4CQMD

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
247
Chain Sequence
SQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 247
sequence length 259
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmD00
5TGDA 5IDYA 2ZTUA 3ZDFA 1E1NA 1PJLA 3BMOA 4ND4A 4D0SA 2ZTVA 4EUEA 3TF5A 2EHDA 4FFLA 1N9GB 4CMKA 1YB5A 4CM3A 3D4PA 3H5NA 1ISJA 4B8ZA 3DDNA 2D2IA 2J5KA 4NBRA 1IB6A 3M1LA 1WLYA 2POQX 3D3EA 1KVRA 1U5AA 1RM0A 1YL5A 1V3VA 2D5AA 2UV8A 4HBGA 1X0VA 4NBVA 3BMQA 3HZZA 4E21A 4LRSB 3MZ0A 4RPGA 4S1VA 2NVUB 3ZH2A 4RZIA 3E8XA 3K2BA 4UEJA 4WCFA 5IF3A 2Z1MA 3GDOA 1GUYA 4IDGA 3MJSA 3ABIA 4QQRA 3TOXA 4G2NA 2F1KA 4KTVE 4L75A 4PZDA 1IL0A 3D3WB 2ZK7A 1ZFNA 4Q3AA 1HYEA 3H65A 4CR6A 3D5QA 3D1LA 4MJLA 3TNLA 3AW9A 3RSHA 1CYDA 1XELA 4OSOA 5AXBA 1HSOA 4J3FA 4CLOA 4IGEA 3Q1LA 2EW2A 2VT3A 2OP1A 1TVEA 1PS0A 4FBGA 4FFMA 1VKOA 5T64A 4CMAA 5K6AA 4Q3CA 1DIBA 2P5UA 2O4CA 3NGXA 2B35A 1B7GO 5CEJA 2YY7A 3PQEA 1SO8A 1C0LA 4BNJA 3L9XA 3IOYA 4PIVA 4XJTA 3CTMA 1U2GA 1JA9A 4H15A 3GGGA 4LMRA 2C2YA 4QTZA 2C7VA 2P9CA 4RO0A 2CVQA 2UDPA 4WPGA 5B1YA 2RH4A 1MV8A 1NAIA 3RUDA 3TDKA 3R3SA 4U0KA 1NYTA 4MP3A 3H2SA 1C0PA 3E5RA 6ADHA 3F4BA 1V3TA 3JQAD 4JXKA 3EZLA 3SC6A 2HKIA 3JQ7B 4GH5A 3OICA 3OJLA 5B12A 1Z45A 2FN7A 3JD0A 4DVJA 5IXYA 4ROSA 5H81A 4AICA 3Q0EA 5DCYA 3GNTA 2AA3A 3OQ1A 5L7YA 1ZK2A 3IMFA 4FS3A 3T7EA 3QWFA 1GUZA 2E4AA 5KKAA 2BF7A 4DQUA 4HADA 1UR5A 4XQCA 2DFDA 3OF2A 5JDIC 1X7GA 1JAYA 1H5QA 1PL8A 2OBYA 2PGDA 4WOKA 3G49A 4UUOA 5C7LO 5JCJA 5BSFA 5T57A 4RVDA 1GYQA 1DO8A 3V5NA 1B8VA 5I8ZA 4CLRA 2B5VA 1YKFA 3ZNPA 4P4NA 5KJCA 2ZIZA 3C1OA 3T7CA 4BOYA 4FC7A 2WEKA 4FSHA 1ZXBA 2H5LA 1E92A 2Q1WA 3DMTC 4A27A 4PG5A 2O3SA 1GPJA 3GVCA 1YRLA 2E48A 2CDCA 1Y81A 3GEMA 3X2EA 1I2ZA 1P1RA 2HK7A 1T2DA 4J1QA 5DBGA 3SLGA 2R00A 1JKIA 4XYEA 1GU7A 4Z3DA 3OA0A 2IEDA 4A10A 4ALNA 1DDOA 1TT7A 2PZJA 1GV0A 1PS9A 2A92A 3BMCB 3WQRA 3AY6A 3E1KA 4TVOA 1PTJA 2ZKLA 2VYVA 3L6DA 3NAQA 3ZV3A 4U8GA 3PYXA 3OJOA 3LLSA 1EE9A 4EJ0A 2VZ9A 1GYPA 1DRVA 3GFGA 2EIHA 2Q3EA 3HB5X 3QA9A 3WWYA 4LK3A 1JW9B 3BMNB 1ZSYA 4OM8A 1NPYA 8LDHA 3FR7A 2I67A 5U9CA 4R9SA 3RUCA 4I5EA 3BHIA 1C1DB 4LW8A 1AN9A 2WMDA 1M67A 1ARZA 1UXJA 3RD5A 4XYBA 2DBRA 4CQLA 4YT5A 2WJPA 4RVFA 2C5EA 3FSRA 4KDEA 1QYVA 5ICSA 3DONA 3TOZA 3GRKA 4I9UA 1E5LA 2PNFA 4AJLA 5C5IA 1LUAA 5HTOA 5I9LA 2X1HA 4W7HA 5I7VA 1H6AA 1Q7CA 2W2LA 5CEFA 4OKNA 2GRAA 3IUSA 5EINA 4Y6SA 2Z1NA 1F0YA 3UFXA 3C7DB 3JYNA 4WECA 4CV0A 3BTSA 1Z6ZA 3KOUA 3W4KA 2UAGA 5KJEA 5AXDA 2GD1O 3LLVA 3VH4A 5TF4A 2YV3A 2X0JA 2I9PA 5EMHA 1R16A 1NP3A 3EY4A 3H2ZA 1U3VA 3JYPA 4M8SA 4BKPA 1ONPA 1YXMA 4CMHA 1Y9EA 4PCVA 3NDJA 3ON5A 3SX2A 3VH2A 3X2FA 3Q9NA 3QSGA 2IRWA 1S6YA 2NU9A 3PYLA 1DLJA 2W98A 3CXRA 4IJVA 1NQTA 2C29D 1A4UA 3EHEA 2VWQA 3QVXA 3GY0A 4NG5A 2IXBA 2CMDA 2G5CA 3C85A 3BHJA 3MOIA 5I9NA 3U09A 1WPQA 5A3VA 1UDCA 1KEUA 1PJQA 4TRJA 1PJ3A 1YDWA 2EWMA 4WEOA 2JD0A 4EBFA 3FNHA 4RV9A 2G17A 5TS3A 3B20A 4F6LA 1LSSA 1FF9A 1DAOA 3RUAA 4MVJF 4CMBA 4LCJA 1WDKA 3UHAA 4D45A 1HDCA 1UP7A 3WGZA 4KUGA 5KCZA 1MX3A 3BTVA 4FOOA 3VTFA 2E37A 3IDSA 3UUWA 4ALMA 4IMRA 1CDOA 3ETDA 1EDZA 2PV7A 5TT0A 4E2WA 1UAGA 2P91A 2V6FA 3WGYA 4RVUA 3DZBA 5B37A 4BKRA 1ISFA 1EBUA 1U9JA 2O3QA 4NBUA 2BLLA 3GHYA 4BNUA 1R4MB 3KRTA 4M87A 1DC6A 1PR3A 4B3IA 3KZVA 2VTDA 2X0RA 2DT5A 3IAHA 1ZJYA 1AHIA 3FHLA 1BMDA 1ZMTA 1HE2A 4G5HA 4W99A 1B8PA 1OBFO 5IN5A 4AJ2A 1BW9B 5JY6A 2AEFA 1ZCJA 4JBIA 1KETA 1LDEA 4N18A 3QW2A 4N54A 3GHHA 3HHPA 2C07A 1D1TA 1ZJZA 3G79A 4FIZA 4HX5A 3FPLA 4P38A 2HJSA 4UVGA 1QYDA 4YYZA 1QKIA 3RBVA 4Z3KA 2QYSA 1JLLA 1WZIA 1RJWA 5DF1A 2X58A 1G6KA 1WWKA 3L4SO 3QRWA 3OIDA 3F6YA 4GX1A 2A9FA 2D4AA 3PIDA 4DXHA 2X9VA 3RWBA 1KC3A 1X1EA 3G3EA 1NHWA 5JNLA 3K92A 2DFVA 2NTJA 5L95A 1MP0A 2NU7A 3I9LA 3ZWPA 3UN1A 5B4VA 5IDWA 1PWXA 2IDZA 1R37A 4YT2A 3UVEA 2Q1TA 4ITUA 2EGGA 2AW5A 1EBFA 3LF1A 4IS3A 4H16A 3ULKA 5JCJD 3IIEA 4YCAA 1O94A 3VOSA 3GZNA 1C1XB 5HS6A 2JFGA 3E6AA 1YVEI 2QZ9A 4E6PA 2PA3A 1GDHA 2X5KO 3OJFA 1KEVA 3CPSA 3DXFA 3PJGA 5DBIA 1T2AA 5JO9A 2RH8A 1LXCA 4ZA2A 5DULA 3GH3A 3GGPA 1ZNQO 1HXHA 3ZW9A 4JJIA 1LTHR 5DP2A 3AU8A 4RZHA 4B8WA 3FPCA 4MVJH 4GKBA 1Y6JA 4E5PA 3ZNNA 2DLDA 1HE5A 2OOSA 4Z6KA 3ZNQA 1DLIA 1GUFA 4XX0A 3UICA 4XWYA 2I66A 1E3WB 1EVYA 4MIYA 2PKQO 4DYVA 4E31A 4PLYA 5COQA 4EDFA 4Z9FA 3DHEA 3H9JA 1HF3A 3ZWXA 3VVBA 1DJQA 1C0IA 1UXGA 3MJCA 1QP8A 4D41A 2JFFA 1P44A 4DA9A 3EC7A 3GGOA 2VYVD 1IHXA 1AXGA 1S7CA 4YJGA 4EUFA 3FD8A 2V6MA 4UVDA 4DIFA 4MVJG 1O89A 4H7PA 3PWKA 3D7LA 4PLPA 1C3VA 1KEPA 4YJHA 2AXQA 3BHMA 2B0JA 1K89A 3Q2KA 4J9UE 3TJRA 3DBLB 1VSUA 1AUPA 2NACA 4IDDA 1WVGA 2DTXA 5HBRA 4P4LA 1NWHA 1F14A 3JQ9A 1ONNA 3JQCA 4GGPA 4B4UA 3ZWMA 2EV9A 1BDMA 3L4BC 3WQSB 2VYNA 4J90A 4UULA 3U9LA 4L8VA 4MVJI 2ILTA 1I2CA 2WSBA 2X9GA 1MLDA 4E3ZA 3H7AA 5K6AC 1YDEA 3KXDA 1P9LA 5IFLA 2HDHA 3NT2A 1MA0A 4MVJE 4CV3A 3PZBA 4EJMA 1G1AA 3QWIA 2EF1A 2DTEA 5A5FA 3DMYA 3L0DA 1PL6A 3ENNA 3U3XA 3CUKA 2BRUA 2C2XA 1NFQA 1DC5A 4B3JA 1PWZA 4NIMA 1KVSA 2TMGA 3LC2O 4CM4B 5TIIA 4PLHA 1HDGO 1HLDA 2FPIA 3LVFO 2QQ5A 3CSDA 3LT4A 2DUWA 2P4HX 3HFSA 4CUJA 