4CQMD

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
247
Chain Sequence
SQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 247
sequence length 259
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmD00
4N5NA 2R00C 5CEFA 4K6FA 1EVZA 5ILGA 4XRRA 4YQZA 4ESOA 5TNXA 5T64A 2GZ2A 3AOGA 1E5QA 5ES3A 5A5EA 4TSKA 1LQTA 1KC1A 3JCZA 3E9MA 1PSDA 1XU7A 2ILTA 2I99A 4EUEA 2Q4BA 1YRLA 4ND3A 3NT5A 3KRTA 2HMTA 4Y6SA 4FFMA 4WLUA 2NWQA 5G0UA 3C85A 2BGKA 4EITA 2OHXA 4G65A 2YFQA 4IQ8A 2ZB8A 3WX0A 3PPIA 1BRMA 2RBEA 3H6KA 3WOHA 4GQAA 5TIIA 3T7EA 3CE6A 2P5UA 3ONFA 4ALIA 4YR9A 1A4UA 1ADGA 2HMSA 2W8ZA 4J7XA 3SEFA 5A06A 5ICMA 5K6AC 2YFHA 5ITVA 1Y5MA 3EY4A 3OQ1A 2NQ8A 3H8VA 2J3KA 4RL6A 4TRNA 3QSGA 5JNLA 1HF3A 2RCYA 2WDZA 1E3SA 2PK3A 3ZHBA 4F6CA 1Z45A 4D0RA 1FMCA 2NU8A 3T4EA 4BB6A 2A4KA 3RBVA 5EMHA 1YQDA 4M86A 4Y6PA 5CEJA 5THKA 3NTQA 3IAHA 2VWGA 3LSYA 5L40A 1KYQA 4WOJA 2ZCUA 3GVHA 3V2HA 3EAGA 3QRWA 3DWFA 3VH1A 4XDYA 2DUUA 2O7SA 3PYLA 4BNVA 3D4NA 2OGUA 4NU5A 3H3JA 1GV0A 3VH3A 2BFPA 2GGSA 3O26A 2IE0A 3ZHZA 5K9ZA 1H9AA 4GH5A 2PGJA 3F5QA 2NADA 1DAPA 1DB3A 4WLFA 2GSDA 4XYEA 3CPSA 1HEUA 4PLZA 4LCJA 5KKAA 3VAZA 4B7XA 5ENDA 3TZKA 1WPQA 2JCYA 2YV3A 5L7TA 3MEQA 3A14A 4Z0HO 2Q45A 2J3HA 3OIFA 4YACA 4QTZA 4BL5A 4BMNA 2P5YA 1UZNA 1DFIA 4R4JA 5JCJD 5JAQA 3DMTC 3RC7A 2Y93A 3WGTA 3UKOA 3OIDA 4DPLA 3PWZA 5BQFA 1KIFA 5KNLA 4P38A 3JQ7B 1PQWA 2CF6A 4XQGA 4H16A 4GGPA 2IZZA 4MIEA 1QP8A 5DULA 1SEPA 4JLWA 5I7EA 1RWBA 3DZIA 4RVUA 2X1HA 2ZCVA 1O8CA 4FQ8A 2D5AA 4WLNA 4PG7A 3PRJA 3CXRA 3I5MA 1KEVA 2PD6A 1JWAB 4JP2A 4ND1A 2TMDA 5HS4A 3NX4A 3TL2A 1YS4A 2DAPA 4U6QA 1H6CA 4W9NC 1WDLA 1NWCA 2HUNA 4PLVA 4YQYA 3R3JA 4JP3A 1MA0A 3JQ9A 5T5QA 3O8QA 3DBRB 5EL0A 4ZGWA 3HFGA 2VRCD 1ZIDA 4D3SA 1LJ8A 1GQ2A 1E3WB 1PJCA 4CQLB 4PCVA 1OC2A 4ZRNA 2IXBA 4CL3A 2PTGA 5JAMA 3F46A 4DVJA 1HLDA 4CMEC 2O2YA 3KUXA 1AUPA 4KWHA 2DPHA 3WLEA 3KO8A 1ISMA 1GAEO 4XGKA 1J6UA 2G5CA 5A04A 4ZQGA 4BVAA 1B0AA 1ZEJA 1I2ZA 4FGWA 1X1EA 1SO8A 4MVJE 4QO7A 5G0SA 3OEWA 3WMWA 3K6JA 2O50A 4YJHB 3GLQA 4Z9YA 3JYLA 1QKIA 3P5SA 1U3WA 3LDHA 5LDHA 5JDCC 2IYPA 3HDYA 3KHUA 1AXGA 1XSEA 4GWGA 3RC1A 4Z0PA 4CMCA 2HU2A 2PZLA 1QSGA 3BTVA 5T8KC 2B35A 4KP7A 1I36A 3Q0EA 4FJ0A 5KVQA 3OHSX 4FOSA 4MVJD 4Y67A 5CDGA 2V6BA 3B1JA 5F1OA 3W6UA 2Y1DA 2H6EA 1PGQA 1YB4A 1MFZA 3NDRA 3PYXA 3E5MA 1N7GA 1SC6A 3EW7A 3CINA 4XB1A 5IXSA 4J2HA 2WD8A 4O63O 4R9SA 2EKPA 1IZ9A 4ZN6A 1R4MB 2BLLA 4H7PA 2X5OA 4FDAA 4IIUA 1WP4A 4D7AA 4KTTE 3IQDB 4D3FA 2W2KA 4OIMA 3CZMA 1DEHA 1WW8A 3KEOA 1PR9A 1XIVA 4R1UA 1ONOA 3V1TC 4BO6A 4BNUA 2RHRA 1YBMA 4ALMA 2BI7A 3GFBA 2DU8A 3PJDA 1EK5A 2EXXA 1YB1A 4E5YA 2EERA 1NPTO 4J0EA 5ENVA 4BNMA 2DVMA 5JDIA 3RD5A 5HWSA 4MVJI 5KVVA 3SJUA 2EP7A 3UAGA 1J0XO 2DBRA 2O4CA 4L0QA 5FYDA 1O89A 3HNPA 5JE8A 4YA6A 3RWBA 4LVUA 4TRRA 2R00A 1G6KA 3JQGB 3W4JA 4DMMA 3CKYA 2X86A 1GUZA 3QHAA 2SCUA 4RZIA 3DBLA 4ILKA 3ITDA 3GOHA 4RF5A 5EERA 3V2GA 4LVCA 4BNJA 4GWKA 5A05A 1ZMOA 2FY8A 1C0IA 3DR3A 4E5PA 2FWMX 3GDOA 1ZMTA 3TDKA 4I5GA 4RF3A 1QRRA 4AJIA 4XYGA 3PJEA 1NTOA 1XELA 4QX6A 4H3VA 4KTVE 4NFYA 4A73A 3BYZA 2ZK7A 1XKQA 4YJGA 3HN2A 3U62A 4MVJF 2EKQA 1X15A 1JWBB 3I9OA 1I8TA 4BO0A 5K6AA 1YBAA 1PX0A 4TRMA 2BI8A 1L7DA 3MJSA 2C2XA 4PLHA 4EDFA 2O7QA 2VTDA 1JQBA 2RAFA 3MZ0A 4QECA 4PN3A 5F5NA 2ZB3A 1CQJA 1Y6JA 2HCTA 3D5QA 3ST7A 4E4YA 3TPCA 3FHLA 2AG8A 1WDKA 4FJ2A 2VNSA 2ZQYA 2D1YA 1H93A 4YAKA 2FR1A 1P1IA 5JC8A 1ONPA 4E21A 1P3DA 1KOLA 1XHLA 3PQEA 2DPGA 2FP4A 2EW8A 3L07A 4ZICA 2O48X 3COSA 4YJGB 4DPMA 5BNIA 2FPIA 2FPPA 3DXFA 4KDEA 4R01A 2Y1EA 1N7HA 1P44A 3LYLA 5A3VA 4NZ9A 1ZH8A 2DLDA 2NUAA 1P74A 3F9IA 1U5CA 4U7WA 3RQSA 1P77A 2VZ9A 1ZW1A 4XZ3A 2FSSA 2POQX 3KYDB 3KM0A 3GEDA 2NVUA 4J9UE 4O6VA 3RASA 2R6JA 2PFGA 4FD3A 3D7LA 4RVSA 4S3MA 4OM8A 1UXIA 1PL7A 3H7AA 4DMLA 1MXHA 4RVDA 4WKGA 2NU6A 1YDWA 1KEUA 3JQ6A 2BFMA 3BHIA 1HDRA 2YV1A 3GN1A 2HMVA 1NP3A 1XQ1A 4LRTB 4YVFA 3PWKA 4DRYA 4MPDA 1F8GA 4LW8A 1HDGO 4YDRA 1Q1NA 4WE3A 3W8DA 4BNHA 5GMOA 2X58A 1NFQA 2JFFA 4PZDA 4BGEA 2W90A 3AFMA 1IB6A 4ZHSA 1W8DA 1Y9AA 4I8XA 1GQYA 4W9NA 3OICA 5CDTA 5ICSA 2FN7A 4QXMA 2JCVA 3BAZA 3GEGA 4FC7A 3UW3A 3DBHB 4XKJA 4GPD1 1O6ZA 4EYEA 3R6DA 4FB5A 3RJ5A 2P4QA 4CMEA 4UEJA 2X22A 3PFFA 4UVGA 1T25A 3HQ4O 3DZGA 4PGFA 1Y8QA 5DCWA 1GCOA 3ENKA 4Y6RA 3WS7A 5DOZA 2GD1O 4CUKA 4XIJA 3ZI0A 1WMBA 3WGQA 4WJZA 4ZA2A 2AQHA 2QHXA 3KOUA 1H2BA 1ULUA 3OJEA 4MKZA 4OQYA 4QUKA 4S1VA 4DYDA 2NVWA 1BSVA 4AJ1A 4B79A 2F00A 1C1DA 3H3FA 1ZK4A 1P0FA 3LC7O 5AQ1A 1P45A 5JDCA 3X2FA 4JBHA 4Y9DA 4PLCA 4EBFA 3BMCA 3PI7A 4IDGA 3RUHA 2ZQZA 1XLTA 3BHMA 2QIOA 5T8KA 4IJVA 4Q9NA 1LSJA 1LDEA 3GZNB 3RSHA 5G0VA 3TNLA 4BGIA 2AMFA 3T7CA 3IS3A 4J3FA 1LU9A 3I6IA 3ADPA 1J49A 3R1IA 1HWYA 5HS6A 3PIIA 4JQCA 1KEPA 1HSZA 3NJ8A 3FF4A 3KTDA 5DBFA 4A0SA 4ZD6A 2I65A 3AI1A 1YE3A 4Z3DA 3VZSA 1HDZA 3PLRA 5DP1A 3JD2A 3QVXA 4IINA 5CAEA 1M75A 2JAHA 1PJ3A 1DO8A 3BMNB 5L3ZA 3VPSA 4BKOA 2JAPA 2Q49A 3K2BA 3UH1A 1YJ8A 3PGJA 2NVBA 5JCJA 3PQDA 2Y1FA 2HSDA 4EI2A 1I33A 3I23A 4U0JA 5J23A 3O03A 2PV7A 4OOFA 1UP7A 4BNLA 1G1AA 1CRWG 4BNGA 1E3JA 3NYWA 