4CQMB

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
232
Chain Sequence
HHHHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
total genus 68
structure length 232
sequence length 241
chains with identical sequence C, F, G, J, K, N, O
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmB00
2PKQO 4XX0A 4ESOA 2PD3A 3DWFA 4TRJA 4IJVA 4OOFA 1I3KA 2W8ZA 4YCAA 1E3WB 2G76A 4RGBA 4B7CA 3KSDO 2TMDA 3LLSA 2DFDA 2Q46A 4TSKA 1YS4A 1BTOA 2JAPA 4AL4A 5AQ1A 1PZFA 4RZHA 1KVQA 2AE1A 2Z95A 1DHTA 5ITVA 1U7HA 4NU6A 1PZEA 3O26A 3ZHXA 1YRLA 4CV3A 2YFQA 3OFSA 3GDOA 5JDCA 1EVYA 4UVGA 4OGWA 3GY0A 1PS9A 3Q9NA 1ZJZA 3Q3CA 3WNQA 4Q3EA 3RUIA 4RF4A 3GGOA 1BW9B 2E4AA 3WOHA 4WUVA 4N54A 1DJQA 4E13A 5AYVA 3NJ8A 1JA9A 3PP8A 2EXXA 5KVSA 3QWBA 1NQ5A 4DUPA 1R66A 3LK7A 4JXKA 4MVJE 4YJGA 4CJXA 5B37A 4MKXA 3RUEA 3O38A 1MUUA 2IRWA 1A4UA 6ADHA 1TXGA 1DB3A 3B70A 1UJMA 4DMLA 1YKFA 5G4LA 4MKZA 4RZIA 2PA3A 2VYVA 2RAFA 4E5YA 4YAGA 3GEMA 1L7EA 3FTNA 3AFNA 3T7EA 1R4NA 1NWCA 3VZRA 1CEQA 5L9AA 4B4VA 2VZ9A 1SZJG 5DCWA 4MVJM 1JLLA 5L7WA 1HYEA 3H4VA 4EUHA 1NASA 2PR2A 2ZB8A 1JW9B 4IM7A 4DLAA 4ZICA 1P31A 4W4TA 5IXSA 1LLCA 2D5AA 3I83A 4PFJA 3SC4A 4NMHA 3DHYA 3GLQA 3PIDA 1ZK0A 5B4UA 1HETA 5JPIA 1BXGB 4MVJG 3HUDA 3V1YA 1YB4A 4HWKA 4LMRA 4AJHA 3GNSA 2DQ4A 4BO6A 3WMWA 3FTPA 3AM5A 1LDBA 4GMGA 3DBRA 5CDGA 5CEFA 4XIJA 1GQ2A 3LSYA 4CMGA 3NEPX 3F1LA 4BGEA 3TJRA 3QQPA 1PR3A 5JY6A 1Z45A 1GY8A 1Z7EA 4ZA2A 4XJTA 3O8QB 4WEQA 4EJ6A 4NH4A 5ICSA 4ND2A 1P9LA 4AJ4A 2ZATA 3K2EA 3QJ5A 2X5KO 3CMCO 1VL8A 3D4PA 4HXYA 1T25A 4R1TA 4CLXA 1GDHA 2CZCA 5IDYA 3VPGA 1G1AA 1UDCA 2VHVA 5JE8A 4K1LA 3ZU2A 1NYTA 1YB1A 1R0KA 2GZ2A 4AJLA 2CVOA 1ENPA 1RJWA 1HSOA 3NT2A 4KUGA 5ES3A 2JD2A 2Q3EA 1VM6A 3D0OA 3VAZA 3AOEC 3NDIA 3TOZA 2PZKA 1GYRA 3DR3A 3GZ4A 3IIEA 3L0DA 4PRKA 4D41A 1XDWA 2IZZA 3CZMA 1QYDA 4OXKA 2NVUA 3EDMA 3UF0A 3F4BA 3WNVA 4XWYA 2VNAA 2QYTA 3GNQA 2C59A 3JQAB 4OOEA 3Q6IA 2X8LA 2B4QA 3RKUA 2NM0A 4YRBA 4JIGA 5EMHA 4C7JA 1Y7TA 3S2IA 1H6BA 1AHHA 1U1IA 4OXNA 3QVOA 4NR0A 4B3JA 5HWSA 2EWMA 1BXKA 1H94A 5AXDA 1DDOA 3FR8A 3U4CA 5FI3A 4F45A 5LDHA 3Q11A 3LLVA 4M8SA 5F1KA 3SVTA 1AHIA 1KEVA 4GX1A 1PGNA 1F14A 3NGLA 3W8FA 1ONNA 4XYGA 2VWQA 3K5PA 5A9SB 4CQLA 2O50A 4R3WA 1IZ9A 4E21A 4CL8A 4FFNA 1LI4A 2V65A 4P8RA 1UXJA 3MWDB 2C7GA 3MJSA 1U5CA 2YW9A 1HYGA 1ZH8A 1TT7A 4AJ2A 4XKJA 2CDAA 2Y99A 4PG8A 4RVFA 5KKCA 3AY6A 3ENKA 3PHIA 3PZRA 2FPPA 4OL9A 3I9JA 4XR4A 3DZKA 4BKUA 4EW6A 3O4RA 3K31A 3H9JA 4J0FA 4LRSB 4FFRA 3CH6A 1C0LA 3FSRA 3ANMA 4CQMA 3ANLA 5FEUA 5CAEA 3WJAA 4L73A 2J3KA 3I5MA 2YYYA 4S1VA 5C7OO 1PL7A 1I33A 4BO5A 2VTEA 1E3LA 3C8MA 5HTOA 4OMUA 3GVCA 2I65A 4WJZA 5IZCC 3UH1A 3AU8A 3L4SO 1X0XA 4OH1A 5IG2A 3HHPA 5H82A 1I3MA 4EYEA 3ZGYA 1WLYA 4OJNA 3EVTA 4MVJA 1NPTO 1Q7CA 3JYQA 3OICA 5L3ZA 3HN2A 2O3QA 3M6IA 2ZQZA 4UVDA 4NZ9A 2VT3A 5AOVA 1HL3A 2QRJA 3KEOA 4IPTA 2GZ1A 1K6IA 1RKXA 4H3VA 3A14A 4Y8VA 4CM4A 2D0IA 2E6UX 2WTBA 2GR9A 1LBEA 3ABIA 1ZO8A 2RHCA 3A06A 3R6DA 4IY1A 1HT0A 2PTGA 3EVNA 2GNAA 3RSHA 3FHLA 4GGOA 1A9ZA 1DFHA 5DNAA 2EGHA 1DO8A 3CIFA 3MJEA 1ADGA 2JHFA 2PKRA 3P2OA 1XKQA 1UXIA 3OP4A 1MFZA 2BHLA 2RBEA 3WYBA 4BV8A 4E5KA 4BNXA 2ZYDA 1HDGO 1DC4A 4J1TA 2FR1A 3R3SA 1ZZEA 2IYOA 2FRDA 3FPCA 4DWVA 1EFLA 1XIVA 3ON5A 1J5PA 4NG5A 1KY5A 2C7VA 2BFPA 4YAJA 5DP2A 1NHGA 5I7FA 4J9UE 2Q4BA 3DOCA 1P0FA 3GH3A 1P1HA 3T4EA 5CFZA 1O6ZA 1I0ZA 2B35A 2O3RA 1Q7GA 1GPJA 1V3TA 1LC3A 3LQFA 1KC1A 1LDGA 4BGIA 3OSUA 1QP8A 3U4HA 2YQ4A 1KERA 5CDTA 1SOWA 4O63O 1ZK1A 1QYVA 1ISIA 2NU8A 1JU9A 3RUHA 1DIGA 3DTYA 4CPDA 4ZJUA 1K5HA 1GZ6A 4Z9FA 3RC7A 3SXPA 5FYDA 4DXHA 5ITWA 1C1XA 1ZFNA 4PLYA 5JMPA 3JD2A 4U8GA 2NNLD 2NSDA 4WK6A 5U9CA 4R1NA 2JJYA 2EV9A 5CPFA 3GHHA 4MP3A 4FJ2A 4FS3A 5A9SA 1EQUA 1HE2A 2I9PA 2AQIA 2X5OA 4OSPA 4CM9D 2DM6A 2X1HA 3RUFA 2HK7A 4WLUA 3GPIA 4Z9XA 3WS7A 2HMWA 4A2CA 4YJGB 3UCFA 2B4RO 2Y68A 3DZFA 2ZK7A 3VPHA 2HK8A 1QKIA 1T26A 4I5FA 2C20A 3X2EA 4EJMA 4E0BA 2BF7A 4XZ3A 1X13A 1YVEI 2ZTLA 4QEDA 5JDCC 1I2BA 2G1UA 4HY3A 5KJ6A 4IXTA 3DMYA 1J4AA 3ICPA 4ZQHA 4LW8A 1ARZA 1BSVA 2GO1A 3BZUA 4A10A 1LNQA 1NVGA 1P44A 2Y1CA 2RHRA 2JFHA 3AOGA 4IZIA 4W99A 3IDSA 4BQRA 1SEPA 1XG5A 4BNKA 4DBVO 4EITA 5L7TA 3JQGA 4MINA 1E1LA 1HDZA 4WASA 5I8WA 1MC5A 3G1UA 3QWHA 3MWEB 3ZV5A 3FPLA 1LRJA 5T57A 5K6AC 3DZIA 3QWAA 3GMSA 4NU5A 1LLQA 3BHJA 3HFSA 3H8VA 3ZWPA 4W7HA 4J4BA 4MPDA 2NTVA 3VZQA 4N7RA 2POQX 1YBVA 2YV1A 1O94A 2I3GA 4XYEA 3K30A 5MGBA 4FFOA 3UGKA 3HSKA 2DTEA 2GD1O 4PLZA 3CMMA 3GOHA 1SOVA 1E5LA 3GZNB 2VTDA 1B8UA 3W4IA 4ND4A 5KJCA 3RFVA 2EF1A 2VRBA 4EGFA 3RFTA 2F1KA 3SJ7A 4WPGA 4UVHA 1IOLA 2O7SA 2WD8A 3IJRA 3S1LA 5DN9A 4JGBA 4D0RA 2DBZA 4XYMA 3E6AA 3BMNA 2ZB4A 4LN1A 5T67A 5EL0A 3JQGB 2FP4A 2GUGA 4MO2A 3BYZA 5G0UA 4E30A 4PZCA 1B15A 5KIAA 4HFJA 1WMAA 3JTMA 4DTIA 1V35A 2PD6A 3KRTA 3ZW9A 1YJQA 1IE3A 2ZJ1A 1TB4A 1Y8QA 4UEKA 4Z3DA 1FDVA 3PQFA 5B1YA 1B14A 5KCZA 1QYXA 2HLPA 4J16A 4M1QA 2H6EA 5COBA 4CMIA 3I52A 2I66A 1V9LA 1KEUA 3ICCA 3QVWA 4IQ8A 4JNKA 1LSSA 1X0VA 4BL5A 5KJFA 3U62A 3FNFA 2FPGA 3UAGA 4PG5A 4HFMA 3UN1A 1YJ8A 1DPGA 1RPNA 2VQ3A 4XQCA 1Y5RA 