4CQMD

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
247
Chain Sequence
b'SQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
total genus 87
structure length 247
sequence length 259
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmD00
4CLXA 1X13A 1FXSA 1N2SA 3HE3A 3LT1A 5CDYA 2WWRA 3UGKA 4QEDA 1P1RA 2OOSA 3X2FA 1JVBA 2FN7A 1D3AA 3AI2A 2VHYA 3AUTA 5L3ZA 3Q0EA 1DBVO 3JQBC 1DJNA 3PTZA 3ZWOA 3NX4A 3PEFA 1ONPA 2O7SA 1BG6A 3D4PA 5KJFA 2PFGA 1MX3A 4PG4A 3GPIA 4UULA 2QZZA 5MGBA 3FNHA 4AJJA 4EUEA 1LC0A 1QYXA 4UUPA 4NBVA 1NR1A 4L4SA 2R00C 2WSBA 2VHVA 3DBHB 3F1LA 4NK4A 4J1SA 3E48A 4YB8A 1A9YA 1P1FA 1E6EA 1VJ1A 2GO1A 3JYNA 1B2LA 2Q4BA 1YE3A 4PCVA 1YBAA 3BMCB 5C37A 1JN0A 1SC6A 2HJRA 4KZPA 4EJ6A 3IJRA 3RU7A 1RKXA 1DLJA 3OEYA 1YB1A 4CLEA 4TVBA 1PU2A 3T7CA 4AJ1A 4W7HA 4WLVA 4F45A 3IKVA 5B37A 2I66A 3DZFA 2ZYDA 1T1SA 1G6KA 1LDBA 4GX2A 1VE9A 4J1NA 3FD8A 2Q99A 3RWBA 2QIOA 1M6WA 3OIDA 1WDLA 2E49A 2ILTA 4CR6A 1LDGA 4CQLB 4I1IA 2O3SA 4D3DA 1LLQA 4CLRB 1Y8QB 3AY3A 1GV0A 1E3SA 3RC7A 3EY4A 2C07A 1C1XB 5EPOA 4IINA 4D7AA 1LX6A 1FDUA 3H9EO 4FS3A 3GVIA 5JMPA 5A5EA 4ZQHA 3JQFC 3G0OA 2CDCA 4GMFA 5KJEA 3LK7A 5BNTA 4J7XA 3UUWA 1GD1O 1T26A 1ZFNA 1SPXA 2AEFA 2DBZA 3CMCO 4UREA 2W4QA 5DBGA 5KVQA 1LA2A 2QYTA 2PLAA 5BT9A 4YQZA 2UV8A 3M1AA 3C1TA 1LQTA 2GDZA 2JD0A 4J16A 3WYCA 1W0CA 1VI2A 2PD6A 2CUKA 1AHHA 2PKQO 3W6UA 2XXBA 3ENNA 1QV6A 3GG9A 1KVUA 3E9NA 4S1VA 3VVCA 4MINA 1NTOA 4Q3CA 3RFXA 1DIRA 4BNVA 4D0SA 3DBRA 4A10A 3NT5A 2FHSA 3PDJA 1Y5RA 3WNVA 1NAIA 4FGWA 4KTTE 3JQ7B 1ZNQO 3C85A 4NFYA 4WCFA 3ON5A 4GX1A 4CM5A 3ZV4A 4H7PA 1FF9A 1B0AA 1PR9A 3ZHXA 4E30A 1ZK2A 3MJSA 5H83A 4H3VA 4ZRMA 5EJ2A 3GZNB 2FWMX 4U6SA 4MVJE 3ROMA 2AQIA 4CQLA 4IMRA 4CLRA 2Q49A 5U9CA 2EJVA 2EERA 3QY9A 1K2WA 3CZMA 2DTDA 4LK3A 3KLPX 2QRLA 4JIGA 1BWSA 2ZCVA 4DTIA 5JDIC 2J3KA 3K5PA 5T67A 3KSDO 1DAPA 1PJSA 2CDBA 4LCJA 2O3UA 4FOSA 4B8ZA 3TSCA 4W99A 4B4WA 4FR5A 2JFGA 2NU9A 3Q9NA 4FQ8A 5DOZA 1FDWA 2VYVD 1YKFA 4XB1A 3BXXA 4YJHB 5AQ1A 2C59A 2C0CA 3OJEA 1X14A 1HKUA 5AXCA 1KC3A 4DQUA 1FDVA 2PZMA 4TVOA 3S55A 1HZJA 3WWYA 3H4VA 4IDAA 3HN2A 3EHEA 1NVTA 3FTPA 3AUAA 2Q2VA 3H9JA 1LXCA 2AA3A 3RUCA 1T4BA 2PA3A 3BA1A 4JP2A 3SBOA 1Z6ZA 1P44A 3DMYA 4Y9DA 1LEHA 3GEMA 1AXGA 3I52A 4KUEA 3UKOA 5A9RA 4YVFA 1I2BA 4KDFA 4J4TA 2B37A 4R3WA 3U4CA 3KOUA 3PQDA 2HMWA 1U7TA 4JCOA 4RPHA 3UCXA 4FFNA 1U4OA 4A03A 3AUUA 3QSGA 4YEDA 3UVEA 2P4QA 2BI7A 4K6FA 3PWSA 4CMEC 5HBRA 3VDRA 3B70A 3RUAA 2EP7A 4JQCA 2WJPA 4MKRA 4ONEA 5LCXA 5CFZA 4O6VA 4BNGA 2PH3A 1NFQA 3SLKA 2VYNA 5KVVA 3DFUA 4ND3A 4NZ9A 3CIFA 2B69A 4ZD6A 2P9EA 4OQZA 2NVWA 3JYOA 1RYEA 4CL8A 3JCZA 2BGMA 3QVTA 4E2XA 1PJCA 3NRCA 5JC1A 4OOEA 1F06A 4DUPA 5K6AC 4D79A 1QYCA 4FW8A 4CM4A 5JLAA 1A5ZA 3FBTA 1I32A 2Y1FA 5T8KC 4TSKA 3WFIA 2NTNA 5ADHA 3HHPA 4P22A 4BGIA 4YTEA 5F21A 3ZW9A 3PHLA 4YJGA 4N7RA 3F6YA 1B8VA 5FWNA 1E7SA 4LW8A 4I9HA 3HUDA 3D4OA 3B1FA 3KLMX 3T4EA 3ZCXA 3GUYA 1PL8A 4FSHA 2AG5A 2HAEA 2GZ2A 3AI1A 1YQXA 3I9NA 4NFSA 1ONNA 5DZSA 3V1TC 4TMFA 3K2EA 3VC7A 1Y9AA 2BFAA 1GUYA 4BNJA 5KKCA 2BLLA 3R0IA 4IZIA 2CMDA 4W9NC 4IDBA 2G17A 3GDGA 1EVYA 4I5FA 1LDMA 4J4BA 2CD9A 2J5QA 3KZVA 3NTQA 1IHXA 4CM6A 4CJXA 2V65A 3W8EA 1KY5A 1YGYA 5DOVA 3DBRB 5K9ZA 4EEXA 1A72A 4Y6PA 2VTEA 4ALNA 3CXRA 2A35A 4DGSA 2X23A 4UVDA 1E1LA 2D4AA 2PGJA 2PV7A 3RFTA 3PGXA 2EV9A 1GY8A 1HETA 2Q1TA 3KTDA 4C7KA 4FFMA 4OSPA 4K28A 3S8MA 3NTOA 1UXIA 3G49A 4MP6A 4DREA 1H93A 2HSDA 3M1LA 2ZYAA 4I08A 4L73A 3JQ9A 4IQ8A 1NHGA 2X0JA 2D5CA 1X7GA 3PZRA 2I65A 3LF1A 4XYEA 4Z6KA 1LDNA 5JSFA 4BKRA 3CZRA 2QRJA 1KY4A 5JY1A 1P1HA 1R4MA 3VKUA 4NU5A 4B3IA 1LSUA 4WECA 3N7UA 1N5DA 2J6IA 3H8VA 2DBQA 4RDHA 3GPDG 2Q3EA 4GWGA 4R1UA 3FTNA 3P19A 1I0ZA 3TF5A 4HWKA 4BNTA 1AHIA 2OP0A 2A92A 2JCVA 4E32A 3DBVO 4XD2A 2PZLA 3W4KA 3WNQA 1XGKA 3UAGA 2ZTLA 5ER9A 2EKPA 3NDRA 4TWRA 1P0CA 2VT3A 2B0JA 3PLNA 3GVHA 4BKPA 3OICA 4Z9XA 4YRBA 1ISFA 4WOKA 3EUWA 1PJLA 2E4AA 1DO8A 2QZ9A 1NFFA 3DFZA 4GVXA 2DFVA 3BTOA 4HNHA 4R5HA 5DN9A 3VPFA 1ENYA 1ZEJA 2OHXA 3O4RA 4NBUA 3DMTA 4J0EA 3GRKA 2QRKA 3A1NA 3FR8A 3GFBA 1UZNA 1LLDA 1UXHA 1ZEMA 4Q3DA 2NU8A 1TI7A 2B4TO 2G1UA 4DYVA 1PX0A 5A06A 2DBVO 4WNCA 3EZLA 5BSEA 1Y6JA 1SO8A 3EVNA 1FK8A 1ZSNA 5A04A 4CMCA 4EBFA 1MB4A 3B6ZA 3M2PA 2PY6A 3I9MA 5G4KA 5A03A 4GLOA 1GEGA 1LSOA 1ZJYA 2X86A 3GA0A 4R1TA 2DM6A 3GH3A 4R9RA 4AL4A 1MA0A 1EVZA 4YPOA 2V6FA 3GGGA 3TL2A 3L07A 5G0VA 5B4TA 3JQ8B 4J9UE 1P0FA 1ISJA 2NM0A 1WAMA 4OSOA 4W4TA 1IL0A 2P9GA 2DUUA 2AQ8A 1P74A 1PGNA 3C1AA 3HJAA 1DOHA 4JP3A 3PJDA 2PH5A 4CR7A 4WLEA 3OJOA 4CM4B 2HMUA 4YRAA 3WGGA 1BTOA 2HCTA 2ZJ0A 3ENKA 3UCFA 7MDHA 4E0BA 3GG2A 2HU2A 4XQEA 3RQSA 1R4NA 3JD4A 4RF4A 4OO3A 3E8XA 1E6UA 2EG9A 3W4JA 1LBEA 3H9GA 5JS6A 4J1TA 1N92A 4U5QA 1QRRA 4TRMA 1SAYA 3E5RA 4J90A 4RLHA 1OZAA 4CM8B 2HKIA 1GDHA 3RUFA 4CMGA 4UUNA 4E13A 4Y98A 4CODB 2VZ8A 4QFCA 3TL3A 4K6CA 5DCUA 3IP3A 3DAPA 4B79A 3VTFA 2SCUA 1E77A 3OIFA 4GPD1 3U09A 1OC2A 1L7DA 1HLDA 1O89A 4PLTA 3WJAA 3KBOA 3R3JA 2I3AA 1HYEA 4PLCA 2CF5A 4O63O 1UH5A 1VC2A 1U8FO 4YBZA 3H65A 3ZN2A 1MFPA 4JROA 4GGPA 2FPPA 3D4NA 