4HP8A 4CMBA 1WXDA 1NPYA 4Q3AA 2X7HA 4W4TA 1GUFA 3I52A 3NDJA 1ZCJA 2PZJA 4NR0A 4D79A 3WGHA 5EN4A 2JFHA 2AE1A 3RKRA 3UICA 3W8EA 5IDWA 1IY8A 3OA0A 1KVRA 3QVWA 4EJ6A 2G1UA 3UUWA 4M89A 3RUIA 3P2YA 5JSFA 1ARZA 3E18A 4CV0A 2GF2A 2VUUA 4NBUA 3DAGA 1Z75A 2DBZA 1DFGA 3H5RA 3LF2A 4IJUA 2VRCA 4KUGA 1JKIA 3H9JA 2EF1A 5I7VA 1V3UA 4IDFA 9LDBA 3GPIA 4CM6A 1LEHA 4TWRA 4XGNA 1C0KA 2VYND 4WGGA 4RPLA 2EIHA 3PEFA 3O9ZA 3VZQA 3WFIA 3CMMA 3OETA 4AJ2A 4YEDA 3F47A 2PR2A 2GASA 1T26A 2JD2A 2EJVA 3PK0A 5DDIP 5I7SA 4Q39A 1I5RA 5AYVA 3V8BA 2DTXA 2HDHA 5HBRA 2FHSA 1DJQA 4RQTA 1T4BA 1RM3A 2BRUA 5G0TA 1YL5A 2ZTUA 1HSOA 3KBOA 4ONEA 3OEYA 4J16A 4IDAA 2Z95A 3CIFA 4QFDA 4CMKA 1JKFA 1K6IA 4MVJA 4OOEA 4OAQA 1PGPA 4BIIA 4IXTA 2CDAA 2D3TA 3K5PA 3TL3A 1JAYA 1M2WA 4A10A 5KJ6A 3DDNA 2G0TA 1BXGB 1DHTA 4YJFA 1LDMA 2JD0A 4R41A 1VSVA 2WEKA 3GNSA 5DT9A 5IFLA 3IP3A 4R68A 3WXBA 1A7KA 1NWHA 2JJYA 1X0XA 2O3TA 1DDOA 3AY3A 3LC2O 4RJTA 3D0OA 4Y98A 1Q0QA 4EGFA 4ZJUA 5FF9A 5A02A 4A26A 3E03A 3ONDA 3ZU4A 1BDMA 4TKLA 4XQCA 3CUKA 2QZZA 1UXGA 1W6UA 4D41A 1DIHA 3ZWBA 5I8ZA 5A9RA 5F1KA 4P22A 1SOVA 2C7VA 2I6TA 3GH3A 3JQ9C 4MP6A 4BNNA 2YYYA 4AVYA 4NPCA 1NAHA 3ASVA 2C5EA 3QY9A 1K5HA 1IULA 1ISIA 2DBVO 2B4QA 4DWVA 4YAJA 4XJSA 1PL8A 3JQ8B 4OJNA 2DT5A 2E48A 3DFZA 2Q1UA 3K8ZA 5BSHA 4Z9XA 4KUHA 1SEVA 2C7GA 3RFVA 4BMSA 4M87A 4E2WA 3UVEA 3KETA 4IZHA 4HADA 4MIYA 4BO4A 4KQXA 4M54A 3E6AA 3EK2A 3FSRA 3OJ0A 3NT2A 4GGOA 1E6EA 4FOOA 4UEOA 1T2EA 3C3XA 4G5HA 3R0IA 4ND2A 1JTVA 5IZ4A 2I5PO 3RUAA 4CLRA 3GPDG 4ZU3A 1G0NA 2YQ4A 1GPDG 2P2SA 4BO9A 2J5QA 4RGBA 3DO5A 4IS3A 5EQFA 1Q7CA 4GL4A 1ID1A 5EQDA 3WJ7A 1B2LA 4MINA 1HL3A 3KEQA 5A03A 3C24A 3ICPA 5BSEA 1DOHA 4U6SA 1ZEMA 4LGVA 5AVOA 3ZU3A 4YRAA 3JQAB 4RPKA 5C7IO 3VPFA 4J49A 4PG8A 2E6UX 2D8AA 2Q46A 2VNAA 3TF5A 3IJPA 1ADCA 4BNXA 3TFOA 2AQIA 2P9CA 3GVIA 5MGBA 3GGOA 2VCYA 4R5MA 1E7SA 3B20A 1M76A 4WLVA 3L9XA 1TEHA 3RROA 5HRUA 1M66A 3G3EA 1HRDA 3M2PA 5JMPA 5B37A 3RI3A 2WTBA 3GRPA 2CNBA 4WPGA 4INAA 1ZUD1 1VJ0A 3DAPA 5A5FA 1LLCA 1VSUA 3GZ4A 9LDTA 5FI3A 3AY7A 2Y0CA 3V2UA 4YCAA 4NK4A 1GEGA 3D4OA 1NFFA 5I9MA 3EHEA 1J4AA 2FSVA 5COQA 2CF5A 1EVYA 1LRKA 1DC6A 3HDQA 1K2WA 1D3AA 3AWDA 5KJCA 5FWNA 3E9QA 5DOVA 3U9LA 5DCYA 1JW9B 4PRKA 1YBVA 1EVJA 2OBYA 1U8FO 2XOXA 2HQ1A 3INGA 4N18A 4HNHA 3V1YA 4PVDA 3NJ4A 4N5LA 3ZH2A 2PGLA 4IY1A 5IZCA 1OC4A 5U4QA 5BT9A 3Q11A 2Y66A 4IDCA 3MJTA 3ZWOA 2Z1MA 1DSSG 2HKIA 1L1FA 1TLTA 1GPJA 3KB6A 3B6ZA 5L51A 1LBEA 1AE1A 3D64A 3QV1A 2PD4A 4NNJA 1PQPA 3GR6A 3ZWCA 1SNYA 1MP0A 1EVIA 4RVGA 4BV9A 3JQBC 2CSUA 4AJNA 4L8VA 3TN7A 4XJTA 3AUUA 4RLSA 4GSKA 5EPOA 1VL6A 2JHGA 2CDCA 4M1QA 4P4GA 3GAZA 1A7AA 1ZK0A 2WYVA 5KIAA 1BHSA 2QG4A 3DFUA 1N9GB 1X7HA 3JQ7A 3E8XA 1NVMB 4J0FA 1GTMA 3FNGA 1NQ5A 3JQFA 3PJFA 5L9AA 4D45A 1PZHA 1KETA 3ROQA 2XF8A 4BOYA 4DL9A 4Y8VA 1B16A 3ETDA 4XYBA 3S8MA 5A3JA 2RH4A 1VPDA 2O23A 1LXCA 5CEEA 1B8UA 4TMFA 1LA2A 2G76A 2BD0A 3I9MA 4Q3EA 4NQZA 3DL2A 4WOKA 3B1KA 5B1YA 1LLUA 3ADOA 1EUDA 4UEKA 1F12A 1QLJA 3WBFA 3ZGYA 5AOVA 4PG5A 3U4HA 3TSCA 3DBRA 5BSGA 1PR3A 3MTGA 1VI2A 1U3UA 1E3WA 4CQLA 3VH4A 5JC1A 4CM1A 4BHTA 3D3WB 4JJGA 3Q9NA 3ZWMA 4ALKA 3NDIA 4GX0A 4FCCA 1GR0A 4CR8A 4XEHA 3EC7A 2PH5A 2PD3A 3L6OO 4J91A 5L4NA 4K26A 3GN2A 2BELA 4L4RA 1T4DA 3LK7A 3KZVA 3QP9A 4DLBA 3RU9A 4DYVA 4BQPA 3AK4A 4FGSA 1A71A 4P4NA 1HYHA 2FOIA 2C54A 4YJHA 5H82A 1EE9A 3VDQA 4BS9A 1ZK2A 1ML3A 3A06A 3QWIA 4HFMA 5CPFA 3JYQA 1UP4A 2E37A 1K6XA 1P1RA 3GY0A 2LDBA 1XGKA 2Q4EA 3JD0A 4RDIA 1EBFA 2DC1A 4OSOA 1VL8A 3DZFA 4JXKA 2Q2QA 1FJHA 1H0KA 3UCXA 2RHCA 4EW6A 5C7OO 4ITUA 4B4VA 4R1TA 4MJLA 4GAEA 3QWAA 1U3VA 3MOGA 2B4TO 4F45A 1DRVA 4BMVA 1DPGA 2VHYA 3KVOA 4IDBA 5COAA 1RJWA 1WDMA 4QFCA 2UV8A 3ZV6A 1QYWA 3NGLA 2EGGA 1N2SA 2B69A 1UDBA 3L4BA 3I9NA 4B8ZA 3ZNPA 1PJ2A 1R4MA 2GO1A 4NDNE 4PLPA 5CG1A 4IDDA 2PNFA 4TVBA 1NX6A 2O3SA 4U5QA 2Q1TA 1LLQA 2DQ4A 2EEZA 4AJPA 1Z6ZA 4BKPA 1TT5B 1NBOA 2Q99A 3WTBA 3HSKA 1MG0A 2V6FA 1E7QA 1XDWA 2HJRA 4L76A 4O1MA 1YWGO 2VYNA 4MVJM 1NR7A 4CMIB 5CDSA 1R0KA 1LTHR 2ZKLA 1HYGA 4P8RA 1IUKA 4RV9A 5GZ1A 1LRLA 3DZKA 2H63A 3RJ9A 1ENZA 1ZZEA 5F3RA 1N5DA 2B83A 2RIRA 4ND4A 3WNQA 4LSMA 1R0LA 3MJ4A 4NBWA 5G4LA 4DIFA 1I32A 3I9JA 1R16A 3JQGA 4XA8A 1DAOA 3MJVA 4GX2A 1E5LA 2OO5A 3L4SO 4MDHA 5HTOA 2IRWA 4L9RA 1UR5A 1ZSYA 4FIZA 1LC3A 2J5RA 1MLDA 4HUJA 3IJRA 3KLPX 3AUTA 2AQ8A 4UUMA 3OIGA 1U3TA 1LRJA 3FWNA 4Q3CA 4EEZA 2YQ5A 1NNUA 3I9LA 2C2YA 3AY6A 1N1GA 1T2DA 1UP6A 1DIGA 3GT0A 3QIVA 3SLGA 1U4SA 1QYCA 1ZSNA 3G79A 3GEMA 3S55A 4CMGA 1C1XB 1IZ0A 4YB8A 4YAGA 1IE3A 1NXQA 3JD3A 4FFNA 2VRBA 4MOWA 4AJOA 1CERA 2BHLA 7MDHA 3C8MA 5BSFA 4E32A 3FTPA 1TB4A 4CLEA 3JQAD 2IXAA 4DA9A 1U9JA 2Y0DA 3EMKA 3DZHA 1Y81A 3KLMX 4PZCA 2HLPA 1SOWA 4AJ4A 1AHHA 1LLDA 4LCEA 4RQUA 3U09A 4N5MA 1O94A 4YBZA 3PYMA 3BMOB 4BNKA 3IC5A 5I9NA 1R4NB 3C1TA 1B8PA 4CUZA 1JU9A 3K73O 2VOEA 1E6WA 3CZRA 1SPXA 4XGIA 3M6IA 2C0CA 1BG6A 3FR7A 1QXSA 3WQRA 3GNTA 5AXBA 1QYDA 1JA9A 3K30A 5KVSA 3DHNA 3SJ7A 3U5TA 5C7LO 3HZZA 5TC4A 2X6TA 4D46A 3JQBA 3KYDA 2WD7B 4OYRA 4WCFB 2OXIA 3TZQA 3VZPA 2EW2A 1GFSA 2JL1A 2IEDA 