNLD 4ND4A 2ZYGA 5F5LA 5G0SA 3AOEA 3PHLA 3DDNA 4FFRA 1UDCA 4EUHA 3FBTA 3IQDB 5DT9A 1PWZA 4H16A 1VPDA 3H9JA 8ADHA 4NG5A 4UVGA 4MPDA 4OKNA 4GMFA 3PQDA 1LSUA 3AM5A 2VWPA 3GHHA 1LRKA 4YYZA 1ZK3A 1SBYA 3ITKA 4RO0A 2AE1A 1WNTA 1H2HA 3VVBA 2I65A 2QZ9A 3F5QA 3F9IA 3GZ4A 3H9UA 3LC7O 4YQZA 1YQDA 4BNMA 2W2LA 5CDYA 4M87A 5JYEA 1R4NB 5B37A 2Y05A 3DB2A 1SZJG 2I99A 3QY9A 4CLDA 4KP7A 3AY7A 4OSOA 2VRBA 3P7MA 3NJ8A 2XXJA 4OOEA 4AFNA 3T7CA 2GRAA 2PGLA 1NVTA 2X8LA 3B1FA 4DYDA 1WVGA 1C0IA 1UAYA 2OHXA 2PKQO 4J9UE 5I7SA 1C1DA 2F1KA 1ISHA 3L07A 3PJEA 1XG5A 4LK3A 4UUMA 3V2HA 2D8AA 2HQ1A 5TGDA 4E21A 2AQIA 5I7FA 3RFVA 3OF2A 3RFTA 1NPTO 3HNPA 3IKVA 3RIHA 5KVVA 1BW9B 2DUWA 1ZBQA 2FSVA 2IZ0A 1E3WA 3CMMA 3L6DA 4RQUA 3UUWA 3EDMA 2CVOA 3JYLA 2Z1NA 4XRRA 1NFFA 3L4BA 3KHUA 4TRNA 4B7UA 3CSDA 1XQ1A 5JFOA 3OECA 1TT5B 4LSWA 1UXGA 3PLNA 3DHYA 3GVHA 1V3UA 3DBHA 2YW9A 3ENNA 3WQSB 3AFNA 5A06A 3UOGA 1X7GA 1NQAO 1SAYA 3D3WB 2LDBA 3RROA 4CLXA 2Z1MA 1F12A 1JU9A 4HNGA 4FJ1A 4FN4A 4YQYA 1V6AA 3WGIA 1X1TA 2QYTA 3GR6A 4HX5A 4NDNE 3WGQA 3INTA 1T2FA 3S2IA 1P1RA 2VWGA 2VZ8A 3TN7A 2YV1A 5T8KA 1R15A 4IIUA 4NJMA 3M6IA 4IDGA 2EGGA 4PVDA 4ZICA 3IP1A 4BNZA 4XEHA 1ZEMA 4I5EA 5JMWA 4PRKA 3M2TA 1DRUA 4FBGA 2C2YA 1ISFA 3GAFA 3B1JA 4UEKA 1KETA 1K6JA 3VPFA 1FDVA 5DF1A 1PJCA 5EL0A 3LC1O 2OP1A 1SEPA 2VNAA 4NU5A 1LSJA 4TRRA 1U3VA 2F00A 1PJ2A 3S1LA 5IAAA 4Q3EA 1QV7A 3JQFA 5EQDA 1PJLA 3JCZA 4ALLA 4OHUA 4OQYA 2WD8A 3QVTA 1ZSYA 4QFCA 4TQGA 5JBIA 3ZHYA 3T4EA 3AI2A 2WM3A 5AXCA 6ADHA 4M89A 1MG0A 2H5LA 3NRCA 1OBFO 4BO9A 4E0BA 1LRLA 1A5ZA 4RVSA 4IJKA 3O9ZA 5CG1A 1K3TA 1F0YA 1LDGA 4URFA 1B3RA 3HADA 1E3IA 3AWDA 1K6IA 1LNQA 4QUKA 4HNHA 2IEDA 3FSRA 1R0KA 2VNSA 2NU6A 4ITUA 4EGFA 4YPOA 3BTVA 3SLGA 3WFJA 5HWSA 2I3AA 4RGBA 2CD9A 2JCXA 3NDRA 1GYQA 4FGSA 4ILKA 4A27A 3ZHXA 2J3IA 4J6FA 2O4CA 2PKRA 5A9RA 1NQ5A 1PZGA 4A5OA 3ZWWA 4GGOA 5A9TA 4DPKA 1I3NA 2LDXA 4A03A 3WOHA 5DOZA 3NX4A 5JE8A 1EE9A 4O1MA 1V3TA 4IMPA 5AXDA 2JHGA 3U49A 4GLLA 2W4QA 3OQ1A 3RUCA 3MJVA 4Z9FA 4N7RA 4XR4A 1VLLA 3PZRA 2EHDA 4DBVO 4YEDA 3ZCXA 1NX6A 3WS7A 3F1LA 4BO0A 1ADCA 3DO5A 4CL3A 4EUFA 1HZJA 2OL4A 5HM8A 2O3UA 2IDZA 3RC1A 2Q4EA 1VJTA 2VYND 2EP7A 1WZIA 3V1UA 4UVDA 2OXIA 3BA1A 3JD3A 3IP3A 3WGYA 3U9LA 1OFGA 4CMKA 3NDIA 3ZHBA 5GZ6A 2O3RA 3L77A 4OXNA 1LRJA 4CLHA 2DFVA 3GDFA 3I9LA 1QORA 1U7HA 3DAFA 3I9KA 3K30A 4IQGA 2DTXA 1GCUA 3I9NA 4Y6SA 1EK6A 1XKQA 3E9NA 3PHGA 1VM6A 5IDQA 2AG5A 1OC2A 2CSUA 4BO3A 3V5NA 1BHSA 4R3NA 4FOOA 4BNGA 1IPEA 3GPDG 3VOSA 5DCUA 1YQGA 1UZLA 1LQUA 2O3QA 1OC4A 5DCYA 1ISMA 2GSDA 2BFPA 1SB9A 1MG5A 3JQAA 1GDHA 1OI7A 2Q1SA 2O4UX 4CLRA 5G4KA 2EGHA 5TT0A 5L4LA 1YL5A 2P2SA 2PR2A 3ZWBA 5ENDA 4EYEA 5AQ1A 2HMUA 1E7RA 2R00A 3PWKA 2VT2A 3S55A 2FN7A 5CFZA 1NFRA 3NDJA 1IE3A 4NK5A 4D3SA 1T25A 1BVRA 1GQYA 1JWAB 2CVQA 3GMSA 4J7UA 2HK8A 3VDRA 1E3JA 2ZQYA 3ZZNA 5LDGA 4QECA 1R0SA 5ITWA 3ETEA 1GQQA 5JCXA 1OZAA 2EXXA 3C1TA 2AEMA 4MKXA 3ZDFA 5CEEA 2FRDA 1N2SA 4U6SA 1O94A 1YOVA 2HK7A 1XIVA 2BFMA 1A9ZA 3AI1A 4GPD1 2RH4A 3DWFA 1NFQA 2B35A 5ER9A 3HHPA 2P5YA 3GG2A 2NU7A 3VPXA 2PV7A 1CWUA 2CUKA 1YKFA 4MVJP 4CLOB 1LDEA 2A4KA 3ZWPA 5IZCA 2O2SA 4BOYA 2PWZA 2VWHA 1GV0A 3QIVA 5F5NA 4OO3A 1H0KA 4S3MA 3HFGA 3Q1LA 1ZVMA 3TF5A 2O3JA 4BNVA 4UVIA 3ZU4A 3WQRA 3COSA 2FR8A 3K8ZA 5F1PA 1A72A 3CKYA 3GGPA 3AUSA 2Q50A 4GVXA 3KSZO 4RLHA 1XHLA 2JCVA 3GEGA 5JDCC 4CMIA 3UXYA 3GNQA 1MFPA 1HE4A 3O8QA 2Q3EA 5COBA 1P1IA 4B8WA 4O0LA 4CR6A 3EY4A 4Q9NA 3AFMA 1U4OA 5DULA 4KMSA 3QWFA 3DR3A 2X0NA 3ST7A 2JD1A 4IJVA 3QJ5A 2J8ZA 3DBLB 1ZSVA 1ISIA 4II3A 2EERA 2HAEA 3DZKA 2DVMA 3LLSA 1HWYA 1WXDA 3DAPA 2FZEA 