1Z73A 4GKBA 4P38A 4CV2A 1KEPA 3HADA 3GGPA 4IDCA 1T2FA 2O2YA 3FNEA 2FZWA 2YJZA 1GZ6A 1ZK0A 4B7XA 1HEUA 1EVJA 4CLDA 4CMBA 1HDGO 4FOOA 5DDIP 3L0DA 1VL8A 3LU1A 4E5KA 4WASA 4JBGA 5JE8A 1DFIA 4DC1A 3EGOA 3H9QA 1ZSVA 3KYCA 1DEHA 4GX0A 1NX6A 3VDQA 5ENVA 1M67A 1OMOA 2YHIB 5KIAA 3QHAA 5IXYA 3OECA 4RZHA 4XCVA 1Q0QA 1BDBA 5TSDA 4LSMA 5JAZA 3ZHZA 2NTVA 4L74A 3M6IA 3IQDB 3H6KA 1VLLA 2VNSA 1EZ4A 4UAGA 3NGLA 2HQ1A 1DPGA 2UUPA 3PZBA 1EBFA 4CM7A 4BNFA 4ID9A 1KERA 2CDAA 1V3VA 3L9WA 1EDZA 1PGJA 2Q1SA 1SEPA 3OQBA 5TX7A 5BR7A 5BSHA 2VRCA 1DFHA 3DTTA 3V1YA 3WX0A 4XDZA 5AXDA 4CUZA 1T24A 4FB5A 4BNWA 2B36A 4AFNA 1YXMA 4NJMB 4PLHA 2X9VA 4D45A 2OL4A 4ND5A 5F1KA 1GPJA 1MP0A 4P4GA 1PJTA 1NVMB 4H15A 4B3HA 1O94A 2H1SA 4FD3A 2DT5A 3U3XA 1BHSA 2BRUA 4OKIA 2WM3A 3TZ6A 3GGOA 3JV7A 3LSYA 3BTUA 4LCEA 3WGOA 4NMHA 1DB3A 2NVUA 1ZUD1 1I3MA 1YJQA 4QX6A 2VT2A 3BMOB 3D64A 2OXIA 5CG2A 5JW6A 1XLTA 4MJLA 3QIVA 2PKQP 1IY8A 3P2YA 1YL6A 3BMQA 3HDHA 1BXGB 3GMSA 5JDCC 1RM5A 5JFOA 4I9NA 2E6UX 5EMHA 3ETEA 4CV3A 1LC3A 4NHEA 4RQUA 4XGIA 5EQDA 1SEVA 2I9PA 2QHXA 5DNAA 3ZWCA 5C7IO 3OA2A 4OM8A 5L4SA 1Q0HA 3V2GA 5I7FA 5IDXA 3I3OA 4O0LA 4FBGA 4XYMA 5KOIA 3ICPA 4BVAA 1JAYA 1UXJA 5G0WA 3DHYA 4FFLA 3CEAA 4MVJA 3VPSA 2HMTA 3MEQA 5A02A 3H5AA 3TPCA 1D7OA 1J5PA 1V3UA 3ZU3A 3A4VA 5F5LA 2LDXA 3LC2O 4FJ1A 1GQYA 3PJEA 3SC4A 1GUZA 4A73A 2Q2WA 1KEUA 2CVOA 3LDHA 3DAGA 2VWHA 4F6LA 4H16A 1P1IA 4TZTA 2Y67A 3K9QO 1R0LA 3PHJA 3LLVA 1PEDA 5ITWA 3JQCA 1PQPA 1O9BA 2BH9A 2YW9A 4B4VA 3ONEA 4QSMA 1CIVA 4L0QA 4BNXA 4BIIA 4MVJG 1DLIA 4B4UA 3TZQA 5FFFA 5AYVA 5U4QA 4F46A 5TGDA 1YDWA 1KYQA 1DIGA 1HLPA 3FN4A 1KVSA 1DC5A 1G1AA 3F5SA 1H2BA 1P45A 1ADGA 3IC5A 1XELA 3QJ5A 4R69A 2FR0A 4QT0A 1KVRA 4Q3EA 1O95A 4JLWA 2G0TA 2Q45A 3PFWO 4OHUA 1YS4A 3DHNA 3B1KA 4EZBA 3O8QB 4LISA 4BV8A 3JQGA 3WYBA 1E7RA 3H2ZA 5HM8A 4OXNA 4HFJA 3WGZA 5FI3A 3VVBA 2O4UX 2NVBA 1KC1A 1VRWA 2ZTUA 1E0DA 2W2LD 4M87A 4PZEA 2C2YA 4G81A 3DZKA 3WGTA 3ASUA 1CQJA 1U5AA 4XGNA 3IJPA 1DIBA 5GY7A 4BB6A 2ZTVA 1BMDA 4JJGA 2FY8A 3WG9A 1YRLA 4CQMA 1PS9A 4TROA 4ALLA 4IS2A 4YT5A 3GN2A 4YAJA 1QORA 1NQAO 3D7LA 1BRMA 4BGVA 3QLJA 3WGIA 2WYVA 3OJLA 4B8WA 2GN8A 3L77A 3VZQA 1R37A 1E1MA 1C0LA 4D46A 3GUCA 2IRWA 3BHJA 3G1TA 3GNTA 1GR0A 3Q1LA 1KS9A 3OFSA 4Q3AA 2AHRA 2BGKA 5GZ6A 4XDYA 2GN4A 3CH6A 3KV3O 3KYBA 4B7CA 1J0XO 3HN7A 2B35A 3QVOA 4ND2A 5EN4A 1Y5MA 3JD1A 1WW8A 4FPXA 4PZDA 3C1OA 3RUHA 1GL3A 2EEZA 3WDSA 4DYDA 1LSJA 1Q7CA 4WEQA 5IDYA 3H7AA 2OORA 4BNKA 1SB9A 3WLEA 3MWDB 1GYRA 4J6FA 3Q6IA 3V2UA 1YBMA 4N5LA 4BKQA 4EUHA 1XKQA 2RH4A 5G0SA 3S2IA 4L4XA 1M76A 4BMNA 1R15A 2B4RO 1DRUA 3ZI0A 2CNBA 3JQAA 4ZQEA 1QXSA 1BXGA 1I3LA 1VKNA 3VZSA 3ANNA 3L6EA 3LT2A 1LQUA 4RZIA 4YDRA 1NHWA 3CKYA 5HWSA 4FCCA 4PVCA 4PN3A 1HDRA 1I33A 2QW8A 4L76A 2JL1A 4RF5A 1H6BA 1QYDA 3HZZA 4R01A 2IE0A 4XEHA 4XQCA 1D4FA 4PG5A 1IHYA 4J9VA 3O8QA 4RPLA 3QA9A 3JQGB 1IE3A 3WTCA 1PL7A 3IOYA 4PLWA 1DC3A 2I76A 1ISIA 4J2HA 2H9IA 2DVMA 3V8BA 1Z7EA 3OQ6A 3DR3A 2HMSA 3L4BC 1GFSA 1OC4A 1K6JA 1ONOA 1XG5A 9LDBA 4E3ZA 1HDYA 2J3HA 4R5MA 1F8GA 4HNGA 4EYEA 3VH4A 4HV4A 1UZLA 2VHXA 2ZKLA 2BF7A 5CDSA 2GZ3A 1CWUA 4A7PA 3K96A 4L8VA 3ZWNA 4MVJH 2XXJA 4RLSA 1JW9B 1A4IA 3HB5X 3U9LA 3WIDA 3UW3A 1DSSG 3NDIA 1H6DA 1N1EA 1NR7A 2IXBA 5EL0A 3INGA 4WJZA 4YAKA 1SBYA 3OJFA 3PIDA 1Y8RB 4BKUA 3AI3A 5JDCA 3H9UA 1A7AA 2NU7A 3ANLA 3B20A 2BKAA 3FBGA 3EVTA 4AG3A 1E3WA 2GGSA 3C7CB 3JQFA 3KYDB 3DZHA 3SJUA 1HWYA 3UH1A 1DIHA 1GEEA 5C3MA 1IPEA 3VKVA 1G0OA 4D42A 5C7OO 3RUEA 2FRDA 3TJRA 2IYPA 3L4SO 4RVGA 4PLFA 2IZ0A 3KSZO 3VAZA 4CMAA 4MKXA 3PJGA 4Y6RA 1E7QA 4NJOA 3U0BA 1PJBA 3HFSA 4BO2A 3W8DA 2VWQA 4GKVA 3FR7A 1I3NA 4U0KA 4E12A 4KTVE 1PIWA 4UUOA 1N8KA 2QQ5A 1NVGA 2YV1A 1VPDA 3EDMA 3GZNA 4PIVA 4WNIA 1NASA 4E2YA 3TZHA 2JD2A 5GMOA 1LDEA 5T5QA 3RC1A 1Q1NA 3DOJA 2PGDA 1EUZA 4KOAA 5JCXA 3LC1O 3K2BA 4DRYA 4FC6A 4B4OA 3H3FA 4EJ0A 1GZ4A 2J3IA 1U8XX 4IJVA 3O9ZA 3PVZA 1UAYA 1XHLA 5I9LA 3PXXA 1DRVA 5JCJD 4GWKA 3UFXA 2QG4A 1ISMA 4KQXA 3ASVA 2XF8A 4G2NA 5JY6A 4YAIA 3SXPA 4DPMA 4G5HA 1KVQA 5COQA 4P8RA 1IZ9A 2W2KA 4TRRA 3Q2IA 4OJNA 4PLZA 1X1TA 1DC4A 1W8DA 2Y0EA 4CMIB 4QTZA 4E4YA 4J4HA 1UXKA 2AQKA 1U3WA 3CTMA 3D5TA 2E37A 4R1SA 3PYXA 4PLPA 3GHHA 1RM4A 2JAHA 3JSAA 4CM3A 5A1TA 1TT7A 5AXAA 3IIEA 4XYBA 2HRZA 2C29D 2QX7A 1NQ5A 5F1PA 1ZVMA 2VWGA 3T7EA 1PZFA 3ZWPA 5L7TA 3F1KA 1T2AA 1MG5A 3SJ7A 1PGQA 1YWGO 3BMCA 2O7QA 1T2EA 1LLUA 3C7DB 4RPJA 3WJ7A 1WVGA 4XGKA 4CM1A 4CM9A 1WP4A 3TQHA 3SEFA 1ULUA 1QMGA 1VSUA 4R68A 5ENDA 1FMCA 3ZNNA 4WLFA 3SLGA 4DPKA 1Z82A 2F00A 3ZHBA 4QXMA 4Z3KA 4P4LA 4HP8A 4RO0A 4LMRA 2WD8A 1T2DA 3BAZA 4L75A 3ZWBA 4R4JA 3WQRA 3H2SA 3MJ4A 4RVHA 1Q7GA 2BGLA 2Y0CA 3FNFA 1YBVA 3I1JA 4BL5A 2J5KA 2UDPA 1TLTA 1PQWA 4TRJA 2DQ4A 1VL6A 3ROPA 3DZJA 1A27A 2POQX 3IAHA 4BQPA 1NPDA 3GRPA 1M75A 1NXQA 2I67A 3AJRA 2O4CA 5F1OA 6LDHA 3Q11A 1PJ2A 5BQFA 1XSEA 5CDTA 5JBIA 1EMDA 3PYLA 2VRCD 4E5PA 3QWFA 4IGEA 2HMVA 3MWEB 1JWBB 1V9LA 1X1EA 3KEOA 3PQFA 1GQ2A 1OBFO 4U8GA 5A05A 4OH1A 1BXKA 3OP4A 4BNIA 1QLJA 4GH5A 3WXBA 2Z95A 2HJSA 3D3EA 1NQTA 3ZNQA 5ILGA 3A14A 3WBFA 1QYWA 