4NU6A 5JY1A 3LT0A 4K9DA 3HDJA 3AW9A 3ZNQA 1FDUA 1ZK1A 3WG9A 1P1FA 4D43A 1UXJA 4IMPA 3WJAA 4NMHA 3EYWA 2I66A 4R3WA 4BNFA 4D44A 3BMQB 4BNWA 1WMAA 4HFJA 3JYPA 1HTBA 3Q9UA 3H9GA 2NU7A 3C7DB 1XWFA 2B5WA 1G0OA 3PZBA 5THQA 1EFLA 5L7YA 1H6BA 3OJLA 3OJFA 3BZUA 5IJZA 5A9TA 4NFSA 4NJMA 8LDHA 4CM5A 4WECA 4A27A 3DBHA 4HFNA 3DEYX 4UUOA 1X7GA 1Y1PA 2HK9A 5ADHA 2WYWA 5IF3A 2VQ3A 5A9SB 3IKTA 5H81A 3L9WA 1I2BA 4BNTA 5IDXA 3VPHA 3MJEA 1BDBA 4CQMB 1NASA 1NFRA 2BFAA 3CH6A 4J43A 1MB4A 4PG4A 4E13A 3NEPX 2GYYA 4JJIA 3AI3A 3ZWAA 4YWJA 4II3A 1U28A 3ZV5A 2D0IA 3JD1A 1OBFO 5F1PA 4GKVA 2CVQA 4IGFA 1BW9B 1I10A 1JVBA 4LK3A 2EG9A 4XR9A 1PZFA 1V0JA 4E2XA 1EQ2A 1CETA 4OXNA 2ZJ1A 1AHIA 3U4CA 3GG2A 1IOLA 4IDEA 4NJMB 4XYLA 1EK6A 3TRIA 5JO0A 4AG3A 5JMWA 4OHUA 1SMKA 2QX7A 3GZNA 4LRSB 2GN8A 2JD1A 3GDGA 2EKLA 3H5AA 3ZDFA 5EINA 1E77A 1KBZA 4W7HA 1VRWA 2AEFA 3AUAA 4PLWA 1F14A 1V6AA 3ANMA 4XYMA 3RBZA 5TS3A 4AJLA 2DFDA 1U4OA 4GX5A 1ULSA 5B4UA 1O95A 3O38A 4TZKA 5CG2A 5K0ZA 5JO9A 3WR5A 4IJWA 2AA3A 2PKQO 2PWZA 3F4LA 1OI7A 1LI4A 3F5SA 2A35A 4BUCA 1UJMA 1YH3A 3BMNA 1F17A 1RM4A 2DTEA 3AFNA 1FDTA 1E1NA 4N54A 3TZCA 3ICCA 3G1TA 1I3NA 4CR7A 3FNEA 3ZV4A 3WWZA 2B37A 1NVGA 2QRLA 1YKFA 1DRWA 2OFPA 3WGGA 2JCXA 1VKNA 4ROSA 4RORA 1CF2O 1X13A 2NTNA 3DAFA 1Q0HA 4XDZA 2PA3A 4MVJP 1W4ZA 3Q2IA 4URFA 2VUSA 1GL3A 3E82A 1T2FA 2H5LA 2WE7A 1RYEA 3H9EO 1UAGA 3V1UA 3W6ZA 2A94A 2OORA 4MP3A 1H6AA 4DBZA 1S6YA 3DQPA 4O5OA 3E5RA 2Y05A 3FWZA 3LC1O 2PH3A 4CUJA 1GYRA 4GLLA 1V9LA 2C59A 1GU7A 1VE9A 4IZIA 1E0DA 2O3RA 4J90A 1KVTA 4R54A 4ZQHA 4CLDA 2CZCA 4BNZA 3AM4A 4DIBA 4IQ0A 1E1KA 2DBQA 3FN4A 2AG5A 2ZB7A 3GVPA 5F5LA 5AXDA 1LSSA 4BKQA 3GNQA 4J4TA 1C0PA 3AUSA 3VPGA 3WQSB 1E7WA 3WNVA 4I9HA 4BGUA 4RPGA 2IODA 4WK6A 3C1OA 4FS3A 4PVCA 2YY7A 3FBGA 1EZ4A 3ZW9A 3K9QO 6LDHA 3O4RA 5IZCC 2WSBA 1E7YA 1TT7A 1ISFA 5LDGA 1GADO 3F1KA 5G4KA 3JQDA 2NSDA 3RCBA 3D4PA 2CFCA 3ANNA 4JGBA 2YDYA 4B4UA 1R6DA 1N8KA 3AOEC 2ZJ0A 1FF9A 4OGWA 2ZYGA 3GMSA 3OQ6A 2C5AA 1ZKMA 4OXYA 3MWEB 1P1HA 3L6DA 1B3BA 2G82A 4I1IA 1UH5A 3IP1A 4JIGA 3GQVA 5T6BA 1S7CA 3GC6A 3L77A 1YOVB 5IN4A 4XD2A 3PHJA 1A9YA 1Y9EA 1BXGA 1BTOA 2QQ5A 4EEXA 1PWZA 3GF4A 3JQFC 5FFFA 4F6LA 3PTZA 5L4LA 1PU2A 1U1IA 1JN0A 2P9GA 3QWBA 3H2SA 3HFSA 1BVUA 1Q7GA 2XAAA 5G4KB 2VWPA 2QZ9A 2X0IA 4R3NA 2P91A 1A72A 5CHEA 3ZW8A 3RUCA 2HRBA 2I3AA 4KZPA 4CV1A 2UYYA 4CLXA 3EVTA 4GVLA 4OH1A 2OMEA 4B7CA 1ONNA 3SBOA 2WE8A 1HDOA 1OFGA 4MO2A 1GDHA 3KYCB 5DP2A 3TFQA 1DBVO 4B3IA 3ON5A 1VJ1A 1DLIA 4FBGA 3DTTA 1X1TA 3ZV3A 3G1UA 1IPFA 3OH8A 4ID9A 3B70A 3JQ8A 3H2ZA 4UVHA 3QVTA 5DN9A 3WIDA 4AL4A 4PLFA 4HFRA 5JPIA 3ROKA 3LZ6A 5CDYA 2HRZA 3JYOA 4KOAA 2H1SA 1AGNA 4A03A 4MVJH 4WEQA 2ZTLA 3EVNA 3IIEA 3IMFA 5I8WA 3A9WA 3AM3A 1NYTA 4E33A 3BHJA 5G0WA 2X0JA 3WLFA 3A1NA 1X7DA 3K31A 3OQBA 4FFRA 4YYZA 4B3HA 4B4OA 1HE3A 1NAIA 4JCOA 5L45A 2O4UX 5HA5A 4J9VA 3RUFA 1B8VA 4WNIA 3UOGA 3GDFA 4GMFA 4AJJA 1PWXA 1EUCA 5AXCA 4N7RA 5A1TA 1D1SA 1LDGA 2V7PA 4MVJG 1PJQA 3JQAA 3WYBA 3L4BC 4E0BA 2J6IA 1Y8RB 1QYVA 2I76A 4OXKA 1ZJZA 3AU9A 4L73A 3NUGA 2O2SA 1F06A 5EESA 3P19A 1EEHA 3QWHA 3I4FA 3QWFA 4CM8B 1MGOA 2G17A 2EJWA 1A4IA 4J1TA 4E5MA 3F4BA 4DQXA 3PIDA 3M1LA 2EWMA 1X14A 3BTSA 4DGSA 1PS0A 2VTEA 2ZTMA 3FCOA 3FNHA 4OKNA 5CDUA 1T1RA 2Y1GA 2E4AA 4IM7A 2YV2A 3ORFA 4IBOA 4CQMD 2FR0A 4BO1A 2Y68A 4R1SA 1U2DA 1VL0A 1P1JA 2GR9A 4RPHA 4E5NA 4YRBA 3LVFO 2I67A 2X8LA 5DBGA 1PJSA 3EZYA 2CY0A 3X2EA 2O3QA 4DREA 5JYDA 4K6CA 2CD9A 5B12A 1HZJA 8ADHA 2EHDA 3BTOA 3ETGA 5GZ3A 2GCGA 5TT1A 1T2AA 4FSHA 3GAFA 1Y5RA 5DF1A 1P1KA 3NGXA 1TXGA 3ENNA 1SZJG 4GLOA 2ZTVA 3K2EA 2V65A 1K3TA 2XXBA 1ZXLA 2VT3A 3ROPA 1UZLA 2UDPA 1VLLA 4NH4A 4BNYA 1UXHA 1DIRA 1YJQA 2VUTA 3NT4A 5H83A 3RKUA 3ZHYA 3EDMA 2VHWA 1LC0A 3WICA 5A4DA 1BWSA 4WCDA 2PY6A 4FFLA 5TT0A 1Z73A 3PQFA 1V35A 2HMWA 2Y99A 5I7FA 4C7JA 1SAYA 4WNCA 3ROMA 1P31A 3WSWA 4PZEA 2EGHA 1HLPA 2GPTA 2DUWA 3JQCA 4ALNA 4CLOB 4JROA 4E31A 4Q3BA 4BKRA 4F3YA 2BFOA 1GCUA 1IPEA 4QSMA 3TZHA 2IYOA 4BO2A 3OFSA 4NG5A 2HJSA 3W8FA 2B0JA 2GZ3A 4PRLA 1XYGA 1QG6A 2Q2VA 2YHIB 1N9GA 2J3JA 4R9RA 3L6EA 4R1NA 5JAZA 3DZBA 1F8FA 2VWHA 1GY8A 3GFGA 3LU1A 4FJ1A 2P9EA 1H94A 2GDZA 1XQ6A 3PJGA 4J7CA 2LDXA 4FC6A 1PTJA 3A28A 4R69A 3PVZA 4UVIA 5KTKA 4O59O 3AOEA 4NBVA 2B36A 1VJTA 2XXJA 4CODB 3WGYA 2BF7A 1JDJA 3ASUA 4HX5A 1LNQA 1Q7BA 1OOEA 4KUEA 1UDAA 1GYQA 1MX3A 2D2IA 4ALLA 3UHAA 3QW2A 3L0DA 3IUSA 4RLHA 3HE3A 5KJ1A 5EIOA 1EMDA 4J1SA 3PDJA 4R5HA 5LCXA 1WNTA 2Q3EA 4GKBA 2CDBA 3DHEA 3D3WA 5IDYA 4JNKA 4BV8A 4GVXA 4CMJA 1HYEA 1DFHA 3DC2A 1PQUA 3MOIA 2ZB4A 4LMRA 1QR6A 3W4IA 3FRJA 3T4XA 2Z5LA 5EJ2A 5T57A 4CR6A 4G81A 1D4FA 3HB5X 1BXKA 3I6QA 4Z0TA 2PKQP 3OA2A 3RU7A 4A5OA 1ZJYA 1B3RA 3CEAA 1CIVA 3NTOA 4I08A 3WFJA 3GG9A 1X0VA 4NHEA 1GZ3A 5BR7A 4CM9D 4PLYA 4RO0A 1V3TA 4L74A 4UUNA 1DIAA 3VHRA 2VHXA 1E92A 2Z1NA 1LUAA 1B26A 3TOZA 3EGOA 2WJPA 3F3SA 2C29D 3PZRA 3SVTA 1LDNA 2A9FA 4TKMA 3QJ5A 1WWKA 4AJEA 1I3KA 5TGDA 3VKUA 5IXYA 1A9ZA 1E7RA 2ZYAA 4RF4A 1C14A 5MDHA 1V3VA 5G2OA 4NFHA 3PFWO 3VVBA 2VZ8A 2AE2A 4W6ZA 4XX0A 3RAJA 1LQUA 1ENPA 1O9BA 1DJNA 