4CQMD

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
247
Chain Sequence
SQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 247
sequence length 259
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmD00
1RM4A 5DOVA 3DL2A 2B4QA 4O0LA 4NHEA 4YR9A 2EJVA 2OXIA 4Q3EA 4E13A 3RBZA 1RM3A 3GNSA 4D42A 4OKIA 3GGOA 3VOSA 4OXKA 1LTHR 1PGQA 3GMSA 3LF2A 5CDUA 4E31A 2HRZA 4INAA 1ISMA 2DM6A 3IKVA 3PDJA 4TRRA 4WOKA 1QYDA 5JPIA 4AJJA 3H5NA 2YFQA 1J5PA 4FPXA 1E6UA 4RLHA 2F1KA 1QYWA 3QWAA 4PG6A 4UEJA 3RUEA 2EIHA 4CR6A 3OEYA 2PKRA 4N5LA 5ER6A 2Y1GA 1LC3A 2QIOA 4IS3A 3BMNA 4O59O 3JTMA 4FCCA 1RYEA 2YZ7A 4PLYA 2IEBA 2WTBA 2JFGA 3IIEA 4MOWA 2YY7A 3D0OA 4AJ1A 1TI7A 4N5MA 3VPHA 2X58A 4IMRA 5TT1A 5DDIP 4NJOA 3ZI0A 1DJQA 4IQGA 1JWBB 4E21A 3F4LA 4UUOA 2RBEA 3I9MA 3DAPA 4LVUA 2J6IA 3EY4A 1N7HA 5TQVA 4Y6SA 5JS6A 4LMRA 4D45A 3ZWXA 5ICSA 4UVEA 2AXQA 3ZWYA 1C1XA 3ENNA 1KVTA 3O38A 3KHUA 2C82A 3U0BA 3UAGA 2D4AA 4KDFA 4FFOA 2O3JA 1HDRA 4DPMA 2NQ8A 3AFNA 2C20A 2GR9A 4XJSA 4DUPA 1JKIA 3DBRB 4RF3A 5F5NA 1H6CA 3L6OO 1WW8A 2HAEA 2FWMX 1HLDA 2NVWA 4JP3A 4NG5A 9LDBA 2X0JA 4A73A 3A1NA 1E7YA 3OH8A 2I5PO 3L9WA 3FRJA 1SCUA 3DZGA 1GQQA 4TRNA 5CEJA 4BGUA 1W4ZA 2VRBA 1DIAA 1YWGO 2FHSA 1PJQA 1IPFA 5IXYA 2UUPA 4CLXA 5FYDA 4PLHA 3B1JA 1ENOA 2EGGA 3BMQA 1YOVA 4BKOA 2DC1A 1L1FA 1JU9A 3UVEA 4B3JA 5IZCC 5B37A 4KUEA 4MPDA 5TSDA 3ROQA 1PJ4A 3AK4A 4BGVA 4L75A 2Z1NA 2ZB3A 2PNFA 3OECA 4AVYA 4GGPA 3ROKA 5F1OA 2GLXA 5G4LA 2VHWA 1V3TA 3DMTC 1ZK3A 1XYGA 3LVFO 4E33A 4KTTE 2AEFA 2Y0EA 2X5OA 2BD0A 1KEVA 2YV2A 2QZ9A 4YJFA 4CR8A 3CSDA 3W1VA 2D1YA 4MVJF 4DIBA 3IDSA 1PZFA 3JQBA 3WBFA 3BTUA 4B4VA 2ET6A 2CNBA 4M54A 3SJUA 2CUKA 3I9NA 4BIIA 4XJTA 2PGDA 1E3WA 4DA9A 4XKJA 1Z7EA 4DIOA 4GWGA 5F1PA 1NVGA 5BNTA 1GPDG 5H81A 1ZNQO 4WNCA 5CHEA 4RQUA 2DBRA 2DPHA 2GGSA 2ZYAA 3DO5A 5JW6A 2W2LA 1PZGA 3PQEA 3VH1A 3RUIA 1QV6A 4ALNA 2W2KA 2WD7B 1KOLA 2QW8A 1WAMA 2X0NA 3RCBA 4E2WA 1FDVA 1HDYA 3HJAA 3K8ZA 1QLJA 1N92A 4I08A 4Z9YA 2NADA 1A9ZA 5JFOA 3ASVA 5JAQA 3JYOA 1NAHA 1ZH8A 3ROMA 3DTYA 4FC7A 3ZH2A 3ZV4A 3E9QA 1YL5A 1LEHA 4CM8B 3PWZA 3H4VA 1I8TA 1GEGA 2CF5A 3KLMX 1IB6A 4CLHA 1DC5A 2O3SA 4CQMD 2Q45A 2VWPA 3GRPA 4UUPA 3GHYA 4EYEA 1P0FA 5TRTA 4MP6A 4Q3CA 3QVSA 4PLFA 2H9IA 1HSZA 3INRA 4B4OA 3FNHA 1U28A 2BFPA 2Q2QA 4TSKA 1HKUA 4K6CA 1I3NA 4RF4A 4B4WA 5C7IO 4HV4A 3PHLA 1D8AA 1UXHA 5KJ6A 5L7TA 1GCUA 4AFNA 2BMAA 5I7FA 3BTOA 2VZ8A 2X1HA 1DB3A 1U5CA 4FOSA 1NAIA 4YWJA 1Q7GA 5JY1A 4EJ6A 3C7DB 1CIVA 3JV7A 2AG5A 2DQ4A 1QV7A 1F06A 1GZ4A 1SB8A 3Q2IA 1GYQA 1N8KA 3V1YA 3CMMA 1JTVA 4EDFA 1A5ZA 3X2EA 3DOCA 1KBZA 3TZKA 5JC1A 4NI5A 1H93A 3S55A 1EVZA 1PTJA 4BO3A 1EZ4A 3RSHA 4BO9A 3NDRA 3PGXA 2DT5A 3KRTA 3AY3A 1EBFA 3S1LA 3H8VA 3N74A 5DT9A 5A02A 4J9UE 1NPDA 4OAQA 4FFNA 1M75A 2GN9A 4DPLA 4M8SA 3ANLA 1VSUA 1ADBA 2EHDA 5I9MA 5DCYA 1J0XO 4QTZA 1N1EA 4P4LA 3UN1A 1DFHA 3GMDA 4CMIB 3TN7A 4DBZA 1E3IA 4XQ9A 4HNHA 1EFLA 4PLWA 6ADHA 1RKXA 3G17A 3ZNOA 1LDEA 4TWRA 2Q1WA 4ZU3A 1IHXA 2HK8A 3B20A 3HSKA 4XRRA 4MVJI 1PQWA 1PZHA 1MFPA 1B3RA 3QY9A 3DWFA 3LSYA 4ALIA 1ZJZA 3QJ5A 4IDFA 3ZDFA 4A2CA 3C1TA 3GF4A 4WASA 1PGJA 3OIDA 2OP1A 2GD1O 2IODA 1NWHA 1Y6JA 4JJGA 3TZHA 4CLDA 4B7CA 4CQLA 2J3JA 1P1JA 2XAAA 1R66A 4OM8A 3WIDA 4F6CA 3VVBA 4UVIA 3RD5A 5L45A 3D4OA 1BGVA 1PGOA 3WGQA 1YJQA 4CPDA 2TMDA 3JD1A 4GH5A 4WUVA 3WGTA 3OSUA 3B6ZA 2FMUA 5IDXA 2ZQZA 3JYPA 3MJTA 1GQ2A 3GDFA 1H9AA 1YBMA 1Q0HA 2AEMA 5A9SA 1Z73A 4S3MA 1A27A 1P74A 3TF5A 4PGFA 3EHEA 5THKA 3KYDB 3LT4A 2CSUA 4I9UA 3HG7A 2BFAA 5IDYA 2EKQA 4B7XA 3ZCXA 4GSKA 3QQPA 3EGOA 1S6YA 3JD2A 5L7YA 1U4SA 1HYEA 5CFZA 5JDIC 3O9ZA 4OHUA 2NNLD 3C1AA 4FJ2A 4Y98A 3KBOA 2P5UA 5TJ9A 1LC0A 1LQTA 1ZIDA 5LC1A 1PIWA 1XGKA 4HWKA 5T67A 1U8FO 2IXBA 3TDKA 3M1LA 5CDYA 1QSGA 5CG1A 1EUCA 2GASA 4CMKA 4AJIA 3B1FA 3M2PA 3DFZA 1JDJA 2HUNA 2Q50A 3HQ4O 3KO8A 4MKZA 4E5PA 4KP7A 3VZPA 1E6EA 4PG4A 4JK3A 1EUDA 1S7CA 3TRIA 2W98A 3OHSX 4YRDA 3WIEA 1PS8A 3ZWBA 3V2UA 5IJZA 4MJLA 5JMWA 4J7CA 3OETA 4DYVA 4XR4A 4N18A 4I9NA 1YVEI 4ZQHA 4F6LA 4GVLA 3F1LA 1FDTA 3H65A 2BFMA 3CH6A 4O63O 3GOHA 4MVJG 4WLVA 3H9UA 5KVQA 2CVQA 2YDXA 4B7UA 3O8QB 1K3TA 2IYOA 3MEQA 1K89A 2BELA 2IEDA 4IDEA 5KJ1A 3PHGA 4J90A 3SC6A 4CMEA 1I3MA 3F3SA 3JQAB 5L4SA 2LDXA 4I8XA 4J43A 3EMKA 3GAFA 4WLNA 4YAIA 3TJRA 4DQXA 2VZ0A 3FSRA 1KVUA 3ZW9A 2JJYA 3P2OA 1B3BA 1DXYA 3Q0EA 3SLGA 4XZ3A 3DR3A 1PR3A 3WGGA 1KYQA 3T4XA 3WNQA 3VTZA 3I23A 4ZN6A 4HP8A 4XRGA 3F9IA 3RFXA 5ADHA 1H2BA 5EESA 2IE0A 1BW9A 3PRJA 1LDGA 2XXBA 2HJSA 3NRCA 2Q1TA 2FPPA 2EW8A 3F5SA 3LT0A 3I5MA 3DZKA 4DLBA 1DIRA 5KKCA 1OZAA 2B35A 3TQHA 5CPBA 1O9BA 5I7EA 4NJMA 4FC6A 3TOZA 4H16A 1D4FA 4UREA 2FP4A 1NBOA 3AWDA 5KKAA 2GUGA 2E49A 2C2XA 4DTIA 3FN4A 2EV9A 4E30A 4NMHA 3W4IA 4OO3A 2SCUA 3WMWA 5C3MA 4PIVA 3VZRA 3RI3A 3U3XA 4G5HA 1LRLA 4JBGA 3DMTA 4R3NA 4MVJM 4RPHA 4FB5A 5BSFA 4J1TA 2ZIZA 4AJEA 1X1TA 4C7JA 2ZCUA 3M6IA 4ID9A 3WGZA 4D43A 1SPXA 2Q2WA 4WOJA 2NSDA 4JCOA 4NIMA 2R2GA 3H5RA 5A06A 4YCAA 1PJBA 2X22A 3E03A 1LXCA 2DUWA 2UVDA 3AOEA 2PR2A 4GLOA 4P4GA 1U8XX 3LZ6A 3Q9UA 4RPKA 3E9NA 5LDGA 2HDHA 3UICA 