4CQMB

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
232
Chain Sequence
b'HHHHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 68
structure length 232
sequence length 241
chains with identical sequence C, F, G, J, K, N, O
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmB00
1BXKA 2YJZA 1ZXLA 2GERA 4J6FA 5DBGA 2AMFA 4Z3DA 2VOJA 3JQ9A 4NBVA 1E3EA 3H65A 5B4TA 2X5OA 1WWKA 4LK3A 3TZCA 3B70A 3FN4A 3ONEA 1HDCA 2AXQA 2BLLA 3D5TA 1DDOA 2GF2A 3GLQA 3FWNA 4CV0A 4DL9A 1UAYA 3M1LA 3JD0A 1TXGA 5CPFA 5T67A 4BKRA 3COSA 3OQ6A 1GQQA 3AK4A 1VKOA 4Q3NA 4YAEA 4IDDA 3JYNA 1DFHA 4YRDA 2QZ9A 4K6FA 3AJRA 1WDMA 3MWDB 5AXBA 5AXCA 1HYEA 4UUPA 2Q2QA 2YFQA 1HDYA 4NJMB 4BMNA 4EI2A 1XDWA 3OECA 3UICA 1DIAA 1PWXA 4E5PA 3DBLB 3T7CA 1NVTA 2PKQO 3DTTA 1V0JA 1PJQA 2VQ3A 3OQ1A 3I83A 4LVUA 3DBRA 3NEPX 1MP0A 1TT7A 3JQ9C 5F5LA 1HDGO 3IMFA 2G0TA 3A9WA 3I23A 2C5EA 1U3WA 5DNAA 2RIRA 3H3JA 2ZQYA 1EZ4A 3RAJA 1KY5A 1U7HA 1ZZEA 7MDHA 1EK6A 3VHRA 4RZIA 1YQDA 1BHSA 4F6LA 4CV1A 2W8ZA 2AA3A 1U9JA 3BYZA 1QG6A 1LI4A 3GRKA 4JN6B 4J2HA 4B8ZA 1K6XA 2VYVD 4Y6SA 2FSVA 4DIFA 2AQ8A 1I3MA 2YYYA 5BT9A 4R5MA 1LRLA 3MTJA 2X7HA 3NDIA 4ND4A 4BNVA 4DPLA 2PH5A 2G82A 1IY8A 2GR9A 3D3WA 3R3JA 4MVJA 4WCDA 3ZV3A 1U5AA 4UUNA 3K96A 1HSOA 3ZWMA 3D5QA 3I52A 3P7MA 1C0LA 3RUAA 2V65A 2OOSA 4I1IA 3FTPA 4R3WA 5JAQA 3HQ4O 4HXYA 5KJ6A 1GZ6A 4Z0HO 4UEKA 1PQWA 2VCYA 4JROA 5IG2A 4WE3A 5CDTA 1U2DA 1GFSA 3TL2A 3JQEA 5TC4A 2EG9A 2HAEA 2VNAA 3ZHZA 3WJAA 2DBZA 4OL9A 2NU9A 4NBTA 5MDHA 2CMDA 3KYCA 5A05A 3PIIA 2PGJA 1MB4A 3E9NA 4RPHA 3ENKA 3DOCA 5TX7A 3E5MA 3AY7A 3QP9A 4NI5A 1P44A 4N7RA 1E7QA 3MTGA 4L76A 2B4RO 2J3HA 1WAMA 3F9IA 3GFGA 5B1YA 1QSGA 2OUIA 4B3IA 3NDJA 4J16A 4UUOA 4R1SA 4CMBA 4YXFA 4ID9A 3EMKA 3GC6A 4LGVA 2Q45A 3ZZNA 4PLYA 5ES3A 3OJEA 3E5RA 4I8XA 3FNHA 4TWRA 2HO5A 3QWHA 3TQHA 3K5PA 5EJ2A 5JXWA 1UZLA 4R3NA 3ASUA 1YGYA 4RV9A 3X2EA 3F46A 3K2EA 3DZHA 3PQFA 3HDHA 4FJ0A 5ILGA 4OXYA 2YDYA 2JAPA 4UULA 4XEHA 4GPD1 3L6OO 3OJOA 4J0EA 5AYVA 2DBQA 1U8XX 3PJFA 3GG9A 2DBRA 2VHZA 2RH8A 2VTEA 2XXBA 5C7LO 3WB9A 4IQGA 2G17A 1R6DA 2HLPA 4CM9D 3WGGA 5G0TA 1DRWA 3L6DA 1G1AA 1UXJA 3DBHB 4IS2A 1Z73A 3VZRA 5IXSA 1PS9A 1YRLA 1B0AA 4QECA 1GR0A 4G2NA 2PLAA 1OAAA 4DIOA 4AJ1A 3DBRB 4BO4A 1P1JA 2ZKLA 4IDAA 3WYCA 2DUUA 4B7UA 1ORRA 1BTOA 1YQXA 2ET6A 1OBFO 2QRLA 4MINA 4AJKA 1ZKMA 4Z9YA 4ZD6A 3WFIA 3DOJA 1KVQA 1VKNA 2VWHA 3JSAA 5BNFA 1ZK0A 1HETA 4FOOA 1HWYA 3ADPA 1L7DA 3RBXA 1P77A 1LRKA 3K30A 1HZJA 1HDRA 1FDUA 3WGYA 3QVOA 5KNLA 2FOIA 3QV1A 1KEUA 3D3WB 5BR7A 2WMDA 3PI7A 5AQ1A 2J5KA 1EFLA 2RBEA 1ZW1A 2P9GA 4YRBA 1PJCA 1QYDA 4N54A 2IYPA 3BHJA 4FR5A 2QHXA 1SOVA 4BNMA 1VM6A 4YT2A 6ADHA 3F4LA 3BIOA 1PL6A 1CJCA 2BD0A 4IDBA 2O7SA 3KYBA 3F5QA 4OOFA 2VRCD 3WS7A 3RJ9A 2EP7A 3IOYA 4JLWA 2ZCUA 3ABIA 3ETDA 4ND5A 4ILKA 4Y67A 3UCFA 3DOOA 1KVUA 4TZTA 1K89A 3OIGA 2BELA 1G0NA 4ALKA 4IUYA 3WGHA 1ZXBA 2W2LA 4D0SA 3KYCB 4CJXA 4DTIA 4OGWA 2NACA 4L9RA 2PGLA 1B15A 1JW9B 2IE0A 4CLHA 3ITDA 1A4IA 1PTJA 2I76A 1LUAA 1CETA 3DHNA 3KTDA 4YAKA 3ZWWA 1BDBA 4JIGA 3D4NA 4A03A 4JBGA 5DN9A 3NX4A 2VT3A 1B8UA 2PKQP 4D42A 3EUWA 3F4BA 3NGLA 4BB6A 2PY6A 2VN8A 5TIIA 3DHEA 1I10A 4LN1A 4Y6PA 4DBZA 3E48A 4JXKA 4NJOA 3GQVA 4CMAA 3PZRA 1P31A 1I01A 2DTXA 3IAHA 4Z0TA 3WXBA 4UEJA 4UREA 4I9NA 4K6CA 4EEZA 1LEHA 3WGQA 3DO5A 1E3IA 3BAZA 4KTTE 1T1RA 1LC0A 3JQ7A 5THQA 2FSSA 1VJ0A 2J3IA 4IIUA 4E2XA 4R54A 1EK5A 3PJEA 5CAEA 2HMUA 5G0WA 1NVMB 4J9VA 1GADO 3ANLA 3VPFA 1NM5A 3SVTA 1ARZA 3U4IA 1YKFA 1IUKA 1U3UA 4LSMA 3B1FA 3LT1A 5H81A 1Z45A 1ZVMA 2W98A 1LRJA 1T25A 1QXSA 3DHYA 1T2AA 2YHIA 4GLLA 4MO2A 3FRJA 2O3SA 1FDTA 2RH4A 2YV3A 5TT0A 1ZSYA 5L95A 1E5QA 2QRKA 3C7AA 1U3VA 3F6YA 1SPXA 2ZJ0A 2QYTA 3O38A 3P2OA 4GL4A 4H7PA 4JGBA 2OZPA 1M76A 3HSKA 4WLNA 1Y5MA 4HBGA 3RU9A 2PH3A 4WCFC 4YPOA 4A5OA 4M1QA 3IDSA 1WDLA 2Y1DA 3CZRA 1OFGA 2GASA 4ESOA 3KB6A 3VOSA 2EW2A 1H2HA 2POQX 4HP8A 4DLLA 4HFNA 3PP8A 4DQVA 1GEGA 3ZNNA 1KVSA 4CMGA 4K1LA 1E1LA 3AOEA 4AJNA 3E1KA 4BNGA 5CDSA 2ZTVA 3LU1A 3GZ4A 5HRUA 4EUFA 4Q3EA 1Q7GA 4BV8A 3NJ4A 3PWZA 3BMNA 1LDMA 1YJQA 1JU9A 5J23A 1E7YA 4YACA 5DOVA 2GD1O 3OM9A 1FK8A 3DZIA 4XB2A 4JJGA 1P9LA 4AJJA 1DRVA 4UVIA 4DPMA 4DLBA 2FP4A 3LC7O 3WMWA 4Q3AA 1VSVA 3BTSA 4PFJA 1XQ6A 2CF5A 2VZ8A 2VWPA 4PZEA 4QX6A 3WBBA 4AICA 4PIVA 4CQMA 5I7VA 3GNSA 5CPBA 3DMTA 4I5DA 3GUCA 3ZI0A 4IMPA 1YBAA 2I9PA 2YFHA 3H4VA 1B14A 4L4RA 3AOEC 4K28A 4O6VA 1AHIA 4CM7A 3L4BA 1ZEJA 3ONFA 1A27A 3TFOA 1K0UA 3O03A 2CF6A 3FR8A 3W6ZA 3K73O 4IQ8A 4MPDA 3I5MA 3GH3A 2QIOA 4RDHA 3BA1A 5JO9A 1NAIA 4G81A 4QFCA 3G3EA 1P1FA 1LDNA 2CY0A 4JNKA 1Z75A 2HMVA 2HK8A 4R1TA 4DQUA 1SAYA 2YW9A 1G0OA 1PR3A 3UFXA 2NVBA 1T1SA 5KIAA 1GU7A 3WIDA 2NU8A 2CDBA 3UN1A 4WUVA 1K3TA 2B5WA 3SJUA 3U5TA 2CNBA 4CM3A 4Y6RA 3NDRA 1WXDA 4HFMA 5TNXA 3FPLA 2F1KA 2C29D 4IDCA 5COBA 3ADOA 2Y1CA 1F8GA 5TJHA 3AFNA 2E82A 1I3KA 2AG8A 1DHTA 9LDTA 3L4BC 4IS3A 3PK0A 1U5CA 3F1LA 5JFOA 1YS4A 4M87A 3FF4A 3U3XA 4J1TA 3AM5A 3ZWAA 5ADHA 1GD1O 5IDYA 1QP8A 2JAHA 3TRIA 4PRKA 5L3ZA 3GEMA 4XQ9A 2X5KO 4BNXA 3VTFA 3TWOA 1ZBQA 3A4VA 1IE3A 2B4TO 1TI7A 1I0ZA 