4CR6A

Crystal structure of the n-acetyl-d-mannosamine dehydrogenase without substrates
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
261
structure length
255
Chain Sequence
GRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYEEPGAIPIACDLRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGARSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAMIFGGMREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLMANNOSAMINE 1-DEHYDROGENASE
publication title Crystal Structures and Functional Studies Clarify Substrate Selectivity and Catalytic Residues for the Unique Orphan Enzyme N-Acetyl-D-Mannosamine Dehydrogenase.
pubmed doi rcsb
source organism Flavobacterium sp. 141-8
molecule tags Oxidoreductase
total genus 87
structure length 255
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.233: N-acylmannosamine 1-dehydrogenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cr6A00
3PI7A 1MG5A 5COBA 5L4SA 3KLPX 1EVYA 2DVMA 2TMGA 5I7EA 1PJLA 3EGOA 2DBZA 3OJOA 3LC7O 4XYEA 2NUAA 1ISIA 1YOVA 3ZWXA 5KWEA 4Q3NA 4DLLA 3K8ZA 3NT4A 5CAEA 2VHVA 3NTOA 4E31A 4M86A 2BI7A 2ZB4A 4GMFA 3M1LA 3JQGB 4IZHA 3TJRA 4D0SA 5JNLA 1R0LA 4D79A 4P8RA 3ADOA 4FS3A 4D3SA 3OECA 1E5LA 1DRUA 1HYGA 4XGKA 5JCJA 3AUSA 4OHUA 2V7PA 1B3BA 4WECA 3UICA 4EBFA 2W8ZA 3GUYA 1NYTA 4DWVA 1R37A 2VHZA 1A4UA 3A9WA 3CPSA 5HWSA 3GG2A 4BO0A 1NFQA 1V3UA 2ZTMA 4TRNA 2FHSA 1HE2A 4E33A 2FZEA 5G2OA 4FW8A 3O4RA 1B2LA 1T24A 1LI4A 3RKUA 4WCDA 1IUKA 1WW8A 3PTZA 1JVBA 4I9UA 4PG4A 4UUNA 3DOCA 2VUUA 1Z7BA 3IMFA 1NFRA 1QXSA 4Z3DA 1KYQA 1K6IA 5I7VA 5A5EA 4HBGA 5TSDA 4CQLA 4JCOA 5JW6A 3CMCO 3HFGA 3W4KA 2I6TA 4NBVA 3S1LA 5TF4A 1EUZA 3FR7A 5ENVA 2HMTA 1DAPA 1WVGA 3INRA 1ISGA 5A4DA 3IL2A 4OGWA 4E5KA 1LLCA 2Y66A 4B4WA 2IZ0A 1TEHA 5FI3A 1LUAA 1MG0A 2BF7A 1VL0A 4JK3A 1WXDA 4HWKA 4EZBA 3EUWA 1J49A 4NDNE 5IDXA 3T4XA 2IZZA 4WGGA 4JIGA 4KOAA 1C0KA 4MP3A 3R3JA 5L7TA 4J4TA 4GLOA 1AGNA 1F8GA 1GUYA 3HDHA 3LQFA 1I2CA 3EZLA 2Z1NA 2Y0EA 4BKQA 3GN1A 1OZAA 4RZIA 1SB8A 1U5CA 3VH1A 4ZQHA 4LVUA 3U62A 5IFLA 2DQ4A 3GDOA 3NKLA 