4DXHA 1MB4A 3CZMA 1XQ6A 2ZKLA 2HJRA 4YT2A 1E7SA 1VC2A 3H9GA 1ENPA 5G2OA 2YDYA 3WYCA 2NUAA 3ZU5A 4WLUA 1E3LA 3H3FA 2FZEA 2X6TA 4G81A 4GWKA 1BDBA 1D7OA 4XGIA 1CJCA 1V6AA 1QYCA 2I76A 3JD3A 3OQ6A 3QVOA 1YONA 1YQXA 1BXKA 3UGKA 1BVRA 4Q3DA 3FNGA 3UH1A 3EYWA 3ICPA 2VYND 3VTFA 4ZVVA 4BKPA 2ZTUA 2HSDA 3LLSA 1DIGA 4CL3A 3PGJA 4RL6A 5JAIA 4J16A 2P4HX 1KETA 4WJZA 4O5OA 4OQZA 3ZU4A 3UCFA 2VQ3A 3HADA 2D3TA 1DJNA 1E7RA 2E37A 4E2YA 2WEKA 4RZIA 5A3JA 3EK2A 1DC3A 3DBHA 3VPXA 1TT5B 1WDMA 1Y8QB 2X9VA 1KVRA 4UULA 4URFA 4TROA 1MLDA 3C85A 2JAPA 4IDDA 1U2GA 2OORA 5L7WA 3H5AA 4FFMA 1OAAA 1V0JA 4J0FA 5JSFA 2PZLA 3WJAA 1HYHA 1OI7A 1XU7A 1Y8RA 3PJFA 1K6JA 4PRLA 1DLIA 3I3OA 3JQ7B 2I6TA 1KY4A 3CUKA 3GT0A 3JD0A 3ZHXA 3IL2A 3RIHA 4ALLA 4A5OA 1ADFA 3JSAA 3WDSA 1W8DA 3QE3A 3V1TC 3OP4A 4CMJA 1FDWA 3MJ4A 3G49A 3CE6A 1L7DA 3ITDA 3HB5X 5I7SA 3I83A 1A71A 5KWEA 1WNTA 4NZ9A 4BV9A 2FSSA 4GKVA 5U4QA 4DGSA 1ZXBA 4LCJA 4QO7A 4BUCA 2W90A 2DBQA 4JLWA 4CR7A 3ANNA 3I6IA 4XYGA 1GQYA 4BO4A 3D64A 1R4NB 1BHSA 3TL2A 5GZ3A 1ZBQA 4FN4A 1LSSA 4IINA 2RH8A 4JX8A 4J49A 1ADGA 3S2GA 2JD1A 3FTPA 3U9LA 1E7WA 2OOSA 4OSOA 3K73O 1WDKA 3ZWWA 4DQVA 3PEFA 1NM5A 3VPGA 2HRBA 2DLDA 3OJOA 3ZWOA 1ZMOA 2AQHA 3H6KA 2FR8A 1OMOA 3RJ9A 5BQFA 3TOXA 2BF7A 2HU2A 1F8FA 1A4UA 3TNLA 4CLRA 1PQUA 3WLEA 3WMXA 2ZYDA 5COQA 3S2FA 1MXFA 2GSDA 3PIDA 4YA6A 3UCEA 5I9LA 3JQ8B 1ZJYA 1O94A 3C24A 2PH5A 4Q9NA 3ZNPA 1K2WA 1R4MB 4LVCA 5EPOA 1XDWA 4EW6A 1LNQA 4MVJP 1JQBA 5JMPA 4U5QA 1HWYA 4FGWA 1N9GB 3WFIA 1T2FA 5ES3A 5KNLA 2VYVD 1PEDA 4QFDA 3ASUA 5BNIA 1VJ1A 5IF3A 1YBVA 1G6KA 4R9SA 4KDEA 4DVJA 2GYYA 3GK3A 4S1VA 3HUDA 5JDIA 3GFGA 1EEHA 2QHXA 1P9LA 3A14A 4R1UA 1DOHA 3WOHA 3C7CB 3I1JA 1H5QA 1SNYA 3ORFA 1YS4A 4OXYA 3RFTA 3WQSB 4YJGA 1T1SA 5T57A 3KUXA 3Q6IA 2JCXA 3RC7A 2QYSA 4HKTA 4HFJA 3U4IA 5DBFA 2X8LA 2E6UX 2NU6A 1EFKA 3ONFA 3A4VA 3MJEA 4AL4A 3ZWAA 1HL3A 3VZQA 3VDQA 1WVGA 3ADOA 1GD1O 5T64A 4BMSA 4EUFA 5ICMA 3U5TA 4RO0A 4D7AA 5EINA 7MDHA 1DRVA 5B4VA 1KC1A 3DBLB 3RC2A 4OYRA 1EE9A 4MDHA 2ZTMA 3L4BC 3K2EA 3R0IA 4GVXA 4A26A 1HEUA 2YHIB 5GMOA 4NH4A 3EC7A 2QQ5A 2NLOA 4JJFA 2P91A 4GSLA 5F3RA 3D5TA 5ITVA 4PVCA 4IDCA 1X15A 3HE3A 1VI2A 4AJPA 3ZHYA 3WGYA 4JGBA 3AUSA 3D3WB 3L0DA 3BXXA 3ZZNA 1NHGA 1T2CA 2NU7A 5CEFA 1LU9A 1LRJA 3KYCA 4BMVA 1ZK4A 1U3VA 4FW8A 5AXBA 4Z3DA 3PIIA 1ORRA 2I9PA 3FR8A 3Q1LA 1AUPA 4BNGA 1T2EA 4CV1A 2NV6A 1TB4A 4GI2A 5F21A 3PYMA 3VH4A 3KVOA 1LSUA 4I5EA 3H9JA 1VL0A 1VPDA 5IXSA 4OL9A 3QP9A 4TMFA 4BO8A 2R6JA 1DLJA 4FBGA 4WCFB 4CM1A 5L9AA 3DAGA 5TF4A 4NFSA 3IC5A 1AXEA 4Q39A 3WB9A 1NYTA 3BMCA 4CM7A 1C0IA 1B2LA 2C2YA 2J5RA 4RF2A 4DL9A 4ESOA 3I9LA 3HN7A 2H5LA 2Y05A 4CMEC 4E32A 2Y67A 4I5GA 1WMAA 2UV8A 3H2SA 3NT2A 4ZRNA 3U49A 1LRKA 4B79A 1V9LA 4TKMA 3W6ZA 2W8ZA 1PGNA 1CQJA 2IZZA 3OQ1A 1Q2XA 2JD0A 3GH3A 4HADA 2AQ8A 1O0SA 4HFRA 1NFQA 4DMLA 4O6VA 3HFGA 3WTCA 3H9QA 3G1TA 4RCVA 4XQCA 3QWHA 4D0RA 4A10A 4E5NA 2JD2A 3QW2A 4BNLA 4J1QA 4M89A 4MIYA 4E12A 2G1UA 4DMMA 4MP8A 2DPGA 4MINA 2PV7A 1GPJA 1BXGB 4CM4B 4YAKA 3HFSA 1EMDA 3IP1A 3KEQA 2GNAA 3ON5A 4A0SA 5B1YA 1IE3A 2UDPA 4TZKA 1YO6A 3S2EA 2E82A 1UAGA 1HT0A 1OOEA 2Y1CA 1JKJA 3JYQA 4PZCA 4CMIA 3TZCA 1BWSA 3Q2KA 1NQTA 3BMOB 1ZW1A 1B16A 3GUCA 5EJ2A 1ULUA 2Q46A 1M2WA 2FZWA 4XDYA 3V5NA 3GG2A 2NU8A 4LMPA 5IN4A 2EJWA 3A06A 4AICA 1UZNA 3MTJA 5AXCA 4IDGA 1LLUA 1ADCA 2B69A 5EIOA 4YDRA 4ZQBA 1AE1A 1ISGA 3BA1A 1EDZA 1PJSA 2Y93A 1BRMA 3EDMA 3PHIA 4OXNA 4FQ8A 4CLOA 2ILTA 1DAPA 3UFXA 1P1IA 4IJUA 4RPGA 3W6UA 3RUHA 2GZ1A 3AOEC 4WLOA 2Y66A 3NT5A 1I3KA 3AI3A 1NFFA 1DEHA 1BVUA 1LQUA 1TA4A 2BHLA 4KUGA 4MO2A 4Z9XA 4XX0A 1XG5A 2Q2VA 4AJKA 1RM5A 5A1TA 4CUKA 4ZA2A 2FPGA 4IS2A 4N7RA 1AHHA 2Y68A 4IPTA 1KVQA 3F1KA 3K2BA 2O48X 1UP6A 3KXDA 4PG8A 3NDIA 4R4JA 5KVCA 1C0LA 2E48A 3U4DA 1BTOA 1BXZA 4BO6A 2WJPA 4CODB 4J7XA 1DPGA 1X14A 3E5RA 1GCOA 1ZEMA 4KUHA 4BKUA 1P31A 4BNNA 5T8KC 4PVDA 2UUOA 1R16A 5GZ1A 4M1QA 3HN2A 3JQGA 4WKGA 5LDHA 3ZNQA 1W0CA 1Z75A 5AYVA 4ZGWA 1WLYA 1XU9A 1QR6A 2D0IA 4Z0PA 5DCUA 2VUSA 4KZPA 4XQGA 1MC5A 4IQ0A 4M86A 2VYVA 4R1SA 4R9RA 3WR5A 2VHZA 1MUUA 3WLFA 4B3IA 3U62A 4ZD6A 1T2DA 2B83A 5HRUA 1PJCA 5TNXA 6LDHA 5KOIA 1P77A 4A03A 1EVJA 1T24A 2P68A 2BFOA 5L51A 2VWHA 2YHUA 1CQIA 4WEQA 3G0OA 3DOJA 4D0SA 1R37A 2VT2A 4RVDA 3VDRA 5ER9A 3WICA 1IUKA 4LW8A 4NBTA 2Y1DA 4XYLA 1XQ1A 4P8RA 2IYPA 1ENZA 3LF1A 1JVBA 2ZYGA 3KV3O 3VPSA 4KWIA 4O1MA 2OL4A 4R69A 5DCWA 5A5FA 1GTMA 3PFWO 3RWBA 2GN4A 1V3UA 4B3HA 4BO7A 4IXWA 2I3AA 3VH2A 4J2HA 3AU9A 1E3JA 2V6GA 1HDZA 3CZRA 3MJVA 2NQTA 3GQVA 4CMHA 2AEJA 1C1XB 1PWZA 1YB1A 2NTJA 1PL6A 4K28A 1UXJA 1JN0A 2CDCA 2NVUA 4MVJE 2Y1EA 4UEKA 1A4IA 5JDCC 2D2IA 1SC6A 3I4FA 1U7TA 3BIOA 3IUSA 2Q4BA 4PCVA 1P45A 1G0NA 1ZVMA 5JLAA 5BSEA 3UOGA 5DP1A 4CV3A 2GRAA 4IJVA 2YJZA 1OFGA 3AW9A 4NK4A 4ZQEA 3JQFC 4HUJA 5ITWA 5F1KA 4FR5A 5JYEA 4F3YA 1E1NA 5DF1A 4DLAA 2JFHA 3NV9A 4BQPA 4FIZA 4N5NA 3F47A 1D3AA 4FDAA 3ZHBA 4FS3A 3DHNA 3ROPA 3NJ4A 3DAFA 3OF2A 2Q4EA 1DIHA 4FSHA 4LN1A 2O3QA 2PKQP 5IDWA 5DBIA 2PK3A 4NBVA 1Z6ZA 3UCXA 2DKNA 3HDYA 2P9EA 1UR5A 3BMQB 1YOVB 2WMDA 3QWBA 1U3UA 