1DC5A 1MA0A 4NFYA 4DMMA 1IULA 4XQGA 2DU8A 2I3GA 3L6EA 1ZEMA 5KCZA 3UXYA 1GDHA 1FJHA 1PGQA 3CUKA 1KVTA 2EW8A 3T4EA 4NH4A 2I99A 4XQEA 4ALJA 5IDQA 1QORA 4IGEA 2ZB7A 3C3XA 2NLOA 5BNTA 4YRAA 5AVOA 1QYXA 1Z7EA 2A4KA 4WLOA 2VUSA 1X13A 4FW8A 3CMMA 1DO8A 2WD8A 1F12A 1XYGA 2NVUA 2O7QA 4UVHA 4HY3A 1HTBA 3R3SA 5JLAA 4Q3BA 3GMSA 4ND1A 1U4SA 2B36A 2VUUA 2Y0CA 3LZ6A 3Q2KA 4FFLA 3NKLA 1LLQA 1SB9A 2O2YA 2YV1A 2ZB3A 3BMQA 2FPPA 4YJGA 2Y1EA 5G4LA 4EYEA 3QLJA 1ZK1A 1WPQA 4DXHA 4CLRB 1DAOA 2D3TA 3BMCB 3EHEA 3ZW9A 1A4UA 3A14A 4PLWA 3PDUA 2PV7A 1DJQA 4LRSB 1AHHA 1LSUA 1JAYA 3BHMA 3BTVA 4DBVO 1NVGA 4KWHA 1OMOA 4NFSA 1K5HA 1XHLA 1IZ0A 3WWYA 4KUGA 4OKNA 4EZBA 5ICSA 4CQMB 3LLSA 1LQTA 4TVOA 3PWKA 1YB5A 3U4HA 1GPJA 1R0KA 3AWDA 3RSHA 3NTRA 2PWZA 3OIFA 2VYVA 2XOXA 2DC1A 5A9SA 1KS9A 4P22A 1SNYA 4ROSA 2ZCVA 2EJWA 4XD2A 4XYBA 4GBJA 3TZHA 2OO5A 2QX7A 4IGFA 2AEFA 3QVSA 1EBUA 3PIDA 5BQFA 1I24A 2DFVA 1ISHA 1BMDA 4JP2A 4B3HA 3UAGA 1E7RA 1PJTA 3MJVA 5TGDA 3Q6IA 3L4SO 1DSSG 1U2GA 4NNJA 3E82A 1EDOA 4D41A 5C3MA 1OI7A 4RDIA 2BGMA 5U9CA 3GDOA 1C1DA 1HE5A 1ONNA 1XSEA 3I9OA 2HRBA 4YT5A 1RM4A 1C14A 4XB1A 4XGIA 2EGHA 2HU2A 4GH5A 1CERA 4BNTA 2UUPA 4I9UA 1ZO8A 1AUPA 1Q0QA 2IEDA 3BHIA 5CDUA 4YAGA 1YJ8A 4ZQGA 3TOZA 1GUFA 1R15A 1MFZA 1ID1A 4IINA 3PYXA 3G0OA 4BQRA 1E3SA 1M66A 4RQTA 5L53A 5KJ1A 4CLOB 1R16A 2ZTMA 5T8KA 3IIEA 2GN6A 4IXWA 1LXCA 2JCXA 5B4VA 4MVJH 5JNLA 1E1KA 2I67A 4CMCA 3JQBA 1LDGA 4GWKA 4BNIA 2OL4A 3D0OA 4J4TA 2NWQA 1GV0A 4NBWA 4EJMA 3EDMA 4RPLA 5JDCA 1KEWA 4YB8A 2IZ0A 4XDYA 4PCVA 3VVCA 5GZ3A 2NNLD 4XYMA 3PJGA 2V6BA 4PG4A 5EINA 5AXDA 4ALNA 4M86A 1S6YA 5F1OA 3SBOA 1B8PA 2NADA 1HYGA 2VT2A 5EESA 3Q9UA 5HTOA 2YZ7A 2ZQZA 2X9VA 1HLDA 4XDZA 4XR9A 1NASA 3GN1A 4B4WA 2WJPA 3JD4A 3F1KA 5KTKA 4S1VA 5JW6A 1LJ8A 3U0BA 4PLHA 2DBVO 4M8SA 4CM9A 2AQKA 5T8KC 2GGSA 1P1HA 3BMQB 4YJGB 3AUAA 1DB3A 2VZ0A 2B83A 3OQBA 4CUZA 4IZIA 3UCXA 1YB1A 3P5SA 3WG9A 2IZZA 2DAPA 3I9MA 4O0LA 2AG5A 4HADA 4KUHA 1BXZA 1EVYA 4WASA 4CL8A 5FWNA 4DRYA 3EW7A 4HV4A 3HB5X 1I32A 4NHEA 2VRBA 2NQ8A 4FOSA 1P0CA 4NG5A 3WQSB 2C7VA 2H1SA 4MKXA 2GZ1A 1DEHA 5THKA 1Y1PA 4QXMA 2QQ5A 3PJDA 1X7HA 2JKVA 4PLPA 1LSOA 2I66A 5DDIP 3VC7A 2HJRA 1LA2A 2DFDA 5A9SB 2VYND 4HFRA 4A7PA 3N7UA 1E7WA 2WE7A 3UGKA 3ZWXA 2O3RA 1DIGA 3QA9A 2FRDA 5IZ4A 2GN4A 3W1VA 4AJLA 1FDVA 3S2GA 4CM1A 1MC4A 2Q4EA 4PLTA 4EITA 4E13A 1LDEA 3HFGA 5JDIA 4BNUA 2G1UA 3GNTA 3JQAD 3V1UA 1VSUA 1HZZA 2P9EA 4LVCA 1Q1NA 1WW8A 1XU9A 1N5DA 4TMFA 1GYRA 3GEGA 3L0DA 3QY9A 1PX0A 1QMGA 1YB4A 4RF5A 4BL5A 1R4NA 2VRCA 4NPCA 3W6UA 4BMVA 4LMRA 4AL4A 3PQDA 5HWSA 1YH3A 2YQ5A 3GT0A 4DGSA 3DC2A 3A06A 3Q9NA 3GGPA 2H63A 3ZV6A 1UXIA 3C8MA 3H7AA 1UP4A 3D1LA 4WKGA 1P1IA 2UVDA 3D4PA 4GQAA 2HRZA 2Y93A 3RVDA 2IODA 2CVQA 4CQLA 3LC2O 1GAEO 2GN9A 3WGIA 2P5YA 4GMFA 4WEOA 2B0JA 3TFQA 3UUWA 3AFMA 2C5AA 1JTVA 4RF4A 3WYEA 1WP4A 1DC4A 3L9WA 3UF0A 1GQ2A 3CMCO 3LF2A 2P9CA 4IJVA 3ZH2A 1ISIA 3WGZA 4YT8A 2B69A 5JDIC 1H93A 4XIYA 1UH5A 3TJRA 1H9BA 4BKUA 3WR5A 4OSPA 1SC6A 3GOHA 4ALIA 4Y9DA 5FEUA 3KSZO 3RD5A 2YHUA 2O3TA 1GZ4A 2LDBA 1OC2A 3LT4A 1U4OA 3ICCA 3GEDA 2R00C 5JE8A 5GZ1A 2Z1MA 2EP5A 4XYEA 2DQ4A 3B6ZA 2Z5LA 1TVEA 1UP6A 2HCTA 1VI2A 3FNFA 3I1JA 4BIIA 3TSCA 1E3JA 4RJTA 1WVGA 2CFCA 3K92A 1UDBA 4CR7A 4MKZA 1ZFNA 5JYDA 4MIYA 1IHYA 2BFOA 4TRJA 2JFFA 1C0PA 4I08A 2ZYGA 4GKVA 3ON5A 5F1PA 2GYYA 3W8FA 3C24A 4R1NA 2J6IA 5FYDA 5JYEA 1ONOA 3SEFA 2BFAA 3ZNPA 5CG1A 4W99A 3SC6A 3VAZA 3KRTA 3PLRA 4NBUA 4BO2A 1HE4A 1QYCA 1EQ2A 2OBYA 1I2ZA 4LCEA 4PZCA 3WYBA 1WMBA 4WK6A 5KJCA 1R4MA 5BSEA 2WYUA 1A7KA 1Y6JA 1UXHA 2PFGA 5JCJD 1OC4A 4L75A 2HQ1A 3RKUA 5FF9A 1YONA 2OGUA 1XA0A 3ZW8A 3JD1A 2PTGA 5LC1A 4YEDA 1RKXA 5G2OA 3ETGA 1ZNQO 1UXGA 2D59A 2PZKA 2XF8A 1F0YA 3AUUA 1BDMA 3HZZA 2Q1WA 3KEQA 4II2A 4P8RA 3VH1A 5K9ZA 4B7XA 4IIVA 3WFJA 2AW5A 5K0ZA 4DWVA 3TZ6A 1N1GA 5IN4A 1N2SA 2DM6A 2JFGA 3DQPA 5I7FA 4BO8A 5ITWA 1L7EA 2BI7A 3CZMA 1R4NB 3PHHA 3T7EA 5F1KA 3GNQA 1AXEA 5EQDA 3FNEA 4E3ZA 5GZ6A 2FZEA 2ZB8A 4E2ZA 3AM3A 4HKTA 5I8ZA 1S7CA 1TT5A 3WMXA 5AXAA 3WX0A 2UAGA 1XCBA 1YL5A 2D2IA 2NU6A 1D4FA 1PU2A 4YQYA 3OA2A 4J3FA 5DF1A 3RC7A 3VTZA 4JJIA 4CQLB 5BSFA 2QW8A 1SB8A 4FJ2A 1SZJG 5H83A 1PIWA 3AI3A 1T2CA 2EKLA 3QRWA 2ZJ1A 1DC3A 1HF3A 4JBHA 2I3AA 2WM3A 1XIVA 1Y8RA 3K6JA 2EXXA 3PGXA 4JCOA 1NAHA 1GCOA 2UV8A 4J7XA 3FBTA 3VPSA 4DC1A 3ZU4A 1X1EA 4FS3A 4BO1A 4DYVA 4WPGA 4OJNA 1SOWA 2VOEA 4FC6A 3WLFA 4BNKA 3SLKA 1O9BA 3OA0A 1V3UA 3LVFO 2JFHA 5IZCA 1O95A 4EW6A 3ZWNA 1HEUA 1LDBA 4AVYA 4W6ZA 2FN7A 3HUDA 4FN4A 4CMEC 4CLEA 1H9AA 2G76A 1ZK2A 3FSRA 4OQYA 5CDYA 3QVWA 4U6QA 1W6UA 4Z3KA 4KQXA 3LT0A 1E6EA 1HLPA 3ONDA 4CV3A 1PSDA 3RUEA 1K6IA 3V2HA 3B1JA 2JD0A 1ZMTA 3TZQA 3HHPA 1Q7CA 4LRTB 2BI8A 3MJSA 2Q3EA 2O2SA 2OMEA 1EBFA 4NDNE 4J7CA 3RBZA 1IPFA 1XG5A 4RZHA 5G0SA 4CUJA 3RUCA 3ZV4A 4GGOA 1BW9A 2Q46A 4D0RA 1V3TA 4ZQBA 1MG0A 2HSDA 3GMDA 1PZFA 3PWSA 3OJLA 4CLXA 2ZB4A 5IZCC 3UOGA 3TZKA 1HT0A 8LDHA 2ZTLA 1CYDA 4CM5A 2H6EA 3DAPA 3H2ZA 1A71A 3RKRA 2YV2A 3PXXA 1B2LA 4F6CA 5COAA 4GVLA 1PR9A 3ROMA 2VHVA 4FBGA 3DTYA 3INGA 4NQZA 2B37A 2X8LA 2DLDA 3O9ZA 