4FC6A 1EZ4A 2X86A 2QYTA 3BTOA 2PTGA 3VAZA 5G4KB 5BNIA 5L4SA 1NAHA 1GR0A 2YHIB 4GBJA 3GVXA 4XA8A 1F8GA 1PSDA 3U4IA 4XRRA 1GCUA 1H2HA 2AMFA 4J43A 4GWGA 1LRLA 4HNHA 4QFCA 2PD3A 3ZW8A 4BO8A 4Z9YA 3F5SA 1WXDA 4TKLA 3RU7A 3D0OA 3PXXA 4L4RA 2HLPA 1QLHA 4IM7A 3VPGA 3FBGA 3FR8A 2VWHA 3ZI0A 2CUKA 5G0VA 1H6CA 5KOIA 2DC1A 3ORFA 2Y67A 3G1UA 5CDYA 1TI7A 4RF4A 4CMIB 1Z7BA 2PZKA 4BV9A 4ZGWA 2WYUA 2HMVA 3WGIA 1XHLA 1LRJA 4FJ0A 5CPFA 5DBFA 3WYCA 2WYWA 4TZTA 4E2ZA 4XIJA 4YAKA 1XWFA 2VZ8A 3V1YA 4FB5A 5I8WA 3RFVA 2AQHA 3WJAA 5KWEA 2AEJA 4HFJA 3OQBA 4CM8A 5IN4A 4YT4A 4XGNA 4XQ9A 1GZ6A 2A35A 4ALIA 4DMMA 2NTNA 3QVSA 1BXGB 4Y67A 2GNAA 1I32A 3KETA 3PPIA 2GGSA 2R00C 1Q0HA 1LLUA 4F6CA 4HV4A 1VJ0A 3ZHZA 2GZ3A 3QQPA 3INTA 4MVJP 2OZPA 4OL9A 5FF9A 3H5RA 3W8FA 3OP4A 2FZEA 3VZPA 1D1SA 3HDQA 1YB1A 4RVHA 1UP6A 3HDYA 2ZATA 4ZICA 2O23A 1VRWA 4ALLA 4MO2A 4CLHA 3AM5A 3E5MA 1PZHA 1ISIA 1P31A 1U8XX 3I9MA 4RPLA 2XXJA 1L7DA 5JC8A 2WM3A 3QWBA 5GZ3A 4N5NA 3C7CB 3GN1A 1KBZA 4L74A 1QXSA 3OQ6A 4YTEA 3I5MA 4BNFA 2Q45A 4GX0A 4CUZA 1E7RA 1DEHA 1Z74A 4DIOA 1Y5MA 2QX7A 3JQGB 4KP7A 3TL3A 4FFOA 1EUDA 1VKNA 3ZV4A 2B5WA 2CVOA 1U3TA 3WLEA 2JL1A 1EVIA 3NDRA 4GLOA 3FNGA 3F5QA 3WWZA 3CINA 1QYCA 1I24A 1DRWA 3PZRA 2AG5A 1T4BA 4DRYA 2GCGA 1YJQA 4J7XA 2E82A 4U5QA 5F5LA 2I5PO 1IZ0A 5AVOA 3ZHBA 1P3DA 4R41A 4TRMA 4E2XA 3PJFA 1WW8A 5KJFA 4M86A 5BNFA 4GVXA 4WGGA 2FRDA 3LK7A 1D7OA 4KQXA 3WSWA 4QO7A 3E9MA 1NQOA 4IDEA 4MKRA 3F9IA 1A9YA 4DQXA 1EK6A 4R3WA 3RUHA 2VWPA 4PLWA 2RIRA 5ICMA 3W1VA 4RVGA 4LSMA 3H6KA 2IXAA 1PU2A 1KERA 3UCEA 4OJNA 1JKFA 3A06A 1WMAA 3PFWO 1E3LA 3HG7A 4DL9A 5TX7A 2D0IA 2DQ4A 4HFMA 1HWYA 1XYGA 1E1MA 4FGWA 5FFFA 5CEEA 1WNTA 5JPIA 2AG8A 5JAIA 1LRKA 1GV1A 5CDUA 2HK8A 2EG9A 4MPDA 2Q4BA 3GAFA 4XB2A 4YJDA 4JX8A 3WGGA 3PJEA 3ZNOA 3I9JA 2P2SA 3B1JA 3S2FA 1DOHA 2O50A 3KEOA 3ZU2A 1TXGA 6LDHA 2ZJ0A 4X54A 4OGWA 5T6BA 3AOGA 2V65A 1IYZA 1PJSA 2BFOA 2QRLA 3LDHA 4L73A 4QFDA 2Q2WA 3KSUA 1DBVO 2JKVA 3DZKA 5CDSA 4ZN6A 3DB2A 1H9AA 4ZD6A 5G0WA 3WOHA 1B26A 1T25A 5DT9A 1AGNA 4CLXA 1PR9A 3OIFA 4KUHA 4RPKA 3FTNA 4KZPA 4MVJD 1W0CA 1PGJA 1NFFA 3O9ZA 1YOVB 5TRTA 4KMSA 4R9RA 2XPCA 4F46A 3U5TA 3DTTA 1SPXA 2WTBA 4PLTA 4W9NC 2VYND 1NNUA 3GF4A 1WP4A 3TSCA 1EQUA 5J23A 4DMLA 2HMWA 1XIVA 1N7GA 4YQZA 3BMOB 2IE0A 2EKLA 2Y93A 4ZQHA 4KWHA 1PL7A 1DFGA 1ADCA 5EN4A 2NM0A 2Q49A 3H9UA 4AVYA 4PZCA 5MDHA 1ENZA 2CVZA 2GN6A 4IDBA 3GG9A 4BO2A 1T1RA 1H6DA 3AU9A 3U49A 1EFKA 3VZRA 4WLEA 3TFOA 4JN6B 4CR7A 1H6BA 4O59O 3BMQB 4MP8A 1NVGA 1ORRA 1U2DA 5COAA 4J4HA 4U7WA 2Q99A 1XSEA 4CL3A 4WCFB 4BNIA 2QRKA 3H9QA 1UP4A 2BMAA 3BTUA 4NNJA 4IS2A 4FFRA 1ISMA 1O0SA 4OH1A 3PDJA 1HTBA 2GF2A 5MGBA 5I9MA 4ALJA 3JYOA 4NBTA 4NU6A 3DZFA 3RC1A 4ZQEA 1ML3A 4CM1A 1WAMA 4PFJA 2J8ZA 4OQZA 5L3ZA 4E2YA 4CLOB 4BNYA 3DAFA 4YBZA 1PZGA 2OGUA 3TWOA 4NR0A 4ZHSA 1ADFA 1P74A 2AHRA 5JBIA 5CP8A 3L9WA 4JCOA 1ISHA 2WE8A 4UUPA 4BGVA 1ISGA 1Y5RA 4BNZA 4XB1A 5K0ZA 2X22A 1NFRA 2DBQA 2OP0A 3ZZNA 3DBHA 4DWVA 2VHZA 2PY6A 3GVIA 3M2PA 4WE3A 4XIYA 4XKJA 4BKUA 3ASVA 1SEVA 5HM8A 1QYWA 4OOEA 1JDJA 1EK5A 1KY4A 1LDNA 1YGYA 3LQFA 3UKOA 9LDBA 1PZEA 3ZWNA 1TEHA 4CLEA 1BWSA 2HMSA 2VN8A 3N58A 3QVTA 5T8KA 3GDGA 4BNWA 1A7KA 1LDMA 1E6EA 1DIGA 1EDOA 3VKVA 3KYCA 1HETA 2B83A 4AJIA 4ONEA 3CZMA 3GEDA 3HADA 1HDOA 4DREA 3G1TA 3EAGA 3RI3A 4BNTA 4DPMA 3KUXA 5A9SA 3GK3A 3VC7A 2NNLD 3ZCXA 1I0ZA 2JCXA 3FNFA 4RPJA 1U5CA 3JQ6A 4Y8VA 1XCBA 1R4NA 4DPKA 5DNAA 2PLAA 4II2A 3W6UA 4AJPA 5L4NA 1FMCA 2EW8A 2JJYA 4R01A 5G4LA 4RDHA 1HSZA 3PHIA 2D1YA 5ILGA 1QV6A 3KYDA 4DLLA 1NVTA 1CEQA 2HU2A 1KVQA 4YAGA 1F8FA 4FW8A 5JYEA 3QHAA 5COBA 3FBTA 1P1KA 4E30A 2NSDA 3WBBA 2GERA 5K9ZA 5HRUA 3JQ9C 4A2CA 3VZQA 3IP3A 1LQUA 4FQ8A 1AE1A 1XLTA 4IDFA 3VH1A 2O3TA 4CLRB 4BO4A 3S2GA 5KVQA 2BGKA 1YBAA 3DR3A 4M55A 3H3FA 2BELA 5KNLA 4HUJA 2NQ8A 4ZQFA 4CODB 5I7EA 1Z7EA 1ZSVA 4YDRA 3JD2A 4A73A 3HFGA 4NHEA 3BA1A 1P0CA 2PK3A 2PKRA 3EYWA 5G2OA 3RVDA 4H3VA 3I9NA 1N2SA 4TRNA 3INRA 3M2TA 1L1FA 1DAPA 1TB4A 2PGLA 5L45A 4CQMA 1SOWA 3UCXA 1PQPA 4L76A 2Q1UA 4NJMA 5A06A 4YACA 4Q9NA 4OIMA 4PLZA 2O7SA 1O95A 2VRBA 4GX5A 3I6QA 4YJFA 5KTKA 2NVBA 3RUFA 1KOLA 4TSKA 1P0FA 2GDZA 4BNHA 1B3RA 1A9ZA 1GTMA 4R68A 1RYEA 4IQGA 5JSFA 4URFA 3B70A 2JD1A 1FDUA 3ANLA 3OJEA 3PJDA 4BMNA 3L07A 3SBOA 1W73A 2JAHA 3NRCA 1M76A 1UZMA 3R0IA 3WMWA 2XF8A 2YDXA 5ADHA 3VTZA 3HN7A 2NU8A 1H93A 1E7SA 4GI2A 2BGLA 2LDXA 3M6IA 3L77A 4NBWA 1GQQA 4WOJA 3O03A 4J91A 4ZRNA 4JIGA 2C5AA 4YAJA 2NQTA 3MWDB 1T26A 1X7HA 4R54A 5JO0A 1YBMA 3PEFA 2HUNA 1N1EA 3H9EO 5THQA 3D5TA 1DFHA 4ZJUA 1WDMA 1UXKA 4GLLA 4OXNA 1CERA 3MTGA 3ADPA 1MG0A 2O2YA 1F12A 3ROMA 5EESA 1GY8A 4CPDA 1AHHA 3PI7A 3GVHA 4OO3A 2EEZA 4D0RA 2HJRA 2YW9A 1VJTA 1CQJA 2VHYA 4WUVA 5JMPA 4CM6A 3NV9A 2JD2A 3IP1A 1PJCA 3JQEA 3IC5A 3BZUA 1GCOA 5TNXA 3VPFA 1N7HA 1Q7GA 2O48X 5TSDA 5IZCA 1PX0A 1RKXA 1NM5A 1HLPA 3DL2A 1CF2O 3K8ZA 3JQFC 1UDBA 4DTIA 3H3JA 1B14A 2YDYA 1LDBA 1OFGA 1ZUD1 3Q11A 3DOJA 4DBVO 1J4AA 1E0DA 1A71A 2I65A 2YFHA 1GQ2A 3HWRA 2GR9A 2IYPA 3TQHA 4GPD1 4I1IA 3PHHA 4C7KA 2R2GA 1B0AA 1Y9AA 1XA0A 1UXIA 1ZK3A 