3WTBA 4WOJA 4ZN6A 1HXHA 4CMIA 4CLOA 1TVEA 3CPSA 1DDOA 2A94A 3QQPA 2WYUA 3EC7A 4E5MA 4XB2A 1YH3A 2IEBA 4J49A 4CV0A 3GQVA 3ICCA 1D1TA 4QFDA 2G76A 3Q3CA 1O5IA 2YYYA 5GZ3A 2A4KA 2DPHA 3MJVA 3VZRA 1SZJG 3EZYA 3L6OO 3GAZA 4A27A 5I8WA 4IPTA 5GZ1A 3WLFA 5B12A 3HFGA 2J3JA 3GY0A 3AY7A 1LNQA 3OQ1A 3DONA 3WQQA 3W4IA 4XIJA 1HE2A 1JU9A 1DRWA 1UP4A 4RORA 4JGBA 5DBIA 4ALIA 3K92A 3A9WA 1CJCA 1UDAA 1Y8QA 3ULKA 2YY7A 2OO5A 1EVIA 3HDJA 2EIHA 2CVQA 4Z3DA 1IULA 3IUPA 1XYGA 4YT8A 3GVCA 4KWIA 5I7EA 1JTVA 4BNUA 4CMHA 4HUJA 1H6AA 1ULSA 4C4OA 4LVUA 3QE3A 4TKMA 5JPIA 1LUAA 1NYTA 3KVOA 1PJQA 3ST7A 2A9FA 5B4VA 5T8KA 3U4HA 2P91A 9LDTA 5JMWA 1O6ZA 2X0RA 1E1KA 4PG8A 3NTRA 4GSLA 2X5KO 5KVCA 2YUTA 5IZ4A 2FSSA 3JQAB 1K3TA 2RHRA 4FDAA 2YZ7A 1LDYA 1XQ1A 1ID1A 5CPBA 3IL2A 2OP1A 3QVSA 3COSA 5JYEA 3DMTC 3LF2A 2PD4A 4J7UA 5HTOA 3IS3A 4DIOA 4BMSA 1IOLA 1PJ4A 1MC4A 4L9RA 5BNFA 3ZH2A 3WOHA 3WGYA 2R2GA 1NBOA 4I5GA 5THQA 1LRJA 3S1LA 3OEWA 1XEAA 2PKRA 5JCJA 5I9MA 1I3KA 1C3VA 4IDDA 3Q2KA 4R3NA 4QO7A 4OYRA 4LN1A 1I5RA 3UXYA 1YL7A 4QO8A 1QV7A 3I4CA 1FDTA 1HT0A 1TEHA 1B8PA 3OBBA 5IFLA 3FPLA 5IZCA 1T25A 4EEZA 3K30A 4HADA 1HF3A 1K0UA 4ITUA 4PZCA 4DPLA 3QW2A 1MXFA 2B4QA 3U4DA 1YJ8A 4E2ZA 1Z74A 2C7GA 4JBHA 4NBWA 1SOVA 2Y1DA 4WCFC 2YV3A 3I23A 5KJ6A 3CINA 2DC1A 1TA4A 2I5PO 3DTYA 2VHZA 4ALJA 3TFOA 3JQ9C 1JDJA 4M49A 4AJHA 4N5NA 3ROQA 4CUJA 3F46A 3M2TA 2DAPA 2Q4EA 5DULA 2OUIA 2ZTMA 5ITVA 3LQFA 2C20A 3NDJA 3I5MA 4RV9A 2E82A 4AICA 4YAGA 1E7MA 3FPCA 5K6AA 3RC9A 3WMXA 4P4NA 3WIEA 5TNXA 4DQXA 3W8FA 1ZMOA 4O5OA 1ADFA 5CEFA 3C3XA 3E6AA 2I6TA 3GAFA 4I8XA 1E3WB 2GYYA 3VZPA 1U3TA 2W8ZA 2EF1A 3D3WB 1XU9A 1GZ3A 2O3TA 4GL4A 4GSKA 2O3RA 1UP7A 3BZUA 4IS3A 1PTJA 1WPQA 4DMLA 3FRJA 3GNSA 4X54A 5HA5A 2W90A 5A3VA 3WYEA 5IZCC 5J23A 2NSDA 3U5TA 3O38A 5A9SB 1NPTO 3FNGA 3SVTA 2NWQA 4YR9A 3PI7A 4IJUA 3DZBA 1EFLA 2NU6A 2YDXA 1BDMA 3RSHA 1MC5A 5H82A 2C2XA 5L7YA 2Q2QA 3ZNOA 2Q1UA 1UDCA 2DPGA 3MOIA 1C14A 4TZKA 5L4LA 2IEDA 4JN6B 4BKOA 1C1XA 3PP8A 1JKIA 1I10A 1Z7BA 3TOXA 4I9UA 5A3JA 3WQSB 5THKA 4INAA 4JJFA 2VWPA 5C5IA 1XCBA 1W4ZA 4D0RA 1I24A 2Z1MA 3JD3A 4IY1A 4CMEA 5IAAA 1RM3A 2WYWA 4MDHA 4BGUA 1F8FA 4E2WA 4RVUA 1B3RA 1KIFA 1E5QA 1QSGA 4OMUA 3AFNA 3HDYA 4DVJA 2AG8A 4YJFB 2W2KB 5B1YA 4YCAA 5COBA 1QYVA 2EGHA 2IYOA 3QV1A 4MO2A 4HKTA 2HLPA 1EUDA 2TMDA 3A28A 1BSVA 1V3TA 2NQ8A 2F1KA 3BTVA 2X7HA 4FC7A 1ZMTA 1P1JA 1V8BA 1OI7A 2RBEA 3C8MA 3E5MA 2PNFA 3OMLA 4MVJP 4E6PA 1YQGA 5L95A 4CMJA 1XDWA 3KM0A 4RPGA 1X15A 3V1UA 2GN9A 2VUTA 1EE2A 4M55A 1HE4A 2G5CA 5JYDA 4BMVA 1F14A 1ADCA 1QG6A 2GRAA 4BV9A 4CR8A 1A7KA 2AXQA 3OA0A 3ONDA 5KJCA 5CDUA 4A26A 1OOEA 5L51A 2GR9A 3GEDA 3PYMA 4ND4A 4II2A 4ZVVA 3F3SA 4YXFA 3JD2A 5H81A 4BS9A 4BUCA 3WGQA 4BNNA 3MJEA 4EI2A 1N1GA 4KUGA 2Y1OA 4WCFB 1VL0A 3ZV6A 4DBVO 2EW8A 3NJ4A 4PVDA 1XU7A 2EHDA 3ZHYA 4RDIA 1R66A 4E31A 2D1YA 1UAGA 2X0IA 3U62A 4FJ0A 5K0ZA 4XWYA 5AVOA 3OETA 4M54A 4Q9NA 4RVDA 2NTJA 3DBLB 3QWBA 3V2HA 3CSDA 3LYLA 1RPNA 2PGLA 3DXFA 3QWIA 4R54A 3JTMA 5JC8A 1UZMA 4M8SA 4YJHA 4O59O 4BO7A 1KVTA 4YJFA 1ZH8A 2ZATA 1Q0LA 3MTGA 1K6XA 5ER6A 3VH1A 4NG5A 4IJWA 1R4NB 1C0PA 3IP1A 2YFHA 3TNLA 3PLRA 4BO8A 2OGUA 3W1VA 4NDNE 2ZB3A 4K26A 1JKJA 3WWZA 1R4MB 1ZZEA 1C0IA 2AEMA 2PZKA 3VH2A 4DLAA 4LVCA 4YT2A 1AE1A 3F4BA 1GV1A 4WE3A 2VTDA 4NNJA 4BO9A 1GYQA 1DHTA 4Q3BA 2HK7A 1QR6A 3CMMA 1KEWA 2TMGA 4PG6A 3VHRA 2EW2A 1N9GA 2OBNA 5TT0A 4I5EA 5JO9A 4FJ2A 4CLOB 1JWAB 1O0SA 3ZU4A 3NYWA 1EK5A 4BHTA 5B4UA 1Z75A 2JHGA 5DBFA 5L4NA 2O3JA 1W6UA 3NEPX 1NAHA 3PQEA 4OKNA 5DF1A 4WPGA 4BB5A 3TN7A 2R6JA 4EUFA 4WK6A 2GSDA 1GAEO 2DU8A 5A9SA 2ZB7A 3RBZA 2ZB8A 2OMEA 3G1UA 3LZ6A 5L9AA 2C54A 3RROA 2GCGA 3LLSA 2Y93A 3E03A 3IUSA 4EJMA 3A06A 3U4IA 1A4UA 1MUUA 4BNZA 4EITA 3MJTA 1ZK4A 4M1QA 5A5FA 3RJ5A 3WBBA 2DFDA 2X8LA 3X2EA 5IXSA 2Q50A 3FHLA 4J0FA 1I36A 1LRKA 4ZQFA 4CPDA 4UEOA 2AE1A 4XR9A 4WLNA 3WSVA 5AOVA 1E7WA 4A0SA 4MP3A 1GYPA 3RFVA 1ISGA 3I6QA 1EEHA 3PRJA 3QWAA 4M86A 4MVJM 4HFRA 3I6IA 1IZ0A 2WD7B 3AM3A 1Q2XA 2RH8A 1ENOA 4CM9D 2AW5A 1XA0A 2C5EA 3GT0A 5I9NA 4PGFA 2OBYA 4FFOA 1PZHA 1ZXBA 1HDXA 1RJWA 5TIIA 4Y6SA 5HS4A 2Y0DA 2VRBA 3OJ0A 3QWHA 3LT4A 4IZHA 1UR5A 1O8CA 1KEVA 4MIYA 2BI8A 3AK4A 3BTSA 4AJIA 4C7JA 1X7DA 2PD3A 3HG7A 3O26A 4DL9A 4PFJA 2XPCA 3R1IA 1N7GA 2P9CA 4FN4A 3DWFA 3AU9A 4RF2A 3DBHA 1LI4A 3IMFA 3RVDA 1A9ZA 3INRA 2NADA 4E21A 3WGHA 3TDKA 2X6TA 5G4LA 1U3VA 3NKLA 3VH3A 2V6MA 3D0OA 3L4BA 6ADHA 1R6DA 3ZU2A 1XIVA 1ZO8A 4DQVA 2B5VA 4LGVA 4CMKA 3WS7A 2D5AA 4N18A 1SMKA 4IUYA 3RC2A 1B15A 1Y81A 2O3QA 2FP4A 4GLLA 4J2OA 4KDEA 3BIOA 2YV2A 3QP9A 1U7HA 4PG7A 1L1FA 1YB4A 8LDHA 5T64A 2I3GA 1NWHA 3RAJA 4WKGA 3DO5A 1HZZA 4AVYA 3AM4A 5KTKA 5DCWA 3GVPA 3PPIA 2ZYGA 1PL6A 4ZHSA 1EFKA 2D3TA 2BFMA 3HNPA 1SCUA 5DP2A 4J3FA 3OH8A 4XKJA 4L4RA 4LRSB 3EW7A 5I7VA 1FDSA 2RAFA 5IF3A 1PS8A 2R00A 4J1QA 3ZV5A 1EQ2A 2VUUA 5I7SA 5G0TA 2H63A 3INTA 4AJPA 3ETGA 1E3LA 4DMMA 3ITKA 5BNIA 2Y99A 5IJZA 4IGFA 2PK3A 1K5HA 4ALKA 5DCYA 1TT5B 3GC6A 1MG0A 2DTEA 1HYHA 4WLOA 1XR3A 2JJYA 3UN1A 1B26A 2ZJ1A 4IM7A 2NNLD 2B5WA 3D3WA 4A5OA 5CHEA 1WZEA 1V6AA 2FR1A 