3AI2A 3JTMA 1QV6A 3ULKA 2Q1WA 4YAIA 2QYSA 2QRJA 5TLSA 3FTNA 3KYBA 4KDFA 2CMDA 3WQQA 4E30A 2FRDA 1TT5A 2VOJA 1EDOA 2YUTA 2X5JO 1DIBA 3FBTA 4YT2A 3Q6IA 4TZTA 1MG5A 4FFOA 3S2GA 2WMDA 3DZJA 4M55A 4Q3NA 4CMIA 1PEDA 1EFKA 3LF1A 3AM5A 1MC5A 1VC2A 2O3JA 4RZHA 3NTRA 4YTEA 4D3DA 1EQUA 1UXKA 4MIOA 5KWEA 1WLYA 3SC6A 1XA0A 4NBTA 1CJCA 1PIWA 1CEQA 2J8ZA 3KSUA 3MTJA 4MKRA 2HO5A 4JN6B 4CM4A 3JSAA 1PGNA 3PHHA 5JLAA 2GNAA 4K1LA 1YQGA 2BMAA 3OP4A 2TMGA 5TRTA 5KOIA 1LSOA 4GI2A 4A7PA 4IIVA 1GV1A 3VPXA 3ZWNA 2BGMA 4J1QA 1GZ6A 4OL9A 1T24A 3NKLA 5DZSA 1QMGA 1KVSA 4BGVA 3GGPA 3DONA 3KXDA 3S2EA 3U0BA 3LT4A 3LLSA 2WYUA 1M6HA 4CM7A 1RM0A 3ITKA 1C1XA 1YXMA 2VYVD 5KVCA 5JY6A 4PLGA 5ER6A 4LSWA 5DBIA 3ZN2A 2PZMA 5JW6A 5DCUA 5TJ9A 2I3GA 3DOCA 4CM4B 3I9KA 4DLAA 1KY4A 3O8QB 5TX7A 4CLHA 4QT0A 1N1EA 3WTCA 2ZIZA 1H5QA 4K28A 4AFNA 4YPOA 4I9UA 2AEMA 4HY3A 1E3EA 1BXZA 1MC4A 5KKCA 1VKOA 4FW8A 3WBBA 4A2CA 2QYTA 3VKVA 1KY5A 4HKTA 4OO3A 1C3VA 1CDOA 3FPCA 3RFTA 5FEUA 4E6PA 3BMOA 3ZCXA 1XG5A 4QQRA 1R4NA 2Y67A 4I5DA 4J4HA 4XCVA 1HDCA 1FK8A 2PKRA 2X9VA 5KCZA 1YB5A 2XPCA 2OL4A 1QV7A 1ZVMA 3G49A 3M1AA 3NAQA 5BNTA 3OMLA 4JK3A 5CP8A 3UF0A 3U4IA 2W2LA 1TI7A 2X23A 1R66A 2P68A 3FPLA 3GHYA 3QVOA 4ZQFA 1I30A 1I24A 2YW9A 3DB2A 3F6YA 3ABIA 1XR3A 3F1LA 1KC3A 2ET6A 1ISGA 3CTMA 2WD7A 3EUWA 3OM9A 2C82A 4JX8A 1M6WA 4WCFA 5U1PA 4XIYA 3VOSA 1A27A 1F0YA 4OSPA 1ZXBA 4BO5A 1EDZA 4JBGA 1RYDA 1T2CA 3U4DA 4WLOA 4D42A 3Q3CA 5COBA 3I3OA 1AXEA 2IZ0A 4DPKA 3MCVA 1Q0LA 7ADHA 3CSDA 3PGXA 4CJXA 4HNGA 3HHPA 3GA0A 1O0SA 2J5KA 3BMQA 2EP5A 1U7HA 4AJHA 1UUFA 1P33A 1U5AA 4TRJA 2W2KB 1NHGA 4J4BA 2BH9A 1LX6A 2VHZA 3H4VA 2BKAA 2D5CA 2VWQA 4I5EA 1I01A 1QLHA 2X5KO 4L4XA 4DC0A 3VZRA 1GEEA 3VC7A 1NPDA 1HDXA 2Y1OA 3RVDA 4RVHA 4NJOA 3WDSA 5B4TA 5ILOA 4DBVO 2VHVA 2VZ0A 4HV4A 1H2HA 3WMXA 4BQRA 3QE3A 5A9SA 3R3SA 4M8SA 1BVRA 1HE2A 1HE5A 4JBIA 4CQMA 2JKVA 2VN8A 1PJTA 3LLVA 4DQVA 3W1VA 4RF2A 3KSZO 3PHLA 2YZ7A 3PXXA 3DBLB 1SB9A 4L75A 3E9NA 5F21A 2X9NA 1V8BA 3UN1A 1BW9A 1GYPA 2B5VA 3VVCA 1SCUA 3WB9A 3WIEA 4U0KA 2OZPA 5L7WA 3RBXA 4FPXA 5GZ6A 1GUYA 1DHRA 3GMDA 1L7EA 5IDQA 5L4SA 4PFJA 4XQ9A 4LISA 1PJ4A 3HB4X 3WYEA 4BO8A 3RFXA 3D1LA 2YHUA 2Q1SA 4TVOA 2O3UA 2GN9A 3ZWYA 1E1MA 1KVQA 1MFPA 3HDHA 1HE4A 2PLAA 1NM5A 3JV7A 1W73A 3D3EA 2ZYDA 3DMYA 4TROA 1J5PA 4ZVVA 4LN1A 3TZ6A 1PZEA 3OBBA 4E5KA 3QLJA 3WYCA 4RCVA 4QO8A 3TQHA 4YT8A 2EV9A 1NQAO 2CUKA 3WGIA 3AU8A 3DMTA 4BKUA 1KVUA 4BO3A 4ZQEA 4XB2A 2GN4A 3TJRA 1DXYA 1DRUA 1PGOA 1XCBA 1Z82A 4MP8A 2NV6A 1KEWA 2OP0A 1GQQA 4E12A 1IHXA 1YVEI 2Q2WA 5TF4A 3HN7A 2FPGA 4YT5A 5HM8A 1FDVA 1SBYA 4QEDA 4XRGA 5L95A 3N74A 1MUUA 3G0OA 1MV8A 2FR8A 2J3IA 5JS6A 2HK7A 1DC3A 1E3LA 3ZWWA 4UVEA 3RC9A 2X0RA 5JYEA 1KERA 3MWDB 4Q3DA 1Z7EA 3PLNA 3PWSA 4B8WA 5JAIA 5CPBA 3H65A 2UUOA 2NVUB 3WGZA 2X4GA 1HT0A 1OMOA 4MKXA 4I5FA 1PS8A 3A4VA 4GX1A 5ER9A 4CM3A 4XWYA 1Y7TA 3RUEA 4GSLA 5TJHA 3K96A 5C37A 2JFGA 1HETA 3AJRA 4LMPA 1HXHA 1ZFNA 3UCEA 4WUVA 3OSUA 1BMDA 3Q1LA 4IPTA 1EE2A 1P0CA 2OP1A 3HWRA 2IZ1A 1NR1A 1LDYA 3QQPA 3GK3A 3KV3O 4U8GA 4NI5A 2CVZA 3I83A 1YO6A 4D0SA 2UAGA 1OAAA 1U7TA 2JHFA 4FR5A 4J2OA 2IEBA 2X9GA 4IQGA 4RVFA 4Z9FA 3C7AA 4CPDA 1B7GO 4CV3A 3TWOA 1K89A 2Y1CA 2V6GA 3LT2A 2GLXA 4RPJA 5IAAA 1YDEA 2AXQA 3GVCA 1PJBA 4JJFA 2AHRA 3QVSA 1ENYA 1XEAA 2FMUA 3QA9A 3FI9A 3N7UA 1JLLA 4NK5A 3OJOA 5KJEA 4CM9A 1E3IA 3S2IA 3UCFA 1XU9A 2GN6A 1BGVA 1IYZA 1Y8QB 1YOVA 1A5ZA 4RDHA 4BB5A 5JXWA 3B1FA 4F46A 1EBUA 1ZSVA 4YAEA 2QRKA 3VTZA 5C3MA 1CQIA 2UVDA 1VM6A 2C07A 3FNFA 2DM6A 2UUPA 2WM3A 4J6FA 1LSUA 1EUZA 5JFOA 3CMCO 1C1DB 1NVTA 3BTUA 3GGGA 4YXFA 3RC2A 5TQVA 2FZEA 1PZGA 1WZEA 3BMCB 3H5NA 4XR4A 3VH2A 3ZU2A 5KJFA 2R2GA 1FDWA 3H9QA 3GUYA 5B4VA 1PGJA 3VDRA 3IOYA 1YQXA 1UDCA 2NLOA 1ZO8A 2P4HX 3JQEA 3PDUA 2C20A 4OMUA 4WEOA 1B15A 2FZWA 4G2NA 1R37A 1D7OA 4EZBA 1Q2XA 4KQWA 3DOOA 3KYCA 1Z74A 1PL6A 4BO7A 2HK8A 2HAEA 3ZNOA 4CL8A 2NTVA 2B4RO 4IXWA 4B4WA 4DXHA 1E7MA 1MXFA 3UFXA 4J1NA 1CYDA 4IS2A 4GMGA 4NIMA 1I0ZA 3I4CA 3UXYA 3TOXA 5LC1A 4R51A 4ND5A 5TSDA 4EUHA 1H9BA 1AN9A 4E2YA 2F1KA 3INTA 4B3JA 3HADA 1K0UA 2W4QA 4HWKA 3PP8A 1W0CA 2DKNA 5IG2A 4DQUA 2GERA 1ISJA 3ONEA 3U49A 3W4KA 4UREA 4DUPA 3K92A 5I9LA 1GZ4A 3VTFA 1RM5A 3C7CB 3PHGA 3U3XA 4P4LA 3DBVO 3DTYA 5JCXA 4CV2A 2VYVA 1LDBA 3H9UA 1HDYA 3SXPA 4YJDA 4AICA 5JBIA 3BXXA 1E6UA 1JAXA 2BGLA 3I1JA 4WLEA 3SLKA 1PJLA 4OQZA 5ITWA 1JVSA 3BIOA 4YRDA 2W2LD 2E82A 4R16A 1Y8RA 3NRCA 4AJKA 1NQTA 2AQKA 2NQTA 1E1LA 4II2A 4B7UA 3ETEA 2GZ1A 2VT2A 2NU9A 3IDSA 3Q2KA 4C4OA 4UUPA 4E3ZA 4CMAA 4Z6KA 3E1KA 4CM8A 1WZIA 2Y0EA 4PIVA 3SC4A 2I9PA 4HBGA 5BNFA 5L53A 3HG7A 4FN4A 3ZWPA 1FXSA 3GUCA 1I3LA 4X54A 3STHA 4KWIA 2OBNA 1ZK3A 2H9IA 2PGDA 3MJCA 4PLTA 3S2FA 1ZBQA 4ALJA 2WWRA 3ZWVA 2X0NA 4UVDA 2NNLD 1WAMA 4KMSA 4UAGA 2RH8A 4EJMA 1QYXA 3HJAA 1DC5A 1HZZA 1RPNA 3E48A 3OECA 5U9CA 3RIHA 3INRA 3S1LA 2AEJA 2NACA 1M67A 3ZNNA 1OZAA 1ISHA 1I2CA 4ZQBA 1YGYA 4E2ZA 3LT1A 3GRKA 3GHHA 2YDXA 3DHYA 3KSDO 1Z7BA 3ZU5A 5CFZA 2D59A 4FFPA 4TQGA 3WWYA 3P2OA 4YJFB 4L4SA 3HUDA 1U8XX 1UZMA 2DTDA 3UGKA 2W98A 1ORRA 1YL6A 