5TLSA 3D5TA 1D7OA 1Z73A 4RL6A 4WOKA 5LDGA 2AA3A 4YRAA 1M2WA 4HV4A 4TKLA 3RBZA 3U0BA 2E48A 3NDRA 4LVUA 1I8TA 3MJ4A 4FBGA 5CEJA 2WYUA 3R3JA 4HNGA 2QRLA 1Y9EA 2ILTA 1LXCA 2PH3A 2NLOA 5JSFA 3M2PA 2VRCA 3AWDA 3L77A 4EI2A 1WDLA 4CV2A 1M67A 4ZQGA 4R1SA 4JLWA 1PGQA 2X0IA 3I6QA 4QUKA 4YDRA 1KVUA 1T1SA 1XR3A 1ZSNA 3UCEA 4R9RA 2NUAA 1GZ4A 5JCJA 5CDYA 1ZK3A 2GF2A 4J1NA 4PVCA 3DB2A 3HADA 3E9NA 3RD5A 1MXFA 2H1SA 2WE7A 5FF9A 3E9QA 2JFGA 1PQWA 2CDCA 3GRPA 1PJ4A 1U8XX 4BNJA 4CQMB 3LF1A 4A5OA 1Z82A 1XGKA 1SPXA 2IDZA 2QG4A 1LQTA 2OHXA 2OUIA 3AUTA 1Y81A 1J49A 1RM4A 1QYWA 2B4TO 2JCYA 3TRIA 1L7DA 4GSKA 4K6CA 2NQTA 4L74A 4CR6A 2ET6A 2C82A 1F12A 3M2TA 4KTTE 4J4TA 3E8XA 1ULSA 2DKNA 3OA0A 3PHHA 4RJTA 3JYPA 1A9YA 3BIOA 3RROA 4UVEA 1BMDA 3WWZA 4JK3A 4P4GA 4Z0PA 2OP1A 3N74A 1FK8A 1T2EA 3IMFA 4RPHA 8ADHA 3S2FA 3GN1A 4GX5A 4E6PA 5EQFA 1GQQA 3ZU3A 1UAYA 3CEAA 1ULUA 1BXZA 4BIIA 1LU9A 1HDYA 1CYDA 2AMFA 1NQTA 4BQPA 4TVBA 4D44A 4FFLA 4WKGA 4M55A 3FNEA 1Z6ZA 4A0SA 3OMLA 2QYSA 1KVTA 4B7UA 3ZWYA 2OO5A 4ILKA 2YQ5A 4CM8A 3X2FA 3DXFA 2IXBA 3RWBA 3AI1A 1HE5A 1D3AA 1AXEA 1K89A 3D3EA 2VWHA 3VVBA 5IZ4A 2BGLA 2VYVD 3G49A 2I67A 1Y6JA 4WNCA 4YR9A 4BNHA 4GI2A 3U09A 4RPGA 1YL7A 2HCTA 1YQGA 4BNMA 5K6AA 2Q50A 2VUTA 3JQDA 3DZHA 4KUEA 1T2DA 2NU7A 1ZSVA 3GN2A 1WW8A 1GEGA 1LDYA 2PZLA 3PJGA 1AXGA 2DC1A 4AJNA 4CUZA 3TF5A 2OGUA 1Y1PA 4QFDA 4R68A 3ZNOA 2CNBA 2YFHA 5AVOA 4L9RA 2WSBA 3PGJA 3ZV4A 3F5QA 4OSOA 4EBFA 1ENYA 3NUGA 5L40A 5TT1A 3I9KA 4BNLA 1P3DA 3V1UA 2G17A 5L4SA 2YDYA 4CUJA 2J5QA 4LSMA 4FPXA 3L6OO 3ZV3A 1LSJA 1V3UA 5EINA 1GUZA 1QR6A 2CSUA 4FC7A 2C29D 4ALLA 3R1IA 1PSDA 1ONPA 1R16A 1JTVA 1H2BA 2Y0EA 4TZTA 3WGIA 2PWZA 5A3VA 1T1RA 1GPDG 2WD7B 3IC5A 2BFAA 3RC9A 1Q7BA 4YPOA 1Z7BA 4Z6KA 1WVGA 1GD1O 3ROQA 3L9XA 1GEEA 1WMBA 4F6LA 3I1JA 1JAYA 3C3XA 2G82A 4N5MA 5F1PA 1P45A 3I9LA 4WE3A 4YWJA 1R12A 4ROSA 4BGUA 4BNUA 2JL1A 3U3XA 1IB6A 4O1MA 3VDRA 3WSVA 2OXIA 3TQHA 4MJLA 4RPJA 4ND1A 5FI5A 4IMRA 4JJIA 4WLFA 4W9NA 5L4NA 3RC2A 1M6HA 1RM3A 4J6FA 5BSHA 3GT0A 2EJVA 4CLRA 1E7YA 1EUDA 1CIVA 2P4QA 4A27A 2H9IA 2O3SA 2EHDA 3D1LA 4PLWA 3OQBA 4I5GA 4RF2A 3TOXA 3KETA 1HTBA 5TJ9A 4KTVE 3UOGA 4R69A 1UAGA 3IUSA 2OFPA 3D7LA 5T8KC 4MP6A 5IDQA 3ZCXA 3IUPA 1UR5A 4IDAA 4NJMB 3DZJA 4UVIA 3INTA 4RVUA 4D3FA 4MIYA 3AM4A 2HO5A 1QG6A 3BXXA 4G5HA 5F3RA 4J4HA 3S2GA 2W98A 3S55A 3ZH2A 3GEGA 2NTJA 2R00A 4YAEA 3ONEA 3RU9A 4LCEA 3NAQA 1V6AA 2W4QA 2A92A 4KDFA 3PYMA 3ZWOA 4II3A 3I4FA 1I01A 3NTRA 5C37A 1UZNA 4F46A 4EZBA 3VZPA 9LDTA 4M86A 1LC0A 2B0JA 3VTZA 2WMDA 2Y1GA 1NBOA 1IY8A 3BMNB 1YGYA 5TF4A 4LK3A 1GZ3A 1OMOA 1UUFA 3K8ZA 1YBMA 1ORRA 2P68A 3AM3A 1KEWA 3STHA 5I9NA 2JCVA 5C7LO 1CRWG 4PRLA 4WLVA 1NP3A 3CXRA 3KO8A 2X4GA 3Q9UA 5BR7A 1U2DA 5B4TA 4I9UA 1BW9A 4GL4A 4R41A 3GAFA 1HDCA 4IDDA 5A3JA 2AHRA 4WLEA 2VZ8A 3RJ5A 1QMGA 2W90A 3OEWA 4YB8A 2C0CA 4IS2A 2GCGA 3BMQA 4OIMA 4CM5A 1B7GO 2DBRA 2I6TA 4BB5A 4YJFA 1ADFA 2TMGA 1LDEA 1EE9A 1ZIDA 2XPCA 4HNHA 2R2GA 5EN4A 4YXFA 1JKJA 1E1NA 3DBLB 7ADHA 3NKLA 1WDKA 4IJUA 4EEXA 4J90A 1MG5A 5JAQA 2Y1OA 5C7IO 1YOVB 4AJEA 5IXYA 3PDJA 4G2NA 3RBXA 1C1XB 2OORA 4I8XA 2IE0A 4CM1A 1AGNA 5GZ1A 5COQA 1W8DA 2IODA 3C24A 3NT4A 1PJQA 1NTOA 2J3IA 4D43A 1F8FA 4W7IA 4A26A 1CWUA 2CD9A 3F4LA 3DO5A 4PG7A 2P9CA 1JVBA 2VCYA 3HG7A 4PLHA 4YJHA 3WLEA 1W6UA 5DOVA 3WIDA 1ZJYA 2YDXA 1NQOA 2J3JA 3MJTA 5BSEA 4JJFA 3K96A 1ZSYA 2JFFA 1JWAB 1U28A 2VNSA 3WG9A 4GGPA 4J91A 2X9VA 2AEMA 5GMOA 3GA0A 4GWKA 3DHNA 3UUWA 3CINA 1I10A 4Y67A 2D2IA 5ER6A 1G0OA 5G0VA 3B20A 4IJKA 3OBBA 3DZGA 1O89A 1MC4A 2Z5LA 2RH4A 4BVAA 2O48X 4YJDA 3JYOA 3F3SA 2FY8A 3GPDG 2HKIA 1ID1A 1D4FA 4BO0A 2QHXA 2HRBA 3TDKA 2OOSA 4CR7A 3DDNA 3E48A 2NADA 4WGGA 3ROPA 1NVMB 4GLOA 4PZDA 4CMAA 4BNVA 4EUEA 2FSSA 3JQ6A 1FDWA 1XELA 5TX7A 3GUYA 3Q1LA 1PWXA 1Q1NA 1B3RA 3HDQA 2JD0A 1N9GB 1P1JA 3GF4A 1EEHA 1WNTA 1KETA 4YEDA 3PI7A 1DC5A 4TZKA 1EK6A 1N7HA 4DYDA 1VKOA 3I6IA 4CM7A 4FFPA 4D79A 1I32A 3GG9A 4CLOB 5CPBA 4U0KA 1B0AA 1HE3A 1PR9A 2OP0A 4JX8A 3H5NA 4FSHA 5JO9A 1J0XO 3JQ8A 3QP9A 4G81A 3MTGA 3E82A 4NK5A 4Y9DA 4NFHA 4PLTA 2XF8A 3KOUA 3S8MA 2P4HX 3OIGA 3ZU4A 5I7EA 3DMTC 1O5IA 2SCUA 3UHAA 5CDUA 3JYNA 3TN7A 1EVZA 5JS6A 2O7QA 1ZK4A 4UULA 1LSOA 3C1AA 7MDHA 4PLPA 3HFGA 2D8AA 4FOSA 1SCUA 3G17A 1NAHA 3WWYA 5JMWA 4GBJA 3WYCA 4H16A 3CE6A 5IDWA 2VZ0A 2NU6A 1MG0A 4GLLA 4ZQBA 5DP1A 5L95A 2F00A 3H3FA 2CFCA 4IDGA 3QA9A 1O9BA 3PLRA 1S7CA 4RQUA 3E9MA 4Q39A 5L51A 5AXBA 4PVDA 1A27A 3QHAA 4AVYA 3GFGA 3RASA 3I9NA 3JQ9A 4XQGA 2UAGA 1VL6A 4I9NA 3SBOA 4XB1A 1ZK2A 1BG6A 4JN6B 5JCXA 4R1UA 4FW8A 2C2XA 1XU7A 1H0KA 1XWFA 5U1PA 4DIOA 4BO9A 3GC6A 4YYZA 3JQ7A 3PQEA 5G2OA 4BNYA 2LDBA 2ZJ0A 1RYEA 2HJRA 1U2GA 1XLTA 1Y8RB 2Q99A 3OJOA 1UDBA 1LQUA 3I4CA 4TKMA 1B3BA 1ML3A 2AXQA 1C1DB 4BO4A 4GVXA 2VUUA 5DCUA 2G0TA 2VHXA 5ADHA 3VC7A 3BTSA 2DFVA 2WEKA 1EUCA 5F5LA 1NWHA 1CETA 4IZHA 3DBHA 2ZKLA 2O3UA 2P9GA 4M89A 1QXSA 3WBBA 1ADCA 2AQ8A 3MJVA 5TNXA 3RUAA 5I7SA 3JQAD 4HP8A 4FJ1A 4CM4B 4ALJA 1BWSA 1I24A 4OM8A 2PD4A 4AJPA 5DBIA 1YONA 2V6GA 1DJNA 2IZ0A 4MDHA 2EKQA 2X9NA 5JYEA 4GQAA 2OL4A 1IHYA 2CVZA 3RC1A 