1UJMA 4HBGA 2DBRA 1U3UA 5CAEA 3CUKA 4F6CA 1MXHA 1CRWG 2JFHA 4M89A 4BO6A 3N74A 2FPGA 1X0VA 3V5NA 4ROSA 4IDEA 5KNLA 4D41A 3JQEA 4R9SA 1B14A 5CG1A 5MDHA 4D44A 4NBRA 1EBUA 2GN6A 4N5MA 1F0YA 2HK9A 2ZQYA 4E5YA 4HX5A 1HDZA 1UP6A 2CVZA 3PHIA 3JQ8A 4BNYA 2X9NA 2X5JO 2WDZA 3RCBA 3VOSA 5IG2A 3B1JA 4BQRA 1EUCA 3BYZA 4W7IA 4MVJD 1M2WA 5G4KB 2PWZA 1K6IA 3QVXA 3EK2A 2GD1O 3TWOA 5LC1A 2QYSA 2NVUB 4WLUA 2X58A 1QLHA 1MGOA 3RKRA 5CP8A 4B7UA 1JA9A 3ZWVA 4IDFA 3F47A 3UICA 3KSUA 4S3MA 4NU6A 1U5CA 4XYGA 3VPGA 5TS3A 2BFOA 3KXDA 1HRDA 1H5QA 3TZKA 2GERA 3PDUA 3P5SA 5JAMA 3TOZA 1VSVA 1YOVA 1SNYA 2WD7A 3QVWA 4TRNA 5A4DA 1WZIA 2Y1EA 4AJOA 2X4GA 4PRLA 4GI2A 4UEJA 3EYWA 3GOHA 3HDQA 2E48A 4F3YA 1W73A 2O23A 4UVHA 1E7YA 4IXTA 4II3A 2RIRA 1ZSYA 5TF4A 2XOXA 3NJ8A 3BMNA 3MJCA 4JJIA 3RKUA 3K73O 2X0NA 4QQRA 2GPTA 1TT5A 1VJTA 4U0JA 4W6ZA 3T4XA 5KJ1A 4YRDA 4NH4A 2D2IA 4BO1A 1N7HA 2VQ3A 1E3IA 2ZQZA 4K9DA 4XA8A 4KUHA 1A71A 4BNMA 3I9JA 4E5NA 4E33A 2Y68A 3TFQA 4NPCA 3E82A 5ILOA 3NAQA 3E9QA 2J5RA 2Y05A 3FWNA 5BSGA 2JKVA 3ROKA 1Y7TA 1H9BA 2UYYA 5DT9A 1PZEA 2BMAA 3AY6A 5TJ9A 5JNLA 2J8ZA 1U4SA 4BGEA 3OHSX 1SOWA 3MZ0A 1I8TA 3RUIA 3D5QA 5ES3A 5ICSA 2BHLA 1WWKA 2IXAA 3PJFA 1WXDA 3KO8A 4Z9FA 1HSOA 1UXGA 3WFJA 1WMBA 1HDCA 4RQTA 3DBLA 1YOVB 3I9OA 4GMGA 1R0KA 2UUOA 3WB9A 4Q39A 3R3SA 3DOCA 3AUSA 3K31A 1NWCA 5FF9A 3GF4A 5IN5A 8ADHA 5G2OA 3GDOA 3DC2A 1AGNA 4ZGWA 3KUXA 3GEGA 4DBZA 1YL5A 1F17A 3GMDA 4GX5A 1WNTA 1DFGA 2XAAA 3MOGA 1LTHR 3KYCB 3P7MA 4W9NA 3BMNB 1WDKA 5FYDA 3ZNPA 2ZIZA 3H5RA 1LRLA 4YT4A 1NFRA 4JXKA 4UUMA 2IZ1A 2BELA 3FSRA 2EKLA 5KKAA 1PWXA 4NJMA 3AOEA 4DWVA 2NQTA 5G0UA 3IKTA 4HY3A 4BOYA 4NI5A 3PHGA 3GNQA 2EWMA 3PWKA 1WDMA 3H5NA 3MCVA 2Q1WA 3I9KA 2HRBA 5L45A 1BVRA 3P2OA 2YFQA 4BNHA 2GF2A 1ZKMA 4EGFA 1KBZA 2CY0A 1PQUA 1MFZA 4ZQBA 3WICA 1JVSA 2UVDA 3GVXA 1E6WA 3AFMA 3BMOA 4IIUA 3ZWYA 3EAGA 3HQ4O 4MP8A 1C1DA 3GHYA 1YDEA 3I83A 5TQVA 4PRKA 5I8ZA 5U1PA 3ZWMA 1E5LA 4YACA 4DA9A 4Y8VA 4XR4A 3S2EA 3HB4X 1I2ZA 5FEUA 4NK5A 1X0XA 1UUFA 4Z9YA 5A9TA 3RUDA 1BW9B 1YO6A 1VJ0A 4K1LA 4CUKA 4ESOA 4GGOA 3D1LA 1AXEA 1YONA 2P68A 3E1KA 1DXYA 2WE8A 1ENPA 4OL9A 3ANMA 4O1MA 5LDGA 1LSSA 1P3DA 1R0SA 1ZJZA 1H6CA 2D8AA 3SX2A 1YB5A 4JK3A 4UVEA 4OAQA 2GZ1A 5JAIA 3N58A 1RYDA 4A2CA 4ZU3A 1HE5A 2YDYA 1U1IA 2EJWA 2O48X 4HXYA 1B16A 3I9LA 4WGGA 3JQDA 2IODA 3QRWA 3PIIA 4QECA 1XQ6A 4TQGA 4NBTA 3E9MA 1OAAA 4OQYA 5T57A 2H5LA 4YQYA 3ZV3A 2HUNA 1D1SA 1IB6A 4MVJI 2OFPA 4IBOA 5KWEA 2NV6A 4RPKA 4JNKA 2V6GA 5TJHA 2JHFA 3G17A 2GUGA 2CSUA 4J7CA 2NACA 2FR8A 5KCZA 2PTGA 1ZK1A 1J49A 2CF6A 5F5NA 2FMUA 1UDBA 3OIGA 3ADOA 2X1HA 1HSZA 3HWRA 1Y9EA 2AMFA 3STHA 1BVUA 4ND1A 2VZ0A 1KOLA 2C5AA 1HYGA 5TT1A 2HK8A 3C7AA 1BGVA 2ET6A 3RJ9A 1F12A 3GFGA 4DIBA 1BXZA 1GPDG 4AJKA 5FI5A 1PWZA 3VTZA 1C1DB 4W82A 4XQ9A 3LVFO 1HE3A 1GUFA 2Y66A 4YAEA 2JCYA 4IMPA 2CZCA 3FF4A 1MLDA 4NQZA 4TKLA 1DIAA 1G0NA 1BW9A 4Z0TA 2ZK7A 2YQ4A 1JKFA 1GCOA 2JCXA 3U49A 3BMQB 4XRRA 4AJNA 2BFPA 4R51A 3ZWAA 3GZ4A 3DB2A 4YWJA 5EESA 3PHHA 2D59A 1EQUA 3L9XA 4ZJUA 1J6UA 4IJKA 1ADBA 1E1NA 3GLQA 1I01A 4YJDA 1M66A 1JAXA 3S2GA 1ZXLA 4JX8A 3ABIA 3F4LA 4Z0HO 3KETA 4URFA 1CEQA 1ENZA 2VOJA 4D3SA 3ETDA 3PGJA 1TXGA 1JLLA 2HDHA 2AQHA 1M6HA 3ZWXA 1EDOA 1MV8A 3JYQA 1J4AA 4CM8A 3ITDA 4D3FA 1H94A 4MIEA 1PGPA 3S2FA 1VKOA 2WMDA 4RVFA 3ADPA 1PS0A 4DLLA 3UHAA 1PZGA 3PFFA 1DC6A 3W6ZA 5BSFA 1LJ8A 1Y1PA 2GASA 1V0JA 4DIFA 1I2CA 1YQDA 1CQIA 4GVLA 4J43A 1ZIDA 3F9IA 2EP5A 2YQ5A 2DUWA 1E3EA 4WCDA 3GR6A 3ORFA 1NP3A 3NT2A 2P5YA 2EGGA 3DAFA 1NPYA 4IQGA 4EW6A 2PZJA 2IZZA 4FFPA 5COAA 5JXWA 4YYZA 4LRTB 2VZ9A 3GK3A 4CLHA 4QUKA 3DDNA 4GQAA 4CQMD 2P4HX 1I30A 3L6DA 2P2SA 4Q3NA 3AM5A 4FGSA 4ZRNA 3DEYX 4XIYA 1P31A 2VYVA 2C82A 3JQ6A 1IPFA 2X5OA 4IDGA 5T6BA 3JYLA 3EMKA 4MPDA 2YHIA 1RWBA 3RU9A 2BD0A 2NLOA 3WR5A 2PR2A 4N54A 3VPXA 2WE7A 1NM5A 3FI9A 3G79A 3UOGA 1H0KA 1C0KA 3TRIA 1B8UA 3KHUA 4BO4A 2EKQA 1E92A 2VN8A 3JQ7A 4J91A 3OM9A 5EIOA 4NFHA 1GU7A 3AWDA 2FOIA 4R41A 3PK0A 4RJTA 4HFNA 4XZ3A 4KMSA 1CERA 3JQAD 4U7WA 4IXWA 4I5DA 3ZW8A 2WEKA 3WSWA 1VM6A 3KB6A 1CF2O 2Q46A 3SC6A 5EINA 5CEEA 4XJSA 2AE2A 2P5UA 3GDFA 3C24A 4FIZA 4XRGA 1ZCJA 2CFCA 2VNAA 4U6QA 1NQOA 2GNAA 5CDGA 3R6DA 3ZU5A 1K89A 2ZB4A 3RBXA 5TLSA 1P77A 2VYND 5C7LO 1LU9A 1R12A 2OZPA 2W98A 3NV9A 4YA6A 5EQFA 3DL2A 3RD5A 4ZICA 4KP7A 4GBJA 1LLCA 4OIMA 1H2HA 3DHEA 3ZZNA 4ALMA 3KEQA 1B3BA 3K6JA 5HRUA 3DOOA 1HTBA 4MOWA 3RASA 1IUKA 2V7PA 1PJ3A 1R16A 4GAEA 1AUPA 1IYZA 2VHWA 3ZGYA 1U28A 3E18A 5DP1A 3F5QA 5JDIA 1P33A 4B3JA 1DAOA 4KQWA 4AJEA 3I4FA 4UVIA 4RCVA 5L7WA 1HDOA 1OFGA 3TZCA 4XQGA 3AU8A 2Z1NA 4Z0PA 2JAPA 1Y8RA 4XJTA 2DLDA 5EERA 4G65A 2EXXA 2X22A 1KETA 3ONFA 3LC7O 4RF3A 3KYDA 4WEOA 4UEKA 3AOEC 5AXBA 3RI3A 5TRTA 2VUSA 4IQ0A 1TB4A 2DTXA 1Z45A 4NIMA 2WTBA 1WMAA 3GN1A 1ARZA 3O03A 2RHCA 5L40A 1GADO 3NT4A 3JYPA 1YVEI 4AJLA 3H3JA 4AJ4A 3K8ZA 1RM0A 5KVSA 3NUGA 3OF2A 2JFFA 4OXYA 2NUAA 1ZW1A 3ZDFA 2O2SA 4RVSA 2D0IA 1H9AA 2UAGA 3BHIA 1EE9A 2JD1A 5JO0A 1EK6A 2DKNA 4Y67A 1U9JA 5CPFA 1ISHA 4MKZA 5IDQA 4KWHA 4CV1A 2O50A 3DQPA 1GTMA 4PLVA 4EDFA 2VCYA 2YHUA 