4OGWA 4RGBA 3UW3A 4OQYA 5I9NA 5TS3A 3PWKA 2YQ5A 1UAYA 1M66A 1GADO 1NPYA 1YL7A 3AFMA 5A5EA 4CM6A 3EUWA 3KSZO 4ZICA 3BHMA 1SEPA 1IOLA 1DRWA 4JN6B 4Z6KA 4XIJA 1LDYA 4R41A 5A03A 3TZ6A 2D59A 1G0OA 2JHGA 3RUFA 4E5KA 5KJEA 4BQRA 1HE5A 4BKQA 3V8BA 1QLHA 4PRKA 4GX0A 4EUHA 1WZEA 2G5CA 4NR0A 2CMDA 5FFFA 1YQDA 2A92A 3L4BA 4FGSA 3L77A 3E82A 4H15A 3GFBA 4PG7A 1UDCA 4CMAA 4J4BA 3E1KA 1HZZA 4L73A 1Z74A 4E5YA 3TSCA 5FWNA 1GUYA 5A04A 4Z0HO 2ZB7A 4W9NC 3ETDA 2PY6A 5JAZA 2NTVA 3DZJA 3PQDA 1N2SA 2AE1A 4YQYA 3SBOA 3JQDA 1E1LA 3L4SO 1HTBA 4K6FA 4RLSA 3JQCA 3G1UA 1E6WA 3DOOA 4PG5A 2V6MA 4EZBA 5JXWA 3HDHA 1DDOA 4P38A 1NQOA 3RROA 4BNXA 1ISHA 1O6ZA 2W2KB 5C37A 1C0PA 3HDQA 4FFPA 4W99A 7ADHA 1TVEA 4IZHA 1G1AA 5C7OO 5DN9A 4C7KA 1X7HA 3O26A 4F45A 2PD3A 3LC2O 3K96A 3MCVA 1EK5A 4NQZA 1UDAA 3FNEA 2YV1A 2QG4A 1B8VA 3PI7A 3PWSA 3V1UA 4Q3AA 3KB6A 1M67A 2B4RO 4EGFA 1UDBA 5ENDA 1K0UA 4LRTB 2HLPA 2I66A 3RUAA 2CFCA 4U0JA 3EZYA 3GPDG 3HB4X 4GLLA 1HDOA 1EVIA 4M55A 4HXYA 1SMKA 1UXGA 1DAOA 4IGFA 3T4EA 2PTGA 1GY8A 3PPIA 1CYDA 4A27A 1UP4A 4DBVO 5JYDA 3AY6A 5JCJD 3DEYX 1KS9A 2C7GA 2EEZA 5T6BA 5GZ6A 4YJHA 2BRUA 4LRSB 1HDCA 2X9GA 5G4KB 3F46A 2YV3A 4ZJUA 1P33A 1QYVA 1RJWA 3ZU3A 3PQFA 4ILKA 4QSMA 3IP3A 4N54A 3EAGA 1B14A 2X0IA 3BTSA 1I01A 4PLPA 3Q3CA 4XR9A 2I3GA 4W4TA 3DMYA 4QX6A 4I9HA 5HA5A 4K9DA 1BSVA 1UUFA 2X5KO 5I8ZA 2CDAA 5CEEA 4UUMA 3KOUA 2RHRA 3OBBA 4DC1A 4D79A 1A72A 1BMDA 1BDMA 2WYWA 3GZNB 4TRMA 4GL4A 5DBGA 1IULA 1GYRA 2NM0A 2XPCA 4YRBA 2DTEA 4BNMA 1KEUA 1SAYA 3OJEA 4GQAA 1H94A 3AOGA 1R12A 3HNPA 1Y5RA 1B8PA 3R1IA 4PZEA 4CQMA 2O4CA 4TKLA 3PJDA 4IIVA 4OSPA 4C4OA 2OFPA 1LI4A 4RVUA 4CV0A 1PR9A 2RHCA 1E0DA 3BAZA 1GYPA 3RVDA 3ZNNA 2HKIA 2P9CA 1X1EA 2V6FA 5EQFA 5B12A 4W82A 4FJ1A 1U3TA 2VOJA 1X7DA 4HNGA 5FI3A 1K6IA 2Y0CA 1EE2A 3IAHA 1XEAA 1RPNA 4NK5A 1O8CA 3PLNA 1XKQA 3P5SA 3GVXA 4IJWA 3SEFA 3AY7A 1H9BA 2FR1A 4L0QA 3VC7A 4KQWA 1B15A 3TL3A 1Y1PA 4JBHA 3VZSA 2OMEA 1F0YA 1HE3A 3GDGA 4DIFA 5TJHA 4HY3A 1N9GA 3FPCA 3RBXA 5A9SB 3CXRA 5JAMA 3WQQA 2G17A 3LC7O 3OEWA 5T8KA 1H6DA 3CIFA 2AG8A 2VTEA 3F5QA 3HDJA 4FOOA 1VLLA 2CVZA 3DONA 1A7AA 1OC2A 1PL8A 4OJNA 3N58A 4U6QA 3ZWMA 4ND4A 4Z9FA 1EUZA 1DRUA 2C5AA 3JYLA 1GV0A 4CUJA 1LX6A 1C1DB 1QG6A 4ND5A 2GF2A 2BI8A 1O95A 2VRCD 4YT8A 4HFNA 3T7EA 1ZXLA 3F6YA 3ETEA 1UZMA 3PLRA 3C1OA 3NGLA 4I1IA 4LK3A 1H0KA 1Q7CA 2DBVO 1MP0A 1VJTA 3GN2A 4NFYA 3AM3A 4JROA 1HDGO 1GDHA 3WFJA 1GUZA 3C8MA 1ZK1A 2P2SA 1I2CA 4LCEA 1JVSA 1I5RA 5JCXA 4JIGA 1ZSYA 4PLZA 1MFZA 3WSWA 5JC8A 2YHIA 2O2SA 4XGNA 1ZKMA 1IY8A 2HQ1A 3M1AA 4XCVA 3ZV6A 4DRYA 1L7EA 4JP2A 4II2A 3M2TA 2RIRA 3DC2A 4CV2A 2VWGA 1I2BA 5K6AC 2WD8A 5CDTA 4WCDA 1EBUA 4UVGA 1Y9EA 1P1KA 1FF9A 1JA9A 1VSVA 3RJ5A 3PYXA 3ZV5A 5JDCA 3MJCA 2OO5A 1ZEJA 2IXAA 5DP2A 3ZWPA 3GEDA 2OZPA 1ZFNA 2JFFA 3G3EA 4XB1A 4RF5A 1YDWA 3JQFA 3FD8A 2B37A 3KM0A 4TRJA 1BW9B 4KTVE 1E77A 1I3LA 2GERA 3B1KA 3KSDO 4MKXA 4ALKA 4DC0A 2DAPA 1XELA 1HSOA 2O3UA 5TLSA 3JD4A 4E5MA 1ISFA 1KVSA 1EK6A 2OUIA 2C29D 5IN5A 4ALMA 3OFSA 1ZK0A 3GEGA 4XQEA 2B5WA 2ZTLA 4WE3A 5I8WA 5JNLA 2HK9A 1T4BA 1ZMTA 3GN1A 1M6HA 4BHTA 4MP3A 2LDBA 1QYXA 2HO5A 2C5EA 3DTTA 5G0WA 4ROSA 1PL7A 1YB5A 2NACA 1WPQA 3CPSA 1GUFA 2TMGA 1XWFA 3OIFA 2JHFA 5IDQA 3I6QA 3DBRA 4BB5A 5DULA 4Z3KA 1MG0A 3OA2A 1D1SA 1T4DA 4WEOA 2CD9A 4E2ZA 5CDGA 3AM4A 4F46A 4BNJA 1HXHA 4AG3A 5A9RA 5A05A 1R0KA 5MDHA 1B0AA 2FN7A 4II3A 2O4UX 2WM3A 5JCJA 3H7AA 4JQCA 3RASA 2X23A 3OMLA 2EP7A 1GEEA 1KIFA 3DHEA 4RV9A 3PDUA 1D1TA 3AUAA 3OA0A 3U09A 3PFFA 4W9NA 3AI2A 3KSUA 1GU7A 2AE2A 3ENKA 3AM5A 3ADPA 4P4NA 3WYEA 2E4AA 2PKQO 3GG9A 1CWUA 4L74A 2RCYA 1X7GA 4NBRA 4EJMA 4L4XA 5G0VA 3PK0A 1J4AA 1P3DA 4UVDA 1J6UA 3AI1A 3PZBA 1A7KA 1X0XA 4J9VA 1PX0A 3GNQA 1PJLA 2C54A 4B8ZA 4LISA 2OBYA 3JQAD 2VHYA 3EZLA 3LK7A 4QXMA 4EUEA 2C7VA 2DFDA 4BNWA 4IY1A 1EVYA 3G79A 2EW2A 2WYUA 5BNFA 3O03A 3JQ9C 3VHRA 5H82A 2ZCVA 3VVCA 4AJNA 3QLJA 2G0TA 4D46A 5BSGA 4D41A 2NU9A 1SZJG 2FSVA 3K6JA 4RORA 3QSGA 2O7QA 4PLGA 1B26A 3KEOA 3GRKA 1RYDA 1Z7BA 1ULSA 4R5MA 4GMFA 1Q0LA 2X7HA 2XXJA 5EQDA 3U4HA 4W7HA 3FWZA 1P0CA 3D1LA 4BMNA 4IIUA 2WD7A 1JKFA 2BGLA 4XDZA 2VTDA 4CLEA 1Y8RB 3EVNA 4MIOA 2H6EA 4KQXA 3UXYA 4Y67A 5JO9A 2P4QA 1V35A 4RVGA 4D3SA 4YBZA 1IPEA 4IQ8A 1KY5A 2WYVA 1HE2A 1Q1NA 3R6DA 4CM3A 4CM8A 5LCXA 3ZWNA 3K5PA 3TPCA 2PZMA 2PH3A 3H9EO 4OMUA 4IDAA 1GAEO 2VUTA 3FR7A 4E2XA 4R51A 2B0JA 2Q1SA 4J0EA 4HBGA 2VYNA 5J23A 4HFMA 4R5HA 9LDTA 1YJ8A 3WSVA 3GHHA 3D5QA 3RUCA 4AJLA 1Q0QA 3MTGA 1NVTA 1U2DA 1MXHA 2R00C 4NBWA 2DBZA 2VRCA 3NAQA 3RC9A 4CUZA 3NJ8A 3UHAA 3RKRA 3GLQA 4DREA 2I99A 1Z45A 4WLFA 3DZIA 4XYBA 1E92A 4NNJA 1NVMB 1PJ3A 3DFUA 5C5IA 1T1RA 2X9NA 2X0RA 3NX4A 5IG2A 2CDBA 5L4LA 2ZATA 3ETGA 4E0BA 2VOEA 3JYNA 4EEZA 4BNZA 4RPJA 1YE3A 4Y8VA 1LSOA 3NT4A 3VAZA 1DC6A 3ZHZA 4CLRB 1IZ9A 3NYWA 1DHTA 2DTXA 2HMSA 1VL8A 1U9JA 4GAEA 4NDNE 4YACA 3RKUA 3W8EA 1FJHA 2A35A 5BR7A 4LGVA 4TQGA 1B8UA 2H1SA 2BI7A 1HDXA 4YPOA 1WXDA 4TVBA 4MVJD 1LSJA 2QZZA 5TX7A 2OBNA 4QUKA 4FJ0A 4QQRA 3PYLA 1WWKA 3ONDA 3T7CA 2Q99A 1UJMA 1NQ5A 2AQIA 2DU8A 2JAHA 4KOAA 5A3VA 1YDEA 