4KDFA 3CMMA 3OECA 1H9BA 3ITKA 4OQYA 2AQKA 2J6IA 1HKUA 3WB9A 2V6GA 1VJ1A 1N8KA 3KM0A 5TQVA 1XDWA 4MOWA 1XKQA 2B4QA 5BSGA 2VT2A 1DHTA 1A7AA 1GEGA 2FP4A 2NTVA 3FWNA 4IINA 3GVPA 3A9WA 4YRBA 4LN1A 4F45A 4K6CA 5CPBA 2VHVA 4C7JA 2HCTA 5JW6A 1I30A 1TT5B 5IAAA 2VCYA 3FN4A 4WEQA 2RHCA 3FWZA 2OXIA 2VNSA 4LGVA 3RAJA 4K9DA 5KVVA 5HS4A 3EW7A 1ENOA 1C14A 2D8AA 3KV3O 4YPOA 3R3JA 4I5DA 2BGMA 3I3OA 4E12A 1E1LA 3S55A 2GN4A 4P8RA 3DBVO 4U6QA 1NWCA 1PGOA 1CETA 1UH5A 4AJKA 1LLCA 5CDTA 4MKXA 4DIBA 5L7TA 3DHNA 2WYVA 4R69A 5DCWA 4CM7A 4J7CA 1GZ4A 1VSVA 1E6WA 4CM9A 3CEAA 3PIIA 3V2UA 1SBYA 1P45A 1V0JA 4LRTB 3JQBA 4ND2A 3JQDA 1X14A 4YB8A 2PGJA 1A27A 2B4RO 4HP8A 4WJZA 3VPXA 1XQ6A 4A0SA 3GA0A 1LDYA 2CF6A 1PJ4A 4FD3A 4WKGA 4CMEC 4CMJA 5BQFA 1EQ2A 2O3UA 1WZEA 4GGOA 1TLTA 2VRCA 4D44A 5ENVA 5B4UA 1IY8A 2I6TA 3P2YA 3M1AA 3MJEA 4XYMA 4BL5A 2AE2A 1JU9A 1ZXLA 3C3XA 4S3MA 2BI8A 3EK2A 1O5IA 5ENDA 2J3IA 1N1GA 2EKQA 4Q3EA 2ET6A 3GZNB 2Z95A 4KQWA 5ER6A 5ILOA 3WNQA 2FOIA 3JSAA 3ST7A 4DGSA 2FR0A 1OAAA 1PQWA 1EMDA 5A05A 1UXHA 2GLXA 3CIFA 3WGOA 4BGIA 4GQAA 3D4NA 3TN7A 3LF2A 4EJ6A 4IQ0A 4Y98A 1CWUA 1ZZEA 4R51A 5TJ9A 2G1UA 1E7WA 3T4XA 4JROA 1U7HA 4OAQA 4WCFC 4Z0PA 1J5PA 1KIFA 2DU8A 4ILKA 2YYYA 4I5FA 2YFQA 3A1NA 1B15A 1KY5A 1R0SA 1V9LA 2ZYDA 1P77A 2C59A 3DZJA 5JDIA 1T2CA 3HUDA 3NT5A 2VUTA 4J7UA 5AXCA 3WTBA 4EEZA 4YWJA 1X13A 2DBVO 3HSKA 4AJNA 2IYOA 5A3JA 4YJGB 3RC9A 3UH1A 1SNYA 2Y1DA 1ZK1A 3HN2A 2BFPA 4MVJM 4E33A 1ENYA 1UUFA 4YJHB 1E3JA 4CL8A 1JVSA 4YRAA 3ZHYA 4EZBA 1DHRA 3LU1A 2E49A 3HE3A 2DBZA 3DMTA 3W4JA 4AJJA 3Q3CA 1Z82A 4KOAA 4J0EA 1C0KA 3KHUA 2DVMA 4L4XA 4IBOA 2W2LD 4IIVA 4IMPA 2Y0CA 3VKUA 1E5QA 4HKTA 4NI5A 5DN9A 5L7WA 4L4SA 4J2HA 4TRRA 2J3JA 1D3AA 3ZHXA 1R0KA 1PGNA 3KB6A 3PLRA 3O8QA 3NEPX 4UVIA 2ZYGA 1SC6A 3K31A 1QRRA 5HA5A 2IZ1A 2CDBA 3I23A 2NV6A 3B1FA 1UZLA 3NKLA 1PJBA 4B7XA 1E3SA 2NVWA 2X8LA 4XJSA 5T8KC 3OH8A 4N5MA 1J6UA 2CFCA 2YJZA 5GY7A 3KEQA 1FJHA 3LSYA 4BB6A 1I3MA 3ZWBA 1F06A 2GUGA 4YEDA 2YUTA 5DOVA 5CFZA 1SB8A 2G82A 3GAZA 3ITDA 4ND3A 2ZTLA 4WK6A 4D42A 4BGEA 3NTRA 1GD1O 5LDHA 1HDRA 4JNKA 1ID1A 4L9RA 4W82A 4TQGA 3TZQA 3WGHA 3VPHA 3DOOA 4U0JA 1V3UA 3P19A 3JQ8A 4YAIA 5C7IO 1DB3A 2PD4A 4RVSA 2JCYA 1QMGA 2UVDA 4RLHA 3PVZA 3B6ZA 3U4HA 4D7AA 1EVJA 4PVDA 4JP2A 1NTOA 2J3HA 4YR9A 1OOEA 2BFMA 4QT0A 3TZHA 3I4CA 3JQAA 3NT4A 1BG6A 3PGJA 4GKVA 1DPGA 1NXQA 4AFNA 4NMHA 4CM8B 5IDXA 2Q4EA 1M2WA 1T24A 4GAEA 2H9IA 1IUKA 1DC4A 4HFNA 4BNMA 5BSHA 2J3KA 5CHEA 3QWAA 1BXZA 4KWIA 3RCBA 5KJ6A 4OSPA 3CE6A 1PJTA 1SAYA 3WGTA 2GZ1A 4RF5A 2ZCUA 4JLWA 4BHTA 4E5NA 4AL4A 3ZV5A 4IGFA 1EEHA 4E5KA 2O7QA 3IKVA 5A9TA 3WQQA 1BSVA 1NBOA 3WDSA 4UEOA 1Y8RA 4YRDA 2H6EA 3ETGA 1D8AA 1RPNA 2PWZA 1A4IA 1YL6A 3MWEB 4GVLA 4LISA 2FPPA 1LNQA 4Q39A 4XGIA 1HRDA 4U6SA 3D64A 5JAQA 5U1PA 4GMFA 3AOEA 5KIAA 4R1NA 3VPSA 1NHGA 1EUZA 2VHWA 3KVOA 3MTJA 4CMGA 1SCUA 1ADBA 3K2EA 1GEEA 3OMLA 3TRIA 4BQRA 3SXPA 3ZWWA 4MDHA 1YQXA 2WE7A 1FDSA 4B4VA 5GMOA 1B3BA 1V8BA 4ZQGA 4K26A 1N92A 4B4WA 2R6JA 4Y6PA 3EVNA 5EJ2A 5I7SA 4FOSA 3WIDA 3G17A 3OEWA 4RJTA 1MB4A 3DAGA 4RF2A 3RJ9A 4IUYA 3DQPA 1G0NA 2FSSA 2W2KA 2X0NA 4PRKA 1GFSA 3BIOA 1JWAB 2X5JO 4ALKA 2YQ5A 3IJPA 3H4VA 1Y8QA 2EGHA 1ENPA 3ROQA 1NX6A 1NR1A 2ZB4A 3BYZA 3DBRB 3WXBA 4TMFA 4YVFA 4IDCA 5EQFA 5FWNA 2EP5A 3QY9A 5F1OA 4M89A 2CZCA 4BO1A 1DIAA 4XZ3A 1PJ2A 4RDIA 4I9HA 3K6JA 4NK5A 3ZV6A 3IL2A 3WBFA 5IZCC 4IPTA 1O9BA 3I9KA 2GPTA 1RYDA 3L6OO 2VOJA 3ZWOA 4B4OA 3GRPA 1DRUA 2QIOA 5IZ4A 3PWSA 5HWSA 3LC1O 5C7OO 2WD7A 3OFSA 1IPEA 3P5SA 3MOGA 5JC1A 1GADO 1VLLA 2AQ8A 1PGQA 1PGPA 1T4DA 3KTDA 4JBHA 1XU9A 3GFBA 2BHLA 2Y1EA 4RGBA 4AJHA 4FCCA 1ZIDA 2AQIA 3QIVA 1N9GA 4CV2A 3L6EA 3DEYX 2ZB3A 1I36A 1I3NA 1YB4A 1OMOA 4UREA 4P22A 1OZAA 1GAEO 2P68A 3UF0A 4IIUA 2D5CA 4W7IA 4BQPA 3KYBA 4PLGA 5G0TA 4JJFA 2EKPA 3F4LA 5TJHA 2O3JA 1K5HA 2HRZA 1HDZA 2IZ0A 3VDQA 3UGKA 1Z75A 4J1SA 5U4QA 3FRJA 1JTVA 2NVUA 4ID9A 4Z0HO 4DUPA 1E1KA 5TLSA 3AK4A 5JMWA 3WFIA 3IJRA 1LLDA 4WNIA 1T1SA 1LLQA 2B4TO 4RQTA 1DC3A 3V8BA 4BNGA 1HYGA 4R3NA 1O8CA 2BH9A 3D3WA 4LCEA 5A1TA 1HE4A 2Y1FA 2NLOA 1P33A 4LMPA 1K2WA 2PZMA 1NPDA 4N5LA 3C1AA 3EZYA 1LBEA 5AYVA 3HNPA 1I3KA 4OXYA 4W4TA 4L0QA 3AJRA 3JYLA 3NYWA 3JV7A 4E13A 5T67A 1ULUA 2FPGA 1OI7A 3D4OA 2LDBA 3PDUA 5LC1A 2DUUA 4DQVA 1QSGA 3WS7A 1VM6A 3AFNA 2FY8A 2NADA 3GMSA 2ZB8A 3AM4A 4Q3DA 2UUOA 3HDHA 2X6TA 3JQBC 3GDFA 5A03A 3WYBA 2ZB7A 4O5OA 3L4BA 4QECA 1L7EA 1I10A 3JYQA 4FDAA 3TZ6A 4J2OA 1LI4A 3PP8A 4RF3A 3DZHA 1U3UA 4UUNA 5L9AA 2Y05A 2I99A 2C82A 2Y1OA 3VZSA 5KKCA 4GL4A 3GZ4A 4UEKA 3OHSX 2W4QA 1VL8A 3LT0A 2ZYAA 4FJ2A 3TFQA 3V1TC 2JHFA 2V7PA 4CM5A 1ZBQA 3JQ7A 4IQ8A 4QUKA 4FFPA 3LYLA 5CDGA 1FDVA 1LJ8A 2PR2A 4BNKA 1IPFA 4WLUA 5EPOA 2OORA 1I2BA 2PFGA 1YQGA 3DOCA 4NK4A 9LDTA 4HNGA 2C0CA 2ZQZA 3DBHB 3ENKA 4INAA 3RFXA 2XXBA 5EQDA 1Z73A 1DSSG 4IZIA 4RLSA 4AG3A 4I9NA 2EXXA 3TL2A 2F00A 3AWDA 4FPXA 3DWFA 1GQYA 2XAAA 2Y1CA 1HDYA 3A14A 3KLMX 3ZU4A 3PFFA 1HT0A 1Y1PA 4Z9XA 1IOLA 3QWHA 1VC2A 3KYCB 4A5OA 3ROPA 2X0IA 2IODA 4BO0A 2JCVA 3GMDA 3WJ7A 5KVSA 4WNCA 2BI7A 2H63A 2BKAA 4BO3A 