1SNYA 1CDOA 2NADA 4WPGA 5THKA 4F6LA 3VPHA 3ANLA 4BKRA 2C82A 3QWIA 1DFHA 5KJCA 2QIOA 3E6AA 4PLYA 4BNTA 4WLNA 3RU7A 3LVFO 1GPDG 4R5HA 3HN2A 5JAMA 3Q0EA 1YONA 1ZJZA 4MO2A 3OJEA 1EMDA 1UP6A 2VQ3A 1T24A 4CM5A 4U7WA 4FFOA 3ASUA 5FI3A 4BKQA 3EZLA 2O3TA 3MTJA 3WMXA 4AJ1A 4CM9D 1RJWA 3KLMX 3OH8A 4W99A 3QWBA 4CMHA 1JKJA 2FR1A 3MOIA 4XYEA 3NEPX 1MXFA 2CY0A 4KTTE 2B36A 3FTPA 3CZMA 1ISJA 2DBQA 3NTOA 2HRZA 3PHHA 3WWYA 3KEOA 3PQEA 4E12A 1MC4A 1M75A 4XJTA 5IXSA 1I2ZA 1XELA 1KVTA 3BHMA 4CQLA 1H2BA 2NVBA 2POQX 3JYOA 1Y8RB 4B7XA 1ULSA 5A5EA 5ITVA 4FC7A 1KVQA 1IHXA 3U3XA 4LISA 1I8TA 2JJYA 2O7QA 4IS3A 5G0TA 2GR9A 2X1HA 3TFQA 2RBEA 4YAEA 1LI4A 4NQZA 2NVUA 3A28A 4FFPA 3I9OA 3PJDA 4Y98A 3UF0A 3X2FA 2Y68A 5C7OO 6LDHA 5KKAA 4NNJA 5IF3A 1QR6A 1ZUD1 3PJFA 3JQBC 1P77A 3WBBA 4N5MA 4A0SA 5JNLA 4OQZA 1R6DA 2C0CA 3PK0A 5DNAA 5KKCA 1JAYA 1U5AA 2Y1EA 4WOKA 2VHXA 1ZK2A 4RCVA 4Q3NA 3D4OA 4QXMA 4D79A 4CMAA 4CV3A 4RZIA 1HE2A 3Q9UA 4CM7A 5A03A 2P68A 3QVOA 4W4TA 4XD2A 3AI3A 1Z73A 3WFIA 3VVCA 1T2CA 2Q2WA 4TVOA 2NLOA 2YQ5A 4B7CA 4FS3A 5LCXA 4YJDA 3MJEA 5JC8A 1DXYA 3ZW9A 1GUFA 2PGJA 2X9VA 1BTOA 3N58A 3RC2A 3OJ0A 1LSOA 4BGEA 2E82A 1B14A 4XZ3A 2Y93A 3WLEA 1V35A 3HDYA 2CDCA 2PZLA 1C1DB 3L4SO 1EE2A 4WEQA 5HS6A 4CMJA 1GYRA 4IDCA 3H6KA 4D45A 5A1TA 4YXFA 2Y1DA 2X0IA 5A9SB 1ZFNA 2YV2A 4LMRA 4RDIA 4CMEA 5TS3A 3UCXA 3WX0A 3RKUA 3AUTA 3PGJA 1HDYA 3C7CB 5B4UA 4KQXA 4OAQA 4Q3DA 3DBRB 4BNFA 3FF4A 4Z0TA 1LX6A 4HFMA 3WGTA 1Y1PA 4EI2A 3RUFA 2ZYDA 2QRJA 2XPCA 1ONNA 1HE5A 3H2ZA 4CMGA 4XWYA 1GR0A 1PS0A 3TQHA 3RSHA 1P9LA 3ANMA 1LDMA 5HTOA 3RUDA 4YRBA 1EVZA 4PN3A 3WTBA 1ADGA 1PX0A 3OJOA 1XQ6A 4LGVA 4HXYA 1ISGA 1DC3A 1P0CA 1X7DA 1ENOA 1ZZEA 4R1SA 1EEHA 4XGKA 5JMPA 4K26A 3ABIA 4BNJA 4E2WA 4YCAA 1E1LA 3D5QA 3FPLA 4AG3A 3FCOA 1O9BA 4MVJG 4E2XA 2VUUA 1XR3A 4U0KA 2X58A 3BIOA 4JGBA 2JFGA 4S1VA 3TFOA 3MEQA 5B4TA 1SC6A 1I3MA 2O23A 4AJPA 3DHNA 4FB5A 1S7CA 4IXWA 2YV3A 3DTTA 4XYLA 1X0VA 3STHA 2I5PO 2IZZA 2EEZA 3AK4A 3INRA 3WYCA 1EUZA 1JA9A 4YAKA 7MDHA 2DBZA 2PZJA 3ONDA 3OJFA 2H1SA 1H6AA 3QWAA 3VTZA 2OFPA 5KWEA 3NTRA 1B8VA 5U9CA 5K6AA 4A10A 1SCUA 2FPIA 1JWBB 1QP8A 1LEHA 5L4NA 4ZQHA 2HMVA 3AM4A 1Y9AA 5L45A 3OIDA 2DQ4A 3LU1A 1U3UA 1QXSA 2FP4A 1P1KA 1UH5A 3MOGA 1BXKA 3U4DA 2P91A 1OAAA 1ZNQO 1QYDA 4FOSA 5DP1A 5JO0A 3C85A 1E3LA 2O48X 4GKBA 1GCOA 4W7IA 4FSHA 4BB5A 3PDUA 4NBRA 2FMUA 4J4HA 4XYBA 2GD1O 3R3JA 3BXXA 4ND1A 3E1KA 4YVFA 4PLFA 1I0ZA 2W8ZA 2EKPA 3D1LA 3VTFA 4JBGA 3SVTA 4GWGA 1I30A 3AOEC 2G76A 3HWRA 4WOJA 3ICCA 4R5MA 2BLLA 2Q4BA 3E82A 4ZRMA 1KBZA 1HYEA 5L53A 1U3TA 5I8ZA 1O6ZA 2PH3A 4DGSA 3WNVA 1NVGA 1NQOA 3U5TA 1JVSA 4D42A 2PKQP 1Q0LA 5C5IA 4CM9A 4H7PA 3KYCB 3LF1A 4FW8A 3ADOA 3DMTA 4AJHA 2E37A 2J5RA 2I3GA 1T1SA 3HN7A 3KSUA 2BGKA 3JQAB 4GBJA 1AXGA 3ASVA 4Z3KA 3ZV3A 5TJ9A 5TNXA 5G4KB 4E32A 4DLAA 4OSPA 1QLJA 1WMBA 3UAGA 3W4JA 1YWGO 3HZZA 1HXHA 2G17A 4ONEA 5KVCA 4PLPA 4ZVVA 1E7SA 4DMMA 3WLFA 1DEHA 1HDGO 2BFAA 2D59A 2PTGA 4DXHA 3I9MA 4J9VA 1JTVA 3L4BC 3G79A 4Q3AA 4RVDA 4YB8A 4WCFA 1G6KA 3ZI0A 1ID1A 2P4HX 2O50A 2GGSA 1N1GA 3JQAD 3RU9A 1NASA 3FNGA 4E33A 3WIDA 1J6UA 2W98A 3ROKA 4GSKA 1Z82A 1PQPA 3G0OA 4MIYA 4QEDA 1M6HA 1GAEO 2E4AA 5IFLA 1HKUA 2I67A 2C2XA 4R54A 4BNYA 2YZ7A 4TMFA 3DZJA 2GO1A 3VZQA 3GGOA 4RJTA 4XR9A 1PL7A 1VC2A 1UR5A 3EMKA 3U4IA 3FR8A 1NP3A 1VL0A 3IMFA 2PFGA 1YO6A 1XU7A 2GLXA 4NHEA 5ER6A 1AUPA 1RYEA 2Z5LA 2UDPA 1S6YA 4KDEA 1EUDA 3GVCA 2BKAA 2Y99A 2ZTUA 2V7PA 3DFUA 1A9YA 1VE9A 2P9GA 2IZ1A 5JAQA 2BGLA 2J3HA 2X0RA 3SC4A 1IY8A 3PHIA 3X2EA 2UYYA 3TZHA 4CMIB 3PEFA 5ILOA 2GUGA 3KO8A 1QYWA 1UZNA 3PHJA 3QQPA 1QYXA 1YH3A 