2I65A 1HE4A 3ICCA 1SO8A 3D4NA 1FMCA 5A4DA 4YYZA 1NXQA 4ND3A 4BV8A 4RPLA 3W8DA 2HMTA 3EVTA 4CMGA 4E6PA 3IJPA 1C0KA 1CDOA 4Y9DA 4U6SA 1VJ0A 1E1MA 4K1LA 4YJGB 2EG9A 1I24A 3I52A 5FEUA 1R0LA 3K92A 1LUAA 2AW5A 3KLPX 1WP4A 2Q49A 3D4PA 3MOIA 4I5DA 5KIAA 2G82A 3ONEA 1FDSA 5BT9A 3NGXA 1E5LA 3CKYA 5ENVA 2VNSA 4WPGA 1AXGA 3MWEB 3PZRA 1R6DA 3IS3A 4X54A 1GFSA 4GPD1 2A4KA 1R15A 1QKIA 5HBRA 3NEPX 1E7MA 3VKUA 2PFGA 5ILGA 1T26A 1JAXA 3KYDA 1F17A 1PU2A 3HWRA 2F00A 3OIGA 4EBFA 4XIYA 3MOGA 4QT0A 4BNIA 1CRWG 5KJFA 5HS6A 4YAGA 5HTOA 2GDZA 1DSSG 1M6WA 1SB9A 1UZLA 5TIIA 4Q3BA 2X86A 2YQ4A 4QECA 2V7PA 5K6AA 4PLCA 1HZJA 1ZZEA 2HMWA 1AHIA 1MG5A 2PGLA 2I67A 4J1SA 4ZHSA 5IFLA 1QXSA 5KTKA 1NNUA 3KYCB 3WYBA 1JLLA 2H63A 4PFJA 3BMNB 1IYZA 3PJEA 3S2IA 1PWXA 1PJTA 4XEHA 1HETA 3CTMA 1I36A 2EKLA 1W73A 5MGBA 2HMVA 4EI2A 5JE8A 4W6ZA 4D44A 3JQEA 3PVZA 1U3WA 3CMCO 1XSEA 3K9QO 5C7LO 3LQFA 4JNKA 1U7HA 1VKNA 3U4CA 2RH4A 2EXXA 3NTQA 4AJOA 1SOVA 4IXTA 4YJDA 3O8QA 3P2YA 2Y1OA 3ULKA 3BMCB 4JJIA 1TEHA 4XYMA 1NFRA 3D3EA 5G0SA 1E3EA 3WXBA 4YVFA 2ZB4A 1H6BA 4FFRA 3JQAA 1W6UA 2J3HA 2OHXA 4K26A 1E3SA 2IDZA 3DBVO 4IJKA 4CL8A 3VH3A 5KVVA 3I9OA 1X0VA 3BTVA 4R01A 2ZB8A 3DB2A 4RQTA 1MX3A 3LT2A 5G4KA 3BHJA 1MA0A 3WBBA 3WGHA 1ZSNA 1TT7A 4BL5A 4JBIA 1WMBA 1LDMA 5CPFA 1MC4A 3DZHA 3OJ0A 2D5AA 4I5FA 1PJ2A 5TC4A 1K6XA 4L4RA 5JY6A 2OP0A 3C3XA 1U4OA 4B4UA 3JQ6A 4WCFC 1E1KA 1YL6A 4JXKA 1VE9A 3QIVA 3DZBA 1F8GA 4R1NA 4IM7A 1C14A 5G0UA 3GZNA 3WGIA 4TVOA 1ENYA 1SOWA 2GZ3A 3H3JA 3PHJA 3QA9A 2GN6A 3WQRA 3JCZA 4E3ZA 3WG9A 3K30A 2QX7A 1LDBA 4RDIA 8LDHA 1CEQA 1Y5MA 5TGDA 1U1IA 3ABIA 3RFVA 4WK6A 3TFQA 4NU6A 2JKVA 2GZ2A 2O7SA 3GVHA 4R3WA 3SXPA 5U9CA 4BNFA 2WWRA 2DFVA 3Q11A 4L4SA 4E4YA 4YJFB 4PLTA 4J4HA 3TFOA 1DFGA 4CLOB 3O4RA 3A9WA 2WE8A 1NTOA 1HF3A 3JQ9A 1XCBA 4MIEA 2YYYA 3PHHA 5L3ZA 3S8MA 2BKAA 3LU1A 4WLEA 3WTBA 5DZSA 3AJRA 2PWZA 2WE7A 5HS4A 1Q7BA 4EEXA 1E3WB 3ZU2A 1EQUA 3CINA 3ZWVA 4J6FA 1I2ZA 3IJRA 8ADHA 1GR0A 1V3VA 5L53A 5AQ1A 4IMPA 3PXXA 2EKPA 1XHLA 5EN4A 4YRAA 2VNAA 3HHPA 1JW9B 5HM8A 3GA0A 1LBEA 2CF6A 1QRRA 3EW7A 1BG6A 5FF9A 2P5YA 4HX5A 4ND2A 2O3TA 3LYLA 5EL0A 4W7IA 4ND1A 4BNTA 3FBTA 1PS0A 1SEVA 3SX2A 3VKVA 3MZ0A 4OOEA 3JQGB 1T2AA 1SBYA 4BO0A 4MVJA 2GN8A 3RQSA 3FCOA 3GC6A 3Q9NA 1C1DA 5JO0A 5K0ZA 2J3IA 1ML3A 2X5JO 2FY8A 2PZJA 5BSHA 4M87A 1GZ6A 1ID1A 1B7GO 1TT5A 3FTNA 1YXMA 4CM9D 3GUYA 5IZ4A 1UP7A 2HMUA 1Y8QA 4BNHA 4RJTA 4G2NA 2FR0A 3HZZA 4R68A 2VHXA 1HLPA 1QMGA 1YQGA 3FWNA 3I9KA 1GV1A 1K5HA 4FFLA 3OJLA 2CY0A 2R00A 5CP8A 3BZUA 3KTDA 1CETA 4KWHA 3K31A 4BO1A 3P7MA 2Y0DA 2B4TO 1X13A 4YTEA 2BLLA 2FOIA 3OJFA 1XA0A 4DPKA 2POQX 2HCTA 3JQ7A 1NR1A 1HRDA 4AJ2A 3LT1A 5EERA 4BVAA 1RM0A 4D3FA 5KJCA 2GCGA 3COSA 3E48A 4ZQFA 3RBVA 3GR6A 4BO2A 3OICA 3X2FA 4BB6A 2WDZA 4L9RA 1MGOA 3NUGA 4IUYA 4WGGA 4MVJH 1NWCA 4BO5A 3ZV3A 1AGNA 3H2ZA 3E9MA 1FDUA 4BNVA 4EITA 2X4GA 4P22A 4BS9A 3FBGA 1NQAO 1LLDA 2NVUB 4UUNA 4NU5A 2Y99A 1YRLA 3UKOA 2YW9A 1IZ0A 4XB2A 2Z95A 1UXKA 3GEMA 3KETA 5ILOA 2C0CA 3E5MA 1GZ3A 1ISJA 1R4NA 5EMHA 3IKTA 3RU7A 2IZ1A 3GVCA 5I7VA 2JCYA 3RU9A 4GX1A 2A9FA 4L8VA 1IL0A 4RVHA 2CVOA 2ZJ0A 2VCYA 4CM5A 1XR3A 5DNAA 1F14A 1U5AA 1F12A 4XA8A 4PN3A 5IZCA 2B5VA 3GPIA 4CQLB 5B4TA 5H83A 4YAEA 3FF4A 3QVWA 3OM9A 3DHYA 1GL3A 1CERA 3KZVA 2EWMA 5U1PA 1H2HA 2GO1A 3PP8A 4R54A 1JWAB 2D8AA 4AJHA 3W8FA 5HWSA 1NASA 2ZJ1A 2ZTVA 3JQ8A 2JCVA 4BGEA 3ST7A 1UXIA 2CZCA 1N1GA 1R4MA 3D7LA 3WGOA 3UUWA 3DDNA 4QFCA 5DOZA 3NTRA 4RDHA 1WDLA 4YQZA 4GX5A 4J2OA 4B8WA 1ONOA 3GY0A 3ITKA 1Y7TA 3NTOA 3R3JA 1NR7A 2EF1A 1YGYA 2V65A 1I32A 4FD3A 4H7PA 1Y9AA 3FHLA 1CF2O 1T25A 1M76A 1N5DA 2Z1MA 2BH9A 2O50A 3L6DA 1NP3A 3SVTA 3QVTA 1DHRA 2Q3EA 3CEAA 3WJ7A 4WECA 5JBIA 1EDOA 1I10A 2NTNA 1DC4A 1DBVO 2VUUA 2WSBA 3IQDB 1Z82A 4QEDA 1JAYA 4BOYA 3W4KA 3GGGA 1P1RA 2J5QA 2EP5A 3FPLA 1KERA 5B4UA 4UEOA 2W4QA 1VL6A 3GZ4A 4AJ4A 3GAZA 1Y81A 3DBLA 4OKNA 3DQPA 3SJ7A 2EERA 4NFHA 4G65A 1UH5A 3JQBC 1XLTA 5A9TA 2YFHA 5FI5A 5CDSA 1OC4A 3SC4A 1ONNA 4YEDA 1WZIA 5AOVA 2PD6A 5K9ZA 4OIMA 2QRJA 1FK8A 3LLVA 3GDOA 1E7QA 1H6AA 1DIBA 3UF0A 4LSMA 1PSDA 4XD2A 4L76A 3WS7A 1O5IA 2DTDA 1I0ZA 4GBJA 3PTZA 2V6BA 3D3WA 4RZHA 5KVSA 4ITUA 3AUUA 4GX2A 3INGA 3ZN2A 1P1FA 3WX0A 4DYDA 4H3VA 3E6AA 1PQPA 3KYBA 4MKRA 1NHWA 2IZ0A 4TZTA 4J3FA 3RAJA 2BGKA 5AVOA 4YJHB 4R1TA 4IBOA 3P19A 4OH1A 2GPTA 2J8ZA 2C07A 4QO8A 2PA3A 3W4JA 2UAGA 3F4BA 3L9XA 2EGHA 4RVFA 2D5CA 3GGPA 5CG2A 3RC1A 1FXSA 4A7PA 4CJXA 5COAA 2J3KA 1ZK2A 4WCFA 2P9GA 5G0TA 4DWVA 1PZEA 3LDHA 4BGIA 3RUDA 1V8BA 2JL1A 3MWDB 1RWBA 1LJ8A 4YT4A 1ZCJA 1VKOA 3QRWA 2B36A 4J4TA 2A94A 3FI9A 4NBUA 4YXFA 1E5QA 5THQA 5L95A 1R0SA 3V2GA 3WWZA 4EJ0A 4ZQGA 4DLLA 4Y6PA 1ZO8A 1KC3A 3ANMA 4NJMB 3IOYA 1TLTA 4Q3NA 5L4NA 5CAEA 4CMCA 3IUPA 1YB4A 1XIVA 1ZUD1 5KCZA 1EQ2A 1ONPA 4J1NA 1MV8A 1O89A 3AU8A 4YT5A 3QV1A 5GY7A 5IAAA 2QRLA 4XYEA 3E18A 4Z0TA 4BNUA 3SLKA 1P44A 2UYYA 4CQMB 4CM9A 2C59A 3IMFA 1P1HA 2Y1FA 2IRWA 2QYTA 4PZDA 3WWYA 1PGPA 4BNYA 1NPTO 5TT0A 3A28A 5F5LA 4IDBA 3STHA 2VT3A 2XOXA 3ZGYA 5COBA 2YUTA 3DXFA 2PZKA 1IHYA 2W2LD 1A9YA 1HYGA 1AN9A 