1GCUA 3CE6A 1U2GA 4BNLA 4ILKA 1CYDA 4RL6A 4CL3A 4DXHA 4XYLA 3G3EA 4UVGA 4DLBA 1JQBA 4R1NA 3RBVA 4ZQGA 4YJGB 1CETA 4D43A 4OXKA 3JQBA 3RIHA 3VPHA 2VOEA 2I99A 3ZWWA 2FZEA 2FSVA 3PWZA 1E3JA 1HL3A 1ZBQA 5HS6A 3DZGA 2IDZA 2Y1GA 3FWZA 1T4DA 2HO5A 2LDBA 4JBIA 5F3RA 4WUVA 1SB8A 5JAQA 1WLYA 4HFMA 1T2CA 1N9GB 4BO0A 4LSWA 1ML3A 1T1RA 2X9GA 1P1KA 2Z5LA 2FPIA 2RCYA 3IDSA 4OGWA 4FFRA 4BO3A 2H6EA 4IIVA 3AW9A 1U2DA 4AJ2A 4MVJF 3JD0A 2ZCUA 3OSUA 1XWFA 2C7VA 5IDWA 4BO5A 4CQMB 2Y1CA 1L7EA 2AEJA 4R16A 2V6BA 4XX0A 4DC0A 1QKIA 1S7CA 4PLYA 1PGOA 1B7GO 1ORRA 4MIOA 3LT0A 4NR0A 5CEJA 4PLGA 3MTJA 1CDOA 1D8AA 1DJQA 2B83A 3HSKA 7ADHA 4OOFA 3BHMA 3WMWA 5TC4A 3UF0A 1DHRA 1ZK3A 3UCEA 1X7HA 4RGBA 1AN9A 1QP8A 3AOGA 1V35A 4LMPA 2W2LA 3FCOA 5L53A 5ICMA 1S6YA 3NGXA 1NNUA 5LDHA 1FJHA 1Q7BA 2GLXA 1PSDA 4ZA2A 2G82A 3Q9UA 5IN4A 3DZIA 1P9LA 1PR3A 1GQQA 3KRTA
chains in the Genus database with same CATH superfamily
4ARUA 4RH0A 1N6LA 3CLUD 2WWRA 2VXYA 3AF4A 1AIPA 4QEDA 5CB4A 5BQOA 2OOSA 1Y9JA 3CWCA 3DDUA 2FN7A 3WLJA 1D3AA 3DM5A 4U8HA 1CW2B 2VHYA 2VHEA 1G20A 3AUTA 5DVZA 5HVNA 1G1MA 1URPA 1DBVO 1JEJA 1RFLA 2G04A 3JQBC 3LECA 2B9VA 4EATA 3NVAA 2XSZD 1FC0A 1CF9A 3PEFA 1RLTA 2O7SA 2B99A 1UEJA 1MX3A 2PWPA 2QU8A 3AR3A 3GPIA 2QZZA 1QDLB 1U2QA 2IHTA 3BXHA 4C01A 1E20A 1Z5GA 1CK4A 3LCVB 4FFSA 3G7NA 2OLJA 5GQSA 1JU3A 3V7WA 4Q21A 3ZBUA 4EUEA 4F2HA 4FEEA 1SH7A 2C3UA 1T9HA 2QT0A 1DWOA 3BRWA 3VHXB 2C4MA 3VNUA 1Z5NA 1QAMA 1VA4A 1AV6A 3ZGVA 5KAMA 3WGMA 1E6EA 1RZUA 3I2HA 5BV8A 3NDBB 2V7UA 3BN3A 2FFHA 3L40A 3IHKA 2ANBA 4G4GA 1K7EB 2C5FA 1U0TA 4D9MA 1JWLA 3WQBA 5EZQA 2ETVA 3IJRA 2FOLA 2A9OA 3MWJA 4OPMA 1DLJA 1ZNXA 2ZJOA 2XA2A 3OEYA 1J9GA 4TVBA 3G68A 1S9DA 2XGSA 3Q3IA 4WI1A 5EJEA 2OBBA 3T7CA 2GCEA 3U17A 3MAGA 1IPHA 1UFRA 2ZDGA 4HAZA 3A1WA 3IKVA 4K46A 5IBCA 1I4LD 4GX2A 1LTKA 5D3QA 4F21A 2PMDA 1U9YA 3FLEA 4HH0A 1LZKA 4H1WA 3TVTA 1GNSA 1U4NA 4E7PA 2QIOA 4HWRA 1EHIA 1M6WA 3WIBA 2M2IA 5JSQA 2EIXA 1LDGA 3O92A 5DIFA 3L93A 5P21A 1CJSA 5FA5A 3RYIA 4CLRB 2ZP1A 1GV0A 1X77A 3RC7A 4F3RA 3EY4A 4JC5A 1Q15A 3FB4A 4DG9A 3H9EO 1GRNA 3DXYA 4PONA 3G0OA 4ZZ0A 1W6RA 2J31A 2NIPA 5BNTA 2BFDB 3FHOA 4HRYA 1B6GA 1ESNA 3CMCO 4FU0A 4NBSA 4TL6A 5CX1B 1PAUA 4BJ1A 1OXMA 2LD4A 1R50A 3C3BA 1U11A 1AF4A 3BS4A 3IAFA 3NPAA 4LYDA 1FP4B 3HC7A 4V2UA 1AH2A 2GDZA 4FHCA 2RSLA 1TD9A 3L8CA 4JUDX 3MFQA 3UQYS 5L6LB 2ZJBA 5HZHA 3PA8A 3I73A 2CK3A 1PUJA 5KQRA 4YRFA 1QOZA 4DHWA 1RRPA 3V1LA 4C2TA 1NATA 4BNVA 3RC3A 3E35A 3D8RA 3I2GA 3NT5A 4QNMA 1XBTA 1GNLA 4TOIA 2PH7A 5EXSA 5I9IA 3D3KA 4RDXA 4P3PA 4F1KA 2P9YA 3ON5A 1RXEA 4RM3A 4U02A 4CM5A 4H7PA 4XASA 3T95A 3FFTA 3TW8B 1B0AA 1L5OA 2E6KA 2F9LA 4JXZA 1GT6A 2OHFA 3DP9A 2PWBA 4TLMB 2OHHA 4UCFA 5CCXA 4RTNA 1SVOA 1R6XA 3MJSA 1YJ5A 3QFTA 1N1DA 1S2NA 2VBIA 5ADUS 3FOFC 1IVYA 1JTEA 3GZNB 5EJ2A 1SIBE 4MVJE 1XRNA 2W6ZA 3DS8A 3O8RA 4W8OA 1TKRA 4P58A 5I4CA 2EJVA 1IMJA 3QY9A 4AKTA 2DTDA 1NN5A 5DNYB 1IZZA 1SCBA 2OCBA 4UTPA 2EFJA 2Q6KA 3PQCA 1V39A 4PS1A 4MHTA 4JIGA 1ECPA 2B7BA 1BWSA 3FCUB 3ZQ6A 1WUYA 4DTIA 5JDIC 1DKOA 3T9AA 5EAIA 3LXUX 1VPEA 4BP8A 3KSDO 4I55B 4IIDA 1BHO1 2CHVA 4WFQA 5E7QA 2O3UA 3AEYA 2A0WA 1XLUA 2IP4A 3LQRA 3Q9NA 1FFXA 3QIAA 3H13A 3UBMA 3LPDA 4MWBA 3ZVNA 4EFLA 1YKFA 1RLJA 3I09A 1UPAA 4KXWA 1DBRA 1IY1A 1P7YA 3OJEA 1K5DA 2WNHA 5IP5A 1EFTA 1HRKA 1Q0UA 1KC3A 3CY6A 3PVSA 1FDVA 4AWBA 1KI9A 1Q7RA 4HDRB 3S55A 3W7AA 1HZJA 5DK4A 3TM4A 3H4VA 4TYWA 4IDAA 3EHEA 4KZKA 1NVTA 4YALA 3RVJA 4M53A 3OIYA 3QXJA 3USCS 1HR0B 1RI3A 1RVV1 1UQTA 3HB1A 4PPNA 3CIOA 2PA3A 1FTSA 4HXEB 4JP2A 5AK4A 1Z6ZA 2HNAA 2Z5FA 3K0FB 3MJRA 3P9CA 2FUG1 3GEMA 4FXPA 3I52A 2ZRFA 2O2DA 4HXGA 3UKOA 1VSTA 3LRTA 4FBMA 2QT9A 2YWHA 1KFCB 1RBYA 2X5XA 3OZEA 1FP7A 1ZCZA 2GRUA 2V5AA 4I1YA 1A97A 3ZE7A 1O94D 1T3HA 2BGTA 1QF6A 4BQQA 2P2DA 3IKLA 2ODQA 4RPHA 1K1EA 2XMBA 3NRBA 2CUNA 3OAAA 5A5DA 4Z4HA 2E85A 1FRNA 3MA0A 2YJ4A 3LY9A 3QSGA 2P4QA 5EWLB 1ZDMA 2YN0A 3KOMA 5IM4F 1XZJA 3D02A 1UKZA 1PT8A 2JAUA 1AX9A 2EP7A 2IW3A 1LFAA 2WJPA 2WUGA 3BSYA 4MKRA 4C7BA 1GR1A 3L8GA 4LJ4A 1KOFA 1Z0KA 2QVGA 2XNHA 4NZ9A 4UD6A 3INYA 1RYEA 1SXJA 2JEYA 2QUIA 2AG6A 5ED4A 5D86A 5LQAA 3TSYA 1PQYA 3D8SA 3COVA 2P5SA 4DUPA 4YR7A 3I04A 1CY2A 4HZIA 4FW8A 4CM4A 1OLXA 4HH3C 3VAAA 2I87A 3VO1A 3W2HA 3PXCX 2QRZA 4UHJA 4WNAB 4KI0A 1FJGB 2NTNA 3IGFA 3ZHUA 3P52A 5B3KA 9LDBA 5ADHA 1Z25A 5KX5A 1UOOA 2Q3BA 3JAWA 1FMFA 1PBNA 4O29A 3A26A 2PZBA 3ZXXA 4PF1A 4N7RA 1N6IA 1WEKA 1B8VA 3EIUA 4GR5A 1PKXA 3IP7A 5BWOA 4I9HA 3HUDA 1ZVQA 1B93A 2C31A 1GLGA 4OA5A 1RAAA 2IX9A 2XYQA 3S7TA 3T4EA 3ZCXA 4CXMA 2AG5A 2JFVA 2HAEA 5TQ2A 4BVEA 4OUDA 4IHJF 4CCWA 3BH0A 3DE3X 3K2EA 3VU0A 2G8LA 4NCAA 1M2GA 4BNJA 5KKCA 1JDNA 1B41A 4MTLA 4PX2A 3RYHB 1NNI1 3BKWA 4I5FA 4J4BA 5EKXA 4PAMA 3G8DA 3Q0IA 2TMYA 1JT9A 2J5QA 2ZJ3A 2ZYSA 3PFNA 1KTIA 2IUUA 4DR7B 1EVKA 2IFTA 3BFVA 3KEMA 2OSBA 4L3VA 3RIGA 1IVSA 5BO5A 1KY5A 1GNRA 2I4OA 2XD4A 4JT9A 4LE0A 3PPWA 5D5HA 5LB2A 4L9AA 1A9XA 2JI9A 1A72A 3CXRA 2PV0A 3Q85A 2QM8A 1MAHA 4C0HA 4UVDA 1E1LA 2QVLA 3N6VA 1Y1QA 3E0XA 3T7IA 2PV7A 3RFTA 2EV9A 3KTDA 4C7KA 3EXFB 4CG0A 