3LSYA 4Y8VA 4CMCA 1YL6A 1ADFA 1BSVA 2B83A 1A27A 5DOVA 4MVJE 1NYTA 1E6WA 1ENZA 4ZD6A 1K2WA 4YDRA 1M2WA 4GWKA 2NM0A 1D1TA 4JIGA 5DDIP 2YHIA 4CR7A 4BKOA 4BIIA 1HSZA 3AJRA 4KOAA 1CQIA 3UKOA 3ZNNA 1H6CA 1NXQA 1PL8A 2EP5A 3WICA 1P45A 1KVUA 3JTMA 2ZJ0A 1EDZA 3GN1A 2IXAA 3OIGA 4UVHA 2PK3A 5AXAA 5JW6A 3FPCA 2W2KA 1CRWG 1P1HA 2X7HA 3WGGA 1DB3A 1VKNA 3W1VA 4R9SA 5IG2A 2Q46A 4ALKA 3TZKA 3JD4A 4ZQBA 4XGNA 5CG2A 3UHAA 2QX7A 4BB6A 1NQTA 4YJGA 5JS6A 4IZHA 1EVJA 1KVSA 2Y0CA 4IY1A 1E0DA 5A5FA 1YDWA 4I9HA 1ZMOA 4EEZA 4PVCA 3EAGA 3BHIA 1CIVA 5F1OA 5B12A 3NT5A 4OKIA 4GH5A 4JP3A 3OFSA 1WAMA 8LDHA 1A71A 4HFJA 4ZA2A 1PU2A 3GRPA 1B2LA 3OQ6A 2ET6A 3WTCA 4O59O 4TRJA 2A94A 3H9EO 1NPDA 1HL3A 4MVJD 2C07A 3QRWA 1W8DA 2TMDA 1SMKA 1O0SA 3U4HA 4K28A 1VJ0A 1PGNA 1WLYA 4P4NA 3TL3A 3GAZA 2Y0EA 3KVOA 5H83A 4Z6KA 4DRYA 5L7TA 2JAPA 1PGPA 5L7YA 2D0IA 1GL3A 4ZQGA 2ZCVA 2CF6A 2UUOA 3MWEB 5I9NA 4ROSA 3FNEA 2NVUB 5IDXA 1XSEA 3S2GA 1A7AA 1KERA 3F6YA 1BMDA 1K5HA 2Y67A 1KEVA 3AUUA 1M6WA 3IUSA 1PS8A 2IYPA 4WNIA 4MKZA 3BYZA 3ZU3A 1JQBA 1P31A 5KCZA 3VH4A 4RPKA 4ZQEA 3PIIA 3INGA 2X86A 3K9QO 5IN4A 5COAA 3LYLA 3O03A 1UP4A 1M66A 3DOOA 1ZSNA 2WSBA 3H5RA 3FHLA 1I36A 4BNNA 2P9CA 3FN4A 3ZHZA 4HWKA 1C0LA 4PG5A 4CUKA 1NM5A 4GX5A 3WGHA 3CH6A 2B5VA 4K9DA 1QSGA 4YTEA 1LLDA 4E5MA 1GUZA 4EJ0A 4I9NA 4NFYA 3RASA 3O4RA 1U3WA 1K0UA 2Y66A 3QE3A 1TVEA 3I5MA 2H6EA 2YYYA 4QT0A 2ZTVA 1TLTA 3BMQB 2GNAA 4F46A 4WLUA 1B0AA 3E5RA 4JNKA 4IUYA 4G2NA 5IZCC 2FPPA 2ZTMA 3Q3CA 4L8VA 2VHVA 3I23A 4EJMA 1EVYA 1JN0A 4NH4A 4J91A 4AICA 2SCUA 3OHSX 4HADA 3KXDA 3PWSA 3LT2A 4GX2A 4LRTB 3NUGA 1LC3A 4YAJA 4E5NA 5BSFA 1RKXA 4XQGA 2WE8A 1NNUA 3HJAA 3QA9A 5CDTA 3V8BA 2QZZA 4BUCA 1YQXA 4NI5A 1B15A 2QYSA 1QYVA 4B79A 3RJ9A 1U28A 1TI7A 5BNTA 1DJQA 3GG9A 4W9NC 1DOHA 4R68A 1LTHR 3ULKA 3PJGA 4J2OA 1RM0A 4JCOA 5KJEA 4JN6B 1Q2XA 3SJUA 2DFDA 4IGEA 4UULA 2V6MA 4Q3CA 5A3JA 2GYYA 2YDYA 4PLCA 4AJJA 3BMNA 1YRLA 1Y81A 3JQ8B 1ULUA 3DONA 3I3OA 5HBRA 2NQ8A 1WDKA 3CINA 4BMNA 4YJHA 4R3WA 1NTOA 4LN1A 2HKIA 3RBXA 3VH3A 1YBMA 2B4RO 1RYDA 1NVMB 5G2OA 3WSVA 4YRAA 3RC9A 3ONEA 3WXBA 1PJSA 3ZWAA 2WMDA 3AOGA 1BG6A 1U2DA 5KJFA 1BXGB 4AJ2A 3PXXA 4RVHA 2Z95A 3SBOA 4ALNA 4J3FA 1DLJA 2XXBA 3PDJA 4GLOA 5ILGA 4D0SA 3JV7A
chains in the Genus database with same CATH superfamily
3KXPA 1ZRNA 5HSGA 3OE4A 5BWLA 2HU7A 4DWWA 1XN4A 4H1HA 3LRTA 3EZXA 1JEQB 3DTNA 4JBXA 3UK7A 4V0QA 2BR4A 2RMKA 5IULC 1ML3A 4JUBA 4BNLA 2QMEA 4AJIA 4CDGA 1SCUB 4IOKA 2MJLA 5DE3A 1C8BA 2DHDA 4FHEA 1ZD3A 2CCKA 3IS3A 2WE7A 3L9WA 2A35A 2ZB3A 3LUKA 3QSYA 2JGKA 2XWJI 2A9RA 3L0DA 1A7KA 4UM7A 3F7NA 5TPWA 3SD7A 3MRSA 3RIMA 2WYVA 3V46A 3ZHQA 3E23A 3TW0A 1Y3IA 2RKWA 5JNUA 1K63A 3UAXA 1WXXA 4B3DA 3CNLA 4B2YA 4XIIA 1E9RA 1JLRA 4ENUA 3FMPB 3O8OB 5H4HA 2IBTA 4FFNA 3O8DA 4D0RA 1L5GB 1Z29A 4LXUA 3R1IA 2VDWB 1QHGA 3QVWA 1JZQA 2O2HA 3EEBA 1HE3A 1YXMA 2CLHB 4PG6A 4W8HA 3WNBA 3Q7TA 3KD3A 5LQMA 2H3HA 1KEZA 4C2UA 1PG2A 1NLUA 5J4KA 1MBZA 1VSBA 5FL7A 3FTNA 3NEJA 1L9KA 1YZNA 2F4VB 1I3KA 1RQLA 2N1BA 1JR6A 3GC6A 2R5FA 3F5SA 4KX5A 4XKJA 5C5DA 2AOUB 5ALFA 3IIEA 2XBMA 2NVWA 4B6FA 4YMLA 4DLKA 4F5ZA 5KTKA 3DTYA 3CURA 2GEJA 1HTBA 3AR3A 3KCQA 1Q0RA 4ZU6X 4JJEA 2DFNA 1GZUA 2X4IA 2XB9A 3C6XA 3NO4A 2QTAA 3P8ZA 4OGGA 2HMAA 1T8SA 4BAUA 1B6RA 3NHJA 1HNZB 4O8ZA 4C4PA 3WDLA 5IM4A 4F5YA 4W5QA 3GLGA 3W2FA 3H17A 3PTZA 3NFYA 3SMVA 1FVXA 1NATA 5JAIA 4G4SO 3GNTA 3D2BA 1LDBA 4J0EA 3R8XA 3UFXA 3WL7A 3ZDQA 1ZVKA 2DT5A 5TQVA 1FXWF 2ZFUA 2IBMA 3V7NA 4EQZA 5IYZA 3ZKAA 5JAZA 2J5BA 2ZUVA 2OXRA 3T9CA 1A1SA 3QSGA 1Z2PX 2BRUC 2R6HA 5FUVA 1OXSC 2V55B 3E2PA 2B8WA 2CCJA 