2BGMA 2RAFA 3FNFA 4GKBA 4D3DA 1LA2A 4CM4A 1BXGA 1QP8A 3BYZA 2J5KA 4RVSA 1ZSVA 2ZQYA 5AXDA 4J91A 4YB8A 3PJGA 3WNVA 3QHAA 3OQBA 2AA3A 2ZK7A 2VZ9A 4XGKA 2Q1UA 1ARZA 3QVXA 4U8GA 3NDJA 2AQKA 4ZRMA 4ONEA 5L40A 3QWFA 3TZQA 2VN8A 3TWOA 2PLAA 1TXGA 2OGUA 1KEWA 3BMOA 4Y6RA 4LSWA 2G76A 2XF8A 3I4CA 3QWIA 1PS9A 4DQUA 3E8XA 4OOFA 5T5QA 3I9JA 4U7WA 3ZW8A 2DUUA 1I30A 4NPCA 2NVBA 3BHIA 2O23A 1YH3A 1YKFA 1OBFO 3GVPA 4YAJA 2DVMA 1LDNA 2HK7A 3AUTA 1LLCA 3C7AA 1I33A 4BNKA 2VWQA 1ISIA 2AHRA 2AMFA 3N7UA 2FRDA 3L6EA 3NKLA 2FPIA 4M49A 2O2YA 3GVIA 4IGEA 3LC1O 4GMGA 1KEPA 1LLQA 1YBAA 4CMBA 4R16A 2Z5LA 1NX6A 5AXAA 1N7GA 1C3VA 4WNIA 3INTA 2NWQA 3DBHB 1VRWA 3R3SA 3ZWCA 4J7UA 3VPFA 4UVHA 4KMSA 4BKRA 2PD4A 4IZIA 3GNTA 1DO8A 2VHVA 2O3RA 2QRKA 2PGJA 3DZFA 4ALJA 3L07A 3MJSA 4GGOA 1QORA 4PLVA 4U0KA 1VM6A 1DFIA 3B70A 4UAGA 1J49A 3V2HA 4XWYA
chains in the Genus database with same CATH superfamily
1Z22A 1C4KA 4I6GA 2B4QA 2PO5A 1QZ3A 4O0LA 2EJVA 2OXIA 4E13A 1DVRA 3QBJA 4OKIA 1SK8A 1U3GA 4B40A 3C1UA 3PQ3A 3TNDA 1PGQA 1A7UA 5CDUA 1KTIA 1V16A 2IHBA 4TWJA 5FD8A 5IUKC 1UOOA 3SBXA 3DV9A 3J7AC 1N2EA 3IPCA 4INAA 2DM6A 4H4CA 1BHJA 4TRRA 5GVSA 4HQOA 4WOKA 4AJJA 2IBSA 3HWX1 4HWRA 1PNVA 3H5NA 1J5PA 5EHXA 3PEWA 4UE6A 3Q15C 3QWAA 1FMJA 4ZOLF 2HLDA 2AVNA 2Q8PA 1PLJA 1SXJB 2QD1A 2HCRA 2UVPB 5ER6A 1YZQA 2QIOA 2ZBVA 4IS3A 4K6MA 4O59O 3X0DA 2V7WA 1WZ2A 1G6OA 1RYEA 3KHTA 1FLAA 2YZ7A 1JH8A 4KFSA 4LMAA 4M98A 4PLYA 5DX1A 3WMRA 3K6SA 4KMRA 2E85A 4MWDA 2AN1A 5ERXA 3KZKA 3D0OA 5TMEA 1EXVA 4KDCA 3K15A 2IYWA 4GL2A 3QNUA 1DBSA 2GBLC 4IMRA 5DHAA 1AGYA 3K2IA 4PSVA 1DKRA 4IGIA 5DDIP 2G1KA 3ZI4A 5UKDA 4EGCB 2YVLA 5IUJC 3IULA 2Q8QA 4CG1A 1OFHA 5EWLB 3STUA 1NVVQ 1W49A 4FYKA 3PKIA 4YCBA 3FLAA 4LVUA 2D0PB 4QDUA 3PVSA 4FDMA 3IA7A 4PXAA 5JS6A 4LMRA 5TQ2B 2CXNA 5ICSA 1L5SA 3I58A 1AO3A 1V2GA 3CUWA 1C1XA 3NRJA 3O38A 2FEAA 4JT2A 3KHUA 3L1KA 3UAGA 3U0BA 3OTWA 4REMA 3D4LA 1M2VA 3RU3A 4KDFA 2YXDA 5EMLA 4DPMA 1G7TA 3HCEA 1ODJA 2PE5A 4XJSA 5B6JA 1JKIA 1Y3FE 1RHKA 3ZS8A 1H2RS 1HMYA 3DNMA 1G8PA 4PZLA 4RDHA 4BCDA 3AVPA 1GXSB 4BV2A 3FDFA 3UANA 1N36B 1IK6A 1Q15A 4KCGA 4YFYA 5F5NA 2ZAIA 1H6CA 3H1TA 3RHZA 2QY9A 2C2MA 3H17A 4F4CA 4CIVA 1ZC4A 2G40A 3KXKA 1N6LA 3M9LA 4HATA 1W0KD 2I5PO 3PF8A 3L9WA 4I3GA 3FRJA 4TXHA 3DD1A 1GQQA 2VC2B 4JQSA 4TRNA 5DHPA 2QL9A 4BGUA 4O2AB 2VRBA 4UFOA 5KTOA 1DIAA 3KQNA 5D3MA 4JOCA 1H1DA 2UUPA 3BFPA 4AQ7A 1Q7EA 1FUEA 4GZMA 4LQDA 3SD7A 4M2LA 4GR9A 2PLNA 3FOWA 1DXQA 1ENOA 1Q95A 3VJKA 3FKJA 1JU9A 4LPKA 4B3JA 2X14A 4QZVA 5JNRA 3LDAA 2JGLA 1XHEA 5DIZA 5B37A 1GCGA 1G63A 5AKIA 5TSDA 5KYKA 1JDVA 2R47A 5IAJA 3AK4A 5HILA 2XEXA 3U37A 3IYLW 3Q6NA 2PNFA 3OECA 1SBNE 4BGVA 5KPDA 2RK3A 3FOZA 3ANTA 2CFRA 5F1OA 2GLXA 3OM1A 5G4LA 1ZK3A 3UB3A 1OAOA 4YREA 3KSMA 5ERYA 2OZVA 3LVFO 4F3NA 2AEFA 2Y0EA 1VRCA 1YRQA 2WV7A 3IIKA 1LPPA 4US0R 4YJFA 4OB8A 1G8KA 2D1YA 2KLHA 3NUQA 4MX8A 2V4ZA 3JQBA 1OYWA 3PCXA 5KMGB 1PX2A 3MXTA 4FB4A 2IF0A 2H1FA 3D0KA 2YJNA 2Y4OA 4BIIA 3P4YA 1UJ6A 5GM2A 2O59A 4U2GA 3IIJA 4ENPA 2OOKA 1NXOA 2W70A 4D9CA 3E9CA 2A67A 3I9V1 5LP6A 1Z7EA 4DIOA 1NR5A 1T5IA 1Z5UA 4GWGA 1NVGA 2VJCA 1GPDG 3BHNA 1ZNQO 1OHHD 3OPYA 4WMLA 5B3JC 4G5FA 1DQPA 1X80A 1FYVA 2DBRA 2GGSA 3CLHA 2PQ2A 4IIBA 4ZOCA 1NONA 1C3OA 1KFEB 3LXRA 4JP5A 4M6WB 3ZX5A 2A5JA 3UWMA 4YH1A 4DJTA 3P0HA 4GC9A 1HM5A 3ZDEA 1VQ1A 3NHBA 4ALNA 4DDVA 3AHIA 1D4ZA 4L5BA 2ZITA 4GT1A 5GM1A 3TDMA 3RARA 1N5IA 4BPBA 2YW2A 4I08A 2BCGY 1PJRA 2NADA 3N0RA 4OBEA 1XK6A 1A9ZA 1E1DA 2JZOA 2BE7A 4I50B 4QDZA 3ZY2A 4B3BA 1IJEA 4M1EA 4DAOA 1UOQA 1ZH8A 3DTYA 1IXZA 1T9ZA 3ZD9A 3E9QA 2WF9A 4R0VA 3PWZA 4RVNA 2CXUA 3P1JA 4L07A 1I8TA 4CM8B 2C2KA 2ZCJA 1GEGA 1QQ6A 1JIUA 1GPMA 5FUMA 2XGGA 3GYBA 3V6LA 3O4HA 3PI6A 1IEQA 2Q45A 2YC4C 2ASVA 2VWPA 4JL6A 5D8DA 5F33A 4C4ZA 3C15C 2O8VA 3F7NA 3IP6A 3KIPA 1MBZA 3O91A 5LXTF 3QVSA 2VP0A 2AJBA 2ZPTX 2GPBA 4MJ3A 4JB0A 1QAMA 2ZWPA 4NFLA 5IDVA 1GCIA 1HSZA 4B4OA 3F3YA 4LOHA 3HA2A 4P7GA 4Q5IA 4P3PA 1HKUA 5MFPA 1GUAA 2QMEA 3THSA 1T6ZA 3IXQA 1QVVA 1YMUA 2PZ8A 3N2IA 4Y1EA 3ACCA 2PBLA 2BMAA 1KYTA 5DM2A 5DLPA 2XMBA 1UQRA 4MWTA 3LXUX 2X1HA 2XTMA 3NHUA 1SCBA 4C22A 2GI4A 4F9FA 5TS2A 1OYYA 3VPAA 4F71A 3C7DB 3WGKA 4Q9IA 4MQ4A 1MQSA 1JR2A 1K8XB 3QU4A 4PX9A 1QFYA 4M9XA 1P91A 1ZGGA 4E3WA 2ZAOA 6YASA 2EHJA 1SB8A 4LFCB 1E4YA 3Q2IA 5E9WA 4EDFA 3V6MA 5LZ2A 2GVNA 2VT6A 3TZKA 1H93A 2CDNA 1CVRA 3BJIC 3K8YA 1OT3A 4UOQA 5TGZA 3TVTA 4BWVA 2JFYA 4MWZA 2J59A 2FK8A 2ZRQA 3RSHA 4ETIA 1XTSA 1COWD 4UBNA 4B5KA 3CV3A 2GCEA 4P9NA 2JI9A 4E4TA 3N74A 3U44B 1FBNA 2PSDA 4QOIA 1L4HA 1WF6A 3IQWA 5ALYA 4ZVMA 2X7XA 4FFNA 3L4EA 1M75A 2GN9A 1FVOA 3LOPA 4BJ1A 5BV8A 3W3AH 3AP2A 4HGOA 3CEPB 4NMWA 4QDTA 2EHDA 4UHEA 3GEIA 2H52A 3GJXC 3L0BA 5DCYA 1KMHB 4QTZA 1WM1A 2PX8A 2RHLA 1V9SA 5TY0A 4YDQA 5IJWA 1X1RA 1E3IA 4X8LA 1O8BA 4WESA 6ADHA 1RKXA 2ZUVA 1WMDA 3D6JA 4TWRA 2Q1WA 3HVJA 5G40A 3G2PA 2IFTA 3B20A 1W36B 3PGVA 1UJCA 1MFPA 4U4AA 5H3LA 1AIPA 3AEKA 1D8TA 2RFLA 3R9XA 2HWYA 3GF4A 4L78A 3OHPA 4WASA 1PGJA 1DTWA 3GCZA 3QY0A 1ZLYA 2OP1A 2GD1O 3QFRA 1NWHA 4JJGA 4WQMA 2FUEA 4DF3A 