5A9SB 1JQBA 4NQZA 2TMDA 1VL6A 4P4GA 1LA2A 3NUGA 4A26A 3PHJA 1OC4A 2FR1A 3SLKA 1R4NB 1A72A 1I01A 2J5QA 4HWKA 3ZWCA 3GG2A 4E0BA 4BS9A 3O38A 4NH4A 1MXHA 4WLFA 3EUWA 1ZVMA 4Z0TA 5THKA 3VVCA 3RROA 4AJ1A 2DTDA 3BMCA 1WMBA 4XRGA 2P9EA 3WFJA 3KO8A 3KYDB 2O2SA 4EEXA 2Z5LA 3E03A 5A04A 3IUPA 1BHSA 1CQIA 4DBZA 1I33A 4CUKA 2Y0EA 4KUEA 4N7RA 1BDBA 1LQTA 2HMTA 2PKQP 4IXTA 1HZJA 1ZH8A 5A02A 4A7PA 3PHGA 5H82A 3BMNA 1V35A 1KVUA 1U4OA 1I3LA 2H1SA 2VUSA 5FEUA 3OSUA 2NUAA 3RUIA 3GOHA 1VE9A 1H0KA 4ND5A 3WIEA 1R6DA 4J1TA 4XCVA 1C1DA 4D46A 3TZCA 3WYEA 4BKOA 4E5YA 2Q50A 1VPDA 3MJTA 2P5YA 1XEAA 3JCZA 5DCUA 3JD3A 3OA2A 1CJCA 4TKMA 2NWQA 1KYQA 4PZEA 2EP7A 1E7YA 2VOEA 3SEFA 1ADGA 1GL3A 3WR5A 1WDLA 4NFSA 4TVBA 4CQMB 4J4TA 4JK3A 1O6ZA 4NJMB 4I8XA 2IEBA 5DP1A 4PG6A 1LC3A 2NU6A 1ZMOA 3ZWVA 1JN0A 4GMGA 3KSDO 4YJFB 1K6IA 4JJGA 5GZ6A 5JFOA 4YQYA 3N7UA 4HXYA 1XQ1A 3V2GA 4CQLB 4BMSA 2FZWA 3HDJA 3CKYA 3EGOA 5CG1A 1YL7A 4J49A 3F3SA 3GUCA 3R1IA 3GC6A 1LEHA 1MC5A 2C54A 3ETEA 1VI2A 1DIHA 3ICPA 3Q9UA 3I9OA 5EIOA 1E3EA 4BO5A 3EDMA 2FSVA 3FNEA 3FTPA 2HSDA 3EVTA 5JDCA 1RM3A 4O6VA 1GZ3A 1QLJA 3DFUA 4MKZA 4KTTE 5LCXA 1R15A 1B8UA 3PWZA 5KVCA 2OHXA 4ZRMA 1YO6A 3NGLA 4IZHA 2ZCVA 4PG4A 5G0UA 4LSWA 3N74A 2I76A 1P1FA 4RQUA 3INGA 1YWGO 1U8FO 5L40A 1DJNA 4G65A 1DFIA 4B7CA 4BMVA 2PH5A 3W4IA 4BGUA 1U1IA 3GN2A 3K9QO 3I6IA 1XGKA 2D59A 3DFZA 1ZSNA 1LDGA 2RBEA 4XQGA 4XYLA 4QO8A 3VH3A 3QV1A 1KVTA 3P7MA 4PVCA 3QP9A 1I5RA 2HO5A 1I8TA 1P1JA 3K73O 5F1PA 3ZGYA 4BO9A 3A4VA 8ADHA 1H2BA 1ZW1A 2FHSA 2YHUA 1KC1A 1ZKMA 3FI9A 4DYDA 2EJWA 3R6DA 3KBOA 4XQEA 3K30A 1X0XA 2ZQYA 1ULSA 1ZO8A 3PLNA 4FGSA 3RKUA 2AEMA 4J16A 4Y6RA 2GZ2A 3K5PA 2QG4A 3EMKA 3MJVA 3SC4A 3GEGA 3OETA 1R66A 2DKNA 5DOZA 2E6UX 2PZLA 2X5OA 3T4EA 5T5QA 3QVWA 1BVUA 2FWMX 4QEDA 5I7FA 1TA4A 3LT1A 4J6FA 1PZFA 3E9QA 5F21A 3RJ5A 3S2IA 4UUMA 4DLAA 3E82A 1B16A 1IULA 1HE3A 5IDQA 3V1UA 3AOEC 5LDGA 3ICCA 5AOVA 2QRJA 2YQ4A 3GPIA 4GWKA 4JP3A 1IHYA 4PLCA 4R1UA 4RL6A 4EW6A 3JD1A 1YE3A 4BO6A 5ITVA 1R0LA 1R4MA 3A28A 3NX4A 5A4DA 3PRJA 2O3RA 3COSA 5TC4A 3UXYA 3WLFA 1Q0QA 4EGFA 4ZVVA 1D4FA 4D3SA 1BW9A 1QR6A 1TT5A 5F3RA 5JAZA 2QW8A 3W6ZA 3AY7A 4I08A 4DLBA 1QG6A 2A94A 4W9NA 1Q7BA 4C4OA 3ONFA 1HDXA 3AM3A 4RORA 3STHA 3RUEA 4CMCA 1ZK0A 2B37A 4QX6A 1R12A 1OC2A 4E32A 3H5AA 2X7HA 3AI3A 2GN9A 4XR9A 3GUYA 3O26A 2HK9A 3CMCO 4QXMA 1SB9A 3H9GA 2Q2QA 1W4ZA 3Q6IA 5JYDA 1NQAO 3PQDA 3OEYA 1LC0A 4K1LA 3MJ4A 3AFMA 2J5RA 1SMKA 3NTOA 5A9RA 1U4SA 2X4GA 1YONA 4PLFA 4DC1A 1M66A 4R1TA 3ROKA 3NDIA 3VDRA 3CH6A 4XEHA 3AI2A 3F1KA 2ZTMA 3U4DA 3CZRA 4TZKA 3DO5A 1A5ZA 3HJAA 3PYMA 7ADHA 1W6UA 4FJ1A 4O1MA 2A4KA 3PTZA 4AJOA 3MEQA 1C1XA 2P9GA 4F3YA 1QV7A 2PH3A 1NVMB 3RQSA 4UAGA 2OFPA 4WCDA 2HQ1A 4OXKA 2Y66A 4IJUA 4M1QA 4O63O 1Y7TA 2FMUA 3WG9A 1SOVA 1RM5A 2RHRA 3GT0A 3Q2IA 4Q3BA 4YAEA 3C1TA 5L53A 2Q1SA 1T2EA 4PLVA 1J49A 2W90A 3ONEA 3SJ7A 1X15A 2DM6A 2Y1GA 2HAEA 1FK8A 2CD9A 4EUHA 1CIVA 1E3WA 4DPLA 5BR7A 3O4RA 1EFLA 4NFYA 1CRWG 2DPGA 3K96A 3JD4A 2G0TA 3ZU5A 1MXFA 3ZWYA 4XDZA 4IY1A 4CR8A 3FCOA 4J4BA 1DIRA 3KSZO 3PHLA 4D3FA 3QJ5A 3BAZA 3E9NA 4BUCA 4UVHA 2EJVA 1JWBB 2VTEA 3I52A 1UAYA 1JVBA 3AUAA 3PK0A 4FR5A 4CJXA 5IXSA 4OOFA 1LU9A 4B3HA 3C8MA 3AI1A 1PEDA 3W8EA 1ONOA 4CQMD 3DBLA 1RM4A 4WLOA 1NR7A 1FDTA 5JXWA 3I83A 2VQ3A 4PRLA 4YXFA 2RCYA 4IJKA 4ESOA 2I3AA 1DXYA 4R4JA 3UCFA 1Q2XA 2Y0DA 2HRBA 1UZNA 3DHYA 2JAPA 3S1LA 1AXEA 4B79A 5IG2A 4IDAA 3BXXA 5FI5A 2OUIA 4MVJA 4WASA 3KLPX 3IS3A 3S2EA 2D3TA 1NQ5A 3OM9A 4NZ9A 5AXAA 3NJ4A 4NJOA 4CM4A 4E4YA 4EYEA 4J1NA 1MUUA 3HQ4O 3F46A 4D43A 4PG8A 3LT2A 4ZQBA 3WSVA 4EI2A 1EE2A 1SZJG 2W8ZA 3RC7A 2JHGA 3IQDB 1M6WA 3OIGA 5G4KA 2YHIA 4BVAA 5F1KA 3UW3A 2G76A 2BD0A 2P4QA 1BRMA 4BNLA 5AQ1A 4A03A 2YZ7A 4II3A 1LSUA 3JTMA 3WNVA 2VHXA 4WLNA 2IZZA 2Y68A 4K28A 4FFNA 4GSLA 2B69A 4IJWA 3RC2A 4G81A 2QHXA 1FDWA 3V2HA 4GX2A 4D3DA 4J9VA 2CY0A 3NJ8A 4TROA 4BNNA 1JAXA 3RKRA 4EITA 1HL3A 3AUTA 3QVOA 4M54A 3QE3A 3I4FA 4Q3NA 2XOXA 5C37A 3QLJA 1U7TA 3GNQA 1Q1NA 2C7GA 5JCXA 4ZU3A 3O8QB 3G0OA 1ZEJA 2JFHA 4TWRA 4AJEA 3NTQA 5BNTA 2DPHA 5G0SA 4CMIA 2VUUA 4E5MA 1BXKA 2VWGA 5H83A 5EERA 3U0BA 5GZ1A 1SEPA 4CV1A 1YS4A 1J0XO 4BKQA 3WMXA 1XU7A 3WICA 1X7DA 5A5EA 1T2FA 3ANMA 5JE8A 1EVZA 4JQCA 4R1SA 1ZEMA 4YT8A 5BSEA 4OHUA 3WX0A 1F17A 4DC0A 5FYDA 2CNBA 1XR3A 5KJ1A 1IZ9A 1IE3A 1E7QA 2BFAA 1BXGA 1FXSA 4D79A 5ITWA 3F1LA 4RPHA 4PN3A 4LVUA 1P1HA 1XG5A 4OYRA 2Q2VA 4W6ZA 4MIOA 3S8MA 4IXWA 1BGVA 3MCVA 4XD2A 5CG2A 1ZK4A 3JQ8B 4NDNE 4GSKA 2B36A 5JLAA 3WGQA 5IJZA 4PGFA 2OL4A 2VZ0A 3GR6A 4O0LA 4K6FA 1UDAA 1HEUA 4CLDA 1QYXA 5JY1A 1BTOA 3VHRA 1YJ8A 4UVEA 4AJ4A 2O4UX 1K6XA 2WWRA 3U4CA 2WD8A 3WTCA 1HZZA 2OMEA 3GLQA 3JQAB 2OO5A 2GN8A 4MP6A 1KS9A 3DTYA 5JAMA 3HB4X 1PS8A 3FF4A 4NFHA 3E18A 5FI3A 3B1KA 5L4LA 2Q46A 4R5MA 1LX6A 4XGKA 3ZN2A 3JQGA 1E7MA 1K3TA 2C20A 2OBNA 2RAFA 2PD6A 3AUUA 3JQFA 1MFPA 3W8DA 2CF5A 5EL0A 4RCVA 4HFRA 5TT1A 3LC7O 2UYYA 1GPDG 4Y9DA 4PG7A 2QZZA 4QSMA 4FN4A 1PQUA 3C24A 3RU9A 3SJUA 3LZ6A 4NU5A 1Y8RB 4BNVA 3ADOA 4M49A 4CM9D 2V6BA 1EUCA 1YQDA 1X1TA 4JBGA 4BV8A 3UAGA 1M6HA 