2J3HA 1GEGA 1SBYA 4FFOA 1GV0A 2C54A 1ZVMA 3PIIA 4I5FA 4CLOA 1H0KA 5LC1A 3B6ZA 1M6WA 3JD0A 3PHIA 3CEAA 4KP7A 3I3OA 3G0OA 3KRTA 2BGKA 1I3NA 2P9CA 1BTOA 3QA9A 2C20A 5JFOA 3H65A 3R0IA 3ZWYA 5ICMA 4IMRA 3PHLA 5A9TA 3W6ZA 5THKA 4XEHA 2OHXA 4YT8A 4BHTA 2BFAA 3ZV4A 4R01A 1KY4A 3KLMX 5EJ2A 4I8XA 4XA8A 3AI1A 2D2IA 3H9JA 2F00A 5JDCA 1GQ2A 1ZCJA 4N5MA 4F3YA 3DAGA 3MJ4A 1E7WA 4BGEA 1ZNQO 4YCAA 1I2BA 3W8FA 2GN4A 2BLLA 3DAPA 1BGVA 3DBHA 3GUCA 1NFFA 4K6FA 4WEOA 3IC5A 4FOSA 1E6EA 3JQDA 3OQ1A 5DOZA 3DHEA 3VTFA 4AJ4A 1PJ2A 5C37A 3Q6IA 4XIYA 3UKOA 3WGZA 3ZWOA 4UVIA 4B3JA 3OIFA 1RYEA 4J9UE 4Z6KA 2Y68A 1JTVA 1MC4A 2F1KA 1NWHA 4CV1A 3V2UA 4BO6A 3DB2A 4FFNA 3GDFA 3DXFA 1TT5B 3RCBA 3PEFA 2DT5A 1HSOA 3C3XA 3GGPA 1LSSA 3VPFA 3GOHA 1YKFA 3CH6A 4QSMA 1R15A 1R4NB 2NV6A 5KJ6A 2GD1O 4QO7A 4CMCA 2NU7A 4XCVA 1B16A 1Y7TA 4E0BA 4E5NA 3OF2A 3ZV6A 1ADBA 1DC5A 2Y1OA 3GHYA 3M6IA 2ILTA 4G2NA 4G65A 3S55A 1K6XA 1VKNA 5IG2A 3HB4X 3VPGA 1V0JA 1PR9A 4OQZA 1A27A 4CM6A 5TJ9A 1C1XA 2AEFA 4GVXA 4ITUA 3H2ZA 3JQBC 4A03A 1XIVA 2D1YA 3CINA 3U09A 4Y6RA 1QMGA 1R12A 3GVXA 5L95A 4GWGA 3T7CA 3AY3A 3Q9UA 1NXQA 3ZWCA 1ENPA 2PZJA 1I5RA 1HZJA 1ENYA 1K89A 1I30A 1WZEA 3AM3A 4IDBA 2D5AA 4G81A 4W82A 1EUDA 3IP1A 3PHHA 2RBEA 3C7CB 3NEPX 5MGBA 2PGLA 3JQ7B 2YHIB 4GKBA 2NU8A 2YHUA 3I9NA 2EIHA 1TT7A 4H3VA 5DT9A 4GBJA 4BKRA 2HMUA 4I1IA 3OHSX 4ALNA 2HLPA 2NACA 2YYYA 3DFZA 3HADA 4YVFA 3MWDB 5GY7A 3WICA 1DFGA 1PGJA 4TQGA 4OOFA 3OSUA 4AFNA 1EVIA 3PLRA 5JAIA 2HO5A 2Y1CA 1IZ0A 3BMQB 3ONFA 4L4XA 3WWZA 3RFVA 1B14A 4Y6SA 5BNFA 2VZ8A 4NNJA 4J7CA 3F3SA 2NADA 2OL4A 5L51A 4PLFA 3L0DA 3DZGA 5CEJA 3VKVA 1ORRA 2P4QA 4YBZA 1LC3A 2VYVD 1KVUA 2WYVA 1QV6A 4FGWA 1GYPA 5T64A 1EE2A 5BNIA 2Q3EA 4Y8VA 4FR5A 2DBQA 3JSAA 4E32A 4FB5A 4K26A 5TX7A 3EW7A 1PGPA 3IS3A 1G6KA 1W0CA 5TT1A 2GN9A 2JCXA 3OBBA 3LLVA 1F8FA 3SBOA 4W7HA 5BNTA 5HM8A 1GADO 1MFPA 1SCUA 4XYMA 1ARZA 3WIDA 5CEFA 4PVDA 5A03A 1HZZA 1GUFA 1ADCA 3H9QA 4XQ9A 4J49A 4M89A 4ZJUA 5A02A 3OQBA 4Q9NA 3RFTA 1E1LA 1NQAO 4PGFA 3LT2A 3L77A 1J4AA 1LRKA 4HNHA 2X1HA 4R9SA 4CR8A 2CFCA 3ZI0A 4QO8A 1YBAA 