3ZN2A 2PH5A 4GX2A 1U3UA 3MOIA 4FB5A 3UCXA 4QQRA 4OQYA 4CLRB 1O0SA 1QV7A 2XOXA 4P4NA 2Y05A 3EC7A 1ZXBA 5ENVA 5KJ1A 3PYLA 1X15A 2DTDA 3DEYX 5T8KA 2NTNA 3ENNA 3FRJA 4RPKA 1A4IA 4YACA 2IXAA 1DAPA 1DAOA 1DLJA 2O4UX 3NT5A 2VWPA 5EERA 5KOIA 2X58A 4DIFA 3PZBA 1K6JA 1JVSA 3LYLA 2Y0CA 4RDIA 1Z74A 2AG5A 4A7PA 4XDZA 3AY3A 4RQTA 3DHEA 5U4QA 1F8GA 5JAIA 2AE2A 5CG1A 4J1SA 1BGVA 4HX5A 4KWHA 4J7UA 3RAJA 4CMHA 1VJ1A 1GYPA 1LRKA 2UV8A 2UDPA 4OKIA 1N92A 4BNTA 1Q0LA 1VE9A 5IN4A 4NBVA 1EVIA 1FF9A 3HN7A 3ZI0A 1VI2A 2WDZA 1ZBQA 3Q2IA 3V8BA 2LDXA 3TPCA 3ZWVA 3KZVA 5IZCA 2ZTUA 3GVHA 3UFXA 3ZW8A 1R37A 3F46A 2CF6A 3HNPA 3JD1A 3HB5X 2Q45A 2ZQYA 1JAXA 3L07A 4D42A 4E33A 4TRRA 4BMNA 4JROA 3TZQA 2QIOA 3FD8A 1NNUA 1C0PA 4OO3A 1E0DA 4J9VA 1C3VA 3M1LA 1NHWA 3VH1A 3K6JA 4RDHA 5COAA 1E5QA 1TI7A 5TT0A 4CV1A 1H2HA 2P5UA 3L6EA 2YZ7A 1HLPA 3OQ6A 2Q1SA 2X22A 2AG8A 2YHIA 4E12A 5JW6A 3UVEA 1JKFA 4U6SA 4ZVVA 4A73A 2EIHA 2DAPA 2HJSA 4IQ0A 6LDHA 3PWKA 1PS8A 5A5EA 1TEHA 4AJOA 3WFIA 3DBHB 4IGEA 4RF3A 3W4KA 3AK4A 3BAZA 3P2YA 1BHSA 2UVDA 4QO8A 5EQDA 4XDYA 3JQBC 3IP3A 4PGFA 1ISMA 3QVTA 4IIVA 5DDIP 3V2GA 4BO1A 2QZZA 4O6VA 1DBVO 4CL3A 1HZJA 3QSGA 3DTTA 2GSDA 1I30A 4JBHA 3GG2A 5G0WA 3JQ8B 3JSAA 5CDSA 3KV3O 1BVUA 3SEFA 5JBIA 2GZ3A 4CM6A 4OQZA 1PX0A 1YO6A 3ZNQA 4MVJF 1XHLA 3O03A 4I1IA 1QYCA 4E3ZA 2V6MA 3PIIA 1V3VA 1YXMA 3FR7A 2Z1NA 2WYVA 4Q3NA 2HDHA 4NQZA 1HDXA 4HFNA 4B8ZA 3INGA 1E3SA 1U3TA 1E3IA 2GYYA 2HMTA 4E5NA 4ZU3A 4DRYA 5A1TA 4JJGA 4O59O 1YWGO 4JP2A 1QLJA 1D1TA 4XGNA 3H9EO 3G3EA 2VN8A 4DBZA 4YAIA 2PY6A 3BMCB 2Y1FA 4JBGA 2ZTMA 4IINA 2EP7A 4CR8A 4CMEA 3L9WA 3WGHA 3H3JA 1OZAA 4CMKA 2OMEA 3BTOA 4ID9A 5T5QA 3PFWO 3KYDB 4E2ZA 3IKTA 1VPDA 1E6UA 1IUKA 2BFMA 3ETDA 1DIBA 1ISJA 1SC6A 1J6UA 1SAYA 1WAMA 4CM8B 5TC4A 5HM8A 4P22A 5CP8A 5EPOA 1ISGA 1MA0A 1U5AA 1OBFO 4IMPA 2EGGA 2NU9A 3A28A 3COSA 3WDSA 4XCVA 3DONA 3DBVO 2PK3A 3RQSA 5ILOA 2B37A 3D64A 1T4BA 5TSDA 1IULA 3AUAA 4WOJA 4INAA 1MXHA 4AJIA 3V2UA 2HRZA 3PWZA 3ONFA 3OIDA 3ZZNA 2NWQA 3PWSA 4R51A 4WCFA 1I2ZA 4DL9A 1I2CA 4WECA 1D1SA 2RCYA 1DRVA 4TWRA 5FWNA 1B8PA 1MLDA 1EE2A 1DIHA 2I99A 4FR5A 4O5OA 4OHUA 3NYWA 3B1JA 2E82A 4E2WA 1RM5A 5JC1A 5J23A 2GDZA 1SEVA 3IJPA 1BRMA 3EYWA 2WE8A 1O8CA 3QWFA 3DMTA 3ORFA 1GR0A 5I9MA 1NFFA 2QQ5A 3PJDA 4IDBA 3F47A 1XEAA 2EERA 3DC2A 4HBGA 3CKYA 4YQZA 4ZQEA 1DC3A 4HFRA 2NVWA 2H5LA 1GTMA 4CMIB 1PZGA 3NTOA 3RIHA 3L4BC 4RLHA 2W2LD 1U7TA 1SO8A 4R4JA 1HDRA 1RYDA 4NI5A 4PZEA 4BO3A 4E4YA 3IAHA 2FN7A 1ENOA 1FDSA 1M66A 4CUKA 4XJSA 2GPTA 5BNFA 5DF1A 4LRTB 4Z3KA 1IHXA 1X14A 1YL6A 2EJWA 1QV6A 3ADPA 4CV0A 2D59A 4YQYA 4CQLB 3AJRA 1OAAA 5L4LA 2HQ1A 4KZPA 4YT4A 1M76A 3H7AA 1C0IA 1WPQA 1BXGA 1EBUA 4F6CA 5JDIC 1P74A 4YA6A 3WYEA 3OEYA 5KVQA 4IQGA 3EGOA 2RH8A 3MOGA 4P4LA 2Q2WA 3KLPX 3I9MA 4UUNA 3ZWWA 1XQ6A 1FMCA 3E5RA 5I9LA 1ZXLA 1K3TA 1T2CA 1PTJA 2NACA 5DCYA 1GCOA 2Q2QA 1ISHA 1HXHA 3HB4X 2AEFA 4CM9A 1F06A 2VOEA 1GU7A 1HF3A 1WP4A 1EK5A 5K9ZA 4M87A 4TRNA 3W8EA 3RU7A 5F1OA 3VKUA 4UUPA 1AUPA 4HADA 5KWEA 5BQFA 2O4CA 2Q2VA 3D4NA 4PIVA 4JBIA 3ROMA 5A9RA 1W0CA 3AI3A 3W6ZA 3AY7A 2PGJA 3D4OA 4XRRA 1WZIA 1R6DA 4BNWA 5IDXA 4J2OA 1V0JA 4LVCA 1Y8RA 2JCXA 1HKUA 1VL0A 3I9OA 4QT0A 3WSWA 3T7CA 3JQBA 4Q3CA 3K9QO 2XXJA 1GV1A 3BMOB 4UAGA 2GGSA 2HK9A 5ILGA 3ZWMA 4BO7A 1JN0A 3NX4A 4E32A 1NXQA 4XGIA 4R01A 4IGFA 1GAEO 1DFIA 3U9LA 3VPFA 4CMJA 1PJ3A 3RKRA 3FN4A 3VPXA 3K92A 4WLOA 4DMMA 4FCCA 1YQDA 1DRWA 3D5QA 1ZVMA 3IQDB 5EESA 5L53A 5A03A 1NPDA 4E5MA 3RJ9A 1E92A 1R4MA 4IDEA 4II2A 2FSVA 4L4RA 1VJTA 1DLIA 2IEBA 4BNGA 5AXCA 3WJ7A 1KIFA 1PEDA 1R15A 2X6TA 3HQ4O 1E3WA 5I8ZA 1JWBB 4R5HA 4YTEA 3EZYA 1P1KA 1OC4A 1QRRA 4DQXA 1LLDA 4IUYA 4RORA 3DAGA 1U8FO 4DIBA 1KC3A 1X7HA 3C7CB 3OHSX 3A9WA 4QECA 1I5RA 1PS0A 3OJEA 3TWOA 2E49A 3F6YA 1ZEMA 1I3NA 1SB9A 1XU9A 4RPLA 4BNIA 5HBRA 4ZD6A 4KQWA 3TFQA 1EUZA 3ZHBA 4BKPA 4RVHA 4EDFA 5ICMA 4NBRA 1P1FA 4R5MA 1UXGA 1WDMA 1E7QA 4OAQA 2BFOA 4QX6A 2XAAA 1LLUA 4MOWA 1E1KA 3CZRA 3F5SA 5HA5A 3AOEA 4W6ZA 3K2BA 3KEQA 4Y6PA 4RLSA 3W4JA 1XQ1A 3WX0A 4NIMA 2C07A 4PLFA 1JKIA 1EZ4A 1VKNA 4GSLA 5L45A 2JAHA 2PZJA 1CF2O 3ZDFA 4AJKA 2RIRA 3KLMX 4TQGA 3DAFA 3EY4A 2IZ1A 4J43A 4U6QA 1R4NB 3MCVA 4MVJD 4Q3AA 4B3IA 4RV9A 4Q9NA 3OA2A 3E03A 4NPCA 4BKOA 5KVCA 4MIEA 2B69A 2VYNA 5A05A 1EQ2A 1JDJA 4XGKA 4YVFA 3GDFA 1AN9A 2E37A 1D8AA 3BA1A 1UDAA 2NQ8A 1K6XA 2VRCD 3W6UA 3G0OA 4R54A 1GQYA 4QO7A 1KOLA 3JV7A 4NBTA 3QE3A 4XR9A 4PLGA 5TGDA 1GFSA 2G5CA 3PXXA 3P5SA 1YBAA 1P1IA 3ZHYA 3W1VA 3D3WA 3WIEA 1KEPA 3DZBA 3FWZA 2P91A 2YV2A 1EDOA 3OJFA 1DC6A 2CF5A 1UH5A 1QORA 3E18A 4GMFA 4ZGWA 3GGPA 3RUDA 3MJCA 3ULKA 2PGDA 4ONEA 1VRWA 3EK2A 1N2SA 2O23A 3LC7O 3HJAA 1EVJA 4NBWA 1MP0A 2HSDA 5IFLA 4E31A 3SJUA 4JQCA 2GRAA 4D45A 3ST7A 5LCXA 2GERA 1N7GA 1DIAA 4BNFA 3TZHA 3F9IA 3GRKA 4OXYA 4DC0A 1E6WA 3UKOA 3VOSA 5H81A 5C3MA 5IAAA 2ZIZA 3N58A 4L76A 1P77A 3E1KA 1U3WA 4DLBA 3FF4A 3BTVA 4XB2A 1CQIA 1A7KA 3HDYA 1PQUA 4DQVA 1YH3A 3CUKA 3V2HA 1C0KA 3QW2A 2D1YA 5JFOA 5LC1A 3AI2A 1T24A 2Y0DA 1NR7A 3SLGA 5A02A 5EJ2A 1PJSA 2ZYAA 2PLAA 3SX2A 4KP7A 3QY9A 4GX0A 2VHYA 5G0TA 3HWRA 