4BB5A 1G0OA 4BIIA 2CDAA 2ZJ1A 5F5NA 5BT9A 2AE1A 3E48A 3PGXA 3GNSA 4BNXA 1NPTO 1PIWA 2CSUA 2GASA 3ZWAA 5C3MA 1K0UA 4B7UA 7MDHA 1M75A 2DAPA 5CAEA 3AUSA 4OMUA 5JDCC 3ASUA 3IKTA 3DAPA 2VNAA 3RFTA 2FR8A 2GYYA 2HMUA 1P1IA 1E3IA 2I3GA 2X9NA 2VRCD 4OKIA 1KEWA 3OBBA 3DZIA 1K6JA 3SVTA 1MG5A 3GQVA 1MFZA 1LSOA 3DBRA 4WLVA 4ND1A 1MGOA 3RASA 5L51A 3ANNA 4I5GA 1H94A 1N5DA 4MINA 3U62A 2WDZA 2YV1A 1B2LA 3I1JA 2X23A 3ONDA 4BO7A 2W2KB 5B4TA 2Y99A 5DZSA 1HYHA 3P2OA 3OJ0A 1BVRA 3GPDG 3DC2A 4XR4A 1Y8QB 2GSDA 1RWBA 4NPCA 4J0FA 3H8VA 4R16A 4R5HA 3UOGA 4XYGA 1NASA 3TZKA 1UJMA 4MIEA 1JKJA 2YV2A 2UUPA 1W8DA 3AY3A 4JGBA 1V6AA 5ES3A 4HY3A 3RBZA 3RIHA 5JS6A 1VL0A 1Q0LA 3ZU3A 2EERA 1E6UA 1YOVA 4LVCA 4YA6A 1YBVA 1GYRA 1U3WA 2SCUA 3DZGA 1E77A 4CMEA 2GO1A 1QORA 5DDIP 5ER9A 3TPCA 1MC4A 3F47A 1LSJA 1YH3A 2WD7B 3PQFA 3RBXA 1U28A 4XDYA 3C7AA
chains in the Genus database with same CATH superfamily
4F4FA 2PWPA 2R44A 2AMJA 1E2QA 5B3AA 4ND4A 1WF3A 4G86A 4KHZA 4U7TB 5IDYA 2BCGY 2ZTVA 4GOLD 3DL7A 1KAMA 5DISB 4EUEA 5E6UA 3TF5A 1N9GB 4ED9A 5AM3A 3RAEC 1CX9B 4QJBA 4XWOA 1SU4A 4QXRA 1GN9A 1AB6A 2PZBA 3D4PA 3L1UA 2IZOA 3K9LA 4LMAA 2H7YA 2L18A 4MVYA 1IB6A 4WESA 1IN8A 3NIBA 2POQX 1GKLA 1KVRA 1DOZA 2D5AA 3K70C 2XTZA 1WXHA 2EHJA 2QTRA 3BMQA 3AEKB 2L17A 3GJ0A 3MZ0A 4GRIA 4RPGA 3LTNC 2RKWA 3E8XA 2Q5LA 2JGNA 1S2DA 3PNSA 4RJKA 5J5CA 1GUYA 2F9LA 5F2NA 4M38A 1L4YA 1FNMA 3L1IA 4QQRA 1LWOA 4JOSA 3IFSA 2IYVA 3KZXA 5AJXA 1Z39A 1NKTA 1VKZA 4ZAGA 1ZFNA 3HB9A 1M2OB 4IHJA 1HYEA 3O94A 3H65A 4FGZA 4Q3AA 4XFDA 5CLLA 2R68A 1TUEA 1XZEA 2WAYA 3H2KA 5KYVA 4BFWA 4GDFA 4MJLA 5CX1B 3AW9A 4QZVA 2IW3A 5K51A 5BQPA 2AYYA 2WHPA 3PT9A 2K5UA 3MA0A 4RVOA 3VYTB 1VZ2A 5CW2A 3O4IA 1CT9A 2ALJA 2EW2A 2VT3A 4B48A 1TVEA 2OPBA 2FQXA 3D6AA 1W48A 4NWIA 4BBPA 4MR7B 5HMMA 3E81A 1ORDA 1ZMBA 2JIZA 2RGEA 1L1EA 3Q7IA 1BD3A 3NGXA 5CHYA 5DTEA 5B6JA 5BUCA 3FG9A 1HO3A 3A6GA 3FUXA 1CR1A 4I4CA 4JSYA 5CEJA 5I7OA 4EQZA 4WZBE 5TPWB 1F8UA 1WCWA 4FD2A 1FQJA 1MOQA 3OPYA 4EY7A 4ZKDA 5FOWA 6PFKA 2DOKA 3L9XA 5IT0A 5LQKA 4PIVA 3MW8A 1CUAA 3NASA 4JJZA 3VR4D 4C0XA 4H15A 3GGGA 2NYAA 1JIJA 4LMRA 4OUKX 2Q0XA 1BFKA 1W94A 2GWRA 3HMKA 2C3MA 3CF2A 4MUAA 2RGWA 2CVQA 1N34B 3OPYI 3TBKA 3WLLA 1MV8A 4G5RA 5E95A 3RUDA 3R4VA 1P73A 2BIFA 6ADHA 3O4JA 4I5IA 3F4BA 4LV8B 2O5VA 3U5ZB 4EIWA 2HKIA 3E27A 3FFXA 2XUGA 3OJLA 2DQZA 4Q66C 1Z45A 4PHTA 3JD0A 4JQZA 5JUWA 3ADBA 1I7PA 2VZLA 1WDWB 3P2KA 1P18A 1MEEA 1N0WA 1FFYA 5TDHA 3OTOB 1AJEA 4MYTA 3HXPA 3KUUA 5LP1A 2GWHA 5DIZA 4HWRA 4H6PA 3VR3D 3LBNA 4PNEA 1Q12A 2D0DA 3I9V1 1COWD 4GT1A 4KXXA 2QX4A 5I48A 1OLUB 1TZCA 1H8EA 1EXDA 4MLZA 1ECLA 1M1UA 4KR3A 1JIXA 1FP1D 1Q1BA 1XKTA 1IXSB 4KACA 1K3FA 2X3YA 5F9HA 2J45A 3G49A 4YXWD 4BDSA 2IUYA 5T57A 1S7GA 2JFNA 4UUQA 1KEEB 3DDZX 4RVDA 4WOCA 4MQBA 2IYZA 5KSZA 3B1YA 4KR9A 4X8MA 5EJGA 4F5WA 3O0DA 4CLRA 1S96A 1YKFA 2VAWA 2RHLA 4AP5A 4P4NA 1UOPA 2ZIZA 5KJCA 1AZSC 2W4IA 3A37A 4HVAA 4FC7A 1Y4ZA 3PNPA 4N8DA 1FFEA 2H5LA 2XV1A 3FI0A 4RQAA 3BGVA 3DMTC 3QPAA 5G3ZA 5REQA 1MIOA 4F4HA 4YCJA 1Z26A 3I05A 5HR5A 3GVCA 5THXA 3QEJA 1IATA 3I6BA 5GM2A 2XOEA 4MDYA 1M2GA 5ALSA 5LR6A 5DBGA 1S2OA 4NENB 1W49A 4IO0A 3SLGA 2QJRA 4XYEA 4YRPA 3VJLA 2Z98A 1V8FA 4U00A 1M54A 1KPHA 1T8SA 2V7EA 2PZJA 1EA7A 3WQRA 1U9IA 3ZV3A 3QBEA 1PNQA 1IM2A 3N3BC 4MRRA 4EJ0A 4DCTA 4LAFA 4OATA 4RENA 3ENZA 2X4LA 3WRVA 1PDOA 2ARKA 3F3KA 3T5GA 1IY0A 1JW9B 3BMNB 2KBFA 4OM8A 4YP0A 4DNQA 3DOUA 5EXSA 4B17A 1NPYA 1JXOA 8LDHA 3OLXA 1RZVA 3CGWA 2PS9A 1O5OA 2I4IA 2I67A 3NPAA 3IDAA 1O57A 2YN4A 2R65A 4LW8A 3NDBB 4HDNB 1AN9A 3AMVA 1XVAA 2OXEA 1FLVA 1PR4A 4GP6A 2OM2A 5F64A 4D0GA 4YCSA 4FSDA 1CS0A 4OI1A 4TXNA 4C3VA 4BY9E 3WHLA 5EQTA 4EARA 3HO1A 1DGQA 3VJRA 1U2TA 2HF2A 3GEBA 2FPRA 2B4KA 1TNDA 3KPJA 3ZDFA 5HHTA 5FTJA 1CHDA 3EFHA 3P0HA 5CR9A 4A9AA 2IE8A 2HXSA 5GJBA 5CLGA 3DT9A 2IYEA 1Y1TA 2WP0A 5BVGA 4R8KA 3EXHC 3RLFA 3THRA 2WM2A 3T7AA 5B6PA 2D8MA 5HTOA 4JEUA 4YI5A 2XA9A 4LV6A 1UM8A 1MJHA 2CLMB 2X1HA 3U39A 1Q83A 2W2LA 2NU8B 3NKFA 2ZT6A 4D3XA 5EINA 3TKLA 4WXEA 3UT0A 1XZHA 4JC4A 3VU1A 1F0YA 5GADl 3KKMA 1WXWA 3QKRA 4WECA 4ARCA 4TVSA 3W4KA 1JKMA 3DPSA 2ZBQA 1AZTA 1NNLA 3AEQB 2VP9A 3DGEC 3HCDA 3LLVA 5KJEA 4BQQA 4JIMA 5EUQB 1EWVA 4D98A 4DUGA 3A4TA 2AMLA 4HAVA 3A25A 3ZGOA 1TD1A 2VTBA 3DE6X 3M3PA 2BFFA 1T1GA 3PPVA 1RRVA 4EHKA 2ZOSA 2IHTA 3CVVA 4Z4CA 1GGEA 1U3VA 2VP3A 3IB6A 2IU3A 2PRKA 3PGMA 1DPFA 1VIMA 4B71A 1QANA 4HB0A 3FUVA 2E5FA 4P33A 4CMHA 3NDJA 3RYTC 5SZKB 9ABPA 3QSGA 3DWIA 4RV5A 3EXEA 2WICA 2O8BA 1SKMA 3ZTYA 4QJ4A 1L1FA 3T0GA 4DARA 4DGQA 5ITZB 1HZZC 3QKWA 2ZUDA 2F3PA 1MTZA 1PEAA 2J46A 2Q4OA 3KKQA 1KAOA 3MLEA 1MZVA 1NQTA 2C29D 3ZJ5A 5C5CA 1A4UA 3EHEA 3UGQA 1YCGA 3KWMA 4YO8A 4QBTA 1NF3A 1JIKA 3AHJA 3QVXA 4UBMA 3RS3A 5EJEA 3R75A 3GY0A 5B3LA 4GC9A 4NG5A 3PE3A 2IXBA 4NDZA 5DWVA 4YUVA 3BHJA 3UUGA 3U09A 2MDTA 5AJWA 4YMSA 1AS0A 3O73A 1QQTA 1UJ4A 2V6JA 3KQPA 2JD0A 2ZYSA 4U7HA 4EBFA 4G5YA 4RV9A 4Y2QA 2JC3A 1O8BA 3V6LA 5TS3A 5ALTA 4ARIA 3C3DA 3EY9A 4GIBA 3TSWA 1C2TA 4IV5A 4W5WA 3KEGA 3X3HA 4ARSA 4S2UA 1FF9A 4NNOA 3RUAA 1RQRA 4CMBA 