1NHWA 3ANLA 4J7UA 4I9NA 2AW5A 2PZKA 2CVOA 3BA1A 4W7IA 3RUDA 1T1SA 2GRAA 4H15A 1DLJA 3FD8A 1PS9A 1YL7A 1H6DA 5GY7A 4C7KA 5IN5A 5C5IA 1TVEA 1O5IA 2HMUA 1UAYA 1HKUA 4W82A 3G17A 2E49A 1FDSA 2NTJA 2ZATA 2IDZA 1D8AA 3GVXA 1ADFA 4CLOA 3ZHXA 1K6JA 4DIOA 3FR8A 1U2GA 1C0LA 1D1TA 3JYNA 1SB8A 1QORA 4NBRA 6ADHA 1R12A 1ZNQO 3M2TA 4UULA 2Q50A 3WSVA 3DOJA 3IKVA 1WVGA 1B14A 1R15A 1ADBA 4IGEA 2YHIA 4W99A 2A92A 1RKXA 4CMHA 3OF2A 5AXAA 1P9LA 4WASA 2OOSA 4O0LA 4YT4A 4HXYA 1ENOA 3C1AA 3PHIA 3N58A 1NQOA 2DFVA 2QW8A 4BNIA 1IHYA 2OUIA 3IUPA 2GUGA 3D5TA 4DTIA 3SX2A 4EJ0A 3EZLA 4IMRA 3ZZNA 3JD4A 3ZWXA 4PG6A 1KS9A 4GBJA 4CLRB 1I3MA 3V5NA 5T67A 3NV9A 4WCFC 1YONA 3P7MA 4DC1A 4ZRMA 1R0SA 2YJZA 4IJKA 1IL0A 3LQFA 1CWUA 2D4AA 3WGOA 1DC4A 1TA4A 1N92A 2V6MA 4M49A 5DNAA 4EUFA 5JDIC 1JKJA 4XQEA 3IL2A 4Z3KA 2NM0A 4OKIA 1GD1O 4IUYA 4DLLA 5FI5A
chains in the Genus database with same CATH superfamily
1XRPA 1SJ9A 3MINA 1ESMA 5ILGA 3RSFA 5CA1A 2X76A 4U9HS 3A31A 3KE9A 4FFWA 4LOIA 1Z34A 4JLAA 4CVNA 4DCPA 4X6UA 4DCCA 1TAHA 2C8JA 4HAYA 1KC1A 4TSKA 1QKKA 4OD0A 4EUEA 2Q4BA 4XH9B 3T1YB 3X1KA 4OHRA 2ZAOA 5LUAA 2BMFA 2HMTA 1QO0D 3NR2A 2YNMA 4FMDB 2NWQA 3DWGA 3L7YA 3OE7D 3R7AA 3J7AC 4YREA 4ZFNA 1OLUA 2QTMA 4Y0AA 1Q1EA 2YV4A 1LPNA 1UFOA 1ZR4A 4FNAA 4H3SA 4FTWA 4MQ5A 4RGYA 4L78A 1BRMA 2RBEA 3UG7A 3AR6A 3NHZA 1HE1C 3H6KA 4C0HA 4DIDA 2P4SA 3MGBA 5JSZB 1KJZA 1DCMA 2X1LA 3MRTA 3G8CA 3OIYA 2PS0A 2P5UA 5DH9A 3ONFA 1ADGA 1YVRA 1P73A 4GR5A 3SEFA 4DV1B 5K6AC 3VSCA 3D59A 3SSAA 5H9WA 1OLXB 5ITVA 1AG9A 2NQ8A 2MSLA 3H8VA 2J3KA 3TRKA 5DYTA 3KPWA 1K2VN 4FFBA 1T5DX 2Y4NA 4BJ5A 5TEWA 1ZJJA 1Z45A 4Y2HA 5K3OA 4R40A 4BN4A 3N6RA 5CM9C 4BB6A 2JZCA 2EKDA 1QC5B 4HEJA 3RBVA 3E81A 1IAVA 1M2FA 1MD9A 2FWBA 3R3XA 1NJ2A 4M86A 3SQDA 3W5BA 4XOIA 3C3MA 3LSYA 1PG5A 1YR3A 4OLHA 5L40A 4WOJA 2ZCUA 1OE0A 4YMGA 1E61A 1OAOA 2OO7A 4YBRA 5ERGB 5BN4B 4XDYA 5DB4A 3D4NA 2Z2ZA 3GUVA 3D54D 3KTAA 3OPYB 4NU5A 2IYAA 3TX2A 3VH3A 3UOWA 3GD5A 4IVPA 4EG1A 3V7YA 3R3VA 1NJ8A 5IH7A 2F3RA 1KJNA 1ZUWA 2IOFA 4Q3OA 3DE7X 2NADA 3QIAA 3EF0A 3CPSA 5KKAA 1QCCA 1WDWB 4LCJA 4PLZA 5AM0A 1KZHA 3VAZA 4AZ0A 3ERCA 3AVTA 3UJNA 1YJAA 2OQRA 2ZWOA 2JCYA 4HG2A 4JJ7A 1XF9A 5L7TA 4JI6B 4BFWA 5NLLA 3EXIB 3A14A 3SEZA 5B36A 2R60A 5ESRA 4MTLA 1NSYA 4M1SA 2Q45A 4Z0HO 1U1DA 3OIFA 5CT6A 4DY4A 1AQNA 5E8JA 1U3CA 4BMNA 1T4GA 2C31A 3M89A 3OMXA 4QJIA 4URZR 4I8IA 4BU0A 1ZC3A 1XAJA 4A15A 1M5TA 5DASA 2GAFA 1KI6A 4FNOA 2BKXA 1C4OA 4JIMA 1IVYA 3FROA 3UKOA 1V39A 2H3HA 3BB1A 1P61B 3PWZA 5KNLA 4JV5B 1KEZA 1ZMXA 3MILA 3I0MA 2QI9F 3WRXC 2CF6A 4URUR 3M5PA 1C9DB 2IPNA 4L0DA 2IUEA 3K4HA 1E1RD 4GGPA 2IZZA 4PC6A 4MIEA 1QP8A 1NOIA 4TGLA 5DULA 4RU1A 2C04A 3I73A 2XMQA 5I7EA 3TTYA 2PEZA 1PJAA 4ZTZB 4O8CA 3RVKA 2NAFA 5LU8A 1FFHA 3P9RA 4HOYA 4PG7A 2Y27A 3HNOA 3AR4A 3I5MA 2PD6A 1JWAB 1QJCA 2TMDA 3EH2A 4ZDJA 3U44A 1AZWA 4M8NE 1SOMA 3ABOB 1FUUA 1H6CA 4HAOA 3TW8B 1NWCA 3U80A 5LJLA 2TS1A 2GPWA 4IG4A 4PLVA 4RFLA 5AKZA 4EYOA 1T8YA 3CEPB 4I4LA 1MA0A 1Z8HA 4PSDA 2QI9C 3O8QA 3DBRB 1Z4KA 2QTRA 4EUKA 4MR8A 4RX1A 1BGXT 3C6ZA 4WNAB 1RRCA 1S3IA 1XNGA 4PCVA 1AHPA 5KX5F 4CL3A 3MQ2A 2PTGA 5JAMA 4X71A 4DVJA 4CMEC 2XZTA 4O2BF 4ZVOA 3DTNA 4DNFA 1W1IA 4MZDA 3QH4A 1S2OA 4XGKA 3TQOA 2G5CA 3Q7TA 4BVAA 4N49A 4Z9BA 3VNVA 2ZWMA 1ULTA 2EOAA 2UYOA 3A1DA 1OYOA 3OZDA 3F74A 3QPAA 4GF5A 4JZYA 1XX6A 1E3QA 1MC8A 1ZEJA 2ODEA 2R85A 4G01B 4ZPXA 1ODCA 1X1EA 1SO8A 4HH1A 4OGFA 2ATCA 2OXRA 5E2IA 3NVKI 2GX6A 3QPBA 3KOXA 1QKIA 1X9GA 5AKLA 3LDHA 4ZO7A 5E6RB 1OQAA 2IYPA 1XMIA 3ESQA 3HDYA 3KHUA 4OHPA 3UFBA 1QTRA 3EXAA 4LBZA 3IBFA 5A71A 1O57A 2R7MA 4PYIA 1XLTC 2OV1A 2XJ4A 4E1BA 2WD9A 3I72A 4FJ0A 2DSTA 4KIGA 3OSZA 5DVZA 2ZRLA 3WISA 3CX3A 5CDGA 3CYFA 3EEOA 3EF3A 1MOPA 3B1JA 3IUYA 5F1OA 3L43A 1NMXA 1I9GA 1A8SA 2ES4A 2GPNA 1GLVA 1PGQA 2Y1DA 4HDMA 1HYBA 4YMHA 4MCHA 5FA6A 1VKZA 1H4QA 2A57A 3G2LA 4KQJA 1OY1A 4G2TA 4XB1A 3KFLA 4J2HA 1JEQA 1MR3F 5EXEA 1H2EA 1IZ9A 3ZDZB 1R4MB 3ZLJA 1NXTA 1CUCA 4PTYA 2J85A 1II8A 1WKBA 2JBHA 1RMYA 5JTTA 5HEKA 5EKDA 2RHJA 4JYZA 3CGWA 4ZO4A 5JI3E 1WW8A 1XDGA 3OCWA 5I9TA 1CIJA 1JSCA 2OWEA 4RZUA 4BXOA 4WOPA 1BQEA 1G8HA 2BHRA 3AZPA 3A4NA 2LNDA 4YRGA 1G20A 2QAGB 5CCBA 2F9LA 3QFHA 5C8ZA 2DU8A 3PJDA 4EX7A 1EK5A 2EXXA 4YN3A 1Q7EA 4MGKR 2EERA 4J0EA 2H1LA 4MARA 1G4UR 4NPHA 1C8BA 3G5LA 2FZ5A 3IQWA 4UE6A 1HEYA 3LV8A 5FYDA 3UJ9A 1SCIA 3QFSA 2Z8XA 1O89A 2G9QA 2ZANA 1AN0A 1VGRA 3R20A 4YA6A 5JE8A 1CPYA 4LVUA 4JAVC 2MSNA 3AHGA 3P4XA 5AIAA 2RIPA 4CFYA 2WJAA 1VHLA 2NV2B 1G6KA 3BKXA 3JQGB 4MS3B 1E0AA 1OX5A 3DL0A 1AKVA 1JQ5A 1P5FA 1GUZA 3FMOB 3QHAA 2PAAA 4ZOAA 2OV8A 3QZUA 3WAJA 2QN8A 3V2GA 3A4MA 2PT6A 4XVRA 2WIJA 1XDSA 3CB4A 3NYRA 1DRKA 4H1VA 1ZMOA 3DPIA 3DR3A 4OQPA 4QYWA 5A05A 2ZG6A 3FVRA 1U3GA 4O2RA 3T9DA 4B47A 1QRRA 2XUKA 1ZM2A 4PAMA 1J8QA 2H3EA 3EPHA 2G80A 1L6IA 3PJEA 2YIJA 4Z8XA 4ZT5A 2Z2IA 5AQEA 2ECOA 2WSYB 1CUIA 4IXDA 4JT4A 3AFIA 3BYZA 2ZK7A 3DP7A 4NFYA 4REMA 4WVFA 3U62A 1KQ3A 2PX4A 3WKEA 2QTCA 4F2DA 3IUNA 3CZ5A 2DJ5A 2FX2A 2AJDA 3HXQA 3I9OA 1I8TA 4LVNA 3VV2A 2W4IA 1QIEA 2JPDA 4KWTA 4BVBA 4BIMA 