1JYFA 1DO0A 3RHTA 4DWWA 2J3JA 4TTIA 4OM8A 5TVKA 4U3JB 2DHDA 4F4FA 1SPBS 3GDWA 3PC7A 3UUFA 4NE2A 1CD5A 5L45A 2RGDA 4D6XA 3OOYA 3HYNA 3TAHA 5I47A 2ZSEA 1PF7E 1UC5B 2WM2A 1CULC 1YJQA 2ZRNA 1Y3IA 2MDTA 1DWPA 3BCHA 3B6ZA 3DMNA 4C0LA 4H6PA 3DL0A 1KDYA 4TL6A 1BMFD 4MS1A 4QRHA 1K7SN 3FVTA 2CUTA 3IMEA 1J2JA 2QPLA 2VJAA 4U9IS 3D6UA 3CLVA 1Z73A 5LYYA 4JL5A 3RYIB 4KXUA 5AIAA 4PGFA 1JTEA 3EHEA 3OPNA 5AW8A 4EHIA 3A9SA 2FNAA 4B6FA 2CSUA 4LOJA 3UM9A 4B7XA 1OIVA 3ZCXA 4CHTA 3A27A 2R86A 1IRXA 2A88A 2V3VA 3P4UA 1MDFA 1S6YA 4LZPA 4XPZA 1DBWA 4D4MA 5F76A 3IAS1 3O9ZA 3VNVA 2DOKA 2NNLD 3UENA 2VSXA 4FJ2A 4Y98A 1PV2A 3AVTA 2QM3A 2VJMA 3KLOA 4MWGA 1ZYUA 2VAMA 1G21B 3IQHX 3SSMA 3PRHA 1ZIDA 1CJBA 1PIWA 2HZBA 4HWKA 3VR0A 2R1VA 2XUJA 3LCMA 1RMQA 4X60A 5GJBA 4DNXA 1RYBA 4AO6A 1QSGA 3RRZA 5F1YA 2J7PA 3G2OA 2BEUA 2UZIR 1YB2A 2GASA 1P29A 3MELA 3O2JA 5ERGB 1KU0A 1Z6YA 3M2PA 4PGHA 1GPWB 3K1AB 2GA9A 4AB1A 3K0AA 3DFZA 5AW4A 3UBMA 1JDJA 3KJIA 4RY0A 2WSSD 5REQA 1Y63A 1NNI1 1U6JA 2Q50A 3HQ4O 4LGMA 3AR9A 4BVHA 2ZYRA 3DCIA 4JDPA 1E6EA 1SH7A 4CQJA 1C9EA 4XVRA 4YRDA 4PRZA 1BA2A 2JH3A 4ZEOA 3V2UA 1OZ0A 4FFVA 3WIEA 3I92A 4LECA 1ZUNB 2OCXA 1S2DA 4XR4A 4N18A 3R5XA 2V55B 2R7KA 4ZQHA 4MR8B 1LVHA 1DEXA 2POCA 1PR4A 1TM5E 1TQ8A 1FDTA 1ZUHA 2W2MA 2YIMA 3AESA 3LUCA 1DRKA 3TBKA 3VBEA 4CKCB 4WLVA 3H9UA 1P7WA 1K0FA 3ZY5A 1K3FA 3FB1A 1XMOB 5JSZB 5HZMA 4G09A 1LBHA 2IYOA 4H4DA 3ZWKA 2TYSB 5KJ1A 2A3RA 4J90A 4L5IA 3HEMA 4Q3OA 5GINE 1V48A 2FG7C 4DV4B 1M1ZA 1DBRA 3ACDA 3F3SA 2X1VA 3V1KA 2LDXA 5F12A 5CB4F 3GAFA 1BAPA 3WWOA 5EHZA 3TJRA 4V0QA 2FE1A 2HU8A 3ET5A 3VV2A 4DM3A 1U6KA 5AI5A 2H2AA 5IASA 3QLUC 4XZ3A 5BQXA 4TMWA 1PR3A 1KYQA 4MW7A 1HNWB 3WNQA 5E6SB 1J22A 4FWTA 2ZT6A 4X1KA 3K72B 3PIRA 4HP8A 1CJTC 5LA6B 1W0JD 5ALIA 3RFXA 1H2BA 4DCVA 3WXMA 1RW4A 1BW9A 1YS2X 1OPXA 1ZWKA 2G5TA 2XXBA 2HBZA 1JXOA 2IHYA 2FPPA 4I4TB 2D1TA 3T3OA 4WBNA 3GJTA 1QHHA 3I5MA 2AOXA 1R3DA 2JS7A 1VJ5A 3MMNA 3L05A 3DDCA 3SEAA 2JIZA 2WYIA 4X97A 3U3OA 5EJ9A 1BD4A 3AEZA 1B6TA 4UBOA 3NG1A 1CZUA 1O9BA 1P9RA 3EDRA 1Z33A 3EXHC 5FWAA 3DLBA 5ITZA 2NO0A 1UBGA 2Y1LA 4RVOA 5AUQA 4UREA 2YCBA 3P0RA 1ZISA 1NBOA 2NUBA 3R7FA 5T7BA 3BBLA 3EJWA 2BBSA 2OCYC 1MABB 2QUJA 4L8LA 1PR0A 3A26A 3QYAA 3OTOB 3RYFA 2NYUA 2XMDA 4BLTA 2EBHX 4OO3A 5C3MA 4ARZA 4XWAA 2Z6UA 4G5HA 1LRLA 2C4WA 3HR7A 3DMTA 2GA8A 1O5TA 2Y77A 4LZAA 5ALQA 4FB5A 3D6MA 5K8UA 4NBSA 4N7BA 3ROEA 1X1TA 3M6IA 4BB9A 2CCJA 4XJVA 2OHGA 4ARAA 4MAAA 4NG4A 3WP1B 4OI4A 2R6DA 2NSDA 3G2QA 1HRKA 3KD3A 2R2GA 2WU1A 4V24A 2FPUA 3VUEA 1XNRB 3PFHA 4HNVA 1WMFA 3E03A 4YDHB 2PX5A 6REQA 5I7OA 3V46A 3KVRA 1NW5A 4E94A 3CZMA 2YWEA 3LCVB 5AVKA 3PXGA 1OXMA 2O8DA 2YWDA 3J81k 4QAJA 3VR3D 3DOIA 5CLLA 1X87A 2RJOA 5G2OA 4I55A 4LQLA 4HN2A 4CIYA 3TS1A 2NVOA 3DYVA 2QORA 2O5VA 2X6TA 1TU4A 3CKMA 1ECFA 4LA4A 4A8PA 2H31A 1NDUA 3UMJA 1R10A 1UFQA 4PYRA 2XWJI 4PZUA 4XGIA 1V6AA 2I76A 1R3UA 5M3BA 2P6NA 3P97A 1EK0A 3CLTD 2QU8A 1YONA 4UOZA 4NYJR 3UGTA 4FWBA 2JW5A 1BXKA 1GNSA 2BONA 1F3OA 3U5ZB 3E8MA 1HNNA 1ZRSA 2PHZA 2VYND 3U7JA 1KKLA 1OASA 1WB6A 5K4AA 1SK9A 3UNXA 3GQBB 2FQWA 3LLSA 3AHJA 5EXPA 4DABA 3R5SA 4OU5A 3HCAA 5LPNA 4RJKA 4WAUA 4IFTA 4RL6A 1EU1A 2P11A 1NJ1A 1QE0A 4ZT4A 1VLHA 2IBTA 1TAGA 5A3RA 1JZTA 5A6SB 2NUTA 1JSCA 2VQ3A 5FUVA 3OAAD 2D3TA 4HCJA 1DJNA 2E37A 4KAAA 5CDFA 3RUPA 3RVKA 4E2YA 3A1VA 1EGHA 4OAOA 3R0ZA 4PSKA 3SHQA 3WYDA 3ZLTA 4ESEA 3K2QA 4C2AA 3KX2A 2WSLA 3IILA 2Q41A 5I4CA 1USWA 3ISTA 3LBFA 3OQVA 2PUFA 3RBAA 1XPOA 1YZUA 1GU0A 2X9VA 2KI5A 4UULA 3REOA 4URFA 2ZRCA 4BYGA 2ZBUA 3DHWC 5BN5A 1YVPA 3C85A 2FN4A 1CIJA 4IDDA 1UMKA 5L7WA 1OAAA 3PVCA 2GFHA 1SCKA 5JSFA 3LQ4A 3F90A 1YRYE 2F7SA 2PUTA 3BEOA 1A69A 4LC0A 4EPTA 3NM4A 1H2ZA 1QO0A 2SECE 1UFRA 3AKYA 4AG6A 4G4JA 2VG8A 2NXCA 2PUHA 4TV9A 3LMKA 4UE2A 4UTZA 2V3CC 3JD0A 4DIUA 1OIWA 2A33A 3JR3A 4FFBB 4MWCA 4RMIA 3IL2A 1T3GA 2IIQA 1IFXA 2Y1WA 4L51A 3W04A 4HDNA 2XEDA 2IH2A 4P7KA 3JSAA 3WDSA 5JQWA 3DZ8A 4AZWA 1UWCA 2XNDA 3AF6A 3HDVA 2DHRA 5CVUA 2JGJA 1KAEA 3V1TC 1SXPA 2WUEA 3FLMA 1N1DA 3CNHA 1BX1A 2PIDA 3MJ4A 4G24A 5FHQA 1NIPA 3WQBA 4TLMB 3QPUA 1L7DA 3S1AA 4B6EA 3ITDA 3KXLA 5BV0A 3EA4A 4B82A 3P26A 1WNTA 1HTTA 3HSSA 3QUSA 4I6EA 5I9SA 4A03A 4GDFA 4N76A 3X1KA 1MPTA 2FGJA 1O87A 3QYPA 3AP1A 1DX6A 5U4QA 3RW9A 3BWBA 4AS2A 3NHWA 4LCJA 5LOVF 1Y48E 3KOXA 1G7CA 4XM0A 4CTOA 4CR7A 1PI3A 2WTXA 3RR2A 3ANNA 3I6IA 1SD2A 2QD5A 4CIAA 2JCSA 2JZNA 1GKUB 2YXLA 3T8YA 1R4NB 1BJKA 1B42A 3QTTA 2VQSA 4M8IA 1V96A 2KQUA 2CL6X 3DTVD 3M34A 4JX8A 2HJHA 1HEYA 4J49A 2YYSA 4B71A 4CXMA 1BCRB 2ZSBA 3FTPA 3HDGA 2ZUEA 2W2PA 1E7WA 1UJ2A 2BTQA 2OZLB 3K73O 2UXCB 1DBQA 3VPGA 3OJOA 4LJ5A 1ZMOA 5DEOA 1OBHA 4OMCA 3IAUA 2VDLB 4MKGA 1OMOA 4DANA 4L50A 3RNLA 5BQFA 3MSCA 3C5EA 2HU2A 3N8HA 1BFUA 1GTJ1 1A4UA 5BQ3A 2GEFA 2WWGA 1FRNA 3DMFA 1PQUA 2QTTA 4LYAA 3WLEA 3K71B 2UYGA 4DR5B 5CBPB 3S0JA 5COQA 2QGFA 5FTNA 3PIDA 2ZSIA 4OLJA 1QZUA 3LHIA 4QU0A 4JHXA 3GL9A 2A14A 5I9LA 3JQ8B 3C24A 4TMVA 2YZKA 4IVPA 4KLRA 3T7JA 2HRRA 1G6HA 5FTMA 1JQKA 2D74A 3O7MA 1CUFA 3U0VA 1WCYA 3KPJA 4A2QA 1DMSA 2WJ3A 4MUHA 4MVJP 