2JW5A 3U7GA 1UPAA 1LBTA 1WXEA 4LCJA 1W19A 2JAXA 3A9TA 3DC7A 2IX3A 1FP2A 4KWTA 4UQOA 4NLLA 4DAEA 2PLFA 5KCZA 4IH1A 4LKOA 2QLNA 3V4PB 1SC1A 4ALMA 4IMRA 1CDOA 1BS1A 3VO1A 5TT0A 4E2WA 3NETA 4PZZA 4DCPA 1QOQB 1DQZA 2DCUA 4BKRA 1EBUA 2ZFUA 1U9JA 1YVDA 3UAZA 4UXJA 2N9UA 2PAFA 3DSRA 3KIPA 1JXAA 4RKWA 4BFCA 1L7BA 2Q6TA 2CK3A 4B3IA 3DLBA 1VMAA 3KZVA 2VTDA 4TUYF 1P7WA 3C8ZA 1AO3A 4KRFA 2ETVA 3NM6B 2MSKA 3FHLA 3ZD7A 5EWMB 3EVAA 5M04A 3VU9B 1PV4A 2KSQA 2OWEA 1IBRA 4LZOA 1RI2A 1SG0A 3G5AA 1K2VN 4IP0A 5SY9A 3HTXA 1LDEA 3LPLA 4N18A 4N54A 4KYUA 3BL8A 1AB5A 4IICA 5EKDA 3W5AA 1AKNA 2EFCB 2QY6A 2UYOA 2OHVA 3FPLA 5ECGC 5JAUA 3SX4A 4KEAA 4XUGB 1BHQ1 1QYDA 1V1MB 4Z3KA 2QYSA 1JLLA 4ZXPA 2XCRB 1VHQA 4XGQA 2XBUA 1QAOA 5DF1A 3SQMA 5C8VA 3NHUA 3QRWA 3ZZUA 4DA7A 5JI3E 1QVWA 1TQ8A 2JIPA 1S0UA 2A9FA 1YZQA 1ICEA 5CFMA 3WA7A 3G3EA 2IH4A 1AO0A 1LV7A 1E2NA 4QOIA 4B3FX 5JNLA 5LJIA 4K8RB 3K92A 2DFVA 3IBGA 1V1JA 5ELXA 1QVVA 2V0NA 4WJKB 4B44A 2Z6VA 2Z8XA 2EWVA 2Z2KA 3PITA 2BONA 4G4JA 4MQMA 4LRXA 4AN4A 4AWAA 1JG1A 3TLBA 1JR3A 5E3HA 4YT2A 1AHPA 4L15A 5FP0A 2OV1A 1YRQA 2EGGA 1EBFA 2HQOA 3H05A 3LF1A 5JNVA 1GG2A 3R8FA 1ZQ9A 2PGAA 3UM9A 4IS3A 2IYLD 3VPBA 3ULKA 3ZBUA 2Z6UA 3BICA 2HJGA 1ZUNB 3ZDRA 1PUIA 3SHOA 4KSCA 3GZNA 3OEHA 5HS6A 2OCPA 3AFOA 3E6AA 1E98A 2QZ9A 4RIGA 4US1R 3UT5A 3X43A 4DOMA 4E6PA 1KEVA 3DXFA 2PVPA 1WEHA 3PJGA 2FFHA 3QFTA 5DBIA 1DDGA 2IH2A 4YI3A 1JBKA 4ISCA 4ZA2A 2GCOA 2P5SA 1U28C 2GM3A 3D2AA 3K1YA 4DMHA 1RBQA 1WSAA 1ZJ4A 3GH3A 1HXHA 3UWOA 3U3KA 4AY3A 1H0HA 2XVZA 4URVR 5FEUA 3GLFE 4B8WA 3SKVA 1VGVA 4GKBA 3LY5A 3ZNNA 4E5PA 1AC5A 1ZKDA 1GPYA 3B5EA 3QKTA 4Z6KA 3A1UA 3HY4A 5NULA 2XE8A 1Y1RA 1PFWA 4E31A 1RZRA 3P2MA 2V9CA 4KE7A 4Z9FA 4RM2A 3O2JA 3H9JA 1HF3A 1KDZA 4HGRA 1TU4A 2X8BA 1UXGA 1VBKA 3MJCA 3OTIA 1QP8A 3WLPA 4D41A 1A5SB 1P44A 3EC7A 1ID8A 1Z16A 1YU6A 4FGJA 1S7CA 1XMVA 2P6PA 1QC5B 4DIFA 4MVJG 5C7YA 5KNBA 1SCDA 1TTHA 2ZJ2A 1V8ZA 2QP4A 1UJ5A 2AXQA 3MTBA 3BJMA 3U3OA 2XMDA 3ZE9A 4C2TA 3R0XA 3RG8A 2I3ZA 5F2EA 3IEXA 4FONA 3I8SA 4AROA 4JA0A 3U16A 2HCFA 2ACEA 4HC4A 1YK1A 1KR2A 2OZKA 2QX8A 2WA1A 4IDDA 5FUWA 2ZPUA 1YNSA 5HOEA 2CB0A 2HY7A 1F14A 4L2IB 1ONNA 4QVKA 3CFYA 3KLOA 4B4UA 5HSGA 2XMGA 3BN3A 4LDAA 3ZWMA 2EV9A 2ZYTX 3EHDA 2VT7A 2VYNA 5TMBA 5J9FA 2WSBA 3T3EA 3W77A 1DBWA 1ND6A 4HN9A 4IVPA 4YCBA 1ZDMA 3GBVA 2REOA 1VL1A 2ZXFA 1YDEA 4N39A 3KXDA 1P9LA 4MA4A 2IV3A 3RT1A 4TMXA 1MA0A 2XUHA 4MVJE 3DOIA 3KAKA 2RHGB 1O77A 2RHTA 1FX0A 3G8BA 3QWIA 5AM2A 3NU1A 3QHPA 4O3MA 3L0DA 1Z4JA 3WYNA 2FEOA 3CUKA 1WUKS 2C2XA 1DC5A 5D84A 1XMJA 3WRXC 4E4RA 2FZVA 1P4GA 5TIIA 3A11A 2A9VA 4PPGA 1HDGO 3O3CA 4JDUA 2BZSA 2XNDA 1KMNA 3G2JA 3F8WA 3LVFO 4R05A 3SNKA 3WGVA 3H18A 2CL0X 3H86A 1JHYA 2VJYA 3HFSA 3IDZA 4P80A 5IJAA 1EZ4A 2X86A 4B81A 4CUJA 5L4SA 1EFRA 1NAHA 2E89A 4I3HA 1GR0A 1NLUA 2YHIB 1KYVA 3AF2A 4MO9A 4A8JB 4BYMA 4OD0A 2GK6A 1ABFA 3U4IA 4O2RA 2HQSA 1GNRA 4XRRA 4TUYB 3QUQA 2AMFA 4L9WA 2ODQA 5J5AA 1JDBC 4HNRA 4MGHA 1JQAA 1W4RA 3HYRA 4MMYB 3A9VA 1J7KA 1ODSA 4EUNA 4F3TA 3NGMA 3I4LA 2ZZNA 2YWRA 5CB0A 1WSBA 1WXDA 4AZWA 1IBMB 1E2GA 1FQOA 1EG2A 2C0QA 2IIVA 3D0OA 2CXPA 4BRZA 1OHHA 1G2IA 4IH9A 4EQ6A 4O2AF 5F98A 4A92A 1LB1B 5L6LB 2W93A 3FBGA 4QUIA 2VWHA 2IY9A 3HJBA 1PEKE 2AJLI 3KU4A 5E9QA 5G0VA 3M89A 2ST1A 2Z56A 4OQNA 3V8MA 5IJWA 2ZVDA 5C5DA 1UKEA 2Y67A 1GILA 4HEA1 3LOQA 1MNAA 2AN5A 1X9GA 4JI6B 3SLRA 3SVZA 1E1CB 4CMIB 3DMHA 4DZTA 4ZGWA 2WYUA 4I36A 2HMVA 3E3LA 3EFBA 1TMKA 3P9XA 3VKHA 4EI8A 5HZGA 5MN5A 4M0DA 3QVUA 2WYWA 3CPHA 4W6QA 1M8GA 2GH1A 2VUIB 1EP2B 2FSGA 4E2ZA 3TD2A 4ARAA 2OAQ1 4YAKA 1UFKA 1XWFA 1GG5A 2V55B 1GO2A 2P9FA 1OZFA 4TYPA 2YINC 4Q4JB 3PEVA 1ESEA 3PEEA 1E64A 5IN4A 2XWJI 4N0EA 1V1RA 3FOWA 3T7TA 2QD4A 2A0XA 4FLFA 4X1YB 1LX7A 3F96A 2A35A 2NTNA 5CCDA 4K9MA 3KUCA 3QMPA 4ZMSA 5B7GA 5K0JA 1BXGB 3WIVA 2R6R1 1I6WA 2VNKA 4AURA 2GNAA 3OWHA 1F1JA 3PUVA 1SH7A 2WTXA 2QAGB 1T6YA 2PRIA 3SYRA 1U8CB 3LOUA 4P53A 5IX8A 3E0XA 1RR6A 3UT6A 4BTEA 4F6CA 5ADVA 1DAFA 3P9SA 1VJ0A 3ZHZA 5BMOA 1KMHB 4JITA 4AZTA 4Z3OA 2X76A 2OZPA 4CIDA 4KQGA 5HJ2A 1JEDA 1MO5A 4HLCA 2X1MA 3OP4A 4KN6A 1JQDA 1K6EA 3QU4A 3R40A 3W8FA 4EY8A 5FTNA 3QLTA 1RCFA 3HDQA 2GBIA 2JIMA 4ADSG 4ZICA 2A5DA 3Q12A 5F4BA 3K94A 4FOTA 1MEOA 3MWEA 1FU4A 4MO2A 2AFIA 1WKBA 2TYSB 3D2BA 4NAUA 2IBSA 1R0WA 1ISIA 3C6YA 3I9MA 4GECA 4MQUA 2HWWA 4B5LA 2XXJA 1GP2A 3IAM1 4RTSA 2Q8PA 1Z4MA 2R8BA 2VRWA 3KT8A 1SVMA 3QWBA 4W7SA 4N5NA 2MYUA 2I2BA 4ZPXA 2UZ3A 3OQ6A 3HJRA 2Q2NA 3MGBA 1Z22A 3IVCA 1ZNYA 4IHJF 2YOGA 3SQDA 4CUZA 1WRBA 2WU1A 1E7RA 3OZTA 4DQLA 3G88A 1VHTA 1Y5MA 3BRWD 2JFPA 3JQGB 5I8PA 2F8SA 1JH9A 1E69A 1KQFA 1JG6A 3CUVA 1VIDA 2OHOA 5EJ9A 3A2MA 4FFOA 5KTRA 3ZXXA 3UQZA 1OLSA 3S1AB 1EP3B 5F77A 1O96A 3G9UA 2PWBA 1BU5A 3U7QB 4GKAA 1VCHA 1EWQA 2WTUA 3G59A 1ZS9A 2XRMA 3PVCA 1U3TA 3WLEA 3DA8A 2JL1A 3NDRA 1P4HA 4OUDB 4ZK2A 1NMXA 2YWXA 3CINA 1P9OA 4JUDX 1G8FA 3QF7A 4HLUC 5IAEA 4TL8A 1YB6A 1QYCA 4AS2A 1I24A 1DRWA 1E2BA 2BGIA 5K99A 2BW0A 4AY5A 1WD7A 3RK4A 2GCGA 1SVOA 3N0XA 4K88A 3STXA 3DMDA 3GLTA 3VHXA 2Z1DA 3WZMA 4E2XA 3PJFA 1TUIA 1X8JA 