5G4KA 4DVJA 3A1NA 1OFGA 3EUWA 5AXAA 3C1TA 4BUCA 3TZKA 4WEOA 5CG2A 3H5RA 2CMDA 2DPHA 3P19A 5DBGA 1M6WA 3PVZA 2X0RA 1R0SA 2BH9A 4D46A 3GVPA 3LT1A 3NRCA 4DC1A 1OC2A 3FCOA 4DPLA 2X5JO 4NHEA 4KMSA 3OF2A 4CLEA 3Q0EA 4J49A 2DBVO 1JQBA 1GYQA 1YOVA 3FBGA 4L75A 2CUKA 3LVFO 4AJ1A 1U3VA 2FMUA 4G65A 4U0JA 4ITUA 1G6KA 3DBLA 5A9TA 4L4SA 3WR5A 3AUSA 4MVJP 3JQAA 4OYRA 1IYZA 4H7PA 2UUOA 2Q49A 1P1RA 1FDUA 4YJFB 1KVSA 4W9NC 3WB9A 1RM0A 2NVUB 4RF5A 3JQFA 1W4ZA 3O9ZA 4B8WA 3BMQB 4IDFA 2X23A 4BMSA 2VOJA 1E3EA 3IOYA 3IL2A 3H6KA 4M49A 1XYGA 2YHIB 3JQ7B 5I7VA 1OI7A 5K0ZA 2Y1DA 4X54A 4GKBA 1PJTA 1E77A 4QXMA 3TL3A 4FC6A 3WQSB 1R0LA 4EEZA 1SBYA 3KYCA 3H2ZA 1SB8A 1S6YA 3UW3A 4GPD1 5FFFA 5JO0A 5HRUA 4BV9A 2H63A 5JNLA 5GY7A 4NK4A 4A03A 3FNGA 2BI8A 5B12A 2BLLA 4K6FA 3PPIA 3AU9A 3OH8A 5IJZA 4AJJA 4ZHSA 4QTZA 5JDIA 1ENZA 3LZ6A 3DBRB 2VWGA 2HMVA 3OM9A 1E6EA 3D3WB 3V5NA 4PG6A 1BDBA 2PFGA 3OJ0A 3ZWAA 3WGTA 3ZV6A 1HSZA 3C7DB 4H15A 8LDHA 1FXSA 1RWBA 5DULA 3VH3A 2UUPA 3WLFA 3GZNA 2V6FA 1NM5A 4CMCA 5TQVA 2EP5A 1B16A 1FJHA 2C2YA 3UXYA 1WXDA 2Q1WA 1O95A 2OBNA 2UYYA 5F21A 2Y93A 4UREA 4TRMA 2FHSA 4M54A 3PEFA 5A04A 3PHGA 1DEHA 2VUSA 1YDWA 3EW7A 3ZWCA 3QIVA 1UP4A 1EMDA 3GGGA 1E7SA 4K9DA 1VLLA 2JD1A 1H6DA 2ZB7A 1YB5A 1WWKA 1X1TA 3G1TA 4C7KA 4DQUA 4GH5A 3SLKA 1CERA 3RFXA 3HDJA 1H9AA 2J3HA 3MZ0A 4XIYA 4E5PA 2FPIA 4I9HA 4BMVA 2HAEA 3JYLA 4LISA 4ALNA 5HS6A 3WTBA 4L8VA 4ND5A 1ZMTA 2BGMA 2YV3A 4DYVA 1TLTA 2EKPA 4BKRA 3H9QA 3OQ1A 2BELA 1KY4A 2BKAA 2ZCUA 2ZYGA 1X7GA 3MTJA 2CDBA 3C1OA 4GWGA 1YDEA 4K28A 4MKRA 2PNFA 3NJ4A 4IIUA 5IN5A 2W2KB 1XCBA 3S2EA 5A5FA 1I36A 3C85A 5JAZA 1A5ZA 3DL2A 4Z0TA 2D5CA 2WM3A 2NV6A 3LC1O 2I3AA 4BNNA 1BDMA 1NQAO 3VTFA 1HLDA 4FOOA 4RVSA 2P9EA 1CDOA 4XQEA 3CTMA 2X0NA 2O3JA 3WXBA 3TFOA 3GNTA 1K0UA 4CMBA 1ZKMA 4I5DA 2XXBA 1PGOA 4AG3A 1PJCA 1NAIA 1R4MB 3ZU5A 1PL6A 2P2SA 4WCDA 1H6AA 1YQXA 1NR1A 2ZTVA 1KS9A 2A9FA 2B36A 4D3SA 3JD4A 2DT5A 3GR6A 2CVQA 3PDUA 3GUCA 4OKNA 3TZCA 4C4OA 4CODB 5CHEA 3GAZA 4KWIA 1Q0QA 5F5NA 3BMOA 3PHJA 3K73O 3GMDA 4PG4A 4BO8A 2J8ZA 3TL2A 3VKVA 1PQPA 1PL8A 3DQPA 3INRA 2IEDA 3BTUA 3M1AA 3LC2O 3JD3A 3JD0A 5L7YA 3OJLA 2X0JA 5KJEA 3OECA 1TT5A 2FOIA 1UP6A 1ADBA 3VVCA 4R16A 4YBZA 3OETA 2JKVA 5JXWA 1IPEA 3KBOA 3AUUA 4KQXA 3WBFA 4RVDA 2FR0A 4RCVA 4FFMA 4NDNE 1ZUD1 4EUFA 5CEEA 1MGOA 2DBQA 4UUMA 3ZWNA 2B5WA 2J5KA 1VJ0A 4YAKA 3JQFC 4MIOA 4ND3A 1A72A 2I76A 4NFYA 1QLHA 1PJLA 3ASVA 1UXKA 1MV8A 4B4WA 3ZNNA 3QWIA 5TS3A 3H2SA 1UZLA 3JCZA 4LCJA 2Z1MA 4BNZA 2V6BA 2DUWA 2W2LA 1T4DA 3EZLA 4HUJA 3ZNPA 4UEJA 3U4IA 3TSCA 5GZ3A 4BS9A 1WZEA 3PTZA 4DLLA 3U4DA 3T4XA 2W2KA 3IS3A 1L1FA 2DUUA 5JAMA 3HZZA 1G0NA 3PQDA 4URFA 4FD3A 5BT9A 5JY1A 2O2YA 3SC6A 1U4SA 4J2HA 2GN9A 4N5NA 1DHRA 4MP8A 1EFKA 4D7AA 5IF3A 4CQMD 3QV1A 4MVJH 4B79A 3A4VA 3FNHA 4PLCA 4Y6SA 5KKAA 2QRKA 1E7MA 2A94A 5H83A 3HDHA 1ISFA 4YJHB 5THQA 4B3HA 3C7AA 2DLDA 2FR8A 3BHMA 3PGXA 3RUCA 4GKVA 1LDNA 4DPMA 4EJ0A 4CMEC 4XYLA 2EW8A 3JQ9C 3PHLA 3DOOA 1H6CA 3Q2KA 1LA2A 1GL3A 2WWRA 4N18A 1FDTA 4N5LA 3WGZA 4F3YA 3ZHZA 5EIOA 4ZN6A 3RI3A 2Y67A 2R6JA 3P7MA 4U7WA 2BMAA 1PWZA 1U9JA 4BB6A 4FGSA 3PRJA 2A35A 4FQ8A 4PN3A 3AFMA 1DSSG 3PLNA 4Z0HO 4CLOA 1MB4A 1P0CA 4XYBA 4PCVA 3KB6A 4BKQA 1N1GA 1KBZA 4UEOA 3KSUA 3B6ZA 3FBTA 2WJPA 1LRLA 1MFPA 3EAGA 3TNLA 2HMSA 4J1QA 4WCFC 4QFCA 1T2FA 3LU1A 1EBFA 4I5EA 5JC8A 4ALKA 1UXHA 1HYHA 1Y8QB 2QW8A 4LGVA 4QSMA 3PFFA 2ZB3A 4BGVA 3KM0A 4IJWA 2OBYA 1YL5A 2C5AA 1H5QA 1DFGA 4TVOA 3JQEA 5TIIA 3DFUA 1LUAA 1PGJA 4B4UA 5T6BA 4KOAA 1BVRA 3ITDA 4IDCA 5C5IA 3PJEA 5B4VA 4R3NA 2WD7A 1NX6A 2AQHA 3GVIA 3FI9A 4O0LA 3ZWXA 3QVXA 5BSFA 1F0YA 3KUXA 3BMCA 1C14A 1X1EA 2GLXA 1XSEA 3ROKA 2EW2A 2QX7A 5JLAA 1LX6A 5TJHA 4PLVA 2BGKA 4J7XA 2D4AA 1N1EA 2D3TA 2EEZA 2R00C 4ZRMA 3IKVA 3WICA 4CLDA 5BNTA 3DFZA 4ZRNA 5DZSA 3GEDA 1SMKA 1PGPA 2QZ9A 1UZMA 4TMFA 5BSGA 1DOHA 4NJMA 3H5AA 4FN4A 4GAEA 1TVEA 3GHYA 1A71A 3DOJA 1SNYA 1Q2XA 1HWYA 1VSUA 3KYCB 4ALMA 1E3JA 2YHUA 2GN6A 3KXDA 4Q3DA 2PV7A 2AEJA 4BOYA 4L4XA 3JQCA 1ZNQO 4DREA 2C54A 3WQQA 4XA8A 3VH4A 2B83A 1OOEA 4J3FA 3AW9A 2ZCVA 3B1FA 3VDQA 3WFJA 2DVMA 3LDHA 1XA0A 2GN8A 4BO2A 4DA9A 4YT2A 5G4KB 2O2SA 1H9BA 1LJ8A 3E5MA 2X9GA 1IPFA 1C1DA 1MX3A 2AW5A 1NFRA 2VYND 1I3LA 3CPSA 4JCOA 3EMKA 3W8DA 3KHUA 3ETGA 3N7UA 5MDHA 2V7PA 4XD2A 2EKLA 4ALIA 4FJ0A 4MVJI 3WQRA 3WGOA 1W73A 4IXWA 5THKA 2I5PO 2J5RA 2J6IA 4ZQFA 4FGWA 5TRTA 1HDOA 3U5TA 1A7AA 1PJ2A 1HZZA 5ER9A 5BNIA 4FDAA 1IL0A 3TZ6A 1ZEJA 4GVLA 1HE4A 5A4DA 4U5QA 4AFNA 1HRDA 3F1KA 4WCFB 3KSZO 2PKQP 1T2AA 3NGXA 4BHTA 4XRGA 1TA4A 3B1KA 3OIFA 5KNLA 5A06A 5DBFA 1Q0HA 2VHZA 3U49A 4LSWA 2C5EA 1Y9AA 1VC2A 1GV0A 2X86A 3ASUA 4CM3A 1H93A 2DPGA 5G0SA 2EG9A 4YT8A 3ADOA 4WNIA 2B5VA 4RVGA 2X7HA 2JHGA 4E2XA 2IYPA 3WGGA 1LDMA 3G79A 4HKTA 4IS3A 3CSDA 5GZ6A 1U4OA 1V8BA 2VHWA 1N8KA 2HMUA 1E7RA 3GDGA 1IZ0A 2PZMA 3LT4A 5T64A 2YJZA 3ZWBA 1DRUA 3GK3A 1F17A 4LMPA 2CY0A 4W82A 4NBUA 3KTDA 2BRUA 1X7DA 3RCBA 3ANNA 1PZHA 1UP7A 5ENDA 3DAPA 3LT2A 2FWMX 4B4OA 4CLHA 2HUNA 1CJCA 3WGYA 2A4KA 2Y1EA 4J0EA 3VHRA 1LEHA 4XQ9A 4KDEA 2YY7A 3VZSA 4E2YA 4DGSA 3WMXA 