2P9BA 4FE3A 1JQBA 3OT5A 2GFQA 3KDSE 1AUVA 4FGWA 4QPCA 4TGLA 5CNMA 1N9GB 1KDVA 4YLYA 4JZYA 3OE7A 4KRXA 1M6YA 2VK2A 1ZL2A 2VYVD 3P94A 4QFDA 5IF3A 1PKXA 1SG6A 3GLHA 3NHFA 1JAZA 4HDSA 4KE8A 2C4KA 3GK3A 3LVQE 4R9SA 2G06A 4DVJA 5JDIA 2VA8A 4DMKA 5C1IA 4R1UA 3T0FA 4C06A 1C80A 1UBCA 5ELXA 1PUJA 4F97A 5E7JA 3LCJA 1PHRA 4HDOB 1H5QA 3ETNA 1FNCA 1YZHA 3HC7A 4KWEA 2BR4A 2XNHA 1FFXB 3I9FA 1ZNWA 1T1SA 2J07A 2ZBFA 3NAGA 3NBAA 1X3SA 5IWAB 3Q6IA 3ZKAA 2JCXA 5AI9A 3RC7A 3SYTA 4BJ5A 4YN3A 3EPLA 4Z9AA 5HQTA 5IBPA 1PSWA 4MUGA 2IYFA 2E6UX 5JQGB 1CDDA 1LWOA 2G77B 3F6RA 1YI8A 5HCNA 4EOGA 1FX0B 4ASUD 1WS6A 1E63A 1G5IA 2IBMA 2PYDA 1YRWA 3GLTA 3MJEA 2YNMC 4GYJA 5DXJA 3WLLA 3ZWAA 1GD1O 5DLYA 4QKQA 1YBHA 2VF8A 4AECA 4Q0MA 4ND7A 3A6GA 2O05A 2R8ZA 2VKQA 1DRVA 3HYCA 4FR2A 1A76A 2KLBA 3TR6A 2GZMA 2M1ZA 3ZDZB 4TQAA 4MDHA 2R97A 1FZQA 5DO9A 3QENA 5DWDA 2JDIA 2QL5A 5A5DA 4NH4A 1G16A 1HZZC 2QQ5A 3A2MA 3LOQA 2Z9BA 4IDOA 4L5YA 3AVVA 2F1IA 4PPNA 1DIOB 5M5BA 1IUNA 1KIMA 5F3RA 1UL1X 1X77A 1K2VN 5ITVA 4IDCA 1QJ4A 1AQUA 2NIPA 2RGAA 5F7ZA 3VNSA 1VMAA 2JIMA 1U7WA 3KAJA 5DGXA 3SKVA 4AJPA 4XSHA 1VJDA 3Q12A 3ZKWA 5BUCA 1DCFA 1XP8A 3ZWDA 1H4TA 1KAGA 1MMFB 1U7OA 4PAOA 2LRHA 3RG2A 2BT4A 2BEKA 1IC6A 3LHDA 1LU9A 5IMBA 3V4OA 5K8JB 3OO0A 4JUFA 2YIJA 2R1TA 4Q7JB 3TIGA 2H18A 2HSWA 1UFKA 1U3VA 2QBYB 2I9PA 3ZDDA 2XVXA 4N3NA 2OG2A 4EPYA 4F1KA 1HOTA 2BR3A 3PFCA 5F21A 3AVXA 2QUAA 5DNYB 4EB3A 4RMGA 3M49A 1QZXA 1H2FA 3FROA 4MUMA 4BO8A 1DLJA 3H8JA 4ZT6A 3E0XA 3TINA 3TNFA 5L9AA 3UT5A 1WABA 4YECA 3WGUA 1SVSA 4YI3A 5TF4A 1UEIA 2ZUCA 3FNQA 3L7YA 3WB9A 2YZ2A 3V9PA 1YJ5A 4CM7A 2OFXA 3PUYA 1B2LA 4UM8B 2C2YA 1QIKA 5KQRA 2J5RA 3FMVA 4TKZA 4BLWA 3I9LA 1VSBA 2NT3A 2NZXA 4RS4A 2Y05A 4BEBA 4DMHA 1YHYA 3PUIA 2CHUA 4G8BA 4BBAA 3CLKA 3H2SA 3NT2A 1MOQA 3R09A 1J5EB 4E4YA 1LRKA 4V0NA 3MS7A 3DE0X 3TW6A 3W6ZA 2G28A 1IXKA 3T7KA 3ZK7A 3DC7A 2OBXA 1LD3A 4C03A 1M7HA 1SCDA 4ENUA 3OQ1A 4HRVA 5LBUA 1KE2A 2JD0A 1PEKE 2AQ8A 1EZ1A 3Q3VA 3ZTWA 1QDUA 1E2NA 2OV6A 4BRSA 4DMLA 3D0QA 1J2RA 4EIWA 5JRZA 3VMMA 1DT5A 2H5IA 3TK1A 4BV3A 1JH9A 3BORA 2ONCA 3V7UA 4E5NA 1FSPA 5HOQA 3DG9A 4G9EA 2BC9A 2XBUA 4J1QA 4M89A 4QGBA 3WJ2A 4DLPA 2IIBA 3N2KA 1XYYA 2DPGA 2Q5HA 3KAKA 3O8OA 4UDNA 3VR5A 4CCYA 1BXGB 3HKEB 4L6AA 4CM4B 2AKEA 3OQIA 4AUKA 3SIPA 4CWAA 4ZT5A 3Q7EA 5FT9A 1XN4A 5AVRA 2FTKE 1UJBA 2PRYA 2IU4A 3L8CA 3E4DA 4RYDA 2UDPA 1ZLXA 4MS4B 1TCVA 3WGLA 1VGVA 3UXMA 4MQEA 2XW6A 1UAGA 1HT0A 1OOEA 2OAQ1 4PIPA 1C0EA 1GG8A 1X94A 3JYQA 4UNSA 3U3ZA 2ICAA 3S81A 2N9UA 2FXIA 3L79A 3CX6A 3JALB 3LPLA 5BSWA 1ULUA 4RENA 2NO4A 2PEYA 2EJWA 3A06A 2WG2A 3M3PA 1QX3A 2NMVA 1VLQA 1CRLA 1A88A 1ADCA 4CKYA 5BNWA 1D5CA 2J0VA 1AE1A 3ZZUA 1PJSA 4OXNA 1M8JA 3QVGA 4BX9A 4O2BF 2QDXA 3QF4A 1Z35A 1JIQA 3UFXA 2FPIB 1GWNA 2OBBA 3L3BA 3PL1A 4NYIR 4F2DA 3R9WA 1HI9A 4EYQA 3AOEC 4EVRA 2WP8J 2X2PA 1QAOA 2FN9A 1TA4A 3IFSA 1ZNYA 4KUGA 2WLSA 4BFSA 3QJGA 3MWYW 4KO2S 3M82A 1Z4JA 1J2UA 1RM5A 4UARA 3PQ7A 2FPGA 3VR5H 2CB0A 4FCVA 1Z4NA 2A6PA 1PR2A 1KVQA 3F1KA 3K2BA 4ZRDA 4B6RA 3KXDA 3X43A 4PG8A 3N28A 3LT5A 1FFHA 3U4DA 3BRWD 5JCOA 1MX5A 4IEEA 4KYTA 4RTQA 1T35A 1KZ7B 1LK5A 4FCTA 5EOVA 4CODB 3EWAA 4J7XA 2W6ZA 2OQVA 4UDOA 3W05A 2FCAA 2PX4A 1AMOA 1JWLA 1ZRMA 1GCOA 1U2PA 1CUAA 1AK2A 2ZDGA 3T7SA 3USCS 3BXEA 3HCRA 4NCNA 4TPKA 2HF7A 1IBSA 3PG5A 1MAUA 2GPSA 2R6AA 4MUIA 5GAJA 1GSOA 3TRKA 1IN7A 3HN2A 3EG9B 3ZBPA 4RNDB 4RFVA 4QWWA 4F4UA 5BUQA 3ADDA 2Z8XA 1EFUA 4MGKR 4X1IA 5FUXA 4KVGA 2IV3A 4ZGWA 4LF5B 1QR6A 2D0IA 2XYPA 1AQLA 4GI5A 4L57A 3VBCA 3NATA 2CXRA 2MYTA 1QTIA 1O95C 4IQ0A 4M86A 4C87A 4Z1MD 5BN4A 1XI2A 1QFMA 4URWR 4QDKA 3U61B 3C8UA 3ZY6A 2GAJA 4ZD6A 4L8GA 2WWIA 4N5HX 5DHQA 1PJCA 5TNXA 2NXEA 2D00A 2C2OA 1IATA 1JILA 2BDTA 2XSZD 1W30A 4OFWA 1T24A 2RGNC 4U2BA 3VU1A 3AF4A 1DXOA 3GD7A 3R40A 4HS9A 1KMNA 2YHUA 1CQIA 2I3BA 3G0OA 3LLCA 4MVXA 3DOJA 3R0QA 4IH4A 2IPXA 5AM5A 2XIQA 3K6SB 2VT2A 3EEQA 1JMYA 1TCCA 3PNYA 3VDRA 1KO8A 4QPDA 5ER9A 2Q5EA 2XYHA 3GGDA 3HP1A 4XYLA 4FTWA 4RHYA 3VI3B 3UV7A 4N65A 4DR2B 1MW9X 1ENZA 3CBQA 3LF1A 3KV3O 5FOVA 4KWIA 1O1YA 2JCGA 3BOSA 1T8TA 3BICA 5DCWA 2QX6A 3D6AA 5ARBA 1QIGA 4C3ZA 1ZM3A 4F3RA 2WSMA 3RWBA 1MAHA 4C1NA 2NTEA 2PXHA 2VJBA 4IXWA 2K5UA 1OSNA 1TAUA 3NAZA 1RABA 3AU9A 3PD0A 4IQFA 3CJRA 1KK1A 3N2EA 5JJKA 7ABPA 2G9ZA 2AEJA 4EY4A 1BQ4A 1C1XB 1IY2A 1M6VA 1TLLA 4OFBA 1YB1A 2NW6A 1U8YA 3R6WA 1BGWA 1KZHA 1USIA 1SXJC 3N5KA 2QLLA 1L3IA 1JN0A 2WPNA 3P9KA 1QWOA 1NRJB 2I6GA 3PV0A 5HUHA 2Y1EA 4UEKA 2BYTA 4LX0A 1A4IA 5DW3A 3LXXA 3EPHA 5BPHA 1Q17A 1U7TA 3BIOA 4DDWA 4PCVA 2IZ5A 2RCNA 3O3OB 5C4IA 3QA3E 1I7LA 2I7TA 4IJVA 4BDSA 3SYMA 1VBFA 2EDCA 2WJAA 2YX1A 4ZQEA 5I6DA 5ITWA 3PDHA 2FW7A 4FR5A 4F21A 5JFTA 3AB3A 4TQ9A 1O95D 3DUFA 3PEUA 2KYRA 5DF1A 4DLVA 3A1SA 3NHSA 4EL0A 7REQA 4IFEA 5SYNA 2WFAA 1TEVA 4HB0A 4FIZA 4HAIA 2ERCA 3T1HB 4DKJA 1X9GA 2F64A 1PVVA 3F47A 4X20A 3ZHBA 3EEOA 1GL7A 3ROPA 4AKSA 5D3MB 3MLBA 5DWVA 4E2FA 4EK9A 4LN1A 2O3QA 3G2LA 3H5TA 5IDWA 2DKNA 2EG5A 5L3SA 2ZWOA 1QS0A 2WMDA 2ORWA 3VZDA 4OGWA 4OQYA 3K09C 3D9QX 4DSZA 3DCJA 2ZQ5A 3IQFA 3EEIA 3W0LB 1T8WA 