4OH7A 1FNDA 4S35A 1HTTA 3NATA 5AOAA 3FB1A 5EMMA 1PBNA 1JEYB 4A4DA 4FZ3A 1M0TA 4YASA 1D7OA 3BB1A 3HVJA 1N2XA 4RULA 2G40A 1G3QA 3DKKA 3F9IA 4RZQA 4DQXA 1FDIA 3B6MA 3KK0A 2W43A 3QNWA 3GP3A 1O94D 1T6ZA 2H1FA 2V8OA 4QARA 4R3WA 3L0SA 3RUHA 4C01A 1SUAA 1ZD4A 4PLWA 3W1VA 4RVGA 4LSMA 2QF7A 2WSYB 2QVXX 5ESWA 2WZQA 4DLVA 1AQ6A 4G0OA 4EHFA 3UCEA 5ALQA 2W2VA 2YHSA 3OIWA 3FE2A 2R1UA 3HP4A 1JKFA 4I6JA 3OTWA 4F2PA 3KNZA 1YRBA 1QU2A 3IKLA 5TX7A 4RYDA 2PJDA 2HOQA 2YC4C 3D6UA 1H2FA 1HE8B 1Z0IA 3DP9A 4HFMA 3D3NA 4QA9A 4WH0A 3N2KA 3I01M 3KLBA 5ADWA 5DASA 2BP7B 4J16C 3CA8A 4H3HB 4UATA 3QQ5A 3ZE2B 4PYJA 3K6KA 4OIFA 4N7BA 4MARA 1G55A 4K6OA 2EG9A 3R74A 2I8CA 1OI4A 3A1FA 1ZL0A 2PH1A 4PFKA 4QGFA 3D3KA 4QLAA 3CSSA 3L8CA 3S2FA 1DOHA 1M7GA 3BS4A 4ITRC 5DM4A 4ODIA 3A9RA 3O8RA 1Y6QA 4WXPA 3AOGA 4O2AB 3A1CA 1DBVO 4W1QA 1NXPA 1JBQA 2AF3C 2WTMA 3DTVA 1K5PA 3QEKA 5C80A 1UOEA 4LNAA 5DVZA 3WOHA 4C7VA 1T25A 5DT9A 1FFSA 2VAMA 3L5OA 3UYLA 3OIFA 4RPKA 4OX9Y 1UKYA 3FTNA 4KZPA 1W0CA 4B3BA 1PGJA 4ENSA 5IBCA 3AP3A 2CN1A 3ORSA 4BLVA 2B7BA 4DRXB 3EWSA 3EXIA 3F7OA 5AKEA 4OU5A 1MW9X 1TGYA 4EGJA 1JYFA 3DZ8A 4F46A 1ECFA 3HMQA 3U5TA 3IIJA 4KLNA 1SUBA 2IXTA 4W9NC 2EAUA 1ZP6A 2NXEA 2NSHA 1N2EA 3GF4A 4TWZA 3W6PA 4CKWA 2IS1A 2H8KA 3GOQA 2O2GA 2XH8A 3EF3A 3PFKA 4DLPA 2J7PA 4NCBA 3ENWA 1P7CA 1XIVA 1YJCA 3BHNA 2G67A 3IR5A 4URZR 3NOXA 2IE0A 5FBQB 2D7CA 1E60A 2CJYA 4ZQHA 1NR5A 5B7NA 4YV7A 1XFDA 2WSSA 2NM0A 2Z3ZA 2Q49A 1QVAA 4HNAA 1NRWA 4EHNA 4Z2YA 3H9UA 4L5JA 4ZV7A 2AVDA 1XRRA 5FIUA 3VZCA 4DANA 1JHAA 5DXFA 2VAPA 4YDHB 1TC1A 1KFCB 16PKA 4IIGA 4FYXA 4ER0A 3U49A 1EFKA 2P2DA 3AYZB 3ETLA 1QG4A 3LGXA 4FOLA 4M22A 3VV3A 4KRGA 3BMQB 2AX3A 3CF6R 5K8VA 4ENVA 4MGEA 1U2DA 3KZOA 4X7MA 5COAA 5AVTA 3R77A 3T1HB 3SIPA 2QGNA 4U7WA 2NT3A 2Q99A 4X92A 1VTKA 5AKHA 4BX3A 4ZYTA 3G85A 5EJ4A 3DKPA 3OO0A 1EHYA 2H59A 1YFKA 3BTUA 1T35A 3TXAA 3UB4A 2P79A 2WHXA 1ZQ1A 3E3NA 1O0SA 3N2GA 3O3NB 2D2XA 4M7RA 4Q6WA 1WBJB 4GR4A 3PDJA 3DEIA 3RV4A 4CCWA 5A6SA 1HTBA 1ZITA 1V9SA 3HZRA 4Q1DA 4QVGA 4IHJB 5F2KA 4ALJA 1T1EA 1BQEA 5CJPA 1G17A 4ZQEA 2ZSBA 3VVLA 4CM1A 1MRNA 1W59A 1KGSA 2B9VA 2YIVX 4PFJA 3UWDA 2XZLA 3FWKA 2ATXA 2GJSA 1VI6A 5L3ZA 3RGGA 2C7BA 1QP7A 2WHPB 5JJCA 1V25A 3DAFA 4ZHSA 4NR0A 3IGFA 3S44A 4K3VA 1R4AA 2VLIA 4JCOA 4JLUA 3U48A 1QHIA 1EFUA 2NUBA 1VA4A 1ISGA 1O94C 1U7XA 2F1HA 4NAHA 4BNZA 4B43A 1E20A 1NFRA 1XZBA 2X22A 4NC9A 1P6XA 1FSPA 2P6UA 5KC8A 2OUKA 2X77A 2IYSA 3M2PA 3OIYA 4L8WB 1SEVA 4RPCA 2OE2A 3QOFA 4QM7A 4Q24A 1L5ZA 1ZUIA 3OPYB 1Z5OA 1NVAA 1VMKA 3VI4B 4AKGA 3QVLA 1PZEA 1TQ6A 2SKCA 1W6RA 4ZYLA 1BWSA 3EIFA 3W9BA 5FT9A 4R0NA 3LD9A 3OP1A 2R3SA 1E4YA 3D8TA 1EDOA 5BN1A 2I1LA 3KYCA 1SIOA 3M4YA 1Y4UA 4RJ2A 4ONEA 5B64A 2G1JA 3CZMA 4C0BA 1A98A 4DREA 5EXXA 1DNPA 4S12A 4ZC1A 3G1TA 2ODEA 3IQWA 3EAGA 3SQXA 4Z0NA 4DPMA 1CZOA 1CNEA 1T9GS 5IUJC 3VC7A 3IEPA 1L5WA 3ZCXA 1GL7A 1T9BA 1N9ZA 1J24A 4JLBA 4F4IA 3TI9A 2GPBA 1U5CA 1NT2A 1M2KA 1Y3BE 3NBKA 1T0IA 3L3BA 5DT2A 4FMCF 4DPKA 5DNAA 3FOBA 1CUHA 1OU0A 2AD5A 1J1UA 3MT8A 5AICA 4AJPA 3KQNA 2WLSA 3AHCA 1TO2E 4B6OA 3H2IA 4R01A 4J6EA 3TVDA 1HSZA 2P2NA 2QGFA 5B2ZA 1YZHA 4HLDA 5ILGA 5LLSA 2ZI3A 5LKAA 2HSWA 4UHEA 2HU2A 3OCYA 2ZWAA 1F8FA 4FW8A 4LQ4A 3MERA 4L02A 4RXUA 2QRGA 5JYEA 2XE7A 3FBTA 4LG1A 5A71A 2WIGA 4C4TA 1A5AB 2I33A 3WBBA 2QR5A 3CY6A 2EWWA 1T2UA 1V5FA 2D0PB 3JQ9C 4PFSA 2B5OA 4HR7A 1AN0A 4AQ7A 3USZA 1LQUA 2J59A 4FQ8A 5CT5A 4JVNA 5AM1A 4CLRB 1IQ0A 3RT7A 2B25A 2ZAGA 1WXXA 4UJ5A 2AV6A 3LLMA 1YBAA 1KZ4A 2WUFA 5CH8A 2AXPA 5EIAA 1BH6A 1IIBA 2AZDA 2ZBFA 4KN9S 4TSFD 4HUJA 5BRNA 3UG6A 5I7EA 3KV1A 4IKPA 1Z7EA 3K6RA 5REQB 1MIOB 4IUDS 2WMOB 4YDRA 4A73A 2EFEB 4DMUB 1LS1A 3DCJA 1P0CA 2PKRA 3EZFA 3AV0B 5G2OA 1SUPA 5E7IA 5DNCA 2V7GA 2VNIA 4JUIA 2BRUC 3I9NA 3CRMA 4H3VA 4LYEA 2YICA 4S1PA 1J0DA 1PV2A 3M2TA 1YZGA 5IVPA 5E4YA 2UVPB 2PGLA 3K8OE 4KXNA 4KYIB 5K7SA 5LIPA 3ESCA 4KIFA 3UCXA 4BP3A 4YRKA 3GJSA 4PCLA 3SJZA 3M4ZA 2O7SA 4F5ZA 2VRBA 5C8ZA 1XQ9A 1H3FA 2AG6A 2P2ZA 2XUZA 3AKYA 1UT5A 4HLNA 4JJ4A 2ZBDA 4YGYA 2NGRA 2AOXA 2NVBA 3FFAA 3WDKA 5KTKA 1YF3A 2CT8A 1N77A 1P0FA 1ZHHA 4K6KA 3GCZA 4QNNA 2GDZA 3CNNA 4GG1A 5CA0A 3SE7A 1DKQA 3L7KA 4URHA 1G3MA 2W2OA 4R68A 1VE6A 4IQGA 4WTOA 1FDUA 3EODA 1RAHA 1XTJA 4GE0A 3SSOA 1EGMB 2CNWD 3L07A 1FE8A 4GS5A 5DNUA 1Q2UA 4BE9A 1W73A 1YI0A 3CUSA 3EZNA 3CWCA 4Q1AA 4C3OB 4UD6A 5HFAA 1HLFA 3G13A 1RPTA 2XF8A 3CUEF 2M1ZA 4IVQA 3LXXA 1YA4A 4FEEA 3KR9A 2UUBB 4G5QA 3DEZA 3GBPA 2P1ZA 5FI0B 3T9DA 3E7XA 3TXYA 3K9HA 1NVEA 4FT2A 1GQQA 1MX5A 3VM6A 1KBQA 1NVFA 4JIGA 1G7SA 1I4WA 2NQTA 4KBYA 4L5CA 5BVGB 4C43A 1SVUA 2W6OA 2WF9A 4GC5A 4QYWA 3IEMA 4X44A 1SKYB 3UHOA 1IMJA 3P9QA 3D5TA 1T15A 1DFHA 5LUBA 3IB3A 4HNSA 1WDMA 4ZJUA 5JHGB 1WY5A 2YFYA 2GM5A 1XXHE 1KI4A 4OXNA 5JD4A 2G06A 1NE2A 5K8LA 3QKRB 1AKMA 2CFIA 4Y6OA 1DBIA 1M33A 4H35A 2ONYA 1Q95A 3L7JA 1AHHA 4GO1A 3PI7A 4CPDA 1JIVA 3I45A 2OM6A 4MMXB 4D9GA 4JP1A 4D0RA 2HJRA 1AS3A 1B73A 2YW9A 4QREA 1O0BA 2QXYA 5E9JA 4B6GA 2DPLA 2NXCA 5JMPA 4CM6A 3DE0X 2VTBB 1XD2A 2JD2A 2BFFB 1T3GA 4MWZA 4JI3B 4MUMA 3TB4A 4DMKA 1NV9A 4G9GA 