3U56A 1P6QA 1Z7EA 3SF8B 121PA 1SXJE 3EMBA 4LZWA 2Y1FA 5IM5A 1R1DA 2DHRA 3KAKA 3RFFA 2ZKLA 4RFSB 3S5UA 4KREA 3LF2A 5GP1A 2GJ8A 3TS1A 4ARZB 1SVIA 2I34A 3G2OA 1EIZA 1QCZA 2QTCA 3F1KA 3FFAA 3OX2A 4MP8A 4RSGA 4QYXA 3SC3A 3JQ7B 3INNA 1LTQA 3TLEA 4QU5A 2SNIE 2G6BA 3BICA 3N2YA 1SEVA 4IHAA 1FB5A 3AF3A 1X92A 1YS7A 2WD7A 4L0QA 1R4NA 2W6ZA 3CJQA 5U4QA 4QKQA 4TWIA 1M34E 1C30A 1MRSA 4D6PA 3FTFA 3FZYA 3ETDA 4B5LA 4LQLA 3ZVKA 4KK4A 3LDAA 3HRHA 5BT9A 1HG0A 1PT9A 3BE6A 4JLJA 4OD0A 2H3EA 1KWKA 3BA6A 3N2KB 1MDFA 2NUBA 3BWEA 1IBSA 3KL2A 3UMJA 4LFCB 1MV8A 4NLLA 3TDKA 1SRQA 1BDHA 2IYSA 2GRJA 1CDDA 1Q1NA 2C98A 2R4TA 2W2PA 3CIOA 3QWHA 3OU2A 4UAJA 2J87A 4X1KB 5SZJA 5CM2Z 1GQRA 2YS7A 2XCIA 5C80A 1KS2A 2HJSA 4RNCA 4EHJA 2FLWA 4JSYA 4GUDA 4RESA 2XDQB 2WHPA 1BIFA 5B58C 3K0BA 2DFPA 4HDMB 3Q8WA 5AJXA 3KTDA 3GNSA 1I0IA 4B5KA 4ZYTA 3W6UA 4NNPA 5C7YA 3RI3A 9ABPA 4BNUA 4LCBA 2WWHA 2GAOA 3MUOA 4OM8A 5FBQB 1IC6A 4GI2A 5F1YA 4K2AA 4WCVA 3EOBI 3TWOA 2VSNA 3AU9A 4R9RA 1SXJD 2QX4A 3O4JA 3VOBA 1CUGA 4K8RB 2LCIA 3ANTA 1JQEA 1BGWA 4QOJA 3H9CA 3A4YA 2B37A 1M54A 3LC2O 5ALZA 2VK2A 3K6JA 3QNMA 4CJXA 4DJFC 1R66A 1GL9B 4JBIA 2E1RA 2HQOA 2IXBA 2ZVQX 3IQFA 3V4OA 5A6SA 3JWPA 4I5DA 1K4YA 1JUDA 3HB5X 4NBUA 5FWNA 3T7AA 5DPMA 3T3HA 4GP7A 2WSYB 4UEJA 3ZW8A 1Z56C 5D8DA 1EA5A 4XI9A 2FPLA 2IIQA 1JKFA 2ZU0C 3RUEA 5EXTA 5JY1A 3H4IA 4F2WA 1PQYA 5GIPE 4J43A 4LJ8A 3LUFA 3W6NA 1CUXA 4W1QA 4WOPA 3PHCA 4L4RA 3L01A 3LDGA 4GZ5A 3T5GA 3H5IA 4E22A 3ECCA 3LLCA 5EXPA 3X44A 2OPBA 3DM5A 5G0VA 1SJ9A 2W83A 3DMGA 4C6TA 4YRRA 3T61A 1CY4A 3D3JA 3R0JA 5J40A 4IVQA 2XA1A 1XEAA 3AR8A 3WL6A 1F0NA 3SKXA 1X87A 4X95A 2B2NA 1N6NA 3WG9A 2DQKA 2V54A 1G2QA 2I6GA 2VSOA 1H0SA 3Q8KA 3M1AA 3ENKA 4Y1FA 1D3AA 4BKUA 1MGPA 3H05A 1Q15A 1POWA 4JT8A 1MTOA 1Z47A 2Q3LA 2WW8A 1MPTA 5FAXA 1SKQA 3V7UA 2JFYA 5CCBA 5ALVA 2NTJA 2P2NA 4TZTA 2JLCA 1D6JA 3DOCA 4JJGA 3KOYA 2ODEA 3IXMA 4YJGB 3EAQA 4XDZA 3RAPR 3PR3A 1AB6A 4OBXA 5H9VA 4LYAA 2XOKA 2WAAA 1YBFA 1WA5A 1NYQA 3NBKA 2GB4A 2OEPA 3WL3A 2QX9A 3MUNA 1XEWX 1DIBA 2MOKA 3I05A 4U6QA 1D7OA 2I3BA 2EOAA 3G89A 2KE5A 4RBNA 5CGQB 2CBGA 3VKFA 3I42A 1YB7A 3EEFA 3OOEA 4M46A 3B5IA 3EVFA 1MABB 1MC8A 1NR7A 2JH3A 1DQYA 1FMJA 2FHSA 1LK5A 3Q10A 4RHEA 4WK6A 3PL1A 3VZCA 3X43A 1JHUA 3UCEA 2V7BA 5IVHA 3FYTA 1JDTA 3IQZA 3P0HA 2PUWA 4TXHA 2RIPA 3E15A 3ZBUA 1U2EA 4C30A 4EY4A 5ALYA 2Z43A 4RPLA 4OMDA 1V2GA 1YRWA 4S05A 4NJMB 3FPEA 5HMMA 3A1CA 2GN2A 2PFKA 4YAGA 4FZ3A 1NKSA 1INLA 3DMTC 1SBNE 2AIRA 3NOVA 1BHQ1 5JARA 5LL6P 1GPLA 4PG7A 1SKYE 4LWOA 4NK4A 4R2JA 3RTBA 3L7MA 3BXZA 4BV3A 4E70A 4HTFA 5DSZA 4BRUA 1G0NA 1ZUWA 4ASUD 1QQ7A 3B9PA 3RK1A 1RYHA 4J8PA 3UB2A 1U65A 4LMBA 3SJBA 4CV0A 1WTAA 5DLPA 1Q7TA 4NZYA 4R51A 4NU6A 2EKQA 4C0WA 1I24A 2DPXA 4PPFA 3PHBE 4RPJA 1XA4A 1A9SA 3H83A 2JF0A 2ORVA 5DX1A 1ZMBA 4L9SA 1IYZA 3L0BA 1QBKC 3N2GB 4MVJF 3C70A 4WCFC 5FTWA 3V1TC 1BVUA 4M9UA 3F3SA 3NYRA 1NRXA 2YVLA 1R74A 1T6XA 2VOJA 2X5NA 2QX8A 1V8BA 3AY3A 5KTMA 1M1YA 3SXUA 4R16A 4DXAA 3GELA 4ZDIA 2OC4A 1VSVA 4WLVA 3TIIA 2E4UA 4TOIA 4QDXA 4BHTA 2RHGB 2DP4E 3K1JA 3R5TA 3I9V1 3HKCB 3ZWNA 4CM8A 3I92A 4DLUA 3SY8A 3I45A 2G9RA 4YR9A 3P71T 2HIAA 2RGNC 5HQJA 3ZLBA 2EATA 5BSKA 1WV1A 4DC9A 4FSXA 1KI6B 4CKCA 1RLMA 3I1JA 1P4JA 5BURA 1REQB 1P0FA 2BFOA 3OX4A 4O2BA 1QHIA 1GIAA 1SFRA 1G0OA 2C4WA 3HB7A 4W6QA 4QUIA 2FZLA 4EY5A 4OIMA 3KOWA 5EJ8A 3ZWYA 4E5UA 5HKKD 2IJGX 4E13A 5CB0A 3GLUA 4RPCA 4U8HA 1YS6A 4EWLA 1C9DB 2HREA 1YKGA 2LUOA 1FYFA 4TQUS 3DE3X 1Z5NA 3DJYA 3MCZA 3ZE7A 4EHBA 2R2GA 1GGFA 3ITNA 1Y5IA 2WKPA 3L0ZA 1X7XA 1DO0A 5FOWA 4N3NA 2C2KA 3SYMA 3L7AA 3DLHA 3A11A 2X22A 