3WLEA 3NRCA 1RJWA 2Y0DA 1ZUD1 3QQPA 3EVTA 2D5CA 2WSBA 2ZIZA 3S1LA 2CDCA 2E48A 1ZSVA 4GX1A 4HUJA 3GK3A 3DMYA 5MGBA 3FD8A 4OXNA 1DIHA 4BGEA 1TLTA 1YBVA 1R0LA 4P4GA 1QLHA 3WTCA 4BGUA 5A02A 5CP8A 3FHLA 3U09A 2CSUA 4WCFA 5A5EA 1K2WA 1V9LA 1U1IA 4NU5A 5EL0A 1A72A 4FB5A 1D8AA 5EPOA 4AJ2A 4DIBA 1PL8A 4BVAA 4BNJA 1JDJA 1M6HA 2DVMA 5A5FA 3ULKA 3QWIA 2X9NA 1YL7A 3KEOA 1O0SA 3G1TA 6LDHA 4Y98A 4PVDA 1TT5B 2VNSA 4MVJG 3R1IA 1F06A 1T4BA 1GV1A 2FPGA 3NT4A 3QSGA 2EKQA 4IDGA 4C7KA 1XR3A 1DLIA 4RVDA 4OO3A 3PLNA 1C0KA 2H5LA 3IS3A 2PR2A 4BS9A 1YWGO 2YUTA 3D7LA 4NU6A 4UVEA 3RIHA 3C85A 1LNQA 1Y8RB 3DEYX 3ZHYA 4BV9A 4XJTA 4LISA 1ISFA 1VPDA 2Q1SA 3GAFA 1VL6A 4J2OA 2P4HX 4AFNA 1P1RA 5DOZA 2NTJA 4I5GA 5A06A 3Q0EA 4PLFA 4N18A 3JQ8A 4URFA 4YT4A 3WJ7A 3GAZA 5A9RA 3MZ0A 2FZWA 4DYDA 3GHHA 4I5EA 5BNIA 3QIVA 3D4OA 3ZU3A 3MJ4A 1UR5A 1V3VA 2E4AA 4GI2A 1Y8QA 4R01A 3VZSA 1H6CA 4OMUA 3E6AA 4MVJP 3GVPA 2VWQA 3S2FA 3DFUA 4B8WA 4XJSA 4CV2A 4OH1A 2X58A 4QO7A 4RVFA 5KVQA 4CL3A 3QWAA 4FFMA 4ZQFA 5CG2A 2X1HA 4BKOA 1LQUA 3JYOA 1BW9B 2ILTA 2IXAA 4I5FA 4RVUA 4JP3A 5G0UA 3DZBA 2VHYA 4R68A 2JD2A 3N74A 3DWFA 1YQGA 5ENDA 3GVCA 4TKLA 1O94A 3QVTA 2J5RA 1NQAO 2G5CA 4D3SA 2PD4A 5KKAA 4R69A 2NU7A 2Q2WA 4WOJA 1XEAA 2RAFA 5LCXA 1MC5A 1NP3A 1B8VA 3K31A 1IL0A 2GZ2A 1QRRA 3RC2A 3TL3A 2RHCA 5EIOA 4QT0A 3OP4A 4IBOA 1FDWA 4NBRA 4DMLA 1PL7A 1LLUA 1PQUA 2C54A 3OJ0A 4YYZA 5L7WA 4CMIA 2D8AA 4BGIA 1XWFA 4DA9A 2C7GA 2IDZA 5DCUA 1NHWA 2J3KA 4EUEA 3S8MA 1PS8A 4FPXA 3JV7A 4BO5A 2FR8A 4E30A 1C0IA 1NFFA 3PTZA 3LSYA 3U4DA 3JD3A 3U49A 3PFFA 2EF1A 3DR3A 4E21A 5I8WA 1MFPA 4WCFB 3ORFA 2GRAA 3WQRA 5DCYA 3AI2A 4H15A 3ZU5A 3EK2A 1EFKA 4KTVE 2X23A 4UUMA 1ENZA 5COQA 3JQ7B 2FWMX 1DC6A 5L51A 3AY3A 4ALLA 4EGFA 3D3EA 3MCVA 1A7AA 4A27A 3HADA 3JQGA 2RCYA 1AGNA 1JLLA 1I3LA 2AEJA 2R2GA 4ITUA 3ZHBA 2BFPA 3QE3A 4OKIA 4CM4A 5TT1A 4CMHA 4L74A 1FDSA 4BB5A 1PQPA 5FI3A 2AHRA 1E1MA 4RPJA 2VYNA 4XA8A 4E0BA 2GDZA 3CEAA 1R37A 2OP0A 5A9TA 4KQWA 2YHIB 3N58A 2E49A 3EZLA 1O6ZA 5FFFA 4GAEA 1HYHA 2BRUA 4RVHA 3JQAA 3VDQA 3C1AA 5KVSA 3QJ5A 4JJFA 3PEFA 1B16A 4WNIA 2HK7A 4BO7A 2P91A 5LDHA 3PHGA 1BXGA 1V6AA 3GF4A 3VDRA 4XRGA 4CODB 5KVVA 1CDOA 4RLHA 1DHRA 5JMPA 1KETA 3NAQA 4YDRA 4AJ4A 1H94A 4XGKA 4IM7A 2Q49A 3GDFA 1LSSA 2HMTA 4MKRA 4OHUA 4YCAA 3V1TC 2TMGA 3HG7A 4RQUA 1E1NA 5DBFA 3KSDO 4M55A 1QV7A 5JS6A 3WTBA 3W4JA 1CIVA 1UP7A 3HDQA 3INRA 3BMNB 3K9QO 5C7IO 1AN9A 5JY6A 4PLVA 1ADGA 1BVUA 4KDEA 5I7SA 1W8DA 1L1FA 1KBZA 2C0CA 1NQTA 2AEMA 1C3VA 2P2SA 3UVEA 1D1SA 5C5IA 4P4NA 3MJEA 1JWBB 1F17A 5HBRA 5ICMA 1DBVO 1J0XO 1PZGA 1JWAB 3IP3A 4WEQA 3RBVA 2EERA 4WOKA 3H2SA 4Q9NA 1UDCA 3STHA 3INTA 4PRLA 3VPXA 4A0SA 3QWFA 4RVSA 3ST7A 1DRUA 3RWBA 3JQFA 4MJLA 3RC9A 1YOVA 2O4CA 3VZPA 3VKVA 2O4UX 2Z1NA 4WLFA 3AM4A 1ADFA 1J4AA 4J90A 1E6UA 3PYMA 3CSDA 1N8KA 2Z95A 2A92A 4J4BA 1WZEA 4M89A 2VZ9A 3NT2A 1HL3A 4L4XA 5CEJA 2X86A 2IZ1A 4BQPA 3FNGA 4FD3A 3UW3A 3GR6A 3NV9A 3NGXA 4GVXA 4CMIB 3IQDB 3IC5A 2QYSA 3GZNA 2CVOA 4E5NA 2HUNA 3JQ6A 1NQ5A 2B4QA 3KLMX 2I5PO 2O50A 1EEHA 1H6DA 3AUTA 4J43A 1KVRA 4TRNA 4IDEA 2AE2A 3DDNA 4MVJF 4RCVA 4L73A 2X0NA 4KOAA 4XGNA 1R12A 4PLGA 3GPIA 4CMJA 2GZ3A 3K8ZA 1N9GA 1NR7A 4B4VA 1U28A 4XZ3A 3H5NA 1ZH8A 4RO0A 2GO1A 4ALMA 1VE9A 5B12A 1U7TA 3IJPA 1E5LA 3JQFC 3H9JA 3JQGB 4MP3A 2E6UX 3V2GA 3LQFA 4CM4B 3KLPX 5JCJA 3ANMA 1HDXA 1A5ZA 3I6IA 1GY8A 1JVBA 5U1PA 1QV6A 3IP1A 4M54A 3ZV5A 5TJ9A 5DCWA 3RC1A 1N92A 4Z9FA 3HN2A 2OHXA 3E8XA 4NK4A 4HX5A 1LSJA 1ZSNA 3HFSA 2WE8A 2B5VA 1Z6ZA 3IUSA 1ZMOA 1T26A 1G6KA 3QHAA 1UZMA 4EJ0A 3H9GA 1RYDA 3IKVA 4XYGA 4GX0A 1BXGB 1TEHA 5L9AA 2X0JA 3FTNA 5A1TA 4HNGA 4NJMA 4A2CA 4E5MA 2BHLA 2R6JA 4E12A 4F3YA 3ANNA 3RQSA 4PZDA 1SEPA 2NTVA 1I36A 2HMWA 2NVUB 4E5YA 4HWKA 1JAXA 1HXHA 1VJ1A 2H9IA 4RVGA 2B35A 4MIOA 3VKUA 1Q2XA 1EVJA 2BGLA 3L07A 5DBIA 1LC3A 2A94A 4YAIA 2WWRA 5K6AC 4E6PA 4Q3CA 3MJCA 1RYEA 1J6UA 4ZGWA 2YDXA 5ENVA 3WQQA 1PJ3A 1PWZA 4UVGA 3ZNQA 3M2PA 4MP6A 2D4AA 4XR4A 4YJDA 2C59A 4GX2A 2O3UA 4WGGA 2IYOA 4NIMA 2NQTA 1GL3A 1K6JA 3EYWA 2O48X 5CHEA 3GPDG 3KUXA 1NPDA 3GHYA 4ZU3A 3TF5A 4XWYA 4DVJA 3ITKA 2TMDA 1JQBA 1ZIDA 3I9NA 4AJOA 3E9MA 3WNQA 5KOIA 1E3WA 4EEXA 3AI1A 5T64A 5I9LA 2Y1GA 4J49A 5L40A 1KY4A 1LLCA 3M2TA 3JTMA 3JQCA 5F21A 1NFRA 3DZFA 1IPEA 2D5AA 5TQVA 3F5SA 2X0IA 2AQHA 2BFMA 3H3FA 1FMCA 3KHUA 3OEYA 4INAA 1W73A 4PVCA 2E37A 3GZNB 4YVFA 5HM8A 2IXBA 3MOGA 3KV3O 1TA4A 1Q7BA 4TRRA 4BNWA 4ZQHA 5HA5A 3JYLA 5EN4A 1C1DB 4W4TA 2YQ4A 3GRPA 3EC7A 5EQFA 4G5HA 4L0QA 1MUUA 4DREA 2Y67A 1SEVA 4C7JA 5TLSA 3ZDFA 4MIEA 2R00A 1C1XA 1DFGA 4XIJA 1Z74A 4C4OA 3EVNA 1CQIA 4WLEA 3AUSA 2Q99A 1MV8A 4EJ6A 1P33A 4Z9XA 4FFNA 1I8TA 1JN0A 2J8ZA 2O23A 4BHTA 1M2WA 1SCUA 2Q50A 5JC8A 3QW2A 3G49A 3C7CB 2W90A 1M67A 1P45A 1NBOA 2FR0A 5B4UA 1DXYA 1HE2A 4MDHA 3WDSA 3Q2IA 1UAGA 2CUKA 1PJSA 1ZK4A 5KKCA 4R51A 4XKJA 3H6KA 4J4HA 2XAAA 4W7IA 4QUKA 2GNAA 2GUGA 5DP1A 5JAIA 5CEEA 5JSFA 1N1EA 3O8QA 1ZK3A 4J1NA 4AJEA 1B7GO 5JC1A 1SO8A 2GCGA 4MOWA 3DBHA 5T6BA 5JAMA 3LC1O 4E31A 5C7OO 4BO9A 4GSKA 1YXMA 3NUGA 1RM3A 5JO0A 1KIFA 1U3TA 3WNVA 5IN5A 3RJ5A 5AOVA 