1IY2A 4OIFA 3L0OA 4JI5B 5BQXA 4KK3A 2BISA 1P80A 4MW9A 1CUWA 3MLBA 4TUYA 1H93A 2HSDA 3J7TA 2IYSA 1C3XA 1B1AA 2QR2A 2J09A 3M9LA 5IANA 2X0JA 3FGPA 4C0WA 4FZJA 3WLIA 1L5RA 4RU1A 5E7IA 5JS7A 4CKZA 4XYEA 4Z6KA 2BE9A 1LDNA 4NCKA 5J40A 4IH1A 1YA8A 1KY4A 3ABSB 4J0CA 1R6UA 3U7JA 4D80A 1PSZA 2VXOA 3VKUA 3GCXA 4ND7A 4RH1A 3NKVA 4B3IA 1LSUA 1R9MA 3N7UA 4WECA 1N5DA 2PAAA 3DLAA 2BWJA 2DBQA 3GPDG 2Q3EA 5FA8A 1JSCA 1D9ZA 3L7YA 4PC3A 4AKSA 1JZSA 3TF5A 1CUZA 2ZBEA 1G5QA 4HLUC 5A4MS 4HTFB 4LRYA 1OD6A 1UBGA 3F2VA 1AHIA 1MT0A 4WKPA 2A92A 2JCVA 4E32A 2VDWA 3WNQA 3NM4A 1V1JA 2QG6A 3K5WA 1Z2OX 5FL3A 3UAGA 4DZTA 2NZJA 3GX1A 3GD7A 3NDRA 5BYAA 4J94A 3P9RA 1PV4A 2EATA 2B0JA 2R7KA 3JVEA 1RSZA 3EZ2A 3GVHA 4V3CA 4ZAWA 3IIMA 4U2KA 3E05A 2Q3FA 3GXOA 4YRBA 5A5GA 2XYHA 4F5DA 1PJLA 2E4AA 2QZ9A 3VPFA 3FFWA 3T94A 1FW6A 3VJMA 1ENYA 2PUDA 1I7PA 2QRMA 2BKUA 4NBUA 5DM0A 4J0EA 3WP1B 1LLDA 4Q3DA 4DYVA 5C0OE 1ULTA 2J0UB 3F74A 3LVBA 3BL5A 3SDZA 4AROA 2ZM5A 3OHPA 1AXRA 4K9SA 3NPMA 4RSRA 4YDHB 2ZE8A 1SHZA 3M4XA 2XKKA 5H3HA 1JXQA 2IOHA 4CMCA 1O8BA 5CYFA 1MB4A 4FKBA 2PY6A 3I9MA 4Y2PA 5A03A 1U8TA 5DTIA 1GEGA 3H1FA 4EWLA 1TA9A 2Q3HA 2ATCA 4HGNA 1ZI8A 1K7YA 4R1TA 5FUXA 4EVSA 5T7BA 3SI7A 3QX3A 4AL4A 5L3QB 1MA0A 1EVZA 2ZSBA 5DW3A 2Z09A 5J2TB 2ZR9A 1II9A 2GESA 5G0VA 1XMVA 4J9UE 1HZZC 2NM0A 1WAMA 1M74A 3NMUF 3AC0A 4P3NA 2P67A 3EVEA 5F77A 1ZCAA 1DMRA 1EJ2A 3Q88A 2P9GA 3N3AC 4NWIA 1K06A 4LXYA 4UBMA 5E4TA 4RFSA 2VUHB 3MS2A 1D09A 2R6R1 3AX6A 4WN3A 5JSYA 1AHNA 4JP3A 4DWJA 3TLGB 3ELWA 4WLEA 3OJOA 4BAZA 1BTOA 2WIAA 1JR4A 5M29A 7MDHA 4E0BA 3GG2A 3PFHA 5EIWA 4F2DA 2MSWA 1TM2A 5IJWA 1OLSB 3E8XA 4NX2A 1SBNE 2IYEA 3LBHA 4RW0A 5E8JA 2J45A 2QS9A 4PBTA 4Q34A 4X7PA 4BE9A 2B7CA 2UYGA 1HORA 3UG7A 2AG1A 2EG9A 1ZI9A 2C83A 5CUQA 5CCDA 5HXAA 5IJ0B 1LBEA 1BU5A 1KRHA 3CLTD 1N92A 3GMTA 4J1TA 4M9XA 4M1KA 2G80A 1QRRA 1SAYA 3B48A 2BHTA 5CW2A 4RLHA 2CJWB 4JLDA 4CM8B 4PO1A 1XJ5A 4QARA 4CBVA 3BWMA 1JEYB 1NF8A 5FH9A 2V8BA 4UUNA 2X4LA 5AK3A 4E13A 1WCYA 2PUTA 2ZAOA 2WB4A 4K6CA 5DCUA 1BU8A 4HR7A 4C2BA 3PXGA 4GPD1 5B53A 1MPTA 3EWSA 3LUKA 4LJSA 4CN9A 4Z99A 1L7DA 3KSBC 1RBMA 1JDTA 3IB3A 4QUEA 2FPRA 4F97A 2H2AA 4II7A 2PBRA 3KBOA 4WCVA 3WADA 4FX5A 2SKCA 1HYEA 4G4IA 2JASA 2CF5A 2JGKA 5C8ZA 1ZN7A 5GOTA 3WB2A 4DCGA 2HXSA 2ZSUA 2I4NA 4YBZA 3ILYA 3UH0A 5HRAA 4H6PA 4Y0AA 3D4NA 5LA6F 4GKBA 4MWCA 3GGPA 2LGJA 2O2YA 2PL1A 4RMJA 5FWYA 2V1UA 1Y98A 2Z9CA 1TUIA 2HTEA 2IY8A 3T5MA 4R0NA 4CI9A 3VA7A 1N33B 3BJIC 1TOAA 2A7QA 2HWUA 1C81A 1ZK0A 1KDTA 1SKBA 2PX3A 3D31A 1W0KA 4FCTA 3KJGA 4PZAA 1HDGO 4TMKA 4JDPA 4EM6A 5JQGB 1JLKA 2F8TA 4N6OA 1Q1GA 4E5KA 4WASA 4Z8YA 1QRAA 5TVGA 4DC1A 1T8YA 3T3GA 3KYCA 1AK1A 3DKVA 2KLHA 1QVVA 3L0SA 3LTEA 3KKLA 1EK2A 3P9PA 3QEKA 4U2DA 5AHRA 3VDQA 5BP7A 1M67A 3R4VA 3TSOA 3QUAA 1X1DA 2IZ6A 4LIPD 3X1JA 3VSEA 2Q62A 3WOVA 1J21A 1FVHA 3A1VA 3EA4A 3M4YA 3FNQA 3CPEA 5K0GA 5AVKA 3LZCA 4EENA 1H8EA 3WRYA 4UAGA 1VLLA 1IG3A 2IUEA 3N5KA 3NGLA 4RCYA 3UHFA 2HQ1A 5CFQA 1RQGA 4JJ7A 4CM7A 3EXIA 3OZUA 2OTCA 1XP8A 5G3YA 4ID9A 1EWKA 1KERA 1I4OA 2CDAA 4FNOA 5JHGB 2B1RA 2QLJA 2Z2JA 3L9WA 5BOSA 2PUFA 1NYQA 1E1YA 1O5TA 2Q1SA 2Q4OA 3OQBA 3PC6A 4HGYA 4QPJC 4XJXA 1W1WA 2N3ZA 1DFHA 2VRCA 3L0PA 4M9RA 4IICA 5L6MB 3WX0A 3C5EA 5ECYA 3ZEAA 5JNRA 1MAUA 4FB5A 4QGAA 1BCRA 2J9FB 4NH0A 3SC2A 2B36A 4Q9LA 2FSUA 3PF8A 2P6NA 1V5IA 2X9VA 4D45A 3LO8A 4OP1A 1MP0A 3K6KA 3PLAE 1NVMB 4H15A 1P9RA 3GJ8A 2OY0A 2FPPB 1DOAA 1E2LA 1NMEA 4FD3A 4RHEA 5CK4A 2BRUA 4JB3A 3IHLA 1D2NA 1UEXC 2QTRA 4GE0A 1T8WA 2CZGA 2X9QA 3KB2A 3DBIA 3LSYA 1UWCA 3JYHA 1GQSA 2FZGA 4YP6A 1MOQA 4AWAA 1ZVKA 3TRKA 1S1MA 5FJJA 1ONBA 2PL5A 4IMIB 2DR0A 1TADA 3R9KA 4IX9A 2YL2A 1GT91 1OFVA 3UHOA 4B83A 4EUSA 1CRPA 3D64A 3OU2A 1WHSB 4U2GA 3W90A 2QL9A 5CR9A 1HC7A 4HAIA 4JT4A 4MJLA 4ZEXA 2ATEA 3ZUPA 1BDIA 3QIVA 2PKQP 4HNQA 1TCUA 1IY8A 3P2YA 1YL6A 3TECE 1NU8A 4AF8A 1SG9A 5HKKD 1JPJA 3ILXA 1Q17A 2DWPA 4TSFA 4CDRA 1Y89A 1T2UA 2IPNA 4MR7A 4EG1A 3ETEA 2Y4NA 4CV3A 4O8ZA 1F7UA 4B3DA 3F3KA 2H7VA 5CNJA 5KTPA 3AL2A 1VG1A 2QVYX 4UM9B 1RU3A 3TOCA 1JKMA 1JE0A 3E9RA 4DQLA 3CISA 3JAWB 4ZVRA 5KX5B 3PCRB 2FXIA 3NHJA 2EBUA 4TSRA 3OA2A 4OM8A 1WVMA 2PUHA 1XTPA 1JSRA 2AW3A 1L7RA 2F3QA 5L4SA 5IDXA 2H16A 1V7CA 3I3OA 3ZCPA 5AW6A 2NSHA 4XYMA 3HR7A 1JAYA 1UXJA 4BVAA 5KC8A 3RVMA 5B1EA 3CRZA 3ED5A 4R71A 4FFLA 5KMGA 1BHQ1 1L4BA 2VBGA 3MEQA 3VPSA 4QGHA 1SR8A 4OJMX 1D7OA 3IIJA 4TWAA 2A67A 1GPH1 1TQDA 5EZSA 3ZU3A 1Z6QA 4B6EA 2R8RA 3C6QA 4TWJA 1Q91A 2CJWA 3PC8C 2EL9A 1Z38A 1AKQA 2M6KA 2XCQA 1JEQB 2PJUA 4OI1A 2FE4A 3SC4A 1GUZA 1L5NA 3PR2B 4OBBA 1KEUA 2CVOA 3PICA 3UZUA 4A73A 1RCUA 1TUBB 2GPNA 5TPWB 3WI7A 1P1IA 1GCAA 1NN0A 4F6LA 5J3JA 2PL3A 4K6MA 1T6NA 4JXJA 3QF4B 2LBPA 3NIBA 3GLGA 2ZUEA 3JU3A 3PX7A 1FDRA 4FDTA 1PQPA 3SX0A 4REOA 4GPIB 1WXHA 2DY1A 4Q7MB 3MQ4A 4QSMA 4CEHA 4C22A 1QCDA 1TQ8A 3C5WP 1A8UA 2OO5C 3TEFA 3Q40A 2H4WA 5ELLA 4MVJG 4N49A 5CRIA 5ILQA 3VSCA 2IYRA 2Q6TA 5AYVA 2Q28A 3I2JA 2BBTA 5BSUA 5U4QA 4B9AA 1L4FA 2QWXA 1ANKA 3JWGA 5ALVA 1A9OA 3FVVA 1NVUQ 3NYRA 4UQPA 3W5CA 2LCIA 1U7OA 1P45A 1Q16A 3DKPA 4FR0A 