1PX0A 4TRMA 4A6DA 4EDFA 1L7DA 1QANA 2C2XA 3KB1A 5FTLA 3NMUF 3IV6A 4PONA 2VTDA 1HI9A 2A3NA 2Z08A 3MZ0A 4HLNA 1TO1E 4EKIA 2GM5A 4PN3A 3SS7X 2Z57A 4BQQA 1SXJC 1Y6JA 4XRGA 1M73E 5H68A 4G1BA 4E4YA 3QE4A 1Z5PA 1QBKC 3DA8A 3TPCA 3I64A 4HXFB 4HDAA 1N2CA 2JK1A 4J16C 3UENA 1NV8A 4HI0E 1T8RA 4PGHA 2Q21A 2ZQYA 1V5WA 4YAKA 2FR1A 1P1IA 4HWPA 1ONPA 2GVNA 2H57A 5FLYA 2QR3A 3HZRA 1U1FA 4JI1B 5F4BA 2EW8A 4ZICA 2O48X 2K2WA 2O8NA 3IBSA 3IOEA 3M83A 4M0PA 5FEMA 5HG0A 5F9FA 4P58A 1EG2A 4DMFA 5A0FA 3F3KA 1TKAA 2VDWB 2ZBRA 3RTCA 3Q3EA 4FHCA 1L9KA 4R01A 3H05A 3TQTA 2H2DA 1CD5A 5EUQB 1N7HA 4EJFA 2ZT8A 4NZ9A 1Q21A 4O1IA 3A3OA 1U5CA 4UCFA 1SULA 4D0LB 1P77A 4X45A 2W42A 2P0YA 2OQIA 1YQ9A 2ENUA 3GJSA 3BXFA 4JY7A 1TW2A 2FSSA 2POQX 4V2UA 3LL7A 3IQHX 1YOBA 3KM0A 2F1IA 1CQJB 4HSGA 4J9UE 2GVZC 4O6VA 2PKWA 3EVEA 3D7LA 1OX6A 4FD3A 4JNCA 4R2LA 4RVSA 5FHQA 3WMGA 2NUPA 1K7SN 4OM8A 4C78A 1J8VA 1P1CA 1MXHA 1TJPB 4WKGA 3A6FA 3VR5A 2E21A 3JQ6A 4WV3A 2BFMA 3KBBA 1N4AA 3BHIA 5H4GA 2JHPA 4LJ7A 4Z1OA 2HMVA 2BGNA 1VCHA 5KTPA 2Y6UA 3NBKA 4M21A 4P82A 4YVFA 3PENA 2VK4A 4MPDA 4DRYA 4B6JA 2K87A 2OXCA 3T7TA 3O8RA 3DMHA 4OL0A 4DWJA 7ABPA 4UAJA 3W5AA 1IBMB 2BFDB 5LYJF 1HDGO 3RTAA 1RMTA 1E9DA 5GMOA 1CJTC 1FVHA 2GD0A 4HAVA 4M3NA 4RD0A 4QGHA 1DUVG 4PZDA 3ZGNA 4B40A 1A7JA 2CFRA 2NO5A 1E1CA 3AFMA 1J2YA 4IDPA 1VGQA 1H42A 2P90A 4ZHSA 2I6GA 3F90A 1J2RA 2Y0BA 3EXEB 4W9NA 3SE7A 4CYMA 1NGSA 2V8BA 4KR3A 1QO0A 4B2YA 1EA7A 1J0EA 3OE7A 2FN7A 3PQ5A 4FUQA 3BAZA 2ADOA 2YYAA 4UMDA 1FNBA 5IKOA 3VV3A 1P9WA 3K20A 1TCVA 4CHGA 2Y1KA 3K0FA 4RENA 4GPD1 1CS0B 1V5FA 4Y6QA 3ISVA 5IM4F 4BMZA 3AL2A 3PFFA 1WPXA 2QUZA 2WFLA 3B7WA 4HYQA 4V03A 1S7GA 3IEIA 3BRSA 1FB5A 1GCOA 3ENKA 3IT2A 4NS4A 1GN8A 1YI0A 5DOZA 5GM2A 2R47A 4CUKA 1SIBE 5LP6C 4G25A 4JEIA 3HP4A 2HPZA 3MS2A 3G0DA 3O2SB 4JB3A 1R2QA 3EEQA 4G56A 5EWLB 3WK6A 1H2BA 1ULUA 4A8PA 4G89A 3IFSA 2H5JA 2NVWA 4Z0NA 4RV4A 5CIQA 4AJ1A 2E9SA 2F00A 4G1FA 4Y2XA 4B79A 1TYDE 3LC7O 4ZT2A 4AQDA 5AQ1A 5IDVA 3LQ1A 2OHVA 4C0QC 4FFDA 4PLCA 3OO0A 3BMCA 3PI7A 5K20A 2WVJA 2ZQZA 3KEFA 5JJKA 2A9RA 3DWEX 3H17A 4IJVA 4Q9NA 4RHEA 3GZNB 4KQHA 2WPDD 1Z5UA 1VXOA 3TNLA 2IWRA 4BGIA 1P7YA 2VTKA 3OFKA 1CUVA 3M5DA 4JITA 1MAUA 1UOQA 2WIBA 3IS3A 4FGZA 5DYGA 5BSWA 2I2BA 3MBIA 1AK1A 4FONA 4DDHA 3AERA 4KRGA 3T5CA 2OBMA 2QPAA 5HS6A 2AWOA 3PIIA 5EZYA 1KEPA 2IEIA 3NBUA 5TXGA 2RC5A 5DBFA 4A0SA 1B43A 3PQ4A 3OPNA 4IDOA 4Z3DA 1CY7A 3B13B 3U6BA 1BE6A 5DP1A 2GYUA 3VNUA 1Q15A 2RGYA 3PKIA 1T13A 1RLMA 1I51A 1UL1X 1M75A 1KDRA 3PFBA 1DO8A 5L3ZA 1XD9A 4JOCA 4F1WA 1KQGA 2G8LA 3V2UA 1EQAA 1D2CA 4C03A 4TUYA 2P35A 1YJ8A 3RYTC 2ZBQA 4KE9A 4WY5A 1E4OA 1H1TA 2V58A 4N5HX 4O2BB 5GVRA 3RRFA 3L8HA 5B30A 3I23A 3KPJA 3RTDA 3F6BX 5JYCA 1YBFA 3R74A 1Y9JA 2PV7A 3O03A 2K5UA 3O3OB 4OOFA 4PRZA 3UH0A 1FTGA 5CVTA 4GMHA 5LJIA 2P9HA 1G1AA 1DX4A 5FA5A 3PXGA 1R27A 5JS2A 1E3JA 4MQEA 1NP6A 4R0VA 5B6IA 1E1RA 3GIDA 2HRCA 5AW9A 2VKQA 2X7HA 3O7WA 1BX1A 4W4TA 3ZCTA 3NDJA 3FYUA 1P7CA 3RGGA 4D79A 4COKA 4M83A 3MF4A 3CEJA 1DTEA 4QNNA 1W0KD 3UT0A 3CV3A 3IUQA 3QVWA 4MW6A 5K8IA 3D8UA 1Z06A 2BONA 2FP3A 4KYIB 3AO0B 4ZALA 4K86A 3ITNA 4CU2A 4CV0A 2GF2A 2VUUA 3OOSA 4OCZA 4C6HA 3GRRA 3K4QA 2AX4A 5E0KB 4WESA 4AW9A 3JZMA 5TF0A 4V0OA 4RETA 4KUGA 1KEKA 3AFGA 5C0OE 1JKIA 5C4GB 3FTDA 5I7VA 5LKAA 2ZDHA 4ZVKA 9LDBA 3GPIA 3OCXA 1DKUA 2JJMA 1TK9A 2MSKA 3JPWA 1G17A 2G28A 1LK5A 1AKUA 3ZLUA 1FL9A 2VDRB 4CKYA 3LWNA 1JDBB 2ZI5A 3NB0A 3L05A 3NOVA 1NA5A 1OAOC 1G2QA 3PBKA 4RPLA 4WGGA 4UM8B 3UG6A 1K4MA 3MTBA 1LS6A 2X2PA 1OCEA 3OETA 2VAMA 4YEDA 5AI4A 4ITVA 3F47A 4NG4A 5DNDA 4AJ2A 1CUWA 2FE4A 3WQBA 2GASA 1BGWA 3ZE9A 5LD2B 2CB9A 3BRQA 3PK0A 3I30X 1UWVA 1UBGA 2YRWA 3HXMA 2PX0A 3BEOA 1OT5A 3LBYA 4I4CA 1DX6A 3TFWA 3BM5A 3EWIA 1HFKA 3CUTA 2BCGY 2QU7A 5IVDA 4ZXFA 1Y6QA 3KBOA 4L95C 4IX9A 3OEYA 4NS1A 4CDNA 4ZCMA 4LZZA 4AP9A 4CMKA 5EIXA 1AKQA 1PGPA 4IXTA 2JARA 2D3TA 3OAAD 5JSYA 1EX1A 1VFNA 1W52X 4K87A 2X1MA 4A10A 5KJ6A 2G0TA 3UK2A 2E3JA 2Z6VA 4EFLA 2JD0A 5JADA 1VSVA 2WEKA 3GNSA 3WKCA 2D6FA 3WI7A 3PUHA 1A7KA 1NWHA 2JFVA 2ON6A 3E3OA 2Y1XA 1X0XA 5EGNA 2Z6UA 1LPMA 2MYTA 2JW5A 5T41A 4Q03A 3D0OA 4Y98A 2PUWA 1H3FA 1P0QA 3IOCA 5FF9A 4BZQA 4NMMA 2V7XA 2FCRA 2LPMA 3RO7A 2BFCB 4A26A 3QJYA 4C5AA 2F1HA 4EOGA 1Q50A 4DJAA 4WRRA 1U0JA 1P91A 3DCJA 4U2DA 2BM0A 1R3DA 2QZZA 1UXGA 2IU3A 3JWHA 1DIHA 821PA 4OK5A 2D74A 1F48A 1PE0A 1SOVA 4FFSA 2C7VA 1LTKA 2L42A 4FLFA 2J45A 3M3HA 4GPZA 3W0LB 4CXMA 1GGEA 3AEYA 4Y1GA 4AVYA 4G0XA 3K9LA 4WH0A 3AR3A 3ASVA 4U2EA 2CLLB 3QY9A 1XLVA 3PUIA 2PYDA 2B4QA 3IQGX 1S1MA 3K0SA 4OJNA 2DT5A 1ISSA 2VK2A 3AHJA 4DCNA 4EF4A 1P2FA 2Q1UA 3MIZA 5C52B 1CE8B 3QG5A 2GK3A 1AQYA 2DUMA 4Z9XA 4LNUA 1NXSA 2HQOA 3H99A 5MF6A 2PGIA 4R7ZA 4PCLA 1SCKA 1QQTA 1ZM7A 3NNDA 3RFVA 1EH5A 2HN9A 3UVEA 3KETA 1KKUA 2ACKA 2ANBA 2G4CA 2EZ4A 2W9XA 2YZMA 3GDHA 4HADA 4BO4A 4F86A 4ZAFA 3PQ7A 4PC3A 3FSRA 5JMOA 2EWWA 3OJ0A 4XLZA 4CDMA 4GGOA 4C76A 2Z4TA 2J5BA 1RCTE 1DEXA 1N2XA 2XMGA 4WXMA 5JATA 4RSMA 5HKAA 3FPBA 5K1ZA 4H7EA 3UANA 1DV2A 4M7PA 1CUGA 2ZIVB 4TM8A 3ZXIA 4LYYA 3WA6A 1BWPA 5CHYA 