5KTKA 1HEUA 1GADO 3H65A 3H9GA 3NDJA 1ZW1A 1M75A 4J7CA 4KUHA 4D3DA 1TT5B 4DPKA 2YUTA 3I23A 3QLJA 3GFBA 4Z9YA 3HE3A 4K26A 4NJOA 2Q1TA 3WGQA 4P38A 2Y66A 5KVVA 1AE1A 1PJBA 1Z75A 3ETEA 1N9GA 4TROA 9LDBA 1K2WA 5DOZA 1B2LA 4D0SA 2BI7A 1PIWA 4Q3BA 4YT5A 3WTCA 3R0IA 1ONOA 1KYQA 1PU2A 3NV9A 4B7XA 1B26A 1E1MA 4XEHA 2FZWA 2HU2A 3KYBA 3BHIA 3PJFA 3V1TC 2GN4A 3KVOA 3LF2A 4JP3A 4NNJA 3LT0A 1GUYA 2DU8A 3NTQA 2O3TA 4UUOA 3PYXA 1N5DA 3H9UA 4R9SA 3GQVA 4FIZA 3QVSA 3I3OA 2AQKA 1GUFA 3ONDA 3L6DA 4NFSA 1QSGA 2WYWA 3QRWA 3KYDA 3IP1A 1DXYA 1B8VA 4IBOA 3RBVA 1ZMOA 2P5YA 1YE3A 1DIRA 2VT2A 3MEQA 1KVRA 1NFQA 1GCUA 3ITKA 1NPYA 3GVXA 4YRDA 5JYDA 4S3MA 5JCJD 1VSVA 2NVBA 2OZPA 1NVTA 2Q4EA 1LTHR 3UICA 2BD0A 3VH2A 1CQJA 4RO0A 1E7WA 2PGLA 1EDZA 2Q1UA 2FZEA 3PK0A 5HS4A 3O8QA 1Y5MA 1P33A 4Y98A 5DT9A 2DTXA 4WLNA 4Y6RA 3FWNA 2GASA 1LSUA 3EHEA 3L4BA 3RVDA 4L0QA 4AICA 3VPSA 4I08A 1ZCJA
chains in the Genus database with same CATH superfamily
5CFMA 2FR8C 2X76A 3N53A 2PKQO 1UWCA 1P2UA 3GJQA 4MB0A 3DWFA 5IM5A 4TRJA 1NE7A 3DHVA 1P80A 3MJFA 1O4WA 1DCKA 2L82A 1YI1A 4BZWA 3CF4A 4WKNA 3MFQA 3TPFA 2HPZA 1UK7A 1H65A 3KT6A 4HDCA 2XOEA 4N6GA 3HZRA 4NCIA 3RGWS 4B6EA 4D8VA 4DJDC 4X3PA 1LV8A 1NN5A 4KODA 3CZCA 4AL4A 1XZDA 3EODA 4LF7B 1NW6A 1PE0A 2PMDA 4WN9A 2F8SA 1FJ2A 4V0MA 1Z2CA 2O7RA 1O8BA 5DGDA 3OFSA 1ESEA 4B17A 4CV3A 3RS4A 2PXXA 4F86A 3L5OA 4UVGA 5M29A 1IVYA 3GY0A 1KYXA 5A7HA 4ERNA 1CLUA 1OF1A 1OXXK 2N47A 3Q9NA 3GD5A 4LNHA 5HKKD 1Z39A 1QRDA 2DCMA 4G0ZA 1PFWA 3WNQA 3QMWA 1BW9B 1X1AA 2FZVA 4M21A 5BSKA 1UWKA 121PA 3CLHA 5D01A 1VE6A 4C0LA 2PUCA 1D4AA 4JH0A 1S89A 3NJ8A 5KVSA 1FDOA 2EXXA 5IYZA 1X7ZB 4OUKX 3GJXC 3QWBA 2W2QA 1E0JA 3KS9A 1G5TA 1RAIA 1D6NA 3N3BC 4JXKA 4PGAA 1DMRA 2B9EA 3PPWA 1YR6A 3ZY2A 4UOZA 3L1JA 3M3DA 3TE6A 1U4NA 4BVGA 2RKBA 1UBKS 4QVIA 1MUUA 4KQ6A 3BIJA 2IRWA 3V4PB 3S29A 1DB3A 4GSYA 4RW0A 4MLDA 1B6RA 1QRAA 2OHJA 4YCDA 3FMGA 5C7YA 2PA3A 2RAFA 4YAGA 1LF0A 2WJJA 1L7EA 3CY6A 3FTNA 2ZU0C 1P7CA 1YZYA 3EEBA 1NWCA 2OV3A 2ZRIA 1TM3E 4IQFA 3ZWDA 2YRWA 3OT4A 3NHUA 1JLLA 1HYEA 1QIIA 3BWVA 3H4VA 4UFNA 3UJHA 1U2ZA 3UBTA 3O4HA 4IM7A 4MCAA 4MQUA 3NBFA 2HQSA 2VDWA 4LRUA 5EJ8A 4DA8A 5DRTA 3T5PA 3TM5A 5J2TB 3SC4A 4YUAA 4I46A 1CYEA 3P2MA 3PIDA 2XYPA 2PX2A 2Y27A 3EXHB 2QG6A 2F9LA 3I28A 3OTGA 4RSRA 2Q21A 3PF8A 3ZDBA 3HUDA 3V1YA 2O0KA 1Z8NA 5C32A 1XRNA 4BO6A 5KB3A 2H2DA 3TEMA 3W9SA 2A57A 3AM5A 1LDBA 4GMGA 5CDGA 3RJZA 1KJWA 1NVXQ 3NEPX 2V03A 3F1LA 3H99A 2QM7A 1MEEA 2R8ZA 2ZJ2A 4H6XA 2UUBB 2J3QA 3ZLTA 3SNHA 1Y4ZA 2HJ9A 3DYIA 1PR3A 2OQRA 4RA9A 2O8BA 5KTTA 3KQKA 1ZICA 1Z7EA 4B7AA 4IZ6A 1ZD3A 3N8IA 4D3XA 3NI2A 4KXVA 3U5ZB 4GOKA 4KH1A 3RG8A 2X1LA 5J4KA 1YR7A 4WKPA 2WUVA 3CMCO 1SVUA 1FSPA 4HXYA 4ITVA 4WACA 1JHXA 1J9GA 3GDWA 2ZR7A 1GDHA 5KNBD 5JWHA 1G3IA 1TZBA 2DQKA 2OK7A 1Y3DE 2G5GX 2VHVA 3ZU2A 4BN4A 1ND5A 1DKRA 2CK3A 4DLPA 5JROA 1R0KA 4CIVA 1W47A 5FNVA 4YLEA 4AJLA 3IEKA 2CVOA 5B6IA 2ZE6A 3EXAA 4I4TA 2VSFA 4KUGA 2HIMA 2JD2A 1YDFA 2MWMA 3GBVA 1VM6A 3D0OA 3MRSA 4LRYA 1EUCB 5DK4A 4MJXA 3AOEC 3DVSX 3FETA 1TCAA 5AWFC 1TMYA 2FH5B 1W46A 2PZKA 3PUWA 4PRKA 1EWQA 1XTZA 1QIMA 1X92A 1XTBA 1QYDA 5C1BA 5K8CA 2HV8A 3EDMA 3C43A 4RETA 3F4BA 3FWHA 4XWYA 4MWSA 3FUUA 2P6OA 2QYTA 3JQAB 3WKCA 4UW9A 3SLRA 2WMNB 3U7EB 3Q6IA 1HH4A 2B4QA 2W0SA 1K27A 4ML3A 1WXIA 1TJYA 3RKUA 3ZLJA 1AKUA 2VHQA 2JI4A 2R5FA 5EIHA 3SQDA 3E0XA 2CBZA 3HB0A 4M1OA 2P9YA 3S2IA 1NNEA 1LWOA 1VRCA 4B31A 3TMYA 2K5UA 2EWMA 3BCSA 2OCDA 1Q0PA 4X8OA 1YCFA 3U19A 3U4CA 4J07A 3P20A 1J1ZA 3CVWA 1SXJB 1G291 3NALA 5CT8A 4IILA 1OLUB 2ZGVA 3H1AA 4M8SA 3UAXA 5F1KA 3QNMA 1UK9A 3IHLA 3IV7A 1RU3A 4F8YA 1EJBA 1KEVA 5AW8A 3LYHA 1SCDA 3AW8A 2WV7A 5ALEA 4XYGA 3K5PA 3Q87B 1W96A 3VHLB 2I2XB 1XTTA 5K3FA 2C5SA 1E6CA 4KE8A 4AMZA 4CL8A 5K0GA 3HI4A 3EXIB 1JEYB 4P8RA 3BJMA 3BG5A 4DMKA 1JHOA 1KAHA 4GRAA 2C4WA 1NMXA 3A3NA 3DZ8A 3T7AA 4X0EA 1TT7A 5AK6A 3T1TA 3TB4A 2Y99A 2EKDA 4PG8A 1NU8A 4RVFA 4UFPA 4LFAB 4U1RA 3AY6A 3AEKA 1KEKA 4RS3A 4XJXA 4JITA 2HWUA 4BKUA 3QVMA 4YV0A 2HF8A 5JBNA 3O4RA 4G63A 1N75A 2IOQA 2WF7A 3K31A 4AS2A 3IILA 4B7XA 4KMOA 4KQMA 3VNUA 3VMFA 3U0VA 4EO4A 2FUCA 4NOLA 1UT6A 4CQMA 1SIUA 5CAEA 1FP1D 2VF8A 4L73A 5C7OO 4BO5A 3FLEA 1V5WA 1UQRA 2IW1A 1GCGA 4BIMA 1PBNA 1G38A 1J70A 1QGUB 4MQFA 1QIKA 3LLCA 1L5KA 4XCQA 4OMUA 3OE4A 4MW2A 1MAWA 1FSFA 2I7VA 3OTWA 1X38A 1O77A 4GPAA 4MKIA 2IL1A 2BISA 3UWKA 2BDUA 3AB7A 3AU8A 3HHPA 3BIFA 5CFPA 4NZZA 1YUMA 4QLOA 1T9HA 3M6VA 2CWWA 1I3MA 4E51A 4MR8B 2FUG6 1GA4A 4CF3A 3UMSA 5C35A 3VJMA 1NPTO 1Q7CA 2XWQA 3JYQA 3KQOA 3OICA 4XPZA 3EVEA 4D4KA 1CB0A 4QG3A 2O3QA 4HWRA 3UWDA 3V2IA 2VDOB 5GGXA 5GOTA 4D1YA 4D9FA 4Q4AB 5AOVA 4ZYLA 1TQ6A 3KEOA 3K15A 2FEXA 1K6IA 4Y8VA 4DG5A 2N75A 3A14A 3ENQA 4O4JF 2D0IA 1U0SY 2E6UX 1XRSB 2QAJA 3BERA 2B20A 3R6WA 2UXBB 3RFUA 2RHCA 2G8LA 3W3AA 3A58B 3CUSA 4O1IA 2FRVA 5E9QA 5LFAA 4RULA 1JQJC 1TVMA 4G84A 1G5IA 2VDQB 3EVNA 4HB0A 4IMJB 3BDVA 3NBUA 5E2BA 3FYUC 3FHLA 3RSHA 4YCNA 2XUJA 2IYEA 2BFFB 2WLSA 1BFKA 3KZ1E 3P2OA 5D3ZA 5SYMA 2ZSIA 5TGZA 5EHZA 2C78A 1EFRD 4L16A 4FFSA 3FW1A 4E5KA 2LD4A 2UZ1A 