2WTBA 1W4ZA 1EVIA 3OFSA 1AE1A 1RM0A 1SBYA 3A1NA 2Q1TA 3HWRA 5JAZA 4II3A 4PG5A 2FHSA 3ROPA 4FQ8A 1XU7A 3DZKA 4H16A 3E9QA 3OJFA 3PHIA 5G0VA 4FFRA 1XKQA 1X7DA 1E3LA 4N5NA 1UJMA 2UDPA 3RUHA 4J0FA 1HDZA 3SJ7A 3PQEA 1UUFA 1Y5RA 3SLGA 4XX0A 3C1OA 4WECA 4GSLA 2GSDA 5HS4A 5L7TA 5T5QA 3G1UA 1EUCA 2GLXA 4R41A 3RASA 3VH3A 3WWZA 1WMAA 1E3WB 3SXPA 4MVJM 4PG8A 2AQIA 4RORA 1NFQA 3I6QA 3W4KA 3PGJA 4GX5A 4FIZA 4UVDA 1GQYA 2XXJA 4KMSA 5EMHA 2D0IA 2X0RA 2HDHA 3KM0A 1P74A 3GVHA 3O4RA 4EBFA 3RU7A 4CM8A 3JD2A 4YAJA 3EGOA 5JPIA 1MLDA 2JCYA 1UDAA 4D3FA 5JBIA 2BGKA 4O63O 3NYWA 3D64A 3HJAA 1UXKA 1I2CA 1FXSA 1YVEI 1WZIA 1PJBA 4OAQA 3WGTA 3T4XA 1GCUA 1PJ4A 5BSHA 1B3RA 3FPCA 5I9NA 1H6AA 2IRWA 4FFOA 4RL6A 4WLUA 3P2YA 4CMEA 5L7YA 4OSOA 4TKMA 4Z6KA 3U62A 2DPHA 3I9KA 5L4LA 3VPGA 5C37A 1C1XB 1E77A 4BKPA 5L4SA 2PNFA 2CDAA 4MVJI 4E33A 2Y66A 4HFJA 1GYPA 3I4CA 4L4SA 5FI5A 1VRWA 2ZK7A 3RUIA 4ONEA 1W0CA 3B1KA 4K9DA 3H5RA 4NMHA 1EUZA 1A9ZA 2C2XA 1M6WA 1KEPA 3TDKA 4W9NA 1X7GA 3L9XA 3DZJA 4L8VA 3IJRA 4ZRNA 1VJTA 5TS3A 3AU8A 4TSKA 2I6TA 1D7OA 4RGBA 3KYDA 3OETA 2WD7A 4GGPA 3R0IA 4KZPA 5EERA 5LDGA 3O8QB 1O5IA 2FR1A 4ND3A 3GUYA 2P5UA 4YJHA 5IF3A 1WLYA 4BO6A 1BGVA 3OHSX 3ZWPA 2JJYA 2YY7A 4YWJA 9LDBA 2Y05A 4XQCA 4CR6A 3ETEA 1CF2O 4JBIA 3W4IA 2EGGA 3RFVA 2PZMA 3HDJA 5IDXA 2NV6A 1ENOA 3CH6A 3S2IA 1H5QA 4CMKA 8ADHA 1H6BA 1ULSA 3GN2A 2I65A 1EQUA 1EUDA 1PEDA 1N7GA 1UZNA 4W9NC 1JVSA 4B4OA 1CWUA 3DXFA 3TNLA 4FGWA 3ZGYA 1IOLA 4J91A 5KVCA 1P3DA 2QZZA 3HN7A 1OZAA 1IHXA 1NYTA 3V8BA 1NPYA 2PD6A 3ZCXA 4ZA2A 1R4MB 3EAGA 3PRJA 3VZQA 4PN3A 3ZWCA 1ENYA 4A26A 2X4GA 3ZNOA 2NVWA 1HE3A 1Z82A 1ZJZA 2PGDA 3ASVA 4QTZA 4ZHSA 1N7HA 1ML3A 1YL6A 4LCJA 4BOYA 1JKJA 1D3AA 3RI3A 3H5AA 4J7UA 1VLLA 4JK3A 3PZBA 1E92A 2OORA 2OFPA 1ISGA 4CM8B 3MWEB 4RF2A 3RROA 5KJEA 3WICA 4IJWA 1MG5A 1I30A 3UCEA 3A28A 4DC0A 1V35A 3ROKA 4RF3A 5A4DA 4AJIA 3UH1A 1Y9AA 2J5QA 1I2BA 1QKIA 2P68A 2DTDA 4F45A 4OIMA 2WYWA 4A73A 4NFHA 3WGOA 1F8FA 4PGFA 1T2DA 4PG6A 2EIHA 4QFDA 4PLZA 1NWHA 4CLDA 5ITVA 1GEEA 1PGJA 3E03A 4E32A 2ZYDA 1X14A 5IDWA 2A9FA 1PGNA 3ENNA 3BMOA 4NR0A 2UUOA 1X15A 5HS6A 2RHRA 3G79A 1PJLA 4E4YA 1BWSA 2CD9A 5L45A 1ADCA 4BMSA 3ZWOA 4AG3A 5IXYA 2X5JO 3FI9A 2C82A 3AU9A 1J5PA 4D44A 1PGOA 1QLJA 1PZHA 3DB2A 4DLAA 3FCOA 3ZN2A 5IFLA 3GDGA 3WSVA 1JKIA 3ZU2A 3I3OA 3JYPA 1XGKA 3Q3CA 1DAPA 3CTMA 3KYDB 3NTOA 4PLCA 4U0KA 3OICA 4MVJD 4BNYA 2WD7B 1V8BA 2PA3A 3GFBA 3GY0A 4QEDA 3ZWBA 4R9RA 2DT5A 3AW9A 4Y8VA 4WJZA 4ZVVA 1LU9A 3FBGA 3Q1LA 1O8CA 2JL1A 4YJHB 1T2FA 1H0KA 3OMLA 2Q4BA 1IB6A 2C2YA 4J1SA 5TRTA 3CE6A 7ADHA 4JQCA 1IZ9A 3H8VA 5I9MA 2O3JA 3FR7A 5DP2A 4BNZA 3WIEA 1DLJA 5L4NA 3E18A 1P1KA 3DL2A 3EY4A 5U4QA 5IJZA 4FDAA 1IYZA 3KO8A 4GWGA 4GKBA 3KBOA 1WNTA 3DBVO 4IDFA 4U8GA 1I33A 4O59O 2BH9A 4IMRA 5DZSA 4JX8A 4ZRMA 5A04A 2EV9A 3IUPA 2JCVA 3H9EO 3B20A 2A35A 2DKNA 2HJSA 3MOIA 4U5QA 2OP1A 4N5LA 1BSVA 3GG2A 2PZJA 1ZJYA 2SCUA 3GA0A 1Y81A 1OOEA 2NM0A 1YO6A 1P0FA 1GPDG 1YDWA 4A10A 1NPTO 4CLRA 1HKUA 2WYVA 3BMCA 4IJKA 1BVRA 1MXHA 1RWBA 1NX6A 1JA9A 3LT2A 4R16A 2PKRA 5KJFA 2UYYA 5H82A 4ZICA 4BKQA 4HNHA 4B3JA 3PFWO 3W8EA 1B3BA 1X1TA 4B7CA 3R6DA 1HDOA 1AXGA 2X22A 2X9GA 4FSHA 4TRMA 5TF4A 4D79A 4Q3DA 4RPKA 4BNNA 4F46A 3VPHA 4GLOA 3SX2A 3UHAA 1E7MA 4B4UA 5I7EA 3C1TA 1XELA 1QR6A 4QO8A 2NUAA 3V5NA 4AJPA 5G4KA 1LX6A 1GUZA 1NTOA 3QVXA 4RPGA 2W2KA 1NHGA 1VC2A 3LDHA 1M75A 4D43A 2V6GA 3UKOA 4E5KA 2PK3A 1GYQA 3BMOB 4IPTA 1E6WA 2DPGA 3PPIA 2GN8A 5ER9A 5BSGA 1NWCA 1ISMA 2W4QA 4YJFA 2FMUA 5JMWA 5T57A 2Y0EA 1GUYA 4OQZA 2ZYAA 4O5OA 3C7DB 5F3RA 3S2EA 4OYRA 5A3JA 3KVOA 1Z7BA 2JHGA 3ROQA 1NQOA 3DMTC 4U7WA 1XQ1A 2VHXA 4WLVA 4IZHA 2WEKA 1DIRA 3RFTA 1LTHR 3JQ8B 1QYVA 1F14A 3VVBA 1GZ3A 3WSWA 4CLOA 3F47A 4K26A 2Y1OA 3ZWYA 1KC1A 1ONPA 4DUPA 2QG4A 3AY6A 3OSUA 3VH2A 4UEOA 2EHDA 2FPIA 2ZATA 1Y8QB 1I5RA 4S3MA 1ENPA 3L77A 4D46A 1KOLA 3BZUA 1B26A 2Y68A 2ZTUA 4R4JA 2VUTA 1EE9A 2OXIA 3ZWVA 2D1YA 4IJUA 3GGOA 1NXQA 3OEWA 3OF2A 1NR1A 5IAAA 1X0VA 2W2LD 4R9SA 1ISJA 3DAFA 3KXDA 3RUDA 4D3DA 1O89A 4O1MA 1T4DA 1YBMA 3BTOA 1TB4A 3BXXA 1MGOA 4D7AA 3DAGA 5ILOA 3P19A 1RPNA 2DTEA 4R1UA 4FC7A 1CRWG 2P4QA 1LDYA 3HDYA 3PHJA 4ZJUA 3TN7A 3MJTA 4YQZA 4KWIA 1PS0A 1CQJA 3NJ8A 3X2FA 1BRMA 4GMGA 4QQRA 3W8DA 4EUHA 1XLTA 2O3QA 4BNFA 3KSUA 3HE3A 2J3JA 4IXTA 2NSDA 2V6FA 4DQXA 1JKFA 3H9QA 3LLVA 3NTQA 4CR8A 5KWEA 3EZYA 4BGVA 2Q1UA 2XPCA 4YTEA 2VWGA 5DULA 1SMKA 2BKAA 3LYLA 3PHLA 3O26A 5GY7A 4CUKA 3NT5A 3LK7A 4MVJE 3ICPA 4W82A 3JYQA 3SC4A 4PG7A 4BO0A 4E2YA 4KP7A 2Y99A 2Y1FA 4XCVA 4TQGA 4X54A 1DFIA 5JCXA 3MEQA 4I9HA 5G4KB 3VH4A 1ADBA 1QYWA 5F5NA 4CM6A 4FGSA 1PZEA 2X6TA 2W2KB 4QSMA 3Q11A 3AOGA 2EKPA 2EJVA 4J1QA 2Q2VA 4H3VA 1EE2A 3CXRA 4BNLA 3V2UA 5JY1A 3CINA 5A03A 1X0XA 1DPGA 3GVXA 5K6AA 2CZCA 3OH8A 4YJFB 2JHFA 1KC3A 1Q0HA 5TSDA 1YDEA 2JD1A 1FF9A 3CKYA 4XRRA 3TPCA 4BUCA 1Y7TA 1T24A 3JQAB 4IQ0A 4M49A 4ZQEA 4N5MA 1J49A 1LLDA 4LW8A 4TZKA 3S55A 1KYQA 3OBBA 5CEFA 1DIBA 3U4CA 2HK9A 1U8FO 2PD3A 4FCCA 4KDFA 3DONA 3JQDA 1ULUA 3BTUA 2DUWA 3DFZA 3I4FA 2GPTA 3GGGA 3U9LA 1EMDA 3DBLA 4E2WA 1CEQA 4YBZA 1Y9EA 