3GFGA 1J6UA 1UZNA 1YRLA 4J1NA 4BQRA 2C82A 4U5QA 1YB1A 4MVJP 1E1NA 4ID9A 2HMVA 1E7RA 5AYVA 3WGOA 4BNTA 4QQRA 4Y67A 5IF3A 5TNXA 1X1EA 1F06A 1T1RA 3HUDA 3GF4A 1HYHA 2ET6A 1XGKA 9LDTA 4WLOA 3ZNQA 3HQ4O 4N18A 4E3ZA 1PQUA 1U7HA 3WGTA 4LK3A 3AY6A 2Q2WA 4A2CA 4YT5A 2CVQA 3H8VA 1OI7A 2HSDA 3NDIA 3EY4A 1O5IA 1XEAA 4IDFA 3KVOA 5ENDA 1TXGA 1U4OA 1R0SA 1AE1A 3K5PA 3ROKA 1N7HA 2AMFA 3PK0A 2P91A 3ZWNA 3LK7A 1TLTA 4EEZA 2Y1EA 4FC6A 1DLIA 5KKCA 3UCFA 2IZ1A 1E3WB 4M1QA 2JD1A 2DPHA 1XLTA 5A3JA 1F14A 1UXJA 1O8CA 1PS9A 2PH3A 3OJLA 4KUEA 2X0NA 4RPKA 4UULA 4BMNA 4Q39A 2RH8A 4YA6A 4D43A 3P5SA 4B7UA 3ULKA 4AJPA 3JCZA 1PJSA 1VJTA 5L7WA 1MLDA 3MJSA 2WE8A 3STHA 4XRRA 1QORA 1P1RA 3JYNA 3F4LA 1GPJA 3E48A 1RYDA 3PGXA 4UEKA 2HRZA 1XU7A 3PHGA 3F6YA 2OMEA 4K28A 3JQCA 2NSDA 4J4HA 4RPLA 3I83A 2JFFA 5FYDA 1DIGA 5FFFA 5B1YA 1GL3A 2C2XA 3ZWWA 1M6HA 4YWJA 4RVSA 3ZHBA 2FR1A 1IOLA 2NVWA 5KVCA 3DMTC 1SEVA 3FSRA 2CF6A 3GNQA 4AJKA 3RUDA 3V1YA 3AI2A 2Y67A 1O94A 3GVCA 4WEQA 5EMHA 1YH3A 2PTGA 1JQBA 5JO0A 4CMIB 3M1AA 4IUYA 3V5NA 2H1SA 3PWZA 1JDJA 2GN6A 3C7AA 4R1NA 3T7EA 1DHRA 3WYCA 2JFGA 3UAGA 3I9OA 4IPTA 4B3HA 3WDSA 1RM4A 5TJHA 2X4GA 1H9BA 3QLJA 4OXKA 3ASUA 3DZFA 4BNNA 1EDOA 1YQXA 3GGGA 4I08A 2Y1DA 1ZSVA 2B37A 1VE9A 2O4CA 3PFFA 4K6CA 1U8XX 3JYPA 5KKAA 2SCUA 2JKVA 2A92A 4L9RA 4OKNA 3V1UA 4ONEA 1I01A 3ANNA 4FQ8A 2PV7A 1U5AA 2V65A 1BRMA 4W99A 4MP8A 5JCJD 2VOEA 4BNIA 3WWYA 2DBRA 3KOUA 3TRIA 3WQRA 1YBMA 3K92A 4DPKA 5KOIA 4YXFA 4L4RA 2QG4A 4PN3A 3S2IA 1YVEI 4ALMA 3AU8A 1ZFNA 1BHSA 3VZSA 2AG8A 5BSGA 2DAPA 1LDNA 3DBRA 1CYDA 3V1TC 2CDCA 4HFNA 4Z0PA 5HS4A 3PZRA 1U3TA 4M54A 1L1FA 1DIBA 4NPCA 4WNIA 4OOEA 3EVTA 2H63A 4CLRB 3AK4A 2VT2A 1G1AA 4DMMA 3ROMA 1BDBA 2O3SA 4TRJA 2ZB7A 1C14A 3UCEA 1ZJZA 3FF4A 5ILGA 1A5ZA 1JW9B 4AJ1A 2Q99A 4R68A 2GPTA 4J1TA 4BKOA 1PGQA 4BO5A 4ZQGA 1JLLA 4OKIA 2PD4A 4IQGA 5KJEA 2W2LD 4CV3A 1E7SA 2O23A 4I5DA 1C0LA 1EVJA 1LDBA 4MVJD 2OORA 3G79A 3JQAD 2OOSA 4WCFB 4Q3EA 1P77A 1YDWA 4KTTE 1YB4A 2VYVA 5G0TA 3RD5A 4ZICA 1B15A 4PLTA 3GN2A 4D46A 1YJQA 1T2DA 3GVHA 4R51A 3PJGA 4JBIA 4TRRA 1LLQA 