2ZRKA 3H1PA 3VTAA 4J1TA 1V1MB 1XHFA 2DPXA 4CIBA 1KYWA 4DLVA 1V5FA 4U9UA 4AMYA 1UJBA 3BSYA 3KYJB 1LTKA 2IYOA 3OM1A 2F3UA 2QN8A 3F6EX 4REOA 5LXTF 4DJEC 3T54A 5C46F 5KNCA 3CVYA 3TQRA 3I04M 4ZZIA 2FJUA 1PJZA 3RV3A 3FMOB 4MV1A 4P36A 1PSWA 1RAFA 4GI3A 4HGZA 4OD0A 2XVYA 3DDHA 2BFPA 2KHZA 4HDRB 2AJDA 2PG3A 2FPLA 4AO7A 4E15A 3AL0C 4J9UE 4X8HA 3T4EA 2AB0A 1MHTA 1HV8A 1EDBA 1Z0JA 4KQ9A 3A04A 3ISJA 4RELA 2NX2A 3BJEA 4Q4JA 2B35A 1FTYA 1V3TA 1GPJA 1RRPA 1LC3A 4P2GA 1KC1A 9MHTA 2F3QA 4JLDA 4UNIA 3SQWA 5HCUA 1CPYA 2A9QA 3EXFB 3I8OA 2Q41A 1LDGA 2CSXA 3E3LA 4IDHA 3U4HA 2AUTA 3Q8WA 2HJHA 4AN4A 2P9HA 5HCIA 1SOWA 1KEEA 2DKOA 4BEBA 2VAVA 5G40A 1JU9A 4EPTA 5CT6A 4G0PA 1KFBB 1Z88A 1DIGA 2CKMA 2NOAA 1EJ6A 3DAOA 3DTYA 3RUHA 4CPDA 4EF5A 1CNEA 1GZ6A 1N5KA 1OFTA 3BBPA 3BSSA 3IBYA 4Z9FA 1FDRA 3IHWA 4PLYA 4L76A 1LPAB 3ZS9A 4F92B 4WK6A 3H2IA 1GZVA 3I1YA 3A6DA 3URMA 2ZT8A 2ANBA 2C5BA 3IIIA 3QPVA 4MP3A 4QEZA 2EQAA 4FS3A 3I0NA 1Q1BA 1ST3A 3ZHCA 4EG4A 1OT3A 2O9JA 3IE0A 3ZE1B 4AN1A 2X1HA 2HK7A 1IFXA 1EWVA 1NLUA 2R6R1 2QSZA 2QEQA 4A2CA 2ZRCA 3UCFA 2B4RO 1K2VN 2QRGA 4RDCA 4NCKA 2Z09A 4ZYTA 1N32B 2XUGA 3PKZA 3STTA 3VPHA 2HK8A 5ICCA 4RTPA 3A0RB 1QKIA 1FUKA 1GZ5A 3LZDA 3X2EA 3QTBA 4E0BA 1MHPA 1Z2DA 4MRVA 3N8GA 1D07A 5M04A 3T3HA 1QZXA 4QRDA 5F7ZA 4IXTA 5HFAA 4P31A 1J4AA 1P8JA 1Q1AA 1ARZA 1BSVA 1C9EA 1H3FA 4LZOA 4UQPA 1XK6A 5DTQA 1NBMD 2XVMA 2R6FA 1OASA 2JFHA 2Q28A 1C3LA 5D3MB 3IDQA 4R8SA 2OCGA 4YV2A 4EITA 1TK3A 3W1WA 1J9EA 1HDZA 2PMCA 4CKXA 3MUFA 1XZHA 1HMYA 1PO7A 3G1UA 3NEYA 5BNWA 1DAGA 2QVCA 3DBIA 3SYRA 4AMBA 1YK0A 4BLRA 4Q00A 3GAAA 4JGIA 1FMFA 2D2VA 2VTKA 3PXAA 2HBYA 3QWAA 4X71A 4LRQA 3BHJA 1I6LA 3BZBA 3JWPA 4HDQB 3ZWPA 4W7HA 4HNRA 4MPDA 4ZVKA 4Z4GA 4H1UA 3ESBA 4KDCA 3RS7A 1XVTA 3MQ2A 4XYEA 1N0HA 3CNHA 5FTLA 4KN5A 1TU0A 1P0MA 5H70A 3SICE 4QQ8A 2H2GA 5FR1A 5MGBA 3UGKA 3IGFA 2I2CA 1GAJA 4LUCA 4FFWA 4JBNA 1SOVA 4N49A 1E5LA 3W4IA 4OMFG 4RTNA 3OOJA 2EF1A 2V54A 3KCNA 3RFVA 4EGFA 3RRNA 4G23A 2PFSA 2GEFA 2WD8A 5FBVB 3IUEA 2HIGA 2X5NA 2GPYA 1W5AA 1BA3A 2ZREA 3MWKA 5D5PA 4KJXA 4GPTA 2ZYUX 4XYMA 2WFLA 2H5JA 4XWKA 4AZVA 1PFGA 3X1XA 2FP4A 4MO2A 1JIIA 1CUXA 2JLAA 4PYOA 2QROA 4FEEA 1RCTE 4W7SA 4QXPA 5LP6F 1BA2A 1JR2A 1IE3A 3K1JA 4XLTA 4NC9A 3KJXA 3X1JA 3PQ5A 4UEKA 4G07A 1EK1A 1GP2A 1VCNA 1EHYA 2J30A 1HUQA 3KHKA 2HLPA 3G0GA 1QHEA 4QYMA 4UE2A 4W8HA 5D1HA 1CIPA 1KS2A 2GCEA 3X1MA 3K0CA 1EJ2A 3V7FA 3N0WA 4AF7A 3ICCA 5LWHA 2RH5A 3M4JA 1GPKA 4HN2A 1IY0A 4DJFC 4PPFA 2M98A 3FNFA 1XWWA 1I94B 1YVRA 5FUMA 2NP7A 2IVFA 3G2NA 1YQQA 4ZI7B 2CYBA 2FDRA 3RTAA 2QVGA 3UN1A 2JAWA 4AC9A 1GAXA 5BRJA 3ODGA 1RBMA 2BBOA 1HNWB 1X7WB 2GI4A 3IAAA 3HFRA 2HA5A 3CCBA 4DMFA 3NDPA 4XIIA 3TMAA 2IA5A 1GTVA 1R5JA 3JRWA 4XEUA 2J0UB 2P6PA 4HV4A 1YFJA 3ZVRA 3HBJA 2E48A 2P8JA 3QEKA 4WKBA 5JI3E 4FBGA 5CXUA 2EL9A 1KKUA 1S8OA 4HNGA 4Q4AA 5JLJA 2ICAA 2QRLA 3HB1A 1Y9EA 2QGNA 4TV8A 1M34E 4HYQA 2PH3A 4RZXA 2NSHA 3PS9A 2FMFA 4DA6A 1VLZA 2X19A 1M67A 1SOMA 1VG9B 1QHHA 4GXNA 4ZQGA 4EATA 1YZQA 2HADA 4PXAA 3Q8LA 3EEFA 1MC1A 1N7IA 3EQZA 3GLSA 3ILHA 5EE0A 3TBKA 3ZHQA 1T2UA 1RD4A 3UCEA 4D9KA 5CHYA 2GPAA 5DM2A 4R9RA 2CB9A 2NUAA 2VIIA 5B3JC 1ZK3A 4S04A 4WV3A 1GRQA 3LXUX 3KQYA 1MXFA 3RD5A 2H1SA 1LB1B 2O7VA 5FF9A 3E9QA 2ODAA 3FNQA 3HJRA 3DT6A 3GRPA 3RRZA 3VYSB 2XI4A 4MA0A 3UJBA 3TAXA 3KVVA 1RJDA 2HJWA 4A5OA 3AF1A 1XGKA 3NIGB 3OQPA 4NNOA 3SHOA 2JA1A 4LY6A 1BU5A 1J49A 4FYIA 4A9AA 1L7DA 1HG1A 2RGNA 2KLHA 4ZO6A 4L74A 3A3YA 4MWTA 1FFEA 1VI6A 1R4AA 2ET6A 4PCAA 1F12A 4Q0MA 5K8VA 3OC0A 4J4TA 4DUYB 4KSCA 3ZKWB 4ZAYA 5BMVA 3BWEA 1AVTA 4F71A 1I6WA 1FQJA 1KK2A 4CBVA 3AG5A 2B3TA 1Z2PX 4KQHA 4B2PA 5JARA 1TYEB 1JKMA 3PHHA 3JWHA 1A9YA 2H0RA 3RROA 1A4XA 2P9JA 1Q84A 2PS0A 4ZZ2A 2IYQA 1SCIA 5TE9A 3UM9A 3O9MA 4UVEA 1DBIA 4TN1A 1HQKA 3GUUA 3OP1A 4JK3A 3L46A 4Q1VA 4P4GA 2WKWA 3CEHA 4QYIB 4TUYB 3VU1A 2NW6A 4TLDA 2OP1A 3QQ5A 2W9XA 2B8EA 1T2EA 3E27A 1XQYA 3IMFA 2C2MA 1JUDA 4W5HA 5K5EA 3E9YA 3RABA 4C04A 5GONF 3OTHA 2DETA 3C39A 3ZBPA 5AKEA 3FCCA 1TM4E 2I6QA 4GX5A 4KFUA 1EP1B 4M9CA 3AR8A 2QRVA 3CEAA 4RENA 1XTPA 2WWWA 4FSXA 5D3MA 1BXZA 5G3YA 2GH1A 2DFPA 2AMFA 2IH4A 4GOMD 1TKCA 1KI6B 1ZU5A 4TVBA 2EQ5A 4WKGA 4Y1RA 1UBCA 2H8KA 2IYTA 1SFRA 1C2YA 1SY7A 1Z6ZA 4UCWA 2IUYA 3OMLA 1PNQA 2QYSA 4P98A 1QVWA 4JC4A 1ANKA 4C6TB 5K8LA 4Q82A 4B6RA 4BFXA 1J5XA 3LP6A 3UMRA 4HNAB 4JI4B 2YQ5A 4OFBA 1UBGA 3WK4A 1WA5A 3I5UA 3W8NA 4LOJA 5EZYA 3DV0B 1K89A 1GFIA 5TMPA 3G49A 5FCDA 1E2NA 4W5OA 3MGBA 3NEJA 4WNCA 1GPLA 4BNHA 5YASA 5FWXA 5IM4A 1JA0A 2HCTA 4G9BA 4QGFA 1YQGA 3GUHA 3OZAA 1DIOB 4YP5A 5K6AA 2QTHA 2Y1KA 3ONNA 3DFMA 3DZHA 4KUEA 4E1VA 4TTAA 2NU7A 3QA3E 4AKHA 1ZUNA 3X44A 2IV7A 3JQPA 4GUAA 4RFLA 3T0IA 3J7TA 5DW0A 3GJ6A 4BMYA 2JEOA 3PJGA 4RABA 1AXGA 4RCZA 3NHKA 5AUQA 3SHFA 2JAXA 3OZGA 1NJ8A 1VIDA 2QRNA 3BJRA 1M3SA 4LNAA 4QFDA 4UAJA 2CNBA 3VYTB 4AO8A 1ATIA 4BTLA 8ATCA 1T5DX 5M3BA 2XBUA 3F5QA 3PVCA 1V5EA 3RAGA 1FS6A 2P1RA 5SY9A 1KFKB 3I9KA 1P3DA 1MH1A 4I50F 2P7HA 4LJLA 3VSDA 2G17A 4JR2A 2YNMA 4ER0A 4L0MA 1YS6A 4GE0A 1Z13A 2LKDA 2J5QA 4LSMA 5CB4F 4FKMA 2YYAA 1LSJA 1XLTC 