2QRJA 2LDXA 2F00A 5DT9A 4ZN6A 3KZVA 1E7SA 3M1AA 4XYLA 1LBEA 1MX3A 1KEVA 3K2BA 2BF7A 5A3VA 3M6IA 2NTNA 1R66A 2VHWA 3JCZA 3IKTA 3G17A 1EDZA 4LMPA 2HMSA 2V6MA 3RFXA 4CQMD 2PZLA 3HNPA 2OBNA 4NZ9A 2CVZA 3WOHA 4FJ1A 1E0DA 4AJHA 3KOUA 3DZGA 5B37A 4EDFA 5CDGA 4YA6A 4OOEA 2C07A 2C20A 2EEZA 4DPKA 1RM5A 2IEBA 1D1TA 5GMOA 4RLSA 5ER6A 3OIDA 4OXKA 1I3NA 1HSZA 2EWMA 4U0JA 3WBFA 1VL8A 3GVIA 3KETA 3IL2A 4CPDA 4IY1A 3PDJA 1YE3A 3ZHXA 4NK5A 1YOVB 1A9YA 1GTMA 2HKIA 4FFPA 1PJ2A 3JQBC 1EVZA 1DOHA 3TOXA 2BMAA 3F3SA 4UAGA 4LSWA 4B79A 1Q0LA 1HRDA 1BG6A 3LF1A 4WNCA 4G65A 4OM8A 2WDZA 5JDCC 1H2BA 4TVBA 1KERA 4BNHA 4P38A 1MXFA 4D45A 4ND2A 4MP8A 1DJNA 4YR9A 4KUEA 3QWBA 4W7HA 1VL0A 2VTDA 4Q39A 4P4LA 3V1YA 3FWZA 5CFZA 2V7PA 1R0SA 3CPSA 4BO3A 1NNUA 3H9UA 2AE1A 3I9LA 4Z0PA 3I9JA 1N9GB 2FY8A 1WDKA 3PVZA 1ZCJA 4R5HA 3CIFA 3HB4X 1PGPA 4J9UE 3RUFA 4U6SA 3PYLA 3RCBA 4TROA 1T2EA
chains in the Genus database with same CATH superfamily
1ZXLA 1RAAA 2ZR8A 4IMIB 4HVTA 4XM2A 5DBHX 5DHQA 5LQSA 4RIFA 2VOJA 1ODSA 3JQ9A 1G8GA 2PSJA 3S6JA 5LUAA 2X5OA 2YWRA 4UHFA 4ZVNA 3TZCA 3MUEA 3ONEA 4YYEA 3KPUA 1DDOA 3NXSA 2EJTA 2BY4A 2GF2A 3FWNA 4QUBA 3T9FA 3MFYA 1TXGA 3G8BA 2WT9A 1JEYB 4OB6A 1TVKB 3COSA 4IF4A 3CN7A 2FMXA 1OYOA 3IP6A 2BFDA 2YRFA 3MILA 1IN5A 2JFQA 4KR7A 5LKRA 3A37A 2C61A 1MCZA 3M4ZA 3EEFA 3DAOA 3H2JA 1DFHA 3JYNA 3PNQA 2V4ZA 3VAAA 4MR7A 1X92A 1WDMA 3MWDB 2AI2A 3SNHA 1BAPA 1JTEA 3MAGA 5AXBA 1HYEA 4UUPA 1Q1AA 2I2AA 2Q2QA 4O2BB 3C4JA 4D57A 1L7QA 3EGEA 4L9SA 3RDPA 4DR6B 4BFXA 4DR1B 1M1UA 3OKCA 4EI2A 3FZGA 3C87A 2HJGA 1C8KA 1SQ0A 2YC2C 1PWXA 4E5PA 1E9BA 3DBLB 3OPNA 4KXXA 3CB4A 2OK7A 2PKQO 4G01B 2YKGA 3AINA 1ETHA 1V0JA 3JAKB 3TTTA 1U8EA 3I83A 3AETB 1OI3A 5F5LA 2OBXA 5GTDA 3FF1A 2NO0A 3AL2A 1GT91 4TWIA 2ZKIA 3QVVA 4Y0AA 1APBA 3A9WA 3FVTA 3I23A 5T41A 1J24A 1U3WA 5F33A 1UZAA 1VB5A 1GNTA 1EZ4A 1TM2A 1DU4A 1HQDA 5CMLA 5HRCA 1QHIA 1W93A 4RZIA 3BWVA 5KYVA 2OK8A 5CFRA 5G41A 5GADl 1YDHA 3BYZA 2R8BA 1OX4A 1WSWA 2H07A 1Z18A 3LX8A 2XGGA 3MT7A 1GUAA 1K6XA 1SD2A 4JN6B 2FSVA 2YMQA 4RY0A 3WV4A 5KTPA 1I3MA 2AIRA 4R5MA 1IXSB 1J21A 2X7HA 3T1QA 1E2JA 1XZ8A 2PH5A 3SQNA 2FJUA 3D3WA 4HJRA 4I1VA 3R3JA 1OJ7A 3ZV3A 3VSDA 1EGVB 5DN6A 4DFDA 1P4SA 4UUNA 4G09A 3AX6A 4LDZA 4ZREA 1HSOA 3UJAA 4G07A 3ZQJA 4ZEVA 2A7QA 2HJWA 4UATA 1KI4A 5LOVA 2AN5A 3UMBA 3O8DA 4BFTA 5ITZA 1IBLB 4IIEA 1QH8A 5JT1A 3EPRA 1IB0A 1CY7A 1M3SA 5C80A 2EJBA 1GZ6A 3E5HA 3H04A 3K1AB 5AKGA 1JAHA 5IG2A 3U4QA 2VCYA 4BX0A 3EQ9A 1ND5A 2RGWA 3SIRA 3STVA 2XCQA 2H59A 3B3FA 3GAAA 4OAOA 4WE3A 1VE7A 2WF7A 3OX2A 1AVTA 4NV0A 4P6VF 1U2DA 4LV5B 3TL2A 4YP9A 3I3SR 4YMHA 1SRQA 3FVWA 5C9ZA 4LGCA 2PQ0A 1E9AA 2EG9A 3PR1A 4KSBA 5E6SB 2W6OA 4OL9A 3NB0A 2Q4TA 4C5CA 2NU9A 2RC6A 3ZHRA 5J1TB 1XVLA 3PQCA 3A6JA 1RRKA 3KYCA 4I1RA 4R8KA 3PIIA 3SI7A 1MB4A 4UTNA 3IIKA 1XRJA 5EMJA 2QJFA 2QSZA 3DOCA 3LLMA 4XEUA 1QBKC 1QIHA 1F4PA 2I54A 2ID9A 3QP9A 5TX7A 3D6TB 3UPDA 4N0PA 3OT5A 1WAMA 5B1YA 4BFUA 1QSGA 3DQQA 2NVOA 3KQLA 4LYEA 3B5JA 5A71A 4BVFA 2QP4A 3A1UA 2G25A 4JHLA 5TQ0B 3GC6A 2UYGA 2SHKA 3HSSA 1BWQA 4PLYA 4WK0B 3W2FA 1USVA 2HM7A 4I8XA 2DSTA 1AUXA 1KO4A 4I36A 4C20A 3QWHA 2ZAGA 5E38A 3TQHA 4O4LF 4R3NA 1EGAA 1YJBA 4QPDA 1VRVA 1CHDA 4N0QA 4Y2HA 3AEKA 3CPJB 2PWBA 4NYMQ 5F52A 4KE8A 1W5TA 1PJRA 2MR6A 3PQFA 2YJ5A 2B1JA 1BX0A 4OXYA 5IC5A 4RVCA 1Z4PX 4O02B 3Q9LA 4NNOA 4UULA 3IV7A 3SE0A 3OJOA 5AYVA 2VYFA 1U8XX 3UPTA 1XZJA 2Y1XA 3K0KA 3GG9A 2XXBA 5C4GB 2PXXA 3MLAA 3H97A 4RSMA 1RHUA 1Z6AA 2G17A 1R6DA 1SQ6A 4KPFC 3DT9A 3DB1A 4CM9D 5IC4A 4LWPA 2QBYB 1PG2A 1X86B 5JMTA 3L6DA 3HCBA 1XNHA 1G1AA 1H4TA 1UXJA 3BERA 1IFXA 3AEUB 3FCYA 2ICAA 2BR4A 2VDRB 3VZRA 4NPHA 2FEOA 3GRUA 4L08A 4TV9B 4QECA 1GR0A 3D8BA 4G2NA 4YBRA 1SC1A 2DPMA 1IIBA 1FVXA 4IZOA 3ZE2B 3V7NA 4DIOA 3TCKA 4BO4A 2O8CB 1NZFA 3NC4A 3WYCA 3GFPA 4DILA 1MVLA 3FIJA 3HXMA 1QTRA 3PICA 4C0XA 4US2R 1LJLA 5B1EA 4KVZA 4A0GA 3I2KA 3TG8A 1LD3A 4RULA 2JF0A 4LGYA 2QRLA 1ZKMA 2ZRIA 4LVOA 1VKNA 3CUVA 1GPKA 5DLPA 1PBTA 4TSRA 3JZAA 1PFGA 3KYJB 4GXRA 4FOOA 3ER8A 1K7FB 3CW2A 1QHSA 4MUBA 2Y1KA 1GHTA 4JBYA 5ESDA 1FXWA 4F06A 3DSRA 1NNEA 5LP6F 3L05A 4QVGA 5KNLA 2QD1A 3R3UA 1KEUA 3UMVA 3FCSB 1M2NA 2YY5A 2ZP1A 4MWOA 4CF3A 1FUUA 1TM7E 2Q0SA 1Z0JA 3QVUA 5AJVB 5F76A 1OZ0A 4PBRA 2P9GA 3KQWA 1FLNA 5D5QA 4YRBA 1C7IA 4BNDB 4KXYA 4A2WA 2CFOA 4PM4A 4EO9A 5HIAA 4B83A 4TWAA 5IVIA 1U2QA 2JIBA 1VM6A 3MNFA 3TNJA 1WXHA 5FPYA 2G0AA 3QX7A 3VR2D 4PZPA 6ADHA 5DISB 4IDBA 1T9CA 2WHPA 4PTZA 1MEOA 4D5GA 4OJTA 5EQTA 2VRCD 3N2GA 2NZYA 3KJEA 1E5VA 1SCBA 4YDHB 3C39A 3NCHA 3C41J 4P86A 3Q8MA 2V9CA 2P3SA 3GT4A 3K0BA 3OWHA 2GM5A 4X62B 3HJFA 1AKQA 1E20A 2WK1A 2ENUA 3OIGA 2YN0A 3TQCA 3VR5D 5AVZA 5IAOA 4IUYA 3LA6A 3SIXA 1P3Y1 4U4AA 3VI4B 4JT2A 5GM1A 4ER6A 4YRGA 2G8LA 2Z6QA 3FZNA 5HCNA 2HGSA 3OT1A 4QYXA 1TNDA 1CLUA 1EP2B 1PTJA 4GNKA 1EP9A 3D7NA 3TNFA 5JRJA 1OIWA 4JXXA 1CETA 1VLQA 1WM1A 2RHLA 4FTWA 4R31A 1I7PA 2HTEA 3EXAA 4A03A 2ZBGA 1GCAA 4JBGA 5DN9A 1MEEA 2JGAA 2PX2A 4PPNA 1ZLXA 2JGDB 2VT3A 4DIUA 1MR3F 3C0KA 5FBRB 1I10A 4AY6A 1AV6A 2VJQA 4DBZA 1P81A 1ZW6A 1JSXA 2X8AA 