4QUBA 1G55A 4MWOA 1E2IA 1II8B 1R4AA 3KQTA 4WCDA 5B3JA 1N9GA 3ZZTA 4ZI3A 5LFAA 2XEDA 2CHGA 1DCTA 1EVQA 1L5KA 3BQMB 2JFNA 3UJCA 1GPNA 2VAVA 3AJ9A 4OHKA 2A84A 4LRUA 4GC5A 4L9RA 2E6UX 1XGKA 1FDSA 1RMQA 2I4LA 2VJYA 3DHVA 3DT8A 3U7RA 4E2FA 2W93A 2Q6TA 3K8YA 1UMDB 1X7YA 4DV5B 3H9GA 3P9ZA 4XDHA 3DZ8A 2ZAMA 5DM4A 3PXAA 4IGKA 1YASA 5KU1A 1T8UA 3H2SA 1RQPA 2A1IA 2UVPA 2ZCUA 2O2YA 2HPVA 1DBVO 1T6BY 5D3ZA 4NOKA 5D85A 4A0FA 2C59A 4M49A 5JZVA 2OORA 4IQ0A 1P2VA 4MKHA 5KOJA 3U60B 1KO5A 5KEIA 4PGAA 4PM4A 4MV7A 5FH9A 2B4QA 2FPWA 2QTVA 4DYHA 4ZMSA 4CKWB 3T7EA 3OICA 3RNOA 3WIBA 2CNLA 1K8YB 4RV5A 1R0RE 4TXJA 3WAGA 2WEKA 3FX2A 4MGHA 3KVVA 4FINA 2FUCA 5K4AA 4DSNA 1CUZA 4ZGWA 5LZ2A 1JWLA 3JQ9A 2CWDA 2A67A 2WKQA 1TUBA 3BJRA 4OHWA 2ECFA 1OQAA 5D86A 4TYNA 1ZK1A 2GPTA 4BKPA 4OJMX 1IRXA 2A86A 1OYOA 1P8JA 2AJBA 5UKDA 4LOJA 4UEQA 1CNFA 3V1KA 1KY2A 1Y3BE 2ODPA 3EGOA 4V03A 2GEUA 5CX1A 3VC3A 1JAHA 1IHOA 1N5JA 4X64B 4B8ZA 5B30A 1BQEA 2Q8NA 4DUPA 4NMXB 2QLTA 2E4VA 3KR1A 4FZ5A 2M6KA 4EG0A 1SR8A 2CZCA 1NF3A 4DA8A 1SBIA 1RTKA 4BDTA 3KWLA 5D01A 5ALEA 3O7WA 1SXJA 1GUYA 4C05A 2HB6A 5AVXA 1EWQA 1PZFA 1I1OA 2YN0A 3R2JA 5HYVA 1XUOA 5KINB 1EFAA 4XCQA 2IYZA 2NQTA 4D9JA 1KYIA 5C8YF 2ZK7A 4LBVA 3K6RA 4U2KA 5JSYA 4BWYA 3K05A 5TPWB 3ZUGA 1IFXA 1LPSA 3H13A 5AOVA 3SQDA 4BL5A 3WIEA 1W6RA 1Y6QA 4L1KA 5HILA 2HDNB 4FD2A 2JGDB 2GCEA 2RHRA 1WHTA 4QULA 1YZQA 3T5BA 3J81k 1M34A 5C8ZA 3N8KA 1Y0BA 1ONPA 1UKZA 1E7MA 1WMSA 4LYYA 4JT4A 4X41A 5HG0A 1BYIA 5K05A 4PZAA 3E5MA 1B16A 2OR3A 4WLFA 4NARA 3AEXA 3EZ6A 3DH0A 2RHCA 1G64A 1GGNA 4D5EA 5J5VA 3TW8B 4LNUB 3W2IA 3F71A 5F21A 4E46A 1T9KA 3NATA 1GZ7A 3HJCA 3EBPA 3B1VA 3VR4H 3GARA 1CULC 3ICVA 3EFOB 3M1IA 4KXYA 4XIYA 1R0CA 1RQRA 2JAHA 3HWSA 4QFMA 2QQGA 2VUTA 3UM9A 4ZI5A 2AB0A 1GXSA 4GOXA 4P0PB 1KRWA 4I55F 4WXRA 5EJGA 4TZKA 5AQEA 1PLKA 2DYKA 1Q44A 4CODB 1O7JA 3NBYC 1EFKA 4O4JF 1EK2A 4QOHA 3X0DA 4QRIA 5CEFA 1HNWB 4ZAFA 1CY8A 4JH0A 2IU6A 5DBFA 5GY7A 3UWPA 4ZCIA 1SBTA 5IYZB 2ZIEA 3FDJA 1DI0A 2YWFA 3HB1A 3LH5A 1N4AA 2RHBA 3M6VA 5TE9A 4S0XA 4FYJA 1JS1X 5JALA 3G49A 3GH1A 4K86A 4YMWA 4KBGA 3TRIA 1DT3A 2J31A 5HHTA 2PMBA 2FZVA 3OUUA 1L4LA 1ZP6A 2DE0X 1DV1A 1E5XA 1OUMA 1HRDA 3KOXA 5EJEA 1ZM4A 4NH0A 4RKRA 5CURA 3RSSA 1R50A 1FSGA 2J59A 1FDRA 4UEOA 2WYUA 3WMGA 1XKLA 1KDTA 4PFJA 5TS2A 3R75A 4MW5A 4RACA 5CDHA 1NUUA 2MT9A 2EF1A 4M3NA 2HMYB 2WD7B 1RWMA 1SKMA 1C30B 3EEYA 2OAEA 5KHOC 2QP9X 5BWNA 2YJ3A 1Y5MA 1O03A 1BCSA 2XRYA 1EWRA 1GTMA 2FK7A 2OCGA 1AIPA 2WIBA 4GBGA 4QL3A 3O9MA 1LNSA 1GKUB 3H9QA 4LCJA 2A14A 3LPMA 2GESA 4XIJA 5IAEA 1JR4A 1MT3A 2EW2A 4UFNA 3GRYA 3VC2A 1LLCA 1SUPA 4ASUA 4B6GA 4ZYXA 3ESQA 4G0PA 5JVDF 1GZ4A 4HZGA 4LV5B 1AQ6A 4A92A 4Y1RA 4JX9A 2GDJA 3UNXA 5K2MA 4MVJH 4DE5A 1J5EB 1Y9EA 1BKSB 1P72A 2E85A 3UJBA 2ECKA 2OENG 4NEQA 3CE9A 2WHPB 3ORQA 5DMXA 2VTBB 5DBHX 5AJUA 5HKOA 5EESA 1IL0A 1E4EA 1QHYA 2I4TA 1WP4A 2OSBA 2ZBUA 4BFYA 4D44A 1OYYA 4RD4A 2J9ZB 2VLIA 1IOVA 4GEKA 5LXTA 2B98A 2C77A 4YRJA 4O63O 1ZIYA 2PBLA 4C01A 3CO5A 4P2BA 1RD4A 3ZWXA 5CCEA 3OF5A 4OQNA 4B6QA 4LHSA 1J9EA 3IBSA 1X3SA 5K3FB 1IATA 2QT0A 1F8GA 3PGLA 4URYR 3RPEA 3S2IA 1NV8A 3TBKA 2I80A 1AKNA 1YJ5A 3HU5A 4CEHA 3TQCA 4BO4A 3H3XA 2NUPA 2W7TA 4GP9A 4ZVKA 1PI3A 1XZQA 1O0BA 2V7QA 1WEKA 1O77A 2LE0A 4CU5A 3HACA 3RS2A 1O08A 5KTNA 1V3QE 2GM9A 4RVFA 5ICEA 4YJ2A 1ZCJA 5BN4B 3BMCA 2YWCA 4II7A 5IBRA 1VBFA 3W77A 1PDVA 1CJBA 1GPUA 4MARA 3S8MA 4P1ZA 3OPYA 2FRDC 3G9QA 1R0ZA 4TL8A 4LRYA 4UD6A 4ENVA 2DPLA 1PQWA 1O94C 3WB0A 4PN7A 3VYSB 3ZIAD 1OKKA 5JBQA 4D25A 2DZDA 4XLTA 4DC0A 2PRSA 3A05A 1VXOA 2BI8A 1KDPA 3P2KA 2FPUA 5BSTA 5C32A 