3ESCA 5B58T 4Q1CA 1NJ6A 3P9KA 3TKLA 3W5VA 1A82A 1EP9A 2H0AA 1MCZA 3PUJA 2BBSA 5JVDF 2C97A 5C5DA 1QG0A 2M32A 2X13A 4YJKA 3RS3A 2Y0EA 3GFSA 2OC9A 3IXQA 4I4TF 2PWZA 4I4IA 5A3VA 1Z26A 3IPXA 4GOJA 4CG3A 2CL7X 4ENRA 2OFXA 1N33B 3G1WA 1JSCA 4P82A 1CX9B 2XUDA 2CL0X 3DKIA 3CB2A 5E1DA 3VNRA 2XB4A 4ZCMA 2QP9X 2O14A 3I1JA 1JAYA 1F4PA 3RB8A 2G82A 1NT4A 5F1PA 4F3TA 3PQ8A 1U8CB 2X4LA 3OX3A 3QZUA 4IEFB 4IIJA 1PV2A 3GWGA 5BV2P 2QTVB 5JS7A 1ZYUA 5C4IA 1NBMA 5KWJA 4HATA 3TIGA 3GP8A 1T8UA 3UXHA 5K3EA 2X8WA 3U3XA 3VDRA 3LGAA 3M4ZA 2I22A 5DEOA 4ZI7A 2BGNA 2OXFA 3LX8A 5F78A 4HNSA 2C04A 3AEUA 3AIIA 4IMRA 4PNZA 5L4NA 4QU9A 2YTZA 2FSUA 5IYZF 1XRRA 3RSZA 2G36A 4DKXA 5A4IS 1Y3CE 5LQAA 1ZWKA 1QKKA 4RANA 1RQGA 2XWPA 2P4QA 3GEEA 1QO0D 4CNQA 4A27A 2H9IA 2O3SA 2R0QC 2EHDA 2FFBA 4RF2A 3OZEA 3VHXB 3G5UA 5AD1A 1HTBA 5GIOE 3KETA 2Y2VA 5AKIA 1NXTA 3A8TA 1EKXA 3DF7A 4IYJA 4R69A 1RWKA 2ROQA 4ZVNA 3UFXB 4FIDA 5T8KC 4K0RA 2CT8A 1GPMA 3ZCXA 2ODEA 3SHTA 4ARZB 1TF2A 1ZL0A 5C5CA 1T5HX 1BE6A 3DZJA 1D6SA 3INTA 1YRAA 1N3BA 1T5OA 3A6EA 4MIYA 4MAFA 3AL2A 3K8YA 5CK5A 4O25A 5CGZA 1TQ8A 2BFCA 3T94A 3FGNA 3BXXA 5AJYA 3E3OA 1QPGA 1QIGA 5JSKA 3U4MA 4QNMA 2BDTA 2YY6A 3M82A 3GEGA 3ZH2A 3S55A 2BM0A 3DQQA 1YIAA 1BJRE 1I4LD 4F5ZA 2WQZA 4V3BA 4YAEA 3NWEA 5K03A 4KBGA 1WOYA 4JLMA 1V6AA 4L0CA 3PV0A 3KJNA 4Z7OB 2CEKA 1VQ1A 3H1GA 4KDFA 5BUCA 3I4FA 1TJ3A 3NIBA 1O94C 3G0IA 3KT3A 2JATA 3NTRA 1FJXA 5CMLA 2H1WA 1TUBB 2IS2A 1II0A 2I6UA 1FP4A 4MV0A 1JAZA 1BE1A 3ZHRA 9LDTA 3PUHA 1L5ZA 2FP4B 4M86A 2JAOA 4U7FA 3DTVD 1FNDA 1U0BB 1XMJA 3BMNB 4S24A 4K8OA 1QCZA 1YGYA 2GN2A 3EG9B 4J6EA 4JVOA 3ZJ5A 4BTVA 5DSZA 5BYKA 1OMOA 1YBMA 2RK4A 3ESAA 3HDGA 4IV5A 2BHTA 4ZYYA 3SYTA 2WHQA 4QTUB 1ZH6A 4UNNA 1JLRA 1OLUA 4DA7A 5C7LO 1W0KD 2FI1A 1CRWG 1HI9A 5I01A 1XL0A 2QQFA 4HSEA 1NI4A 4BLPA 1O6BA 4WN3A 1IM5A 3CPHA 3GUZA 4Q7MB 4KAJA 4FTWA 4X1KA 4OI0A 2FF7A 3F6SA 3FZNA 4CW7A 5CA0F 1OH6A 2PRKA 4R83A 1I51A 2X7JA 3C3CA 4Q4CA 1JF8A 3BB4A 3LAWA 1AHNA 3C4QA 4TMXA 1NUSA 2H1RA 4DSZA 1YB6A 3UK7A 4TV8B 3TSOA 4CM5A 4O4JB 4BB5A 1B73A 4YJFA 4QBIA 3T1VA 1VLVA 1Z0UA 1EE9A 1ZIDA 3JAMA 3HJNA 2A9PA 3V48A 5EN4A 4PTZA 4NESA 5F52A 3W5UA 5I9BA 1JKJA 1WDKA 3DEZA 3KKPA 4J90A 1MG5A 4N5HX 4AJ9A 5BPFA 2BJVA 2IXEA 4OBBA 5F98A 3X1ZA 4RCYA 1L0BA 4RGQA 1PX2A 2G1JA 3KFXA 4N6OA 4ZVUA 4PQYA 1QF6A 4A2WA 4PO8A 2WBLC 2R84A 2ZXEA 3E22A 1OGYA 2FWRA 3DFKA 4GOLD 2XGSA 4XX1A 4Y2GA 3T52A 4BNDA 3NT4A 1PJQA 4NJEA 4D43A 1F8FA 5FPHA 2DFLA 4B5LA 4F9FA 1JHAA 4A26A 2CD9A 1WXFA 2OE2A 3DAYA 3F4LA 5CVTA 4PG7A 2OYRA 1KARA 5IAKA 3TDMA 4RMJA 2IYAA 2ORYA 3ZYZA 4MVCA 4X44A 3HG7A 4PLHA 2YINC 1W6UA 3LBIA 7GPBA 3AKDA 2J3JA 3IRVA 3ZOZA 3K96A 1B6TA 4MSUA 2VSNA 1ZSYA 2V4UA 3OMXA 4JWTA 5KX5F 4H08A 3OUUA 2FFHA 5JZBA 4GGPA 2QNBA 2ZLBA 3I6ZA 1XNHA 3DHNA 4UBIA 3DPUA 1YS9A 2B4KA 1FFDA 2YWBA 3LH5A 4KIGA 1I10A 4KIUA 2D2IA 3CURA 1SQSA 4KXNA 1DEXA 1PFKA 1Z6TA 1AC5A 5KYVA 4PINA 5K6TA 1M8GA 2VP9A 3OBBA 3JZIA 2PIDA 3LCJA 3UJ8A 2QQEA 5EUQB 2Z9DA 1LWNA 3QVLA 3IAFA 2NU8B 1AH2A 4DLSA 2O1EA 4D81A 4K88A 1ULAA 4YJDA 1DP4A 3JYOA 4S1PA 1STOA 5EXPA 3TQIA 5BWCA 2AN9A 5FPPA 4ENVA 1W29A 1N25A 4HAXA 4HLUA 3RNOA 4HVLA 5GWXA 3WLNA 1KU6A 3DEKA 1S3FA 1H8HA 2OOKA 3LDAA 4ZMBA 4WGGA 4Y18A 4GP9A 3V32A 4CGZA 4DQDA 2EC5A 5AUOB 5B30A 4EUEA 3SG0A 4F4FA 4QOIA 3JQ6A 3M81A 2AYZA 1PWXA 4YMHA 5ED0A 4LHVA 1B3RA 4HL6A 1HDIA 4B71A 1UADA 1N9GB 2RHMA 1P1JA 3AEQA 1I4EB 4AZ3B 1WNTA 4D8XA 1FTGA 3L02A 3PI7A 4ZYVA 3OZIA 1Y1SA 6Q21A 3SHQA 1BE0A 3IAXA 1SU7A 3I6IA 2PBZA 5B1SA 4IVPA 4FFPA 4D79A 1ZIOA 5HQTA 4HB2A 4RBNA 2H7CA 4D80A 2AJBA 4YMUA 4C4AA 5B55A 5CVEA 5HKLA 4EZEA 5CPBA 4I4LA 4U0KA 4Q9IA 3UKDA 1B0AA 4EGQA 5BNZA 4N8EA 3ZXUB 3C7TA 2YJGA 1A8HA 2OP0A 2Z2XA 3O7MA 3GT7A 5JXIA 1WY7A 3AVQA 3WB1A 2JJ1A 4FSHA 1SG9A 3D9QX 5GONB 4ZVRA 4HCJA 2XTAA 5J5CA 5JO9A 2R7KA 1J0XO 3NM5A 2MYNA 1A2KC 2V7QA 5KSOA 3MTGA 3HWWA 3O94A 1T9ZA 3NKVA 3F8TA 3UWOA 2RB5A 1XTUA 2P4HX 3OIGA 5I7EA 1E58A 4QSHA 4Y2JA 3DMTC 1O5IA 2EAUA 1K6MA 2B98A 2SCUA 1U6JA 3UHAA 5CDUA 4KIFA 2O7QA 5EIFA 3BJZA 4D4IA 1K5PA 3RYFA 3C1AA 1A88A 5CR9A 2OGZA 1BCRA 2X8BA 3ZTYA 4ENPA 4PLPA 3K0HA 3GLUA 4N8DA 3G17A 2J4CA 2H7YA 3K9CA 1RHQA 4D82A 4EJ2A 4ICIA 4YMLA 5JMWA 4MUGA 1YR1A 4KXWA 1EXDA 4KFSA 4H16A 3EDQA 5LMUB 2OZEA 1MG0A 2G83A 3EBPA 3QELB 2OZKA 3B8HA 3BX1A 4P3NA 3PLRA 1EFCA 1JSRA 5FOSA 1Q1EA 3OCXA 5AXBA 4PVDA 5CAEB 4ENTA 1ZX1A 3RASA 2RG1A 1Y4UA 2YFYA 1R6VA 3R5FA 1YGPA 2C3MA 3HJFA 3D4LA 4I9NA 2JHAA 5D8DA 3VGJA 4RNDB 3GXOA 3P9RA 5DX8A 4QHSA 4P54A 4JODA 3WGVA 4AG6A 1Q44A 1AUXA 3SS7X 5JH7A 2FZ5A 4M8KA 4EF6A 5JCXA 4P84A 4FW8A 3R24A 1U02A 4EA7A 2G77B 2C2XA 4OHMA 1MAUA 3CF4G 1KRXA 1D0IA 2A30A 5U1PA 3HCCA 2V9ZA 3JQ7A 5G2OA 4G8CA 2ZJ0A 2X9LA 1RYEA 1P5FA 1U2GA 2YWHA 3OJOA 1ZD9A 3D3QA 1UDBA 3EASA 2W5UA 1KY2A 4LWZA 4TKMA 3SFVA 2FLVA 1B3BA 4QJIA 4WXEA 5K0CA 5LQUA 1C1DB 4AXXA 4B82A 3H2GA 1LKZA 2E21A 2WF6A 4L5JA 4QXOA 3A36A 4M46A 1D5CA 4RXUA 5TMDA 1VPLA 1SULA 4UDOA 1A69A 2IP4A 2SNIE 3BTSA 4XD7D 2Y6UA 1AX9A 1C7EA 1NWHA 5CJPA 5F7OA 4JI8B 5IP5A 4DM4A 3P9XA 3DBHA 3LP8A 3NJRA 1ADCA 1AF7A 3MJVA 