4H3KB 4NZYA 3WL4A 1CYEA 4MUFA 3GEHA 4CFSA 3GP3A 1M6YA 4KB5A 5TMPA 1A1VA 4QT0A 1YB2A 4ITRC 1ODIA 1J8YF 1XZNA 2WWHA 2UZAA 1U80A 2A1IA 4A8HA 1J0EA 2G0TA 2AV6A 3WB0A 3PFWO 3DE7X 1YS4A 2JDIA 2FPMA 3DHNA 5REQA 1O3YA 4Y1RB 3O8QB 1WF6A 4KR0A 5GJWC 3LDFA 1KK2A 1E7RA 1JR3E 2XVZA 3EXG1 3PDIA 4HFJA 2FI1A 5FI3A 3ZBQA 2PIDA 4LJ5A 2NVBA 1E0DA 1Y3BE 2QX9A 3QEJA 1A98A 1PG2A 3E3MA 3DZKA 3EB9A 3EZFA 4RIHA 1OXKB 2K6GA 3UW1A 3IVCA 2Q0SA 5K20A 3KWLA 4Y2YA 3KUKA 2BTQB 2R8YA 4I1VA 5J4LA 4JJGA 3JRWA 1YJBA 2FY8A 4MUNA 4AUNA 1E1CB 1T34A 2PSHA 2WUDA 2XD9A 4ALLA 4N65A 4YAJA 2Y77A 1QORA 1NQAO 3BJZA 1PR2A 2YWBA 4FD2A 1I0LA 1A69A 1VCNA 1Q50A 3QLJA 3OF5A 1EINA 2ZQ5A 1C0LA 2ECPA 1US8A 1PW7A 1FRQA 2GBGA 4I2NA 1DCTA 2O07A 1GR0A 1X1AA 2Z83A 1WDTA 3VTAA 4FB4A 4MDFA 2AHRA 4N0DA 5GZ6A 2M1XA 3AZPA 1FFSA 2VQSA 1SUFA 3EVBA 3KYBA 3K94A 3OLVA 1J0XO 1BQ3A 3D4LA 3K0SA 3STUA 2B35A 1D03A 5EN4A 1JRLA 1Y5MA 1XRMA 4GZMA 3L1KA 1BS2A 4K8OA 4AU1A 1Q7CA 1WF3A 1E2QA 3QVMA 4HH4A 1SB9A 1TIKA 1UPXA 2X8JA 4BLPA 1GYRA 5AOCA 3V2UA 4ARZB 1NMQA 3DLHA 4ZT5A 3AIOA 2PJRA 4A6EA 3DMNA 3S2IA 1M76A 3NTVA 1J0CA 2WFAA 3V9PA 1J23A 1BC5A 3ZI0A 1N78A 3JQAA 2ECQA 4TPKA 3WMEA 5BNZA 2Y4OA 1QXSA 4WZAA 1BXGA 4ZQEA 3NWJA 2Z9DA 4RY2A 4CU5A 2H31A 3ANNA 3BCHA 3OCYA 1LQUA 2JJMA 4RZIA 5KYUA 1ZC3A 4NOKA 3RNLA 3SPXA 4ZEVA 1NHWA 3M4NA 3AVPA 3T5PA 1B42A 2Z5VA 4PN3A 2H9AA 4W5QA 1RRFA 4Z2AA 4RK0A 3D6UA 3TJZA 1T3SA 3SYMA 1M1UA 2HLDD 4W5WA 4D25A 4Z4IA 2YZMA 2BZ1A 3HZOA 3HZZA 4IFBA 2PSFA 1I1HA 3UY4A 4C14A 1IHYA 4J9VA 2WU3A 1U0HC 2DG2A 5MN4A 3BERA 3HKBA 4MWDA 2CFIA 3PRYA 2GI4A 1H3FA 1DC3A 2Q8QA 1ISIA 3GBSA 3OLQA 4ZAVA 1RJ9B 2DVMA 4HN9A 4XDGA 5F4ZA 1XG5A 1F7VA 1Z47A 2OCGA 1XC7A 1QDEA 3HCPA 3F67A 5M2QA 2Z6UA 1B2RA 3QEMA 3QITA 4EYEA 4KJZA 3AFOA 3IR5A 2BF7A 1AGRA 5CAEB 2FQYA 3RGWS 3SR0A 4KFCA 1SXHA 3KZCA 1OCEA 2PPVA 1X7ZA 2WF6A 3PEUA 1ETUA 4B6PA 5LMZA 2VA9A 3FNIA 3H4IA 3HCNA 4A7PA 2IYFA 1M1ZA 1VLHA 2D13A 2H4YA 1HE1C 4LI3X 4LJAA 3V6MA 3PQ5A 1GLNA 5C18A 1SVUA 5K5EA 1JW9B 3UW3A 4W5JA 2P9JA 1E2HA 1FX1A 3R40A 1V25A 1H6DA 4LS3A 1CE8B 3THWA 3B51X 1NR7A 3CRW1 2BEWB 3O3CA 3N87A 3SZ3A 5HOQA 2V0GA 2EDAA 5JCPA 1EXDA 5LIRA 1AQJA 1CZKA 2IU6A 1NZJA 1X2EA 2BHSA 4WXPA 1DWUA 3MWLA 1ORIA 4BZZA 1MRNA 1JHPA 1HEYA 1F2TB 4YAKA 3FZQA 3IP8A 2ZRNA 1TZ2A 4KE8A 4X1YB 4W9MC 1K66A 2FQQA 1SOAA 2WF8A 2GZRA 3UAYA 1UMBA 3JZIA 3O0DA 4X20B 5HTKA 2GBLC 4PNEA 3NCTA 4LVOA 2CFSA 1X7XB 3CNNA 3S70A 2NTEA 2C8LA 1UDRA 2EEPA 1E3WA 1RI4A 3EVTA 3I34X 4YONB 1A2QA 3GLIA 3N2LA 1TO2E 3EXHA 3JQFA 5IF9A 1HK7A 3SJUA 4XQ0A 4Z2YA 1N2XA 1LB1B 1ZJ4A 5LXTB 4GRAA 3UH1A 1JHQA 3CH4B 1XU4A 3HA3A 3EYAA 3IRVA 5B36A 5C3MA 3AVWA 2BEKA 3AIIA 2ORIA 4NAHA 3PDIB 4PR0A 421PA 3ZIUA 4REQA 4PYQA 2EJCA 2V9PA 3OOHA 4IVPA 2QE7D 1OXVA 1LF0A 4HCJA 4C0XA 1O2DA 4Y6RA 5EP3A 1CZLA 1E7QA 1CU1A 4F4DA 1F4LA 4BO2A 2VWQA 2I6GA 1KNXA 3HCWA 4DJ5X 4G0WA 2O8FA 1UDXA 1U2RA 1M2VA 2QF7A 1IDN1 2VJMB 3NLLA 3V8QA 4WJLA 5J2UB 1OTXA 2J33A 3O8NA 4V39A 2BGUA 4HB3A 5I3CA 2YFYA 1XCPA 4MQBA 2QQ5A 2WQZA 3SS9X 4PIVA 4WNIA 3EPHA 1YE8A 3UJCA 3EISA 5GMOA 4DCMA 1Y3IA 3AW8A 1Q1NA 1BHJA 2ZSAA 5JCXA 2QRUA 4RMNA 3CYFA 1XD9A 4HLDA 4MQEA 4EVRA 5HQ3A 3QXSA 4B4OA 3IMEA 1QG2A 4EJ0A 2J3IA 1U8XX 5HCUA 4ZARA 5HIMA 3NYIA 3R77A 3DVQX 4O4JA 5I9LA 3GJQA 4WADA 5AW5A 4IUDS 2VDPB 3VQTA 3EZ9A 1KMHA 4TSFD 3P94A 3TBKA 5C9ZA 4KQXA 1S3FA 2AN3A 1CUFA 2AXNA 2FZLA 5GPBA 5IBPA 1X8LA 1P2BA 3H9BA 4UUAA 3UJ6A 3EE6A 4TT8A 4QOJA 3SC3A 4D4GA 3WK8A 4P8RA 1IZ9A 2W2KA 2GBFA 4GF5A 1KE1A 4LPSA 3VV2A 3RHZA 1JEOA 3E9EA 3PEVA 1BQ4A 3CN9A 4FN5A 3VPCA 5T4HA 5C53B 2IOQA 5DLQC 4H60A 4KQEA 5CVEA 4L7QA 3SEZA 3I39X 4XUDA 4D82A 5JJIA 3C48A 3FB1A 3D5TA 2E37A 1FFCA 1MC8A 1C8KA 2JFOA 3HKCB 4QUDA 4R1SA 4X71A 1E62A 3I0MA 4CM3A 5AXAA 3W2FA 5K8IA 3IIEA 1ODFA 1NF9A 2WNIA 4MRPA 3KFVA 2DBYA 3NBYC 3U3KA 5C4MA 2PIAA 4P82A 3LWZA 3R5JA 1ECGA 2VWGA 2AZTA 4DMCA 4YXWD 1J25A 4GPAA 1PZFA 2RFLA 2YVUA 4MK4A 2X7XA 4QVGA 4RANA 1L8LA 4BGDA 5L7TA 2WFLB 1PGQA 1ZZGA 2XBUA 2O7QA 1T2EA 1KSFX 4WOPA 1LLUA 2GPSA 4OHVA 3UMSA 4HGRA 3UWKA 5L3SB 5ALDA 4KODA 3KOYA 4O2AF 4BFSA 1WP4A 3PQ6A 4D4KA 2C9CA 4O4HA 3L49A 3SEFA 1THGA 4RKRA 1QMGA 3B9QA 3L7NA 3UJ8A 4URVR 3EX7C 3OF3A 3RV4A 2AX3A 3M6UA 2WT9A 5JS2A 1EXVA 4QBIA 5F7JA 3ZHBA 4LGMA 4J2TA 1YDGA 1BDHA 2BM1A 4QXMA 3FDZB 4EKNB 4Z3KA 1EFPB 1T5TA 3E1GA 2JRCA 4LMRA 4P4LA 4A15A 1TAUA 5M7EA 1OBOA 3ZQ4A 1IHPA 1H3EA 4R4JA 3MJ4A 4LJ8A 4CW7A 1Q7GA 1OGYA 2BGLA 1YBVA 3V8NA 1G18A 1TLTA 2ZUWA 4XAQA 5I7UA 2R4TA 2G6BA 3C97A 2A30A 1R5BA 1YZYA 2YBDA 1A27A 2XTNA 3NASA 2POQX 3IAHA 3ODPA 4P54A 4DZRA 3C6KA 2W6QA 4EHJA 4EPRA 2I67A 4M88A 3WAKA 1V26A 2VJPA 3OT1B 4DSTA 2VT7A 6LDHA 3Q11A 2HHAA 1G8FA 1Z4NA 2RG1A 1EX9A 1I0IA 2YNMC 2HMVA 3ESQA 3G5UA 3QWFA 3UWDA 5C4IA 1V9LA 3KEOA 3QBEA 5IUKC 1E1DA 1EM8B 1QHFA 1LGYA 1GQ2A 1VG8A 2IPXA 2WPDD 4FSDA 2YC4C 4JU8A 3UBTA 1BXKA 1DT3A 1NXXA 4Y2UA 3OP4A 4TYPA 1B74A 1EGAA 2FETA 3DTVB 3ONWA 3PDCA 4P3XA 4UATA 2Z95A 3TOVA 1NQTA 3W2GA 1PNQA 1M6VB 1N5KA 2QV0A 3TIXB 1QYWA 4OYLA 1KR2A 1Z6XA 4WOJA 2P75A 1FE8A 1GGMA 2AMLA 2MSDB 2F6RA 4U7HA 2M6LA 