4XWGA 2G3YA 2G4LA 5FTJA 2YJGA 3NWJA 3NTQA 2DBYA 2WJPA 1ZD8A 1DVRA 1QIHA 2XLBA 3L40A 4JVSB 4KUHA 2IHBA 4HC4A 3RTCA 4E14A 3ECSA 1DDIA 3AEQA 3LUAA 4JYBA 2O1WA 3HJRA 4DWJA 1B6GA 1QE5A 4RF5A 1U2GC 2B4YA 5T57A 1BROA 3HI6A 4RS4A 4F1KA 5ICMA 1NU8A 3R4VA 4HGRA 4KVFA 3VPGA 4KITB 1UIMA 4H35A 1DDOA 1NUPA 2NP7A 1KSJA 1N6KA 2ADOA 3T1TA 2DQYA 1JAZA 1U7XA 1ODCA 4LECA 3JWGA 4AY5A 1Z28A 3JU3A 4RDHA 1OXTA 1Q20A 1EQUA 1ZUHA 2EG5A 3KLOA 4H4DA 5L95A 1T36A 3BB4A 3HCAA 3SICE 3EHEA 3HUDA 4J1TC 3ZDDA 4Q3OA 4P0TA 1P29A 2ZUEA 4GKKB 3LT4A 5B1HA 5JWHA 2IV3A 4WBNF 5JT1A 4BJHB 5DCWA 2ETVA 4G4SP 1VFNA 5AK0A 4EP1A 1CDZA 2PQ0A 1KO4A 3LAWA 5J2UF 2JLXA 1WEHA 2J9FA 4LOKA 4JI2B 3JRWA 1AC5A 2BONA 3W8DA 1XLTC 2PGXA 3RVKA 1A88A 3O8RA 1X39A 2QTWB 3UO8B 3A36A 1E3EA 4AJNA 3AKEA 3I1FA 1JHRA 4J16C 4BVGA 3VR5D 5CD1A 4ENTA 1USKA 1EH5A 4D3FA 5BWCA 1E3DA 2BF7A 4TXMA 1JW9B 1YR7A 3TVTA 1GVNB 2J85A 3X1ZA 5BSMA 4C5CA 5IPFA 1QP7A 3SZLA 4DPMA 3G17A 2X19A 1HDEA 1MA3A 3AHJA 2AA3A 3GFQA 4QYSA 5ERGB 1TA4A 3T6KA 4DM7A 3O83A 5D3KA 5J59A 5A1JA 5H16A 1GU7A 2BEVA 3V2UA 4EKIA 2QD4A 3N3BC 2OP0A 3P27A 4YXWD 3PPIA 1E5LA 1Q3KA 3DNPA 2Q49A 1NQVA 5BXYA 4GPTA 3JVDA 4CIYA 4M1TA 4D7AA 4HQLA 1XO1A 3A6KA 3EE6A 4HFNA 2Q5LA 4UFPA 1MR3F 1GAXA 4U39A 1JR2A 5AM2A 1HQYE 2BMJA 4C4ZA 2C9OA 3QXSA 1QF7A 5I7WA 3LT0A 3U3JA 1V7PC 1V26A 3GJTA 1KDOA 3IP9A 3ZU5A 2XRFA 3DEAA 4NBWA 5ADVA 2R65A 1R12A 3AIIA 1U9IA 1J49A 3IVCA 4L8LA 2FSIA 3RWBA 1TADA 3KJFA 2WJJA 4FFMA 1YA4A 3ZYCA 4UQOA 2FG6C 4G07A 5BOSA 3R20A 2JK1A 3MLEA 2ERCA 1SVLA 4QU9A 4WINA 2HGSA 1FK8A 1M1YB 2H17A 3SXUB 1KORA 4L07A 4A15A 4JJFA 4BV8A 4P4GA 2ZPUA 4GBED 2IITA 4WHMA 2JAUA 3W5DA 4X65B 1G17A 2Z9CA 1IN8A 5EZSA 4CM8B 4JB2A 4P3YA 4ER3A 3N7TA 2C20A 1L1FA 1D5CA 2AW5A 4FLMA 3CLSD 5JSKA 2CVZA 1G8PA 1P9WA 2CXXA 1ZOSA 4DIOA 3BILA 1UUFA 3ELBA 1NBIA 3CUEF 3T1NA 2DB3A 4E07A 2EVWX 1C3OA 3H1EA 1IJFA 3U4CA 2QM7A 3OFJA 3RWMB 1DBPA 1QS0A 4GXQA 4YMVA 1C29B 1LLQA 4HD8A 4JL5A 4CMBA 5BV1A 4YT8A 1CUFA 1R37A 1P2TA 1T9CA 4D3DA 5KTOA 1GPWB 1SQ0A 3VZPA 5KYXB 3KFXA 1KFKB 2BV3A 1Z5VA 2CXUA 3GRCA 1Q1BA 2C9BA 1EUQA 3SMQA 2C61A 4E4TA 3G5AA 1UM9A 3NMUF 5KREA 1MEEA 1K7SN 4YT2A 2AEFA 3VAAA 1HK7A 4P5PA 1CZHA 2FWMX 1SD2A 9ATCA 1X7XB 3GT3A 1KS9A 5B3AA 1BU8A 1M8PA 4BN4A 4U7FA 2A0UA 4ZJYA 4CIAA 3KUXA 5HGJA 3D64A 1AHNA 1ZICA 2BHLA 2Y3IA 1NVVR 1OILA 4HUTA 4YRFA 1EHYA 1L3IA 1N9GB 4V1CI 1I7DA 3GFFA 3Q85A 3MTAA 1QH1A 3U5ZB 2ZSEA 3AGQA 3GA0A 5KIAA 1QBGA 3BJMA 5KOYA 3E8XA 2TSYB 4FC6A 3OPXA 3AHCA 4G5GA 1DIGA 1KHTA 3NJRA 2FK8A 3OZVA 4PLGA 2B34A 2ZBGA 3WADA 4DC1A 4TTIA 5DYTA 1XTVA 1T2NA 2FJUA 3OE7D 3ZJUA 1FUEA 1XZGA 2WHXA 1G41A 3F6EX 2R1TB 4F84A 3U61B 3UN1A 1PGOA 2P6PA 2ZB8A 1PK7A 3BWYA 3C24A 3ZIDA 1ZGCA 2UVPB 4KUGA 1KJIA 3DW1X 4BNHA 2FQQA 4QX6A 2CGEA 1G38A 1V4VA 3DEYX 3FUXA 3PX3A 4OATA 3V9AA 1TAGA 1DTEA 1Z45A 5IC6A 5B4VA 1O95A 1TK3A 2QTVB 2V7XA 4J1SA 5J1SB 4M1WA 3DOHA 2VT6A 4BLQA 4JLUA 1AV7A 1WW3A 2XWBF 1HLDA 3GROA 1QNFA 4KQIA 3K9CA 3OQNA 1MHTA 1I6WA 2MYTA 4KE6A 4BJ6A 4RD6A 3A27A 2B1QA 1E2LA 3VKVA 1V71A 3NM6B 2WFMA 5L51A 1TUBB 1HDRA 4MDEA 2RJ3A 1N3YA 4IZIA 4FDTA 5AXBA 4CIXA 4DQDA 3AUYA 2XD4A 1B1AA 1E3SA 2JA1A 3B89A 1HI9A 3RF6A 1JHXA 2I3DA 1NR5A 3ZS8A 2ODWA 1JDVA 1CZLA 1MFZA 1SIBE 3AVOA 5LMUB 3Q3JB 2OLJA 3LS2A 3W3AA 1QRDA 2JIMA 1HDZA 3KVYA 1EFRD 4FNGA 4RVGA 3T9EA 2XF8A 3O8LA 3SR4A 1LBIA 4Y9RA 3UCFA 3SC6A 1MB0A 1NJGA 3FLBA 1SXJB 3PYMA 4LXGA 2C2WA 4GM4A 4MMXB 5PGMA 1LLFA 3V2GA 1QVWA 3P2YA 4LZJA 2OV6A 4RV9A 5FEMA 1W29A 4WDQA 3UJ3X 3RANA 5K4GA 3ESXA 1SHKA 3A3PA 1DBIA 2CVPA 2BGUA 3DDSA 3F6RA 4UMEA 5CFQA 1GPH1 3ZHUA 3L79A 4RY9A 