4MDEA 3I61A 3LW8A 5EP3A 1NMSA 1JDVA 1W4LA 4DKXA 2L2QA 1OA1A 1YBFA 4I9NA 5CX1A 5TEWA 3TQRA 1LEHA 3TO5A 1PFYA 4PWZA 2QX9A 1XA3A 1TL7C 2F9FA 3BAZA 2X8BA 4NL4H 3DMGA 4TT8A 4LY3A 3BL5A 4FFWA 4WN9B 4HSGA 2B9VA 3QI7A 3PJEA 2WJIA 3U6KA 1QIEA 5BR8B 4HT3B 3BJMA 3HZRA 4PZ9A 2CNWD 1R8YA 3HI6A 1UKEA 3NBUA 2JJMA 4J9VA 3RRXA 1P7CA 1X8LA 5H68A 1NM5A 2GCOA 5K3SA 5KTYA 1SXQA 1ARZA 1V8OA 2PO5A 3U4IA 4MCIA 4J94A 1SIOA 1DPFA 3ZDEA 4LDJA 4B6RA 2FZGA 1UEXC 4LSMA 3QLUC 2AZXA 2OFXA 1Q1QA 3LT1A 2CHUA 3JWIA 3MPOA 5CK5A 1W5AA 5FIUA 1GKYA 2W98A 4A8JB 4EHHA 1VL5A 4GECA 3KTFA 1MJFA 3DHYA 1X7XB 1T2AA 2YHIA 4XM1A 3ZE0B 3UQZA 4HNTA 1F4VA 2I3ZA 1CY8A 1FDTA 4UAVA 5JARA 2O2IA 3U6BA 1N3LA 2YV3A 3SHQA 3UV6A 1A77A 3NIBA 1C5KA 2QRKA 2ZT6A 2C04A 4OAPA 3F6YA 3P2OA 3BMXA 1DIOB 3LPMA 4F5EA 2MSEB 2H1CA 4MQFB 4WLNA 1Q19A 5GIOE 1KHTA 1VPVA 2PT6A 4HBGA 4DR7B 2JAOA 4WCFC 2NZJA 1V11B 4A5OA 3P2KA 5HVNA 1KGSA 3MJRA 2BEVB 3WQHA 3IDSA 2Y1DA 5BV8A 1IMOA 2GASA 4K0RA 3KB6A 3VOSA 2EW2A 2QMZA 2VHJA 4HP8A 3BAFA 4TM8A 4Y7DA 5LQAA 3LQRA 1UKBA 5FTNA 1EM8A 1J8DA 3FPKA 3PFBA 1KP2A 1E1LA 3KD2A 3IDFA 2EQBA 4HTFA 1LBSA 5THXA 2IITA 3GZ4A 3KJFA 2JKYA 1RACA 1WCXA 1NLZA 1A96A 4EUFA 4Q3EA 2R84A 1U8CB 1Q7GA 3WGKA 2X0FA 4BV8A 5JTUA 3NJ4A 2FWRA 4P54A 3BMNA 3K16A 4LXTA 1L5HA 2OECA 5DOVA 3OM9A 3A4NA 4JJGA 3DEAA 1QE3A 1BEUB 2AB0A 3KPVA 2WJ3A 1OXSC 3JVIA 3MIIA 1F2TA 1TJ3A 1WRBA 2QRUA 3O9MA 4QLOA 4LOHA 4XWTA 2E5LB 3IXMA 1F38A 3LC7O 1KAEA 3MM4A 1QVWA 3QNWA 4F5DA 1M8PA 3K9CA 4N5DA 4IEIA 4B0OA 2WW8A 3WHIA 1XQ6A 1G20E 1SUDA 2XCUA 1E3TA 2CF5A 1DBSA 4PZEA 4QX6A 2Z43A 3OM8A 3WRXA 4AICA 1SKQA 4CQMA 3WJ2A 2RG1A 4E08A 2HQRA 1WHSA 3OZRA 3LVRE 1R64A 2I9PA 1NI4B 3TQIA 1EFVA 4DV1B 4L4RA 4OYHA 4O6VA 4K28A 3L1KA 3EXG2 3JARB 4R7TA 3LO8A 4P5EA 3MMPA 5HG0A 1A27A 4W8OA 2X13A 5CB8A 3U1BA 1X7WB 3L7CA 1S2IA 1FQJA 2WF9A 5K2MA 2H5IA 1RWPA 4EELA 3H2KA 4QDTA 2P2CA 3GH3A 4RDHA 1OXBB 3MD0A 4FXOA 4GFDA 3T6KA 1GN9A 4DUZB 2QKYA 4V38A 4QFCA 1P1FA 1Z75A 1FDRA 2IBMA 1J1ZA 4R1TA 2ZG6A 2VK4A 3B48A 2RHBA 2D1RA 4Z9AA 5AWFC 1W6RA 2QTMA 6REQB 2OAP1 5KPJA 3UFXA 1G21E 4HYYA 4MYHA 2ACEA 1IDN1 1XDBA 2JDIA 1K92A 2CCGA 1K3TA 2G06A 2ZUSA 3IOBA 4P53A 3U5TA 1J8MF 5LZ5A 3TAUA 1XCOA 1WXDA 1V37A 1RBZA 3PLAE 5H80A 4MPPA 4YECA 4IDCA 3QYAA 1HQKA 4F9EA 3P32A 4P3NA 5AKIA 2GHTA 1F8GA 1PWEA 5EHZA 1UBHS 2Z5FA 4Q9HA 3SM3A 5TJHA 3WL5A 2RI6A 4AC9A 3GFSA 2D7CA 1T0PA 2ZUFA 2O8FB 1Q6YA 2R7NA 4G56A 3PK0A 2Y77A 4IS3A 2V58A 4KQHA 4LXGA 4M87A 4OMFG 5CCXA 1NF9A 1FYFA 2E2WA 3G2NA 4HQLA 5BQFA 5ALGA 1WVMA 2YZGA 2WWYA 2I6UA 5EHGA 4L2IA 1WO8A 3GJ3A 3P1JA 1QP8A 4RK7A 5IDYA 4EWLA 5EYPB 3TPZA 1P5ZB 3WHPA 2BGRA 1KI9A 5L3ZA 5IJ9B 1TK3A 3ZCTA 1DEAA 3EFBA 2D0DA 4AG5A 3PWTA 2C9BA 2NPOA 2QW0X 1E0KA 3BFJA 3KT8A 3TWOA 1IE3A 1K7XB 3AIKA 3QVLA 1BN7A 1X3LA 4PX5A 4V39A 4HATA 4DL9A 2DU8A 2I3GA 1ZQ1A 3PENA 1UCFA 4UJ3A 2O8FA 1FJHA 3S2YA 1LWOA 1OSNA 5FO1A 2QNIA 1TYCA 2BM8A 1Q3KA 2I99A 2QMEA 2VJMB 4WVLA 4Z7NB 1LS1A 5IDQA 2ZB7A 3C3XA 4LQDA 3PKIA 4ATNA 1TEZA 4QTTB 2A4KA 4OGFA 3EVCA 4V3CA 4HQKA 4B84A 3CMMA 1DO8A 4QELA 2WD8A 4TL9A 4YLYA 4UVHA 1WABA 4BWFB 2VQFB 1GRQA 3FCUB 2LKCA 2R1UA 3LSTA 5JLAA 3R76A 4LECA 5A6SB 3LZ6A 4F4JA 3OX4A 2ORIA 2NZUG 4Y3UA 2DY1A 3HKEB 2YV1A 5JV5A 4ZOLF 2IS2A 4BZQA 5CVJA 3MELA 2CSXA 4EYEA 4YJ2F 3QLJA 2WWFA 1RFGE 1UMBA 5AIAA 3TLMA 5EEGA 3JZMA 4DXHA 3B3QA 1JFSA 3EBOA 1PVDA 3A1DA 1UK7A 2Q3FA 1JA0A 1CUCA 2PV7A 3CTPA 4FLEA 5CT4A 3TTWA 1ZVVA 1T6ZA 1GU0A 2VNJA 4HAVA 2FP4B 1M2VA 3HYLA 1W29A 1YZGA 1JAYA 2QAGB 3BHMA 1WMSA 5B5SA 1NVGA 5D8DA 1OMOA 5JZMA 1K5HA 2WT4A 1U7WA 4C4TA 3IUQA 3OPQA 3GRYA 4OD0A 5DHTA 5KHAA 4KVGA 2IV7A 1OGJA 4KUGA 4OKNA 3WWYA 4B7AA 4EZBA 5ICSA 3P9KA 4TVOA 1JDBB 2QQEA 4JP1A 1GPJA 1VIDA 3M6VA 3RSHA 4AIIA 3GLFB 1EXNA 1XAHA 3FOCA 2BBTA 2XOXA 2DC1A 1UKYA 4GRAA 5JSHA 5CLGA 1WJGA 1QANA 4PICA 3EG9B 4GKKB 2YC4C 3OTGA 4JY7A 2EJWA 4XD2A 1WZUA 4XYBA 3WHLA 2H4XA 2MSCB 3LY5A 3TZHA 5LFAA 3IBFA 4BXOB 3I2YX 2GK4A 4FLFA 4H0FA 2BC9A 2F9LA 3NXKA 4JJEA 4MEAA 4RWZA 5EWJA 5K5EA 4HLDA 3GT3A 1CYEA 1FVOA 4B3HA 3GJ0A 4F2DA 4QVIA 2W43A 3RHZA 3Q6IA 4CIXA 1QLWA 4PAOA 2VAWA 5IYZA 1TRHA 1U2GA 1RQ7A 3WO0A 1M83A 3JXEA 4HQFA 3ZCVA 1VP9A 3GDOA 1T8TA 4OHZA 1HE5A 3RK0A 2XKKA 1XDZA 3WGLA 4MS4A 1RM4A 2NU8B 1GDDA 2HU2A 3OZVA 3EVBA 1JMKC 3C6YA 1K2VN 1STOA 4AUKA 1ZO8A 1AUPA 1BFDA 1Q0QA 3BHIA 4Z2YA 5A4MS 5BOSB 5CDUA 4B3TB 1CUEA 1YJ8A 2B0CA 4OQDA 1GARA 4EGSA 4EHAA 4FT4A 4BCDA 1JUDA 4XX1A 5D01A 1A8QA 5FORA 4Z7JA 5HJ5A 1VRCA 2VRNA 3T5GA 3U13A 4KR9A 4TL7A 4C07A 2ZOSA 2XT6A 3GQBA 1D0VA 4EH1A 4ALMA 1T9BA 2QVYX 4QDUA 5T8KA 1I6LA 2J7PD 1G8AA 3UJ6A 1NXXA 5C7YA 2FN8A 1O57A 3ETNA 4OHXA 3DUWA 3Q8KA 3NHAA 2B6HA 5JU6A 3JQBA 1M6VB 3HLKA 2FLKA 5F4BA 4JC4A 2OL4A 2GBPA 3LLCA 5DHAA 1ILWA 3FSJX 1N5LA 1QCYA 3I05A 3N7AA 4FMCB 4NBWA 3TB6A 3EDMA 3MCUA 5JDCA 1EA7A 4R2WA 3ZEAA 5LLTA 3GA7A 1OH6A 2ZPAA 5HM6A 2H8KA 2JLCA 4XYMA 3PJGA 1W48A 1O94D 1MO2A 2CB9A 2V6BA 3V80A 5EIXA 2WU3A 4ZT7A 3SE7A 3LKZA 3SBOA 1K9VF 1B8PA 2JEYA 4IIJA 4KXUA 4QUHA 5HKKD 1N2CA 2YZ7A 3TUJC 2AL7A 2ZQZA 4JVLA 4XDZA 1U9CA 4BTEA 3B60A 3C98A 1FZQA 