1T1EA 4WXPA 5HQ3A 2JFWA 1SKBA 2XE7A 3PDWA 3PKJA 4GC5A 2IHYA 4XTRA 4YJ2F 1KSJA 2C9MA 4Z1OA 4Y6OA 3NUZA 3K35A 1D2GA 4O5AA 3ZEAA 1LNZA 2MSCB 5IUNC 4CHGA 1N4DA 3QUSA 1U99A 2X9NA 4M9SA 4ISBA 5IKOA 2OL4A 3PRKE 2ZAOA 2CVZA 4WX2B 3RC1A 3LUDA 4DY4A 4QU5A 2PH5A 4GX2A 4Y0NA 1EDEA 4FB5A 3IBGA 5AM3A 1QE3A 4OQ4A 4OQYA 3NYQA 4JSRA 4CLRB 3BXPA 1Q22A 3EC7A 1ZXBA 2DH6A 3NS7A 4EYQA 4JI0B 2WHYA 3BWDD 4GYWA 2DTDA 5T8KA 4L51A 2NTNA 2XB6A 4PYQA 4QOHA 1A4IA 1KF0A 3CCCA 3HA5A 3T34A 3K53A 3GARA 4Q48A 5T4HA 4OHCA 5EMMA 3CUWA 4C0SA 1JFLA 3NT5A 2ZSJA 5EERA 5KOIA 5KYKA 2OQIA 4C0KA 5CRIA 2C4KA 3W5HA 3LYLA 5AKXA 5BQ5A 3ZY3A 1Z74A 4XDZA 5ECDA 4DCVA 4TYPA 1BEZA 2Q6KA 2ZZKA 3N2EA 2UZAA 3C7KA 4KPFC 5E1MA 1DS6A 5DHQA 4ZIRA 3PCRB 5DWQA 1ISPA 1E4EA 1GYPA 4CMHA 3S2ZA 1LBSA 4GF5A 4CDGA 4OKIA 4EI7A 1B1AA 3B5IA 1WSAA 4ZARA 1EVIA 4JMLA 3ZCQA 3ZX5A 2ZUCA 3ZI0A 1TM1E 1MO5A 1ZBQA 5DHSA 3ZK8A 4S0ZA 2ZIAA 1NJFA 2JLBA 3TPCA 1DKLA 1M2VB 3TTSA 5IZCA 4DRXB 3IUNA 3KJIA 2X0DA 2CXHA 4MAMA 1F20A 1M8JA 1XTVA 1H22A 1F6BA 4G9EA 1DQPA 2AN4A 2Q45A 3L07A 4D42A 4BAUA 4MK4A 3TSYA 2QIOA 5AIBA 1C0PA 2VLBA 3ZJYA 1VB5A 1M7GA 4Q02A 1UK6A 2UUCB 3BWMA 2R9VA 5JFTA 3AVUA 3EG5A 1TI7A 4F60A 3EVZA 2VZEA 4RYLA 4IOJA 2GS9A 2B78A 4IFIA 4J0IA 4R1PA 4L2IA 5F64A 3W2GA 4HH4A 2NAFA 1ZNWA 1RC8A 2WT8A 2OBMA 4WUTA 3OTQA 5JZVA 1MAHA 2VBIA 1K5DA 3UJPA 4JAVC 5KYUA 1C9JA 4IV8A 2GXAA 1GTZA 4FYKA 4U6SA 4ZVVA 1VHJA 3SKVA 4CGYA 5FV4A 4Y1FA 2HHHB 2DAPA 3PRYA 3PXGA 3B9QA 4KGVA 1M72A 3KKZA 4CF4A 4WCVA 2BUCA 1NBAA 4J76A 5DK6A 1W5SA 2NV0A 1P2FA 2VF7A 1EBBA 2J7PD 3DW3X 1YVUA 4YIHA 4RF3A 1JJFA 3LWZA 2YR0A 4PBSA 1BHSA 1I2DA 2IHTA 5DNEA 3T1NA 3PL5A 2BEVA 2KBEA 5FB3A 4KMRA 3KB8A 3ZZMA 2QZZA 3I6MA 4YONB 1BX1A 5LVAA 1DBVO 1L1QA 1EUYA 3HABA 3DTTA 1Y33E 5G0WA 2AL7A 2EFHB 1FU8A 3JSAA 3WDKA 1Y4SA 3KV3O 3NVMB 4NRDA 1Q0TA 2F1JA 1BVUA 4PONA 3RIMA 5JBIA 3V8VA 4CM6A 4JENA 2PWBA 4OQZA 1YO6A 3GIDA 4MVJF 4G1BA 3AXSA 3HA7A 3U3OA 2XUPA 1TZCA 1QYCA 3MWDA 4FWBA 2IWRA 2I2DA 1XBTA 2HPVA 1V3VA 4MWEA 1YXMA 1OUMA 4FCVA 1NF2A 1F0NA 5D1NA 2W6PA 2HDHA 4D9CA 2HEIA 1EU1A 1VZ3A 2WG1A 4OLHA 4RMIA 1SUIA 4PHTA 4B8ZA 5I7WA 3G89A 2REOA 1FCJA 1E3IA 3KNZA 4LXIA 4YCBA 1HK7A 3W6PA 3TUZC 2HMTA 4E5NA 1COWD 5A1TA 1EX6A 4ZT7A 3R75A 3FDJA 4DNXA 1RYMA 1LPNA 3UK1A 1ZD5A 1XZJA 3FWKA 2FOXA 1UBOS 3W1EA 4YMTA 4P1ZA 1QLJA 2OXEA 3ACBA 4BX2A 2C8KA 4G1MB 2LKCA 4KYIB 3KR9A 3FVQA 5EZYF 1KSGA 1K0FA 1FRQA 1RRMA 1XVUA 2Y1FA 1N2JA 1QR2A 1QDLB 2Q6OA 1J0AA 1N2CA 2ZRMA 4IINA 1Z06A 2ZRBA 1EFPB 3L9WA 2PX3A 4KQCA 3RC3A 5I5EA 1NNI1 3TNYA 2OMEA 5BVHB 4NBKA 1OCEA 3UFBA 2BFDB 1JALA 2A58A 4OXXA 1OH5A 4DDMA 4L8LA 3RYIA 3COPA 3V9PA 1DUIA 1ISJA 4AP5A 1A9SA 2GMWA 1SAYA 4JBXA 4R8LA 4L08A 2PJZA 2YWEA 1CK4A 4HXGA 5HIKA 1QTIA 3K2QA 4U7DA 3B9BA 4V0LA 1B74A 1U5AA 1OBFO 3CJQA 5KDLA 4IICA 1HT3A 1V2HE 3RVQA 1T8RA 3UT5B 4EGSA 1YR8A 5C4MA 4LSZA 3QUQA 1CVRA 3COSA 5GONA 3CRQA 4II7A 5HPYB 1XZEA 4UJ3A 5BT8A 4X65B 3DONA 3TLGA 2PK3A 1E3QA 3ZW7A 2ERXA 2QRZA 3D64A 4QLBA 4KQJA 5ILOA 3DAHA 4P4UA 2YJ4A 4CHTA 2VL7A 3KPUA 3PWZA 4OHVA 3ONFA 1FNNA 1BNCA 4YP7A 2C31A 5HM6A 4OYHA 1FX0B 3KTAA 1D1SA 2RCYA 4UU1A 3OPNA 4Y9TA 4C0AC 5FWNA 2OYSA 1B8PA 4MRSA 2F55A 1K7XB 2W6MA 4LBWA 4JI6B 3VR4A 4O5OA 5B2FA 3QVUA 2P9TA 5MN4A 5IWAB 2VQEB 1XQVA 2F7SA 1F4VA 2FN3A 2IYFA 2WIBA 4N0PA 2E82A 4S1TA 5JC1A 3FCUB 5JPCA 1U2RA 3GJ8A 4B3RB 1GLGA 1BRMA 2A1TR 2G72A 5H4HA 4EJSC 4EB8A 5K8JB 2ZSDA 3QWFA 1II9A 3DMTA 4M7WA 4A8JB 5BVGB 3JWEA 2R2AA 1GR0A 3ORFA 4F1WA 1IAVA 2R11A 2X3YA 4DWJA 4TYNA 4WH0A 4IDBA 3UPDA 2IDKA 3DC2A 4W5JA 5J9FA 3H0EA 2DMRA 3DOUA 1YJ5A 1L1RA 1UL1X 1ZZGA 1ATZA 4J0QA 4R7GA 1DC3A 1NG9A 1OX6A 5KYGA 1WMDA 1GTMA 2XKAA 1XKTA 2PWPA 3CNOA 3E9EA 3M5PA 1GXSB 3RIHA 5F23A 1BS2A 3UC5A 5J58A 5E0OA 4R4JA 2AF3C 2H7VA 4B2YA 3CZ5A 4XSHA 5EKUA 2FN7A 1YFLA 5BWMA 5BOSA 2GPTA 2A0YA 2OHHA 5BNFA 3GEHA 4EYOA 2XADA 1IHXA 1X14A 1YL6A 3IEXA 3LPLA 3ORHA 3R0ZA 4IVRA 2B4YA 1A50B 4YQYA 4ID3A 3A6LA 1SBIA 3AVWA 4KZPA 1KO4A 1M76A 1C0IA 5AK4A 2VP0A 2FK7A 3L7AA 1OIWA 4I1UA 4ZCRA 1L4LA 5JDIC 3I58A 1GTSA 1K8QA 3PUIA 4KVAA 2ZJZA 3EGOA 2HC9A 2JFYA 3UTDA 5A4KA 4RTOA 1YA8A 3KLPX 1N5MA 3ZWWA 2PLWA 1P8AA 4AQ7A 1XQ6A 1FMCA 1TU3A 2JAQA 5FBQB 2J5XA 4FKZA 5DCYA 3S2YA 3K9BA 1B43A 4ZT6A 2VJAA 2RKOA 3GJYA 3NANA 4CIWA 3NUQA 1GCIA 3HB4X 2FPMA 5ALJA 2VTBB 1GU7A 2OB1A 3DDCA 1EK5A 4H2DA 1SC3A 2O1XA 2NG1A 3W6OA 4PC6A 3RU7A 2C88A 4Z1MD 3SF8A 1EX1A 2C00A 4RKFA 1VA5A 2JVIA 4PY2A 4PO3X 2IEZA 4HADA 1HRKA 3A1UA 8ABPA 4WNAA 4CCYA 4PIVA 3L0SA 1USWA 1OFVA 4JBIA 2EL7A 1ZONA 3NEAA 2KE5A 2CLHB 5CLGA 4PICA 3W6ZA 4G4IA 1KMMA 1UDXA 4ZK6A 1TM2A 1R6DA 2BHRA 4ZWNA 1EXVA 5DTIA 4JDPA 3I9OA 2JCXA 4MRMA 3VM6A 4J0JA 3F73A 1GV1A 2FZGA 2HK9A 5KSPA 4H1VA 1D6JA 4A23A 4BO7A 1JN0A 2P79A 4N39A 3NX4A 4E32A 1NI4B 1PNVA 4R01A 4IGFA 1IXYA 2Z2IA 4MWOA 4CCAA 3RKRA 1CLEA 1X77A 3FN4A 2VPYA 3VPXA 4WLOA 1OILA 1JLMA 5B7PA 3X1KA 4UDNA 2IHKA 3SY8A 2NMVA 1TQDA 3G9XA 1PEKE 4E5MA 4KKVA 1LZLA 1MAAA 1Y4DE 4MYTA 2GBFA 3DPIA 3L05A 4GXTA 4IDEA 2FLWA 4II2A 1DLIA 3QYAA 3L8HA 1B0UA 4DMRA 4HQFA 1F48A 3V3KA 1PZNA 4FU0A 4WZAA