1V47A 1WHTB 5CDUA 3OOWA 3PFCA 2IZ5A 3ZJTA 1P81A 1SHTX 3D8TA 3FFXA 1UXKA 1PT5A 1O96B 3LBFA 2KX7A 3CW8X 3DKRA 1L8OA 2OBNA 1OSNA 4IQ8A 2WYOA 4LY3A 3PUWA 4RQTA 3MJFA 4ZVMA 2P4UA 1XLVA 5ANRB 5CCXA 1V1MA 3QVVA 1FQOA 3MT9A 3N8NA 3BCRA 1LGYA 3JWJA 3NHFA 2NSDA 5EFZA 4LZLA 1TW2A 2QI9C 2R6FA 1JVBA 4LDAA 1HY3A 3ENVA 1E1RA 4Y2UA 2GPJA 2V7VA 1VMKA 2P9JA 5C31A 5TQ0A 1CG6A 4UNSA 4KXXA 4Z51A 4RXTA 1JPJA 3PTLA 2WIFA 5KX5A 4B4VA 5J2TA 2QY6A 4MW2A 5JWOA 3WHPA 1RPNA 3CZAA 5CT4A 1ULAA 2H31A 4HDSB 1KWGA 1GXSB 2Q9CA 4UATA 4HI0E 1VIVA 2CEAA 2ZDQA 5CM9C 4ZDKA 5KOIA 1JEJA 1WPQA 1C9JA 1AMOA 2O8DA 1K4KA 4LTNA 3H2GA 1K3UB 2W37A 2ZE7A 1KAHA 2PZEA 2GOYA 4ZK2A 2Q3MA 1TKBA 2FPXA 2YFKA 2GJSA 3QKTA 2QTTA 4G0ZA 4ABYA 1A50B 4PLVA 4FCCA 1WXGA 4P5EA 5JY6A 1S4MA 3LV8A 4ZTBA 1LJ8A 4OAPA 1XPUA 2ANBA 2F8TA 2Y92A 2WTUA 2I8AA 2VK4A 1MGOA 2FPOA 5F3DA 2B30A 3UW3A 4Q3KA 3EVDA 2X6TA 1RXIA 3DOFA 4NV1A 5DGDA 4OOFA 1UFQA 4M98A 4G86A 5B7PA 3K6SA 3IJRA 1CUCA 4MQMA 3V4SA 4PYIA 1TD9A 5AI8A 3GI1A 4RJLA 4RABA 1E32A 4NSNA 3VR5A 3CUTA 2OAP1 4EI8A 3NKVA 5AHXA 1ZXLA 5I7HA 1AHHA 4M53A 4X3PA 2RBKA 1BCSB 1FMFA 3BHJA 1CUBA 1R4ZA 4BMVA 3MPUA 3TX6A 2WB2A 2ZJZA 4XRGA 1HEYA 3M1LA 2G67A 4QATA 4XWKA 2XDWA 4BNKA 3CEPB 3AG6A 3C3XA 5EIBD 4B8YA 4YXWA 2DETA 3KZMA 5E9WA 2GPSA 1JZTA 4FWBA 2PMDA 4FBLA 2W2VA 1AE1A 3UOAB 4Y2TA 1JTFA 1BA2A 4NIMA 1NULA 4O4LA 4RQBA 2JLSA 2GHIA 1OLUB 3TR6A 2REBA 4Y1RB 3HXPA 3TPZA 2WSSA 1AZTA 1IB6A 2X0KA 2E4YA 1AMNA 1A7UA 4YBZA 2C4VA 4R8MA 4PXSA 1JLHA 2BZSA 4RKWA 4ZC1A 3TZLA 1KNXA 1PUXA 2PCJA 5EJMA 3T9BA 3L41A 2PNJA 5IH7A 1H5QA 1SURA 1E4EB 3FRHA 1GN9A 1NI5A 1HDXA 2PT6A 4NBKA 3JD0A 3PDCA 2J41A 4JZKA 4JYPA 4PPQA 3LHFA 4KQWA 3I6BA 3TDNA 4MUXA 1X6VA 2RSLA 4D9NA 3QNWA 3UWKA 4TYWA 5C52B 3OCXA 1F48A 1MMFB 3FDXA 2VJDA 4BGDA 3KOUA 4ZVLA 1N2CE 4L76A 5LQCA 1Q6ZA 3MJTA 3CLVA 3QOYA 2I7TA 4CEHB 1RRMA 3B7WA 4TT8A 3SLRA 3S2SA 3SSOA 1EZ4A 2HF9A 2Q99A 5L3QB 3VI4B 3HXQA 2WNIA 4WADA 3MILA 2W6JA 3GJQA 4BRSA 3RREA 4HX2A 3KWFA 4YJ2B 4DDHA 1U8AA 3BMCB 4HYYA 4C7KA 4KK3A 2XZPA 5CT6A 4D4HA 3KSDO 2WM2A 2I54A 2ZULA 3MW8A 1IULA 4G84A 3VPCA 4E5NA 4OYRA 4EI7A 1GA1A 1T29A 4ZEOA 5ALMA 2J3QA 3HRIA 2VJAA 3PB3A 1QUFA 3I30X 4J0QA 4QXRA 1N7GA 4LAFA 3EXEB 4IJWA 3VDMA 1V5IA 1BO6A 1YDEA 2C88A 5HJEA 2YZGA 3NXSA 2FF7A 2QRGA 3MJ4A 5CRIA 2I7DA 3S0JA 2AV6A 3EASA 4XVUA 3BF7A 4OFWA 1UAGA 4LJ9A 3NBAA 3V8QA 1CQWA 3AUAA 5DTRA 2X23A 5F2KA 2Q4OA 3LT1A 1CR0A 4KIUA 1Q1QA 2BI7A 4KCGA 2ZIXA 4JXKA 5EJFA 1CXZA 5JO9A 1EG2A 2GBIA 4D98A 4E11A 3Q2OA 1ULZA 5IWAB 1LFAA 4ON9A 3H8VA 4OHFA 3HDVA 2FSHA 2ZYAA 3CUYA 3LCCA 4TTSA 4YP9A 5JXWA 1TGYA 4EITA 4I50B 3HO1A 4QO8A 3OE7A 1UMCA 4PZZA 1PLJA 3RBVA 1NLZA 1VZ3A 4WX2B 3CUVA 4JQCA 5A06A 1DIRA 2Y1CA 4AP5A 1PQUA 3HBJA 3B9RA 3Q3EA 3OKCA 3H3FA 3BG5A 4WDRA 3CPHA 2F8LA 1EJ2A 2FWPA 1F8FA 2CUNA 2G04A 1PBNA 4HPXB 1VCIA 4DDUA 1GPKA 3CUSA 4GXRA 4F2PA 1FRFS 3GUYA 1VPWA 3NFRA 4N7BA 4JLBA 4LXXA 4H1UA 4KQ6A 3GT0A 3RVRA 1QH8A 3VSBA 2R7MA 5FUBA 4TVSA 1YVEI 4Q1AA 2BFWA 2C0PA 2LZ0A 3RK4A 2Q2QA 4KLZA 2O8EA 3M7IA 2B2XA 2C78A 3QVSA 2RC5A 3EIFA 2QN7A 3D31A 3KZCA 4ERNA 1YE5A 2X7JA 3TI7A 3TMAA 4OLFA 1JHMA 1TCAA 1U90A 2F59A 2HJ9A 3GUZA 1A96A 1IUKA 2V6JA 3EG9A 3GWZA 2ZDGA 3BMNB 2VHJA 2JKZA 1P33A 3WC4A 4AJ9A 1Y33E 1D8AA 2O7NA 1UDXA 1FFBA 1R6XA 2WYIA 3L8CA 2C31A 3VNAA 3WMFA 3U44B 2CMDA 2UVDA 1JIVA 2VTDA 3EB9A 2HL6A 4IUCS 3WJ7A 4F5EA 2EL7A 2WU8A 4K9OA 2QNRA 1UC8A 3T52A 2EP8A 1F2VA 2XV1A 1C7IA 2VDMB 3PF9A 4RGVA 3OWHA 2ZRLA 1UPCA 2J07A 2ZB4A 4FFLA 5K3AA 4ZKDA 1FFYA 4M55A 3AZQA 4M1MA 4EUEA 2ZE6A 1ENPA 3SOZA 2HA6A 3TZCA 2LWIA 4ALIA 1P5HA 4GZLA 1U0GA 