1N25A 2HPZA 5C8YF 4FZ3A 1ODTC 4XLZA 4H7JA 3UC9A 4S1VA 5EUMA 5JW6A 4PNEA 3DE3X 3KNZA 3P2JA 3GUUA 4RIEA 5FP0A 1C9NA 1Z8NA 2VPYA 4LTMA 1D2MA 3KVNA 1B1AA 3GGCA 1OTXA 2QX4A 4M8SA 4CM9A 5ITSA 3M6LA 1KI6A 2FPPB 3BMQB 3EOZA 2E6KA 1IOZA 1JNXX 5BXQC 2D4HA 1JGTA 3HXKA 2Q5FA 4OHWA 4B5KA 3CQ9A 3TUZC 1FL9A 1YR3A 2ZJOA 4H31A 4BBPA 1YB1A 2FG5A 4F2GA 2Q4OA 3H0CA 3P5SA 2DAPA 3CRNA 3ODPA 3QE4A 4QGFA 5BSUA 3WG9A 1CC1S 2J85A 4JUBA 4QGGA 3HXQA 1J06A 1EVYA 3IRUA 1J8VA 2BKVA 4M3NA 3U7RA 4ZAFA 1UJNA 4M21A 1CUWA 2YXDA 3CSSA 5A2GA 4GMDA 1EX6A 5DX8A 4HV4A 3HB5X 5AK6A 1US8A 2LVBA 5AM5A 3SHVA 3TTSA 3V8MA 1VGVA 3U1TA 1P0CA 2XCLA 2B2NA 2ZTHA 4NCXA 2IWHA 1AQNA 4RTKA 3V46A 3UUFA 2GZ1A 1BDIA 4U2GA 5E3JA 5GV8A 2NUTB 3NR2A 4ZGGA 5AVYA 4JOSA 1T9GS 2ZGVA 5DDIP 1VBMA 2I66A 3WLSA 2XUZA 2HJRA 4DABA 2GYVA 2W2QA 2VAVA 4C7XA 2GVDC 5A9SB 5P8WA 1JHVA 1JEEA 3R5TA 2OTCA 3N7UA 1E7WA 4EVSA 2AMVA 3LGSA 4ITRC 1FW8A 2Z4TA 3LOQA 4NMMA 5FQNA 2OV8A 3T5TA 3DMRA 3W1VA 3S2GA 2IBSA 1SCQA 3VMMA 1UK6A 2PBFA 2OV6A 2DUNA 3JQAD 4MW6A 5E7QA 4QGAA 4IOJA 2P9EA 1Q7TA 1CQPA 3SIPA 1RMTA 3KIPA 4WDRA 4TMFA 3SAJA 3VR2A 5K05A 2FSFA 1ZHFA 2D0PB 3QY9A 3T3IA 1JPJA 1QMGA 4WZAB 3CUEF 1CR1A 2PUBA 1E60A 1U31A 2P9TA 2VRCA 4NPCA 4YCJA 1YCFA 2JAWA 2QR3A 2J0UB 2Y1WA 3GA5A 2F1HA 3CPEA 5MGNA 1COZA 4BZZA 4A91A 3VKHA 2UYOA 5LKAA 3Q1KA 3V4ZA 3UMYA 3Q9NA 3GGPA 2TRSB 3ZV6A 1UXIA 3OF5A 3VR5A 3PNYA 1W88A 3GLHB 3H7AA 3VAYA 3KAQA 1P1IA 3CZ5A 3F6EX 4LJAA 2HRZA 1KORA 2IODA 4CQLA 4FE3A 2FFJA 1CT9A 3HEAA 1GAEO 2AZDA 2R5WA 3QW4B 4PHCA 1T8PA 3FFWA 3SP1A 4GMFA 1EGQA 4PQYA 5CIQA 3UUWA 4RF4A 1JTVA 4U7FA 1HFWA 1DC4A 1F2VA 2AZTA 3UF0A 4KO1S 1GQ2A 4WKBA 3LF2A 2P9CA 1JU4A 1NUQA 5FQOA 1ISIA 3ZH2A 3V1MA 1UBCA 3VX3A 5DEIA 1RD4A 1THZA 1S2LA 4ACBA 2F1RA 1G7CA 1XRRA 4RSGA 3NHPA 1QB8A 3TJRA 4HOYA 3ADCA 2FZ4A 3LYAA 2F8LA 3CLTC 4OHMA 5FNZA 1OFTA 2P6UA 5D3MB 4YONB 2E7ZA 2G36A 4CNBA 2LPMA 1ABBA 3HM2A 1R9GA 2Q6KA 3X1YA 3VOBA 2Y9MB 1N2EA 1Y6QA 3AJ8A 4Y9DA 2P9BA 1RLIA 3KSZO 1C2YA 3BKWA 3RD5A 3OPMA 4BQEA 1TTTA 4MJ3A 2LDBA 3K4QA 3LP8A 3QHPA 2OCIA 2YMMA 2XAUA 1KFCB 2FVYA 3CF4A 1VTKA 3A32A 1CY4A 4XVHA 1H8HD 5EE0A 2CNWA 5ARCA 5GZ1A 2O7NA 5INTA 4FM9A 1YA6A 1YI8A 4EG7A 2HLDA 1Z4OA 1IWPB 2ZJ2A 1UPUA 3N53A 1OH7A 4U63A 4RJTA 1Z5OA 4YO8A 2CFCA 2Q27A 2J41A 4NU0A 1SCDA 3I01M 1EVEA 4OQFA 4EG8A 4YCCA 4H1WA 1SULA 3FTEA 1EHCA 1ZFNA 5DTMA 4BBJA 4QQKA 5JYDA 3CYFA 1AK1A 4RMJA 2JFFA 3IP9A 5M7EA 2CLCX 1C0PA 1E6LA 2OHOA 5ALOA 3KQVA 5HRAA 1KR2A 2HDNB 1PT9A 2JGRA 1OW3B 3N07A 3ON5A 3W8FA 4R1NA 5FKJA 3JASB 1K0FA 1ONOA 3L8YA 3DWEX 3SEFA 2BFAA 3IBGA 4QAJA 4RBNA 1HT2E 5CYPA 3SFVA 3OCCA 4C0WA 1N5OX 1TZCA 4FMBB 1O97D 4DJJA 3BILA 3QMMA 1E8DA 2M2IA 4KB5A 2OBYA 1FUKA 4LCEA 2FZLA 2P3LA 4YV7A 5LXTB 5DTQA 1DP4A 2G0NA 3CX6A 4HEA1 1W2HA 2L18A 3DXZA 4X94A 3RT7A 4DNPA 3BSFA 5E9WA 3ZIUA 2Z2ZA 1VMAA 1UXHA 3O4GA 1TC1A 5DM2A 4BUZA 4RS3A 2FSIA 4IOKA 4L75A 4US0R 1CUGA 2QZPA 2P1DA 3RKUA 4RPIA 5IARA 3L43A 1V7ZA 3IMGA 1E96A 2AG1A 1SBHA 1TLLA 3WGMA 2E4YA 5AKJA 4AP6A 2LCFA 4FYJA 1C9MA 1P91A 4M76B 3MMXA 2PX6A 1P9WA 1UXGA 4OSOA 3KEQA 3K0EA 1BDMA 1A2BA 1D8TA 2Q1WA 3UJ3X 5DVZA 5K9ZA 4P0QB 2PT9A 5KQSA 1EK1A 3LO5A 3R74A 2DT8A 4LXHA 4ETMA 2QU7A 2YBEA 1G6HA 3DV0A 3VHQA 4ZYWA 5K0ZA 4DWVA 1RQRA 1DBPA 2XZOA 4O4IF 1TPYA 3DQPA 3FLAA 4ZT2A 1L7EA 4BO8A 3CZMA 4RCZA 4PTLA 3KUCA 4H4EA 4OFZA 4KDRA 2IHVA 3TSYA 1AXEA 4QJ4A 1T36A 2P67A 5DHFA 2XYRA 3BRWD 3VPCA 4Q9LA 1TCBA 1W49A 1F2UB 4ZZ2A 3RREA 4Q1BA 4UM7A 4E2ZA 1AV7A 2A0KA 3CISA 1S7CA 1TT5A 5I8ZA 3WMXA 1S89A 1XCBA 1YL5A 2NU6A 2YMPA 5DF1A 4J3FA 5BSFA 1CNEA 2OY0A 1P0PA 2R8RA 4YALA 1SB8A 4FJ2A 3HJNA 3NFRA 1XZHA 2NXCA 3DFMA 1L7PA 1DC3A 1JA1A 1YS2X 4YMIA 2BAGA 1NW7A 4DLRA 3FUTA 1XIVA 4KIJA 4Y6QA 1PV4A 5IH7A 4DC1A 1GCOA 1UQUA 1SZPA 1TDJA 1B6RA 2BEWA 1F8YA 2WIFA 3BHNA 4R9UC 4WPGA 4BO1A 2EGUA 1KZ6A 2DYKA 1D2GA 3H1BA 4BNKA 1EUQA 4KXFB 1V3UA 5KTMA 1TGYA 1OTHA 4AY4A 2PDAA 1C4KA 3K7EA 3QU5A 3CT6A 3NHWA 4EW6A 1Y48E 3VVLA 3G2QA 1G3UA 1ONSA 2BDUA 1ZIYA 3NH9A 1XLVA 3TQQA 4CF5A 3MWLA 3BC1A 5DE3A 1L4GA 3PC4A 4ZEOA 4L8WB 4I66A 3CNHA 4KQXA 3LT0A 4JU9A 5DWVA 3ZK9A 3PNBA 4IWXA 4DSUA 3CR3C 3EGCA 1SD1A 2BEKA 1KXZA 5M29A 1C9EA 3ZY3A 1K6IA 3TZQA 1ZMTA 3NANA 5DGHA 2CLIB 1GPUA 2R7KA 1YVDA 3MJSA 5FL7D 2Q3EA 2O2SA 5KC9A 1XZFA 2WT8A 4I5IA 3KKLA 1IRXA 1IIRA 3RGGA 3UC5A 3FMPB 2OD2A 2FUG1 3E2PA 5EWLA 4GU5A 2ZWMA 4Q9AA 3PNVA 4MVWA 2WQZA 5AHRA 5G0SA 2Z6VA 1MPXA 4A6DA 3JTEA 4M88A 4D0RA 2QLNA 1FTYA 3RTCA 3UAYA 2C2OA 1OUMA 4ZQBA 2QM0A 2FDCA 5BO5A 2G67A 4JENA 4Q16A 2Q1XA 3W9YA 3RIMA 1D2NA 1NZJA 5IZCC 1K5DA 3TZKA 1UEIA 2HNAA 2C7BA 3AFIA 3D9QX 1P62B 5J4VA 2CJYA 4PHHA 2XRFA 1ZRSA 2HWWA 4Y2YA 2FVXA 2PRZA 3DAPA 1ONBA 3H2ZA 4YMWA 1JPUA 3MAJA 3KJIA 4HBZA 3PXXA 1X1RA 2OCXA 1PR9A 1DNPA 6NULA 5KC8A 5F98A 4ZJZA 4FBGA 3DTYA 3INGA 3NBAA 4NQZA 4G8BA 4KSCA 5JBQA 2DLDA 3ZDXB 4A6XA 2IXEA 2J32A 1RJWA 3CR8A 3WWDA 4PTYA 2JFZA 3HRIA 3Q3GE 4B85A 1IBMB 2W58A 3ZD8A 2IYRA 3ENZA 3I5UA 2VP5A 1CF9A 5FBWB 3S1LA 2EJCA 3ZGZA 2BCEA 2E48A 2JAXA 1D1QA 1ZSVA 4BFLA 1Z07A 3FD8A 4B5LA 2VT7A 4GS5A 1YBVA 2HIMA 3W5DA 