5K99A 4IS3A 1A1VA 3O2QB 4F6RB 4GL4A 1ID1A 1SKUA 2Z2YA 1Z56C 4FM9A 1TMYA 1CJSA 5FX2A 1EUCB 2EDAA 4F97A 5A03A 4YMTA 1CZHA 3PRYA 2IYUA 3SVZA 4DVGA 3B6KA 3VSAA 3IRVA 4LGVA 5AVOA 1JSXA 4RPKA 1JHQA 2AF3C 2PO5A 3A6PC 1XDUA 2CZGA 3EPRA 4JI8B 4L9SA 3E05A 3TBKA 2XLCA 2XRFA 3SKYA 2OO5C 3PTAA 1ADCA 1DQNA 4BNXA 4N7JA 4IUCS 5KDLA 2WTUA 2BMWA 3TR5A 2YJNA 4Z9AA 2VCYA 3QENA 3B20A 5KYWB 5DHRA 5EJ5A 3ZPXA 5BN5B 4ZIRB 3L9XA 1X9IA 1FEZA 4RHTA 1N5IA 3J7TA 5HRUA 4MVYA 3H7IA 5B3KA 2WR8A 1JKMA 1M66A 1M5UA 3NNNA 5I01A 2OB2A 2P77A 3M2PA 3OUUA 5JMPA 2R97A 5JSZA 2J0QA 1NW5A 3IVGA 1DMSA 3ND6A 3R77A 3TOCA 1MPXA 3UK1A 5CD1A 9LDTA 3T0GA 1Z0ZA 2FFHA 2FKNA 2Y0CA 1RAHA 5LQCA 1I94B 4NBNA 3VSBA 4DKXA 1GEGA 1OLXA 3C5VA 1DEOA 5I9MA 3O4JA 4FN5A 3T1TA 2HXSA 1KXZA 3RIMA 2LP4Y 1N2JA 2CF5A 2OHGA 3HDQA 3CRVA 1D3AA 2XEXA 2XR1A 4QPNA 3WBJA 5FWNA 4MWSA 2FXIA 1E2BA 2YJTD 1QC5A 2RAPA 2XDQB 1E8DA 1JW9B 4I2NA 4Y1FA 1F7UA 2ZU6A 2C2ZA 1KIMA 3WLRA 1VMKA 3KKQA 1U8FO 1ECLA 1JHPA 5JJBA 3I1FA 4MVXA 5ILQA 3COVA 2YR0A 2OEPA 1LJLA 1Z4PX 2C3UA 4YLGA 1E89A 3CKKA 2W2OA 3NJ4A 4PVDA 5FUXA 1KJ9A 5IZCA 1OC4A 1FQJA 1USKA 4G1MB 5BT9A 3Q11A 2A5YB 4IDCA 1DG9A 5U4QA 1UCFA 4MXDA 3TAHA 1DSSG 3TIIA 3ZWOA 2MYUA 5GWXA 5KS2A 1QQAA 5MHTA 1TLTA 1GPJA 1IXSB 1L1QA 4PBRA 4UDXX 3E7DA 1LBEA 4K2HA 5ALIA 3DUFB 3WFZA 3D64A 5LR6A 3QV1A 2CMFA 2RHBA 3KXIA 4DXAA 1E3MA 3WGNA 2HDOA 1LLFA 1EVIA 3B51X 3RABA 5AW0A 3DQZA 3EXIA 3TQSA 4BV9A 4QVGA 3GJRA 1J9ZA 1WMEA 4L8VA 1E2MA 2JAUA 3HVIA 4XJTA 1DAHA 1CQPA 3Q7RA 2COEA 4RLSA 3W77A 1Z0DA 3E0QA 3MFYA 5DLPA 4BFUA 2KE5A 1V8FA 1E58A 1QVZA 1V25A 2P78A 4P4GA 3ZK7A 1A7AA 1TLFA 2XCIA 4GZ6A 3WC4A 4ENUA 4GI1A 3KFXA 4R8VA 2RDMA 2RGNA 1I5OA 1N32B 2RI0A 5AJVB 5FXMA 3STWA 1GTMA 1QTIA 3JQFA 1K97A 5HQJA 5KREA 1E9CA 3TSWA 5J4KA 1KETA 5ELMA 2XF8A 3F6SA 3FLAA 5EZSA 2C7OA 5A3JA 1B16A 4B33A 5GJVC 3WKAA 1TECE 3MLEA 3RS3A 3QEBZ 3OCUA 3KUUA 1A2KC 4D9MA 4FQ7A 4TMFA 2G8NA 2WOOA 2XGGA 2QE6A 3FUVA 3LPLA 5AH0A 2R751 5CGZA 3MMNA 1H2RS 3GH1A 1IN5A 1KMCA 4WOKA 4H7HA 5B1YA 1LLUA 2X3FA 3ZXUB 5ELLA 2OXEA 1BQ3A 3TEFA 4EMUA 4UEKA 3S29A 4PG5A 4W1RA 4Y7CA 3SVLA 2B61A 3I2KA 3TI7A 1ESNA 1R74A 4F2PA 2WUFA 2ORVA 2XUOA 3DBRA 4HNAB 3TR6A 5JBNA 3HWWA 5JJIA 1PR3A 1AU9A 2EU8A 4FEGA 3D3JA 2HLNA 4WNAA 4KN6A 3H42B 1GARA 1TE2A 2FEAA 4HPJB 3U1VA 3D3WB 1XPOA 3Q9NA 3ELBA 3ZWMA 4GX0A 4NULA 1VYUA 5BV0A 1WBDA 3KZOA 5D86A 3TI9A 1G21B 5L4NA 2PD3A 3L6OO 1ZNXA 2A9PA 3GRFA 4RH3A 1CUBA 3KSRA 5KC8A 3GN2A 4HGRA 3HO8A 5DTIA 3C5WP 4CTJA 3SYMA 3OHMA 3VR6D 2RONA 3AYZB 1SD2A 2BEWA 5KB3A 3TW0A 2Q9BA 5JNUA 4QG3A 4KREA 1RFLA 1NSTA 3NATA 4GU5A 5JAHA 3RU9A 1K66A 3QBEA 4MAMA 1A71A 2D7JA 3NCHA 2FOIA 4P4NA 3MCTA 1EE9A 4D3XA 4BS9A 5H5JA 3QWIA 1KSFX 1TA0A 3PHCA 4OY3A 2E37A 5E6RA 3OWXA 3GY0A 4RTSA 2HSJA 3JQQA 1YFZA 2PMWB 4G1VA 3MHTA 4N76A 4RD6A 1UADA 3FMFA 1TJYA 1VL8A 3TMAA 3VI3B 4V1CI 3DZFA 2BZSA 4HHEA 4GEGA 2XT6A 1O3YA 2VS1A 1FJHA 3QMWA 3UCXA 3MYRA 4POAA 1Z5NA 4TMWA 4MJLA 4GAEA 3QWAA 1U3VA 9MHTA 3NM6B 4D57A 1H2YA 4F45A 3P9ZA 1FFAA 1DRVA 3G85A 3PUWA 4YCMA 4WACA 2AFHB 2B21A 2O5EA 1RPTA 1N2SA 1WX1A 2QV7A 3H5LA 3VUFA 1W0KA 3WLJA 2XE8A 3P0EA 3BJZA 1UBSB 3HA3A 1HKHA 3I9NA 4RHYA 4XX0B 1R4MA 5KI6A 4NDNE 3WK7A 4BX0A 4D98A 4FYYA 2PMCA 3HWSA 2UXBB 5DBEX 3KJXA 2UZ0A 2C5LA 1JMKC 4JGGA 4O4HF 1LLQA 3SF8B 1Z5GA 2BOVA 4YDQA 1Z6ZA 3KV1A 4BKPA 1GAJA 1TT5B 1NBOA 2Q99A 1RU3A 1OYWA 4LBYA 3QF4B 1MG0A 4EO4A 1E9FA 3G82C 2HEGA 3EARA 2HJRA 1WXWA 2QAGA 3IODA 3EDCA 4QM6A 4X24A 2WHQA 3WLSA 4ZDKA 5CDSA 1DC7A 2WQZA 1R0RE 4JVMA 3HKBB 2JFNA 3CF4G 2PN1A 2IPXA 1VJDA 2VCHA 1LRLA 3L8GA 4JVNA 4QYXA 5GZ1A 3LA6A 2WTAA 1P72A 2X8BA 3K7EA 3O4IA 4PC2A 3RJ9A 3T1VA 1VG0B 2RIRA 4Q4HB 1CRPA 4DIFA 3MJ4A 1EE1A 5G4LA 3UAYA 3VJRA 1IEQA 1X1SA 2EARA 3I9JA 3JQGA 4MS3A 4M88A 5J9FA 3T3MB 1BCRB 1EAYA 2Z0MA 4A0GA 4AY3A 4G85A 1EB8A 1EDEA 2QJWA 4I6JA 4MDHA 4PAQA 4QPCA 3P9KA 2F3TA 2XOEA 3FTEA 1BHQ1 4L9RA 1TIBA 5FAXA 2FEXA 1PWYE 1ZSYA 1I1NA 4NAHA 1XZDA 3BFPA 3VHXB 1L3CA 4EG8A 5KUTA 1N5JA 4HUJA 2F3PA 3OAAA 4CJXA 1JI0A 1TAUA 4WW0A 1DBWA 3ND8A 3TD6A 3BE6A 2A1TS 4N3CA 4X91A 2C2YA 4HXGA 2VUHB 5CB8A 3M3DA 3PC8A 1DIGA 1R8QA 3C6BA 5D5QA 1U4SA 1QYCA 3UJ6A 2XMPA 4DAOA 3MMZA 5AVTA 4C7OB 1LVGA 1JV2B 1C1XB 1YHYA 4RUKA 1SKBA 2IPMA 3P0JA 1IE3A 4MWTA 4R1PA 3DVQX 1CERA 3FYUC 1GCGA 2D0DA 3IKMB 4FYKA 3C8MA 7MDHA 1OGJA 3L7JA 4RKFA 3VZCA 1G8AA 1ZP6A 2EFEB 3SHVA 1ITZA 3L06A 3OFJA 4TYWA 1BD4A 2XVXA 1JQKA 2BT4A 2HWWA 5EIFA 3AF0A 1KI8A 1P9OA 4MITA 1EFTA 2WA1A 1CTQA 1YMQA 2LV8A 4XXHA 1JDUA 3NDBB 2CVPA 2RHMA 4BDSA 4D4HA 2Q5FA 4EDHA 4P7KA 4AJ4A 1AHHA 4D8XA 4IJ6A 2FSHA 3BGIA 1KYWA 4GLFA 1SVMA 4YBZA 5IT9A 2CCKA 5JECA 1QGED 3HCAA 2QOEA 1B8PA 4RY2A 5GM1A 2KHZA 2VJBA 3TXYA 3W5IA 3OLWA 3CZRA 1EP2B 1YT5A 4DLXA 2GJAA 3VPAA 4F9EA 3W1EA 5BPHA 2P5SA 2XTZA 2VDWA 2CL0X 3B38A 3FR7A 4KAJA 3ZHCA 5ENZA 4CCYB 1RWWA 3IV7A 3M8KA 5AUPB 1C8KA 3EQZA 3W78A 3K30A 5JZVA 3H4IA 4TT3D 4AYTA 5C7LO 3FFWA 4OREX 4JUCA 1RHQA 5IFKA 1BJKA 4G3XA 5KWIA 4EPVA 4WCFB 1KL7A 3FKSD 4U39A 2Z83A 3BCSA 2FEMA 3TZQA 1MX1A 2EW2A 3GEPA 3VZPA 1GFSA 4UXIA 2JI6A 4QUBA 