4L6AA 4O2BF 3SGLA 1G5FA 1GCOA 5DWDA 3L1KA 1SBHA 1NT4A 2GYWA 3B5IA 5IZCA 2B4YA 1RKXA 1NM5A 1PT5A 3K8ZA 1CF2O 3JWEA 3JQFC 1YJBA 5LP6A 4TZ6A 3EXEB 3L40A 2O8BB 3NUZA 4EB6A 2YDYA 5D3MA 5H9VA 2VDVE 3WY9A 4BMPB 3IX7A 1J4AA 2J4DA 3FFBA 5ALNA 1XDBA 2R8PA 3D6NB 4IMIB 5DIFA 1GQ2A 5AKLA 5F5XA 5GGXA 3QTLA 3RS2A 1ZWLA 4GPD1 4UPDA 4I1IA 1P2FA 1YUMA 3WB2A 1AGXA 1OA1A 1V11A 4ZCMA 2C31A 5LD2C 4FMCB 5C35A 4D9KA 1TZJA 1IK4A 1ZK3A 2XWPA 2VSQA 2CFOA 3CMMA 1BOFA 3LBHA 2WHEA 4MUEA 2AQKA 3R9XA 4BFZA 5ELLA 1HKUA 3WB9A 5DE3A 3KM0A 4XOUA 5HDQA 3LQ1A 1MEJA 1XKQA 3EVCA 2VT2A 1XEWX 2ODNA 1DHTA 3S0JA 1A7AA 1DEAA 1GEGA 5B1SA 5EMJA 4IINA 5BPHA 3A2LA 1JR2A 1KJJA 5HJ5A 1E9RA 4K6CA 2IU4A 1BWQA 1RYHA 1U0LA 2FMHA 3ESDA 3HXOA 4CEIA 4QTYA 4ZEOA 2HHHB 4QWMA 3FWZA 3Q9LA 4EFKA 4ARBA 2VNSA 4J76A 4R2KA 1IZ7A 1M6NA 2GHRA 1RLJA 3EW7A 1OFUX 2W2QA 4PZAA 3KV3O 4Y2HA 1GTSA 4I5DA 1WMFA 2Y76A 2F3RA 3I3OA 1HGXA 3MB5A 4MUYA 1E1LA 2YV5A 4QQKA 3T9EA 4HAXA 3TG2A 1NWCA 3WHIA 4HN2A 4FGLA 1CETA 3AKEA 2BEJA 4KXUA 3HJNA 1AK9A 3KWLA 1LLCA 1KIAA 1ZD1A 2V9ZA 3W79A 4MDEA 3FPHA 4C4SA 4CM7A 1TAQA 4J7CA 4ZALA 2A7XA 4LJLA 1RAIA 5DXAA 3R0JA 4EKIA 3D7KA 3A0RB 2ZUSA 3RVNA 4RTRA 5C4MA 1DARA 4ZO4A 3EXG2 3V2UA 1P45A 2IV7A 1JLLB 2AG1A 4KLAA 3T1QA 1X74A 4BCDA 3ZEIA 4ND2A 3JQDA 1X14A 4YB8A 4HTAA 3U3ZA 2B4RO 2ZJFA 2WWIA 3AL3A 3NEAA 2X5XA 4A0SA 1ZW6A 1X8XA 4AX4A 4FTWA 1LDYA 1V96A 1TW3A 3TIVA 3L1JA 5FPHA 3STUA 4CMEC 4FK8A 4A6EA 2RI1A 5I9IA 1X8LA 3HEAA 4HPXB 4IX1A 2N46A 4J0GA 5H7XA 2C1XA 2AGVA 4GGOA 4XFKA 4D44A 4BAGA 2P9TA 3CX7A 1SZPA 3MJEA 4MEJA 2WABA 2E4ZA 4U63A 4BL5A 3LE8A 1MOSA 1JU9A 2BGRA 1ZXLA 3IP9A 3QPUA 2A57A 5FDFA 3FXAA 1O5IA 221PA 2OKGA 2FZ4A 3NNDA 4GQIA 3GLFA 3FMVA 1M2NA 3GZNB 2Z95A 2JIDA 2REQA 4R9VA 5ER6A 3LLCA 3UT5B 3W2IA 4G4SO 2CXSA 4LYAA 4DGSA 4D97A 4AF7A 4U7DA 1HPLA 1AG9A 1PQWA 3FWYA 3K09C 1Q14A 4YO7A 3UJ7A 3WGOA 3ZS8A 1Y3HA 2GCOB 3ELYA 1P2TA 1GDTA 4RKFA 4YP5A 4EJ6A 4EL0A 1NP6A 4DLSA 1AKYA 2DT8A 2HW8A 1CWUA 1KJZA 3D1JA 4LXTA 4RGQA 3V46A 5KYTA 4R51A 2A3RA 1C9NA 4ZCRA 4W1SA 1E7WA 1UDRA 1V95A 1U7HA 4WCFC 1K75A 5HK9A 5DNVA 2CEKA 1Z4IA 4B2YA 5HZMA 1T3SA 2YYYA 1NN3A 2YFQA 2P90A 3A1NA 5I5GA 3LQQA 3DZJA 1QFJA 1V9LA 3P5BA 1J39A 4OQPA 2OYRA 4EABA 4O2BB 3WIOA 2CHUA 2VUTA 3H9CA 3WTBA 3ER9A 2G04A 3ZKAA 4B32A 4AJNA 5ARCA 1JNYA 4TTPA 1AGPA 1MTOA 2XGGA 3TSAA 1SNYA 4EB8A 1ZK1A 2O0MA 3IBFA 3R6TA 4P93A 3V4OA 4MVJM 1U3FA 4FM9A 3M7IA 4LDZA 3UMJA 1LVUA 3L6UA 4B9AA 4CL8A 5CVCA 4QXQA 3JQRA 3BIWA 1ZN9A 2ZSDA 3EDQA 3UJDA 3P26A 4J0HA 4CKEA 1TK9A 2L2QA 3A9CA 3DMTA 4PYNA 4AU1A 1C7RA 2A0YA 3W4JA 4G36A 1CP2A 1RWVA 1YBHA 1V16A 2ZEJA 1L6IA 2ZRNA 3CE9A 1C0KA 1U6KA 2OHFA 3HA7A 3LO5A 3M6VA 3R23A 4LSGA 2I62A 1QRSA 1WKVA 3PD7A 3LVQE 4XRGA 4IBOA 4F8JA 4LZLA 3SIRA 2N47A 4IIVA 1O9GA 4S24A 4BAZA 2Y0CA 4MJ7A 2AKEA 3A3PA 2L82A 3G9TA 4D26A 4HKTA 4NI5A 1KK2A 5ULLA 2V7BA 3HI4A 2FTKE 1K0FA 3MVEA 4Q05A 2A5YB 1KQPA 4J2HA 4V03A 2J3JA 3HNOA 1D3AA 3NHSA 3ZHXA 4C0SA 2BBSA 1FX0B 4EVQA 3PLRA 1YCHA 1RPZA 4UVIA 2I8LA 3K31A 1PYDA 2A5FA 2HJHA 2IZ1A 2ZDHA 3FCCA 5FH9A 3NKLA 3AF5A 3AV3A 4F1JA 4C1NA 2ZKIA 3HCWA 1WIWA 2O9JA 3VR6D 3W1EA 3OH8A 2IHYA 2DLNA 2ATCA 5AP9A 4PC7A 3W5JA 2PUBA 1B93A 4EG3A 2QZSA 1W9HA 5AR1A 1RI3A 3LSYA 3BSFA 3PWTA 4BB6A 4C4RA 1I3MA 3BREA 1F06A 5HE9A 4WKCA 1XD8A 5KNCA 4M8IA 1C4WA 4DAOA 5DOVA 5CFZA 5IBRA 5F7JA 3M3HA 1C7QA 1W1WA 1P0IA 2V7QD 2ORED 3N5KA 1FBTA 1Z5ZA 4ND3A 5FA8A 3CYFA 5HF5A 4CG3A 4XVUA 2VDNB 1SCBA 3PQ5A 4UHKA 3ZYCA 2OFOA 4MI9A 4XDHA 1UJ6A 1WY7A 5I7WA 4EQ6B 2R7AA 4EVIA 3OZVA 3QBVA 5LUAA 3EXHA 4C0WA 2BGUA 4DLZA 1Q11A 4X7PA 3IP7A 5CX4A 3WGHA 1VSBA 4PX9A 2XBMA 1EG7A 1V3UA 1WDTA 1RFGE 2I0FA 2QQEA 3EZ2A 2C5GA 1OXTA 4PQFA 3C48A 2PRZA 4KHPB 4RACA 2VPYA 1W96A 1TO6A 1UEXC 1XWIA 1TA9A 1PJRA 1Z6GA 1MJ5A 2XBLA 2GEFA 3A1DA 4S04A 2ASVA 5A3RA 4DKJA 1EVJA 3W3AA 2G6BA 5BUSA 2OECA 3IQXA 4PINA 4S0XA 1U8UA 1XLTC 3AJDA 2P0AA 2J3HA 2Y4NA 3OVMA 5ALIA 1OOEA 1ZUHA 3OQVA 2BFMA 4QT0A 3TZHA 4OX9B 2FQ1A 4BPRA 3PGJA 2O2XA 4JC5A 2QB5A 2WKPA 2YC2C 1NXQA 1F48A 4YR7A 2KLBA 3N8KA 5IDXA 1T9ZA 1V1RB 2BWJA 5JCPA 2Q62A 4OPMA 1KR5A 2C4NA 5IU6A 3DUFB 2R2AA 2H9IA 2IIQA 3DLAA 5KNDA 1U11A 3NHRA 5KJ6A 3W2HA 2BTQA 3UATA 1COWA 4QODA 1QHYA 3E22A 3IRUA 3KOOA 3Q7SA 3SXJA 3TR0A 4HOYA 1Y6GA 2GVZC 2VKTA 4M0KA 4M3NA 1SXIA 5I6DA 4C05A 3OD5A 3MHTA 2IOFK 4E5KA 2O7QA 3K15A 4YXWA 3UJ6A 4E2FA 4LXYA 5CTAA 3GFTA 5K8UA 1H3EA 1J2EA 1YI8A 4JT2A 2I2AA 3PS9A 3M5DA 5E4JA 3WDSA 3W5CA 2JGRA 2B2XA 1G2OA 3OJWA 2IUFA 4QDTA 1O2DA 4R7ZA 5EWJA 1YE8A 1J2UA 2HA6A 4HSGA 4RA6A 4ZTZB 2GA8A 3MWEB 4GVLA 3F2VA 1SVIA 2AFIB 1CIPA 2XDQA 1K7CA 2FPPA 4NHOA 4Q47A 4AMGA 2GAFA 3MCTA 4OM7A 2HLNA 4NATA 3ZHRA 4DXDA 4UU1A 3GP5A 3ND5A 1N33B 3PUHA 4B33A 4EY4A 4EUKA 4B2PA 5KIAA 3DE2X 4Z7JA 5FUXA 1FYVA 3DZCA 4H77A 5LOVF 1XZJA 3NYRA 3VPSA 3I76A 1D09A 1EUZA 2ZSIA 3CG4A 3KR1A 5AIBA 3K9CA 4GI1A 5I51A 5KWVA 1ADBA 2D1RA 3K2EA 3RFFA 4U2EA 5H68A 3RTAA 5FTWA 1INLA 3EZXA 4BQRA 3Q7RA 1CVIA 3TTUA 3QX9A 3H11A 2NZXA 4TXHA 4QU8A 4BXOA 1OLSB 2AC7A 3OY7A 1O96B 4QUGA 1H2EA 1ODLA 1WMEA 3W8RA 1B3BA 5AW2A