2QRHA 1MB2A 2ZXEA 1XD2A 1SELA 1XRPA 2EFGA 3I6MA 1JALA 1XYYA 3IR5A 3QI2A 4NU8X 4R1UA 5EZYF 4AJEA 3FAZA 1TZKA 1GADO 1YS4A 2ZRIA 4HAVA 4IHKA 4AO6A 3S8YA 4KFCA 2OV8A 3GIDA 3GWGA 3QBDA 2V74B 3P2OA 2P6UA 3FHOA 2XMRA 4M8KA 2XGJA 1UBTS 1N3BA 2NSHA 2OCKA 3H2YA 5B1SA 1CIJA 3U9SA 4D9IA 5BOSB 6ABPA 4BB9A 5JSQA 3BB3A 3QLEA 3A6GA 4UDYX 2XUQA 3WWPA 1SH7A 4L27A 1UWCA 2GHTA 3FRIA 3QTBA 1ZG3A 3HE3A 1PT7A 1EK1A 2JK0A 1WSBA 1I01A 2PZFA 3MWLA 1QP0A 4IDOA 1FXSA 1UOPA 3LKVA 2G77B 4KQKA 3ZTYA 3AJ8A 3VX4A 1C3OB 3I5AA 2HFKA 2PZBA 3HM2A 4P4UA 4ABTA 2PYZA 1FVFA 1R5OA 4BZQA 2A0XA 1B6TA 1KAQA 1A04A 1P39A 2B78A 1QAQA 5DJ5A 1F1BA 4QHTA 2R8BA 3R76A 3QA3E 1YIOA 2X4GA 3IDZA 3EYAA 1ELOA 1EX1A 1NBWB 3CFYA 3SG0A 1Z0AA 4B4DA 1SKUA 2PIAA 4C29A 1UM9B 3EWNA 3HXMA 2C2BA 1A4IA 2XNDD 4M38A 1OZFA 4Q7EA 4NZZA 3JYNA 1TQHA 1FX1A 1T3TA 3D8RA 5P21A 4ALJA 5BR8B 2G63A 2ISQA 2WWGA 1U3CA 1T5TA 2GPNA 4IAOA 4AZTA 2IFTA 1CCWA 4JK3A 5IT0A 2YY5A 2PSFA 4F3CA 1HT1E 5C4GB 4GW3A 4YUYA 4NCXA 4BGIA 1GGJA 5K8VA 4AJKA 2NXEA 1ESDA 2O5VA 4RZHA 4AS1A 3AVQA 3FUUA 2XUGA 2YBEA 3VU0A 4R71A 1V41E 2ECQA 4B4OA 1BFKA 3FGPA 1CD5A 2AI2A 2GZ1A 4KFUA 4JYAB 3I0ZA 1NW5A 1XNQB 1LH0A 1PF7E 4N18A 1HFEL 4EW2A 3TB6A 2DPGA 5ELXA 5CJJA 1JEEA 1RQ2A 4U0JA 2NNLD 3G7SA 1P0MA 4NV3A 2WT8A 4ND4A 1PUJA 1PCXA 3A3NA 1E6CA 1FS4A 3PHLA 4IX1A 3RK0A 4CDNA 5FRDA 1L2TA 4M9XA 2YXNA 5DT9A 1PWZA 3TJMA 2VJNA 1YE8A 2CXHA 3DO6A 3H9JA 1Y6GA 2GS9A 1XCMA 4MPDA 4RNDB 4UVGA 4GMFA 3PQDA 4Z7NB 1LRKA 1CU1A 2R8RA 4RV4A 1XTZA 3TD2A 4OHOA 1RT9A 3ITKA 4RO0A 1RCTE 1VB5A 1UPFA 3R5SA 1EFHA 1GOTA 1H2HA 3F5QA 1V96A 3F9IA 3GZ4A 3WNDA 4BNMA 1YQDA 1PWYE 3WK7A 5EE0A 1G42A 4QGFA 5GVSA 1KI9A 4M87A 1WMDA 5B37A 1KI4A 2Y05A 1SZJG 2ACWA 4PZ0A 4CLDA 2FSUA 2LKCA 3R3HA 3ACCA 2P7IA 1T6NA 3STXA 3JVUA 5A5VA 3NJ8A 2XXJA 1VHWA 4U3JB 5J4YA 3B1FA 4KVAA 2PE5A 1X1RA 5KS2A 1C0IA 5LQKA 4KE9A 2RB4A 2Z4SA 2OHXA 3GP3A 4J9UE 4N7MA 4WZBB 3UXHA 3L07A 3AP2A 4LYHA 1WBDA 4UUMA 2WPNA 4QYMA 1Q11A 2CKDA 2HQ1A 1OXXK 1NSYA 2AOVA 3IKVA 1E69A 2JGLA 3ZPXA 1R8YA 2DUWA 2WY2D 1E3WA 3L6DA 4RQUA 3PQ5A 4NE7A 4COOA 3TLCA 2CVOA 3G2MA 5G53C 3WWCA 2H2FA 4XRRA 1Q16A 1B8NA 3KHUA 4TRNA 2IEYA 4UDNA 1M2VA 5DHTA 1XQ1A 4R1PA 1TT5B 3F78A 4LSWA 4Q82A 3MSXA 4B47A 1Y1QA 3M9XA 3ZOZA 1F3LA 3DHYA 4AY4A 4JMPA 1BX1A 1UEJA 2IYUA 5J9FA 1NMYA 1AZSC 1OFHA 3D4LA 3QTLA 3EW9A 3WQSB 4ODIA 1QK4A 1X7GA 1YVRA 1NQAO 3D3KA 2RAUA 3D3WB 3WK4A 4LF8B 3W79A 2DX7A 3BJEA 3CZ4A 2ZSIA 4YQYA 1V1MB 2P6OA 3WGIA 2PUAA 3V6MA 3CXUA 4NDNE 4E08A 1T2FA 2BGIA 4HLUA 3RAGA 1HMYA 1P1RA 1PD0A 2CLOB 1V45E 3QFSA 2QJWA 3FVWA 2IPMA 4D4JA 4JKIA 4DIKA 7YASA 2WICA 1KFCB 1H2RS 4FYVA 5SY9A 1DAMA 5T8KA 3UUFA 3MF4A 3M6IA 4MCHA 4DW8A 4ZIRB 5C1DA 3IP1A 5LLTA 3V4RA 4BNZA 4JT2A 1KBQA 3VISA 2H4YA 4FBGA 2GVZC 1Z2CA 1R0WA 2AC2A 4M0LA 4A3SA 3VKGA 2AZTA 4YRTA 3OKAA 1V8ZA 2QSJA 1FDVA 2XSZD 2VJOA 3MRVA 4TL6A 5T3UA 1YT5A 7AT1A 1S3FA 2W2OA 1SEPA 3CZCA 1C0EA 3LC1O 1CW2B 5E8RA 1U3VA 2C2HA 1MQ8B 2F00A 1J23A 2O8DB 3JCZA 5BP7A 4AF6A 3PR2B 2XCQA 1DUIA 1N2CA 1W9MA 1ZH2A 2AR9A 3OFNA 4N6NA 5CLFA 3QVTA 5FUQA 5K01A 1SXQA 1ZSYA 4QFCA 1Y5NA 4HZIA 3G88A 4TQGA 3ZHYA 3V33A 2H5LA 5F2NA 1FFHA 1U0OC 4B2LA 3U9TA 4BO9A 4C0SA 2VQEB 4BLSA 1IY1A 2OWDA 4RVSA 2Z9BA 3TTWA 3O9ZA 4O1HA 1HPLA 2X4LA 1B3RA 3HADA 3K6SB 1PYOA 1R5BA 5I5EA 4HNHA 5BXQC 3VNVA 2GD2A 1YZKA 3I3SR 4NTZA 2NU6A 2WLSA 1V48A 4EGFA 4YPOA 3WFJA 5KYGA 1ZOOA 4RGBA 2CD9A 2ZYHA 3NDRA 4TXNA 1EDEA 1ABFA 1CR1A 2WQZA 4J6FA 4UE6A 1QZ3A 4P7JA 1NQ5A 4C78A 3WL8A 1H1LB 3AINA 3ZWWA 4GGOA 5L6LB 2PIDA 3FYCA 1UZAA 1VMEA 2CJWB 2WSLA 4DPKA 4A03A 3WOHA 3W9UA 1CFZA 1NUSA 4RKQA