4ZN6A 4GOJA 1YZGA 5KYXA 5EEGA 1DDOA 1CP2A 2A94A 3QQPA 5A4JA 3IBSA 3NVMB 1GAJA 4HEA1 5H8WA 4LYJA 3EC7A 5IXJA 1XD2B 4OB7A 4PCLA 5SYNA 4R98A 4ZFNA 2PLNA 4HLQB 2DECA 4X00A 4CV0A 3CF0A 3LRPA 4KQMA 3GQVA 3ICCA 5D3KA 5AKHA 4CRWB 1WXQA 4MVYA 4B6JA 2WSMA 1SKMA 2JIZD 3AETA 2D74A 3N3BC 5GZ3A 3FGNA 2DPHA 3G0IA 3MJVA 3PNYA 3R5FA 1E66A 4HJXA 4DCNA 3L8HA 4YP1A 2WFLA 4X8LA 2GLTA 4Q4AB 1NYRA 1S2LA 5K0EA 4ZOLF 1XKLA 2WF9A 4KR6A 4A27A 1RWKA 5I8WA 1E9BA 5KNDA 3WLFA 3AM1A 4A0RA 3A9RA 3R7SA 3N28A 4MWTA 3RIEA 1GIAA 3KJZA 1HE2A 5A62A 2R7AA 2Y9MB 4YMTA 1DRWA 5CLGA 4RORA 1KGSA 1LBQA 1ORWA 1LBSA 1UF9A 1WB5A 2JFBA 2VDUE 2JLAA 3A9WA 2IEAA 3K92A 3LA6A 1Y8QA 3QYJA 5A6VA 3K35A 2YY7A 4Q1CA 2PUBA 4TUYB 1EVIA 1GPKA 1DX6A 3LUGA 4YMGA 5KNBD 1RXWA 2CVQA 4ITVA 3CX6A 3TLKA 2B21A 2X14A 4KWIA 3G2NA 5I7EA 1JTVA 2WJ6A 4PNHA 4BNUA 4HUJA 3DEZA 4U3JA 4LVUA 3BJRA 5JIBA 5C51B 1LUAA 1J97A 2FEOA 2PEZA 3PD1A 2HA2A 3ST7A 4IDNA 2ASVA 1JG7A 1JSXA 3QVVA 4L5BA 9LDTA 2CJYA 3OWHA 2X0RA 5LLSA 2FPOA 3I45A 5DMHA 1Y1TA 1EGMB 2VG8A 3T61A 3NTRA 2YJNA 4GSLA 5IZ4A 4MW4A 3JQAB 1K3TA 3G23A 1LI7A 4MS1A 5GJBA 1J0DA 4G9GA 4MR9A 2YZ7A 2MMCA 3EY9A 2WVAA 4MB2A 5EJAA 3SVZA 2RGGA 1USWA 5CPBA 1V8DA 2B0CA 2OP1A 3COSA 3QVSA 4H0NA 3DMTC 4QDXA 3VKGA 4I81A 3HP4A 4HMQA 2PD4A 4J7UA 3KJEA 5AI9A 8ABPA 3RRJA 5JRJA 2PEYA 3FA2A 5FQOA 1PQ4A 1M8FA 4BMSA 2DWOA 3WOHA 3JQCA 1K88A 1N5MA 3M6XA 2DPYA 4EB6B 1DVRA 3ZDAA 2CMKA 4J1TC 3WGYA 4ER7A 5CDFE 3CUWA 2SNIE 4I5GA 5THQA 3RSGA 4B2IA 4N6NA 3OEWA 5I9MA 2PG3A 1I3KA 3BUSA 3K9BA 4K2AA 3EMDA 3REQA 2V7QD 2JANA 4C30A 2G70A 3DOEA 3KOZA 3MGCA 3UXYA 4QO8A 4PYNA 1FDTA 1HT0A 2GKGA 1W5EA 1L3BA 5IZCA 4M4SA 4EEZA 1T5IA 1FTYA 3QEMB 4B5LA 5EE9A 3F4KA 4HADA 1N5RA 1K0UA 3TI9A 3H9CA 5DLDA 1T8PA 2CXHA 2ZSFA 2H29A 3ESZA 4RE5A 4BAGA 1V4BA 2YYSA 2AJLI 7AT1A 1YJ8A 1VXRA 2I1LA 4E2ZA 1QP7A 2D4HA 3NHBA 1SXJB 4UDXX 1C4XA 1SBCA 1Y37A 1NJ5A 2XVXA 4WCFC 3O94A 3MLAA 3T3IA 1FP6A 1CZHA 2I5PO 3SCZA 4TMZA 1SQFA 4I50A 5FDFA 3U7HB 1TM5E 1WSAA 3NQ41 3JQ9C 4Y6QA 3UMYA 4D8WA 5AM3A 1VBNA 3IAM1 1R74A 3LQ2A 3SHTA 8MHTA 2NUPB 2C3OA 1XVAA 4CUJA 4DCOA 5AI8A 4QGGA 1D7AA 1P5RA 1GNPA 2Q4EA 3LXXA 1ODJA 1FL9A 1U1FA 3CF4G 4TL7A 2W2VA 3NBMA 4N01A 4MGZR 5DASA 2XT6A 3EZ7A 4MYDA 4Q4HB 3T1OA 3BBPA 4AICA 4WVLA 3TW4A 3C3KA 5BRNA 3GH1A 1Y34E 2AOUA 4WKNA 5K6AA 1DV1A 3T4PA 2V7EA 3WMXA 1IY0A 3MBOA 521PA 4MGKR 3I42A 3W8FA 1FFXB 3EGVA 1X7XA 1OJ7A 3MMNA 1S3SA 4ZO8A 4AX8A 3C3XA 2I6TA 3AQ4A 5I7RA 1MGPA 2LV8A 2W8ZA 1T5DX 1XU9A 2IWRA 2J9ZB 3RU2A 1GZ3A 1N0VC 2O3RA 3ET5A 2E7ZA 4PHTA 1I1OA 1ESEA 4I4TA 3GNSA 3C98A 5MFPA 4ZODA 5T41A 4EL0A 3GZJA 3IT2A 2W90A 3MIIA 5A3VA 5JI2E 3Q9LA 1XK6A 2QROA 2NSDA 4FFWA 3U5TA 5F9FA 2R4UA 3OKFA 4DMGA 1DO2A 1BOOA 3FNGA 4GEGA 4B40A 9GPBA 1YR1A 4NMWA 5EWLA 4L9WA 3BDVA 4YR9A 2XNSA 4IKPA 1GN8A 2O8FB 1A96A 1RQNA 4FGJA 1T5HX 4JLVA 3ZUGA 1G2PA 4QPNA 2ZWAA 1RXIA 5L7YA 2Q2QA 1KH3A 3K1AA 1O6GA 1UDCA 2I2AA 3H5LA 2DPGA 1YS2X 3IILA 4YCMA 1IBMB 4LCBA 2XADA 5C8YF 3MOIA 4D4JA 5L4LA 4AUEA 5EI5A 2QDXA 4A82A 3NWOA 5A2GA 2V1XA 3GJTA 5IPFA 5JVDF 5M34A 4RELA 4B71A 2VJNA 2AS0A 3TOXA 8OHMA 2QD2A 1DWPA 2OKGA 3FUXA 2QZSA 4FR2A 1Z29A 2COEA 4YT4A 1NJFA 1TF5A 2WTAA 2JGFA 3CC8A 1PWEA 4JJFA 1TYZA 4EG6A 3LPCA 3GLVA 5ICEA 4JBNA 3TKAA 4D0RA 3VOAA 3I6MA 5CBKA 1I3CA 4G86A 5K8VA 2ZRDA 1HFKA 1TU4A 4YPVA 5HFAA 2J7PD 1EP1B 4L50A 1KAHA 2WYWA 1JDZA 2ZOSA 5IASA 1FZTA 1B3RA 3Q8MA 3AV3A 2GBLA 3KZKA 4MA5A 3E9YA 3TZEA 4DVJA 2QY6A 2AG8A 4YJFB 1OASA 5FWXB 2ZJZA 1OBVA 4LX8A 4YCAA 4JASB 5COBA 1P62B 2IYOA 4GW3A 3BVPA 4MO2A 3RYHA 1VZ2A 1TZBA 1EUDA 4JODA 3A28A 3H1BA 1V3TA 1R8JA 2NQ8A 3UMCA 2F1KA 4FC7A 5FV7A 2CJFA 5JXGA 3KVNA 4HAOA 3OMLA 2PNFA 2R87A 2A0FA 4RX1A 3LJKA 5KNCA 1XDWA 3E15A 4ZC1A 3RAEC 2GN9A 3IJ5A 2VUTA 2WIDA 5BUCA 1EE2A 3B60A 1HE4A 5JYDA 4AURA 4BMVA 2GRAA 4B74A 1IQUA 1A7KA 2ESRA 3ZD6A 3GCGA 3KHTA 1F1JA 1AKNA 3L6BA 4EPYA 4MJ3A 5CDUA 2RGDA 5L51A 2I22A 2OCIA 4I46A 4CQNA 1E8DA 1L4EA 1OJLA 1ZI6A 2RI6A 3F3SA 3L1IA 4ZVVA 1PLJA 3IBFA 1Z4OA 4WKOA 4N8DA 3SZGA 5JMOA 5DN6D 3VR0A 2G9ZA 3BL6A 2GKSA 3OJWA 4Y1GA 5CLHA 3S2ZA 4DBVO 5D87A 5EJIA 3UV7A 5JRDS 3HABA 4B48A 1WU8A 4A8JA 4RA6B 1CR1A 5LVAA 2OO7A 1U2SA 3C3WA 5K0ZA 4XWYA 2IYUA 5AVOA 3BE5A 1KYXA 3H04A 1KZ9A 3K1AB 3P9YA 3MMXA 2VPWA 3BFPA 3FNRA 5AW9A 5F3WB 2HX1A 2PGLA 3DXFA 3QWIA 2IOFA 4JFRA 1EX1A 2I03A 4ED9A 3K0EA 1UZMA 1DUIA 1T5OA 1CZUA 4C29A 1KVTA 2XVYA 1ZH8A 5CURA 2WIGA 1G63A 2E1PA 4HWSA 4IYJA 3MTGA 5ER6A 5C5CA 4TUYF 2Z2IA 2J59A 2YFHA 2WPDA 1FRVA 1L9KA 2EBWA 2GF0A 4BO8A 3EH1A 4BEJA 1VE5A 3FWPA 1C8BA 2ZB3A 4HGZA 2WG1A 3AR4A 3B1XA 3IPRA 3QKTA 1S1CA 1ZZEA 1QBGA 1P7CA 2AR7A 4NBKA 3UMJA 4LVCA 2GBIA 3GEEA 3VH2A 1E6CA 4DLAA 5KVSA 4CI0B 4YT2A 3D2AA 3WQHA 2P1RA 3OCZA 4IG4A 3O8OB 4BO9A 1GYQA 3A2NA 3VDMA 1XZMA 1QFZA 4B3TB 1U3DA 4DSOA 2TECE 4DRXB 2MR6A 3CG4A 2C7PA 4R2WA 1UBKS 3C3CA 3QA3E 4MUAA 4CLOB 4KLZA 1O0SA 4X7MA 3HLYA 4RSHA 4BN5A 2A88A 4L8LA 1Z75A 3DEIA 4GLBA 2BVNA 2KLBA 5B3JA 2EX1A 4B46A 2CC2A 3ZGOA 4QUIA 4C7OB 4I4TB 1Q1AA 1QX3A 1W49A 3NGMA 3OUZA 4WOCA 4WPGA 2FWBA 3TGWA 3QM1A 1C3JA 1J2TA 1W2HA