1OGIA 5JEDA 1U3DA 1ZGCA 2C04A 5A5EA 3EUWA 2OM2A 4ZICA 2ZULA 4ZAYA 3BHMA 4JN6B 1AS0A 2AFIE 4M36A 3DNFA 4NBLA 1LDYA 4R6WA 2CD7A 2XQKA 4FDTA 3PEYA 3L7CA 4KQ1A 3H97A 4E5KA 4KAFA 3RRJA 3WIOA 5ALVA 1UPFA 4ZANA 4BQRA 3HKCA 3MQFA 3V8BA 3QBDA 1QLHA 1IM8A 1DDIA 4GX0A 4EUHA 2G5CA 5DKFA 5FFFA 3L4BA 2A92A 2WTEA 4MS3B 1QE5A 4OA5A 2VLBA 4WJKB 5INTA 3E82A 1IOWA 1BJTA 4H15A 4G63A 1JG4A 1I1HA 4KPUA 4WOPA 2AN5A 1SXJD 1QGZA 5E4TA 3E1KA 3BCSA 5EXEA 5BW6B 2XJ9A 1W2HA 2G07A 4G5GA 4E5YA 1HT2E 2QS9A 5LP6B 3CT4A 2QTCA 5A04A 1EM8A 2VLIA 4MUEA 1IONA 1YASA 1P4SA 2CXPA 3OPYB 4N8EA 1B0PA 1K63A 1X80B 5DFAA 3PQDA 1N2SA 4EX7A 1CFJA 2AE1A 1J1ZA 3OZEA 4RXMA 5CFRA 4Q4HB 4A15A 1HTBA 1I6LA 4ZCQA 1G20A 1PN3A 3DEIA 1EFCA 3I2HA 1OX6A 2GMWA 3G1UA 4N0PA 4EZBA 1KJJA 2R7NA 1NQOA 4UJ3A 4BNXA 4RTOA 1MKYA 1XVIA 1C0PA 2HRCA 2C8LA 1IVYA 2C42A 4JUAA 3CRZA 1XQXA 4Y2TA 3TVDA 1TQ2A 3OUUA 4ADSG 3ZVKA 1FTYA 4IZHA 1N3YA 1U0HC 2H7YA 3LQRA 3MB8A 4QJBA 1G1AA 1XZNA 1JQEA 2XKAA 3MCTA 5CM9C 2CXTA 3EZ2A 1UK9A 1FNDA 4FT2A 4UHDA 4F72A 3R8XA 2ZXEA 4UXIA 2HPVA 2H7XA 4O25A 1B74A 2YV1A 1B8VA 1D0IA 4HNSA 3V1UA 2QNBA 2ZUSA 3V8MA 1I9GA 1M67A 4B7ZA 1JP7A 4LF4B 2ZZKA 4EGFA 1CZNA 1UDBA 1JIXA 2IYNA 4LRTB 2J4FA 4NV0A 3D6VA 5EHIA 5ENDA 3RRYA 3TSWA 4U7TB 4U0JA 2O5RA 3EZYA 3PF9A 3QPVA 5LM3A 3GPDG 4KLZA 3Q3JB 1K5DA 4ZYXA 3MC1A 1EVIA 1V7QA 4MV5A 4BRZA 8AT1A 4K9RA 3GGJA 2FW9A 5HVNA 2LWIA 1UXGA 1DAOA 5BN1A 1BHO1 3I34X 4RMJA 5NLLA 4YC7A 1CYDA 3I73A 4DBVO 3SWWA 3ETCA 4MQ6A 4NHOA 3EYAA 1Z9BA 1ZS9A 1DJMA 5CTJA 3Q8KA 1EE1A 1XVUA 5DTJA 1F9EA 4YJHA 5T6BA 4LRSB 1HDCA 1DJLA 1Q92A 2HWXA 1BWPA 1WD5A 2WQZA 1OFVA 3T7DA 3ZTYA 2XUOA 2YICA 4FN5A 4WWHA 2FFRA 1KMCA 2A0WA 3ZU3A 1K7CA 1JHOA 2ZUBA 1DMRA 3BC1A 5LSAA 1N2HA 4QVGA 4N54A 2G4VA 3EAGA 3HA5A 2AXEA 1S2IA 5FBQB 3TZBA 1FMTA 4KE9A 3L8GA 5BRNA 3DMYA 1E18A 4H3HB 3SQDA 4KXMA 3L5KA 3FCXA 1QP4A 2X5KO 2RHTA 1AT1A 3W2TA 3KOUA 4DC1A 3R5TA 2XVYA 4JEHA 2WYWA 3IQZA 1A8SA 2BMJA 1RLTA 4R98A 4B9AA 2N46A 2XRYA 2E7ZA 4OB6A 4PGGA 1T9BA 4BNMA 5CDFE 1H94A 1GNRA 3CVJA 4XOUA 4AMVA 1S8AA 4JT8A 3WRVA 4MWBA 3HNPA 4RAOA 1TL7C 1Y5RA 1Z38A 2R62A 2C7QA 4FNAA 1VHLA 4P35A 3GBVA 1NLFA 2O4CA 4TKLA 4OSPA 3MT8A 4WESB 1CNEA 4CF6A 4CQMA 4C4OA 5TMBA 4RGYA 2G36A 5HX7A 4RVUA 3FHCB 1PR9A 2P5SA 3FAKA 5B3AA 1GYPA 2QV0A 2MJLA 3AEKB 4FCWA 2HKIA 1T8YA 4U00A 1X1EA 5LQJA 1KBOA 2V6FA 5EIFA 5EQFA 4R8VA 1RQ2A 5B12A 3R9XB 2CKDA 4FJ1A 1DTWB 3B12A 3OCJA 2V9PA 2WJHA 2Z8YA 1E1RA 4LQCA 2VOJA 2AN4A 1X7DA 4MLPA 4QLAA 4RX1A 5FI3A 5J47A 1JLKA 1Y8AA 1QTRA 1EFRD 1IPHA 5CR9A 1FFEA 3TMKA 5CFLA 2WHRA 3IP9A 3IAHA 1XV5A 5ES4B 3WKBA 3ZOKA 4NK5A 2RK4A 4N39A 2BGGA 1XMJA 1EX1A 4LJ9A 1O8CA 1XKQA 3LUKA 4H59A 5I3ZA 1M2KA 4Y2HA 3SEFA 2AWOA 3EXIA 3MLAA 3QEMA 3R23A 4FUQA 1ZN8A 1KPIA 3KE9A 3WBKA 4KQWA 5IVHA 4UU1A 3LGXA 4MS1B 3A3YA 1C4OA 1E99A 2MSNA 2Q3FA 3MBOA 5TJHA 3RBXA 3FFAA 2QQGA 5I7UA 2LUOA 1KU6A 2ZJAA 3GUZA 4BX3A 2YS7A 2Q4TA 3WQQA 2G17A 3EDQA 4TZ0A 1A1VA 1B2RA 2AG8A 2DFPA 3GJ8A 1RT9A 4LUCA 3VFDA 1W36C 2MYNA 2IU3A 3W1WA 2RGXA 1YA8A 1SBZA 4DCCA 4ND4A 2WICA 3NHKA 1AQYA 3FCSB 4WOCA 4Z9FA 2F1OA 2EJTA 3A4IA 1EUZA 1T3SA 3UWDA 2VJMB 1GV0A 1C1DB 1QG6A 1QVRA 3EIEA 1L5FA 1HLGA 2Z57A 1V7PC 5LMUB 5BYJA 1H3EA 1TJPB 2R1VB 1K7YA 1RAFA 1XZPA 2GBIA 2Q5OA 3LFTA 3R2JA 4FWIB 4DVGA 5FL7D 4RNCA 4LK3A 1QP0A 2BEUB 2DBVO 5ALNA 1MP0A 2XVAA 2A9JA 4NFYA 4NBKA 2WIBA 2VHJA 2I2FA 1NF9A 3AM3A 1I0LA 1OGJA 1HDGO 2P27A 3DS8A 3K0AB 5REQB 4R6XA 3VHXA 4M0KA 2E9SA 3H0CA 2AI3A 4DMRA 2P2SA 1QFZA 1CUHA 3MSXA 3GP3A 3LPDA 1BX0A 1JVSA 1YT5A 4POOA 2BFCB 3BE5A 4K9NA 1G55A 1QLWA 3OFNA 1VJRA 3M1YA 2P41A 4G86A 4OGGA 1RTTA 3MGGA 1IN6A 1S2GA 2DHCA 5HE8A 4CBVA 5JC8A 1GZ7A 3M5PA 2ACEA 4DLUA 4BBJA 3AESB 3FPGA 3DE5X 4ZODA 3S70A 2XOEA 2WF7A 4XCVA 4DRYA 3B7WA 2GCIA 1N0UA 3MM4A 1D2MA 4IIGA 2QLMA 3ASZA 3DV2A 3F49S 4LXTA 5AH0A 1CQXA 4PCLA 2X7JA 2KPOA 4OTZA 2VWGA 5SYMA 3QOWA 2MU1A 5AUNB 2C58A 3ELUA 1RHMA 3GLHE 4QGSA 1EBUA 4YV0A 4UVGA 4IDQA 2HF9A 4BMOB 1YK0A 2H2WA 1Y9EA 4IVRA 5J4VA 1CQPA 3ONNA 4X7MA 3OQHA 1N7JA 2IELA 3N9IA 4JEUA 3PUXA 4H7FA 1SCJA 1LJLA 3ZV5A 1NYLA 2WT8A 3W79A 5LP1A 4X6YA 3BGSA 5KU7A 1JFVA 3STWA 2D13A 2QLTA 5MFZA 3ZWPA 3AQIA 4DDUA 1I13A 2JFFA 5FA6A 3CG4A 3FHOA 4RF5A 2FMFA 2DLNA 3AJ8A 3EG5A 3FD8A 3JQFA 3KM0A 4FT4A 4M7OA 1BW9B 3RK0A 4BU1A 1DOAA 2ECQA 3LC0A 2FKNA 5M7EA 3S2SA 3QUAA 1IVSA 2A1TR 2FAXA 2FPPB 2ZVDA 1JG1A 1U0EA 2YWJA 1UBNA 3GLUA 4JODA 1A7JA 3ZXYA 4OD0A 2DAPA 4WBNB 2H3EA 4Z49A 3GGCA 1HSOA 2O3UA 4C5AA 4DC9A 1ISFA 2QRZA 1KVSA 2WAOA 3D6HA 3A70A 1N6HA 5FPYA 2C29D 4JXZA 4Q1DA 2FWIA 4HDMB 5AHRA 5ITZB 3SMVA 2D2FA 4R1QA 4H17A 1Y0BA 3W6NA 3VC1A 2OTCA 1CRZA 4YMVA 3FB4A 4NXNB 2WOOA 4RFSA 3PJRA 2CXSA 1J0BA 1M6HA 5G3YA 1V4BA 4MP3A 4BHTA 3RYFB 1QH1A 2HO5A 2XZPA 1Z2OX 3EBLA 3JASB 3Q0TA 5G0WA 2PZAA 2NACA 3OEHA 1G5TA 3B8HA 1OY1A 1Q0SA 3PICA 2F2TA 5B3KA 2IUUA 2XCQA 2ZRPA 3GFQA 3VNQA 4ARZB 2PYZA 3W8NA 3OIFA 4RIGA 1TYEB 1C2YA 1KDTA 2CJXA 3EPPA 3UYKA 4HUQB 4Z3KA 4ZDKA 4CFSA 2BGUA 1H05A 1SZCA 4WEOA 4KL8S 4E2ZA 5CDGA 1QG4A 5JAOA 2CNWA 5GJVC 4AG3A 3BE8A 4B75A 4F1WA 5AVYA