4Q9LA 1LBSA 4I1VA 4XWAA 1K63A 4NU6A 4L28A 2NMVA 4K9DA 4RXTA 2Q3MA 1R6VA 5CLIA 3GIWA 3DL4A 4N39A 5ALNA 5LKRA 3ZNQA 1VSBA 4C0LA 1ZK1A 1E62A 5B6PA 2F1RA 3SMVA 1PJRA 3QF7A 5FOQA 4IMPA 3T5PA 4ZAGA 1WRBA 4Q9IA 4ETIA 3HYCA 4FT2A 5CFQA 1G42A 2ZUFA 4PIPA 3EOBI 4R3WA 1JPJA 1GPBA 1U94A 5JZSA 4PO3X 4BNWA 2BFDA 1L5FA 3GARA 5HCUA 3TOSA 4DA8A 4FE7A 1WMAA 4QGFA 3Q9UA 4TOIA 5EUBA 3WLIA 3R0ZA 4E88A 4MUHA 1O4WA 1GSOA 1E6LA 2QN9A 4RIIA 1L0BA 3N2YA 3ZZMA 3JQRA 3UC9A 5GJWC 4BMPB 3EXEA 3PEEA 3UWDA 2BGUA 3OJFA 5FDFA 2X8AA 3BZUA 4MEBA 4JEMA 3A36A 4NJMA 5DCLA 2AK2A 2QPLA 4PYKA 3CB2A 4XPZA 3OZUA 2ZUUA 3MS4A 4HDOB 1GZVA 4UUOA 1X7GA 4HUQB 5ESDA 4PAGA 3KZNA 5IF9A 5A9SB 1LZLA 1CS0A 1TAQA 4MS1B 1J23A 2BE7A 1Q3HA 2CHUA 3HA7A 3L9WA 5H81A 4WZBE 1C50A 1G3QA 5HK8A 5IC6A 1R8SA 5LA6F 3V46A 3VPHA 4E6EA 4ER3A 3WJ1A 1XEWX 3R0JA 2TMKA 1W49A 4BYMA 3QX9A 2DKOA 3LCVB 3UMGA 1AB6A 4JODA 1ZCZA 1OA1A 4PG4A 3G2OA 2Z56A 5HCNA 4FSDA 3SOPA 4MA0A 4DJTA 4GOMD 4IDNA 4F0JA 5EWLA 3LYHA 5FBZA 4DYHA 3K6SB 2PGNA 5J47A 4LDAA 2CVFA 2CVQA 3KG2A 3PX3A 4IGFA 1BW9B 4RD3A 3WWDA 2HF9A 3I2IA 5BOSB 2FOXA 2ZR0A 4F3NA 3HCEA 4YRSA 3VX4A 4OXNA 1BEUB 1P8JA 2QDXA 2WWWA 5A5VA 3GG2A 5BQ3A 2IX9A 1L7BA 2MSCB 3EFHA 4XYLA 1G21E 2F1OA 3AP3A 2AUTA 4AG3A 3KLNA 3MUEA 2FXVA 3NETA 1K8RA 4CKWB 3GZNA 1J07A 3A4TA 1CUJA 4LRSB 5TQ2B 1KO4A 1SBNE 3GDGA 4RTRA 3IT3A 3LX5A 3H5AA 1LPAB 2ZIFA 4X90A 1DAEA 4G37A 3T7KA 3O95A 2VJMB 3QX8A 4KO2S 1QZ3A 2ORED 3O74A 2DFDA 4AJLA 3QU4A 4DWWA 4GX5A 4ZYUA 3O38A 3P5BA 1Z25A 1BU8A 2AI3A 2IPOA 3A9RA 3EE6A 2HV9A 4IJWA 4XVHA 1JJBA 3K2IA 5EE5B 4EHNA 5C1DA 2FLKA 4KXWA 4XWWA 3FFAA 2IK8A 3DTVB 4Y9SA 1JYSA 5JRJA 3D43A 3GMTA 1LPOA 4EJSC 3QOXA 1SY7A 2GDJA 3DWIA 2Q3DA 1HOTA 1P7VA 2QL7A 3T5BA 1O9HA 3TTUA 3IPYA 1I3NA 3FNEA 4IHAA 1JHOA 2H9AA 3F97A 4N03A 2Q6LA 2P9BA 2FPGB 4FR0A 4OHWA 2AKAB 2JCXA 3DOIA 4DCOA 2I62A 4MEJA 1UJ5A 3HXKA 3UJHA 4GP6A 1QHHB 2VG8A 4RXUA 3RPEA 1B6SA 4XDZA 3Q2IA 2PUDA 4IV5A 1FS5A 3HA2A 3E9ZA 1GL3A 2EATA 3TFQA 3V32A 1G7RA 4FNMA 1ESCA 3BE5A 1RYEA 4WZZA 5AWFC 4GPAA 2B9EA 3O91A 4X3OA 3BFXA 5BRAA 1H6AA 5KOJA 1S6YA 3TS1A 2BL4A 4NYJQ 4XB6B 1U2RA 3ZJTA 4DA4A 1SBQA 4IG9A 1QRAA 4YJ2F 3PFKA 3FWZA 4KL8S 4BRWA 3EGIA 3LGSA 3W7BA 4DC9A 2C59A 3ZY5A 4LQDA 5AVUA 1ZH6A 4UQOA 5IYZB 3NH6A 1E0DA 2O3RA 4R54A 1KVTA 1WEHA 4AN0A 4BNZA 4DIBA 4EYGA 1GM5A 2DBQA 1I3CA 2B94A 3CR3C 4QREA 3WMRA 3OFND 1U7OA 4C4TA 1INLA 5CB6A 3GVPA 5F5LA 3ZE0B 1U8YA 3GNQA 4WN3A 1TZJA 2X0DA 4Q3KA 3WQSB 3WNVA 4Q12A 2JIRA 4URVR 1D9XA 2RHGB 3QU2A 1GJRA 4LY6A 1JTFA 1TU0A 4PVCA 3JATB 2FSIA 3LKBA 2XDAA 1AA6A 3R5SA 5DI9A 3BG5A 1T9DA 3ZW9A 3WWEA 2OENG 5IZCC 5ED0A 3F49S 3D6MA 3VR6A 5B57C 4O4HB 1T29A 1TT7A 2WIAA 1AMUA 1GADO 1HC7A 3NTUA 3ZWDA 3VKWA 4RDCA 3ZIUA 2NSDA 2XYRA 4KIJA 3RCBA 3RW9A 3ANNA 2YDYA 3V7FA 4NEGA 4JI5B 1RP1A 4AMGA 1S2NA 2NSHA 4OGWA 4HAWA 2IW1A 2ZYGA 3OLCX 3OQ6A 4ZD6A 4CT5A 5IRCD 1SHKA 2O1WA 2I1LA 1QAQA 3JU3A 3REFA 3PL5A 4NCIA 1UH5A 5EUCA 3IP1A 1XRRA 4PXYA 8MHTA 5LLTA 1IUNA 3GQVA 4FZ5A 1CR2A 5EMMA 4D4JA 2PMDA 2Z5VA 1JLRA 1WSWA 3L77A 4TSFD 1R64A 2Q5EA 1LV8A 4KMMA 4R8KA 1JHMA 5ETJA 3KC2A 1A9YA 1EWYA 1T8WA 1XXLA 3IMGA 4XVQA 1BTOA 1U7WA 2HJVA 1CZNA 4EEXA 1PWZA 1N7IA 4EHHA 3JQFC 4YV2A 2ZYHA 2WAOA 1KK1A 1Y42X 1P5JA 2P9GA 3TQIA 4JLSA 2ZJ2A 1BVUA 5AM4A 5CVUA 3EQ8A 3V1NA 3V7NA 4BWVA 1Z35A 2O1SA 3GLHB 2QZ9A 5IT4A 3BQMB 3HJTA 3IMCA 5FRDA 1JHZA 2BFCA 2DLCX 4D92A 3LWZA 4LTDA 5SICE 2HFKA 3KKPA 5JSHA 2Q5JA 3HJRA 1A72A 3PUYA 3ZZ0A 5ADWA 3HDTA 2QVYX 2QD3A 2I3AA 4GI7A 2Z8YA 3W9BA 5LIRA 2ETVA 1PD1A 5C2JB 3P26A 2DFTA 2OZKA 5J5AA 3T9FA 1K7FB 3WLMA 3SBOA 1HDOA 1OFGA 4MO2A 1GDHA 4B3IA 1DBVO 3OZ7A 3A05A 4DQLA 1VJ1A 4FBGA 3DTTA 1X1TA 4FOTA 4ZP1A 3R9IA 4XCXA 4UATA 2JAOA 1IPFA 4EX6A 1VCNA 2VO1A 2QZPA 4BRUA 3V8RA 3ZTWA 2J41A 5HF8A 5DN9A 1RWVA 1X80B 1CE8A 1U2SA 3DT8A 3GV0A 3QFCA 2NIPA 3QVVA 2ZJFA 2AXPA 5CB4B 5C4IA 4KOAA 4ESOA 2OG1A 1UWCA 1C41A 4QT4A 4ZTUB 5BYBA 4MVJH 3IIEA 1YCDA 4E09A 2CEKA 5B53A 1UFKA 1S3FA 3OLZA 4RADA 2RHHA 1FTNA 3WLFA 3A1NA 3K31A 4AF8A 3KEGA 4MQUA 2FRDC 4MV7A 3ITEA 5LXTF 3F2IA 3H1AA 4JCOA 1E1DA 4HDKB 5JWOA 5JARA 2O4UX 5L45A 1JBQA 1HY3A 1W2WB 3DAHA 4ZANA 1M8FA 3RUFA 2YHAA 1ORTA 5ALHA 4JHXA 1QCYA 5FL3A 2Y8EA 4FNGA 3U7QB 5JQGF 1P7PA 2EKBA 4F6RA 4GMFA 3VR1A 4AJJA 1ND5A 2QVCA 3TOVA 1BE0A 1EUCA 3PNOA 2PKEA 4XIFA 2IS4A 2WM2A 4G4SP 1DELA 2V7PA 3MWLA 3FPEA 2PLWA 3E4DA 2J6IA 1Y8RB 3G6KA 3GP3A 1QO7A 3KD2A 3VO1A 1ZJZA 3MUFA 1Q3TA 2NU9B 4L73A 5IJXA 4QBKA 1JZTA 2Q6VA 4RA9B 4Q4CA 2WJIA 1F06A 4CHTA 3QWHA 1ADYA 4CM8B 5KYWA 2H1VA 2G17A 3A04A 4YGXB 1Z5ZA 3ILVA 4TXJA 3WHLA 4ZIRA 5BN5A 3HVRA 4J1TA 5EJEA 4LI3X 2ZZKA 2QAGC 3BFJA 1KAHA 3Q88A 4HN4B 4JS0A 1VDZA 1XCGB 3RC8A 3NANA 4DGSA 2VTEA 5F3DA 4OKNA 3ZYZA 2CCGA 3RHTA 5C7YA 5CB0A 4OVKA 1XTPA 3HMKA 5IJWA 1L7RA 1EI9A 4IM7A 4FDLA 1P4HA 3CUYA 1G9TA 4L9WA 4O4JF 4R8MA 4AU1A 4HLUC 5L3RA 3RSLA 4IHQA 4Y0VA 2Y68A 4G26A 3T15A 3N0VA 1U2DA 1VL0A 4R1SA 4F8EA 4F85A 1MCZA 4HQ0A 1OPXA 1X6VA 4TT3A 2I67A 2X8LA 3X2EA 1E69A 1BFDA 1PJSA 1R50A 2A1IA 2WMYA 3IELA 1JA0A 1HZJA 2G6TA 3BTOA 1NQVA 3KU4A