4PWYA 1XEWX 1Q50A 3FHLA 4IQ4A 3U09A 2YN4A 3PC8C 1YR8A 2Q6IA 4WCFA 1GAWA 2Q5QA 3U3MA 4MMZB 1ZC3A 3QEAZ 1Y4ZA 3K5WA 5MFZA 3SEAA 1OA0A 1W85B 3F5DA 1X3SA 2D1QA 1W4AA 2BGIA 4J75A 4L8LA 2QZ4A 2XVAA 3VJLA 2O59A 2QSYA 5TS2A 1PL8A 1UJCA 2QLTA 4BNJA 1JDJA 3T0FA 4DMGA 5K8JB 1W76A 1U1DA 1GPNA 3LY9A 5AM0A 3ULKA 1V8ZA 3QU9A 3A6GA 3G1TA 2QLLA 4PVDA 2PL1A 5EEHA 4TMYA 1F06A 2FSGA 3LX4A 4CE6A 1E63A 4U2EA 2FPGA 2YRWA 2X14A 4C7KA 2CXHA 3C3CA 3IHLA 2JIDA 3P9NA 5G40A 2PIDA 1L4BA 2ESRA 1ZL2A 2PMKA 4BS9A 4GE3A 1INLA 2ERXA 2WJWA 1E9SA 1Y8RB 3RIHA 2WWXA 3ZHYA 4GR4A 3ZE9A 4WESB 4PFSA 4XJTA 3WB1A 5K4GA 1ISFA 1VPDA 1K8RA 3U7EB 2ZBDA 4F3TA 1OHHD 1VL6A 5KOHA 1IBSA 3RSCA 1U0FA 3M4JA 1FNNA 4C6HA 1S2GA 1YFZA 4IL5A 3V42A 3X1ZA 1E0AA 1AKEA 4XIIA 2IYQA 1Y8AA 2Q5JA 3QFSA 4MGIR 3AJEA 4URFA 4YT4A 5ALTA 3ADKA 2J9XB 3MZ0A 2VXYA 4DYDA 4W1PA 1EWYA 3GHHA 1RQLA 3RNOA 1QPGA 1BH2A 4QRIA 4XJXA 5LYYA 3ZU3A 3WGNA 2QR2A 5B6IA 2WUVA 3AKDA 3DVAB 3LTEA 3PTAA 3DYIA 2RHDA 4U7JA 4P82A 2OWEA 2HIGA 3A6ZA 3DZCA 1HURA 5CYFA 5AW8A 1MO5A 4D4KA 2I2CA 3AF3A 3E6AA 5DNYB 2HTFA 1ZU5A 4B6JA 1VCOA 2H7CA 1Z63A 2BV3A 1N2GA 4QRDA 2IYSA 2W7TA 3K94A 3ZK7A 4B8WA 3EODA 4DWOA 1N6LA 3DUFB 4C7OA 5K3CA 9MHTA 2NXWA 2C0QA 2GAIA 2J7PA 2X42A 4OHFA 3K32A 2PSHA 4QTUB 1JDPA 3DNPA 3KAPA 2X1HA 4LFCB 4BKOA 1LQUA 3HEBA 5JNTA 1N78A 2JZCA 2WKQA 3ORRA 4EPWA 4FYMA 4ZJPA 5F1YA 3UTCA 3GGSA 1N2CE 2CHVA 3DZBA 3HH8A 4G8DA 1ZAKA 4OUDA 1K6EA 4R68A 3GLIB 1M33A 1YQGA 3GVCA 4FHFA 5IM5A 1O94A 5I4KA 3IE2A 3G2PA 2FV8A 1UT5A 2J5RA 4L0MA 2RIPA 2XA2A 1NQAO 3BBLA 3GX1A 3TQOA 1UBOS 3CWCA 5HKKA 1XMIA 5KKAA 5JASA 3MWFA 3RC8A 1II9A 2O8EA 3H5OA 2RAFA 3DCYA 2JGEA 1MC5A 5FXMA 3R7WA 4RESA 5JZSA 2DWQA 2G6TA 3RRBA 3UT0A 3AR6A 2E4UA 3LWBA 4N6GA 2CBGA 1MB2A 1UWCA 3I1YA 4JLDA 1CEEA 2DEUA 3ICVA 4UKDA 4X1YA 4RDCA 2ZZKA 3GLKA 4LOJA 3U3KA 1LLUA 3EVFA 4WSOA 3ZDYB 1DKQA 1J2EA 1UINA 5REQB 2D8AA 4BGIA 3R7NA 1DE0A 3VBCA 4H2DA 2C7GA 1IPHA 1JLHA 1ZVJA 3MQ4A 4MB2A 2VZEA 3BFXA 4N7MA 3S8MA 5JY1A 1DEKA 2WIGA 3K6RA 4FUTA 4RTNA 1PG0A 3CX7A 3OTWA 2FR8A 1F1BA 4YC7A 1G9TA 4ZVMA 3L6CA 5LDDC 5JJBA 1RXEA 3U49A 1MB9A 1O9HA 2EF1A 1LTKA 4QG7A 1P7YA 1Y4DE 3DPUA 2QMYA 3PXBA 1ZM4A 4YPVA 3DPSA 3AI2A 5KU7A 3G8YA 1G38A 4YUAA 1AF4A 3OZCA 4KTVE 2X23A 1PWYE 2JZNA 3ETLA 1W87A 5AOAA 4DG5A 5B3LA 5JNWA 5WRFA 1I7NA 3HADA 3FDJA 2I7CA 4TKUA 1DBIA 2RCYA 1KZ1A 1PEYA 2FPLA 3ZHBA 2AEJA 1FUIA 3IAAA 2DUJA 5AHXA 3TW0A 1EG2A 1SUSA 2QE7D 4EOGA 4L74A 5HPYB 5AKEA 2IEIA 2QMHA 1T0BA 4RPJA 3DHVA 4ERNA 1UF9A 4XA8A 4CIYA 4DLVA 1GQFA 2PBLA 4FE7A 1QK4A 1R37A 3ND8A 3ROGA 3F0TA 3F96A 4B35A 2XGJA 3NBZC 2GJAA 2E49A 2NT4A 1O6ZA 5L6MB 1XK6A 4OFBA 2APJA 5TMPA 1HYHA 3KE8A 4KJXA 1OLXA 2F43B 2Z9BA 3JQAA 1EGHA 4XFKA 4MV6A 4MCJA 4TV8F 4ZT4A 1PEKE 4JYBA 1Y1KE 4X3OA 4WNIA 1CY6A 4WV3A 3U4GA 4ENWA 4BO7A 1PK8A 3E2IA 1DO0A 2P91A 3AF0A 3G8AA 1DWOA 1RE0A 3FYHA 3O91A 4JHXA 4EFDA 3VO8A 3SEZA 1V6AA 4IX9A 4DCPA 3DLPX 3A9SA 2JFXA 3E53A 4J0JA 4ZV4A 3NAQA 1NYLA 4NABA 4TX1A 3K9FC 4XGKA 5ALNA 5G0WA 2Q49A 1MOZA 2DBYA 4TUYB 2OD7A 3NHBA 3REOA 3W6UA 3X3HA 3V1TC 1UT8A 3BG5A 3W5SA 2JLWA 3SKYA 3BCUA 4UFNA 4AZ0B 2CXXA 1ZKDA 2AI1A 4UE2A 3WIBA 4EQ6B 5I4IA 1PJAA 2A1UB 2KMLA 1JLSA 6ABPA 2CT8A 3HDQA 4IVPA 5C7IO 3K9QO 1RTKA 1BU8A 2VJBA 1CJTC 1WE2A 3IVMA 1BVUA 4KDEA 1W5EA 5JY6A 4B48A 1V7QA 1T3HA 2ONYA 2AFIA 3SU8A 4KQJA 3E4CA 1QNFA 5EXXA 1OCEA 3OG9A 3OZAA 1SKMA 4TLMB 2AEMA 4WACA 3UVEA 1ZVQA 2VDKB 1SC4A 4G86A 4P4NA 5BN3A 5HBRA 3O1LA 4JYZA 4DCSA 3DF9A 1M6NA 4AN1A 2Q07A 3ANYB 1SXHA 3LCRA 5D5HA 4WOKA 4AY3A 3L8MA 4Q9NA 3RF6A 1Z8HA 3INTA 4O4LB 4PRLA 4A0SA 3EIQA 3QWFA 3HKBA 3VDXA 1T5BA 4LOIA 3V00A 5IWAB 1DRUA 1GR1A 1KRHA 5DRTA 3BVPA 1YOVA 2O4CA 2QRZA 4G8JA 4IW3B 4NZYA 3RVOA 3VKVA 4HLQB 3AM4A 4FCTA 1Z2PX 4FKBA 4J90A 1H8HA 3FYUC 2AUTA 3NHKA 1KU0A 3CSDA 2Z95A 4M1ZA 2A92A 1H2RS 3K05A 3A9CA 4XSVA 4M89A 4F85A 1PQ4A 3IUNA 2VZ9A 1HL3A 4MRVA 4BP8A 2IZ1A 1MBZA 1JALA 1WTAA 1A76A 1S96A 2JI4A 3NV9A 3NGXA 4I50A 3IQDB 1EZ1A 1QC5A 3IC5A 3NHLA 3RK4A 3I53A 4G5XA 3IQXA 3KPWA 2G1JA 1AS3A 3Q15C 2IP2A 3GJSA 3K6SA 4Y2PA 1XPRA 1GITA 2J46A 2I5PO 5BR4A 2O50A 3D59A 3VBEA 1KVRA 1U8TA 1L7OA 2AE2A 4IV0A 4N12A 4UNQA 5ECYA 4D8VA 1PE0A 1XRQA 2FCAA 3VR3D 1EXDA 3A25A 4CETA 1P1CA 3TXXA 5T6BA 3EQ2A 1Z0SA 1CUZA 3EC1A 3LUFA 3RV4A 5BMOA 5LOVF 4I19A 4C4YA 1EKXA 2WWTA 3H5NA 1J7KA 2CXPA 3FHJA 3SLRA 3LUBA 1M74A 3GYBA 3OUUA 1QFZA 1VE9A 3AUXA 1C4OA 1E5LA 3JQFC 3PUXA 5B12A 5I3CA 3HO6A 5HIMA 2E18A 2XOEA 3AF5A 1W9HA 2HHCA 3LIIA 1AT1A 2J0SA 4FBLA 4MQ5A 4CM4B 3ZC3A 7ABPA 3HGTA 2H3EA 1XLTC 4JD5A 4PX3A 3HB9A 3QZUA 4PPYA 4PO9A 4M54A 5LP6B 1IEVA 4QU5A 5DCWA 2OPBA 1UMDB 5B2ZA 2PX5A 1N92A 2J4CA 2QRMA 3LQKA 1CXZA 4FBMA 3S3TA 2OHXA 4XPZA 4NWIA 3BSYA 1JEYA 5KYWB 1RAFA 4G4IA 1E8MA 3K20A 1Z6ZA 1SKYE 1V16B 2IYVA 4V0QA 3VPDA 1X7ZB 2ZYSA 1H2FA 1VBFA 3ZZMA 4UEQA 4QRHA 2CL6X 1UZMA 4EJ0A 4ZGBA 2HBQA 5EE9A 3IB3A 4JI6B 3S8YA 1FFGA 3DCNA 3MWDA 2R6ZA 1MPTA 2C4TA 5TMDA 3HXOA 2YCBA 1SOUA 1BXGB 4MV5A 4LHYA 4YIKA 3TMYA 5A1TA 4HNGA 4Q48A 4AD8A 4L15A 2YJGA 4ZHQB 4E5MA 3K2IA 4H17A 4G9BA 3SMQA 2R85A 2B7BA 4Z4FA