3IJRA 5IJZA 5KVSA 1U28A 2FN7A 2D0IA 3N58A 3DBLA 4CL3A 4DRYA 5ADHA 5BT9A 2GZ2A 3FN4A 2P9GA 1M76A 2UVDA 3R1IA 1N9GB 5C3MA 1EDZA 5H81A 3UW3A 3WTCA 3Q0EA 3AUTA 1UAGA 2BRUA 2CVOA 3BA1A 4RDIA 2FZWA 4FIZA 3AM4A 3VZPA 1DFHA 4NJMA 4BNVA 3PYXA 1XHLA 4YJHB 1D1SA 2VHWA 1W8DA 3LC1O 3GA0A 4J0EA 3ZU2A 4BNLA 4U0KA 1IE3A 3JQBA 1NVTA 2JAPA 1SNYA 3WGHA 2WM3A 2EXXA 2B4TO 1WLYA 1Q0QA 2VHXA 4YTEA 1VRWA 5JDIC 1PQWA 4KMSA 4QFDA 3QE3A 4PZCA 4PLCA 3C24A 4QX6A 4F46A 2XAAA 2YFHA 3VVBA 2IRWA 1C1DA 2D4AA 4YQYA 1PS8A 4TRMA 5JMWA 1JAYA 1RKXA 1OOEA 1Y9EA 1CJCA 1HEUA 2W4QA 4OMUA 3W4JA 1UP4A 1NWCA 2HK9A 1JKJA 4YPOA 3WGQA 5JAQA 1EMDA 3GHHA 2DC1A 1ZEJA 2IODA 2W2KB 2VUSA 4JLWA 4XX0A 3IKVA 2O3RA 3B70A 3PP8A 3VDRA 4CMEA 4WNCA 3BHMA 3PYMA 5L7YA 1KOLA 3SEFA 1PGOA 1OMOA 3EK2A 2DTXA 4DXHA 2DKNA 3GG9A 4IMPA 1WPQA 5CG2A 1X1TA 3FNGA 1X7GA 1NHWA 2B5VA 3FR8A 4WLFA 1S6YA 1VKOA 6LDHA 3D3WA 1EE9A 2VRCA 1E6UA 4IJKA 4WUVA 5L3ZA 1J5PA 3GZ4A 5JC1A 2O2SA 1PJQA 2QRKA 3CXRA 3WQQA 4HKTA 2POQX 1LRLA 4AJOA 1I3MA 4NQZA 4ALKA 4BO3A 3AOGA 1T2EA 2C5EA 3VH3A 3ICPA 4GVLA 3ZWPA 4NFYA 3JD1A 3DWFA 3A4VA 4BV8A 1VL8A 3DAFA 3FPLA 3QHAA 4RZHA 3RJ9A 4HY3A 1Q7CA 2Z95A 2HCTA 2ZK7A 4WOJA 3WBBA 1WAMA 2ZIZA 4WLNA 4HNGA 1JAXA 5AXBA 2G76A 4ZHSA 5FEUA 2QRLA 5T57A 4ND4A 4XR9A 1X7DA 1AHIA 3FCOA 1SZJG 2O3UA 5CDTA 4Z9YA 2B0JA 1X0XA 4FJ1A 3H3JA 3D64A 5JY6A 4IBOA 3DEYX 4PLHA 4PIVA 2BD0A 3ZGYA 4BNYA 4XQCA 1U8FO 3RU9A 4RLHA 4PLZA 3G17A 2P9EA 5DBFA 1VSVA 1NX6A 1X14A 5BSEA 2EKQA 3KZVA 2GLXA 2NTNA 4RVFA 4A73A 2X23A 5L9AA 5B4UA 2RCYA 1R16A 1PJ3A 4F6LA 3LT4A 5JC8A 3EC7A 3U4HA 1NAIA 2NM0A 2NVUA 4Z0HO 1GTMA 5KVQA 3WXBA 1F17A 1H2BA 4J6FA 5ES3A 4R5HA 3K30A 3H2SA 2Q4BA 1WWKA 3ONDA 1HETA 1E7MA 3H5AA 3INTA 4R54A 3WGGA 1H6CA 1QRRA 5KNLA 4K1LA 4NFHA 4RV9A 1UR5A 1GCUA 4PG8A 1Y8QA 3VHRA 3WGIA 3OJEA 4H16A 3TQHA 3VC7A 4KWIA 3S2EA 1ONNA 4BO8A 4GPD1 4E5PA 3NJ4A 1U2DA 3HDJA 1DC3A 5IZ4A 2HUNA 4IJWA 5G0SA 4GWKA 5F5LA 4U8GA 1E7YA 2ZJ0A 3INGA 3DR3A 2JL1A 2ZCUA 3GVPA 3L9WA 4D41A 2B69A 1B26A 1HDZA 3B20A 3LT1A 2J5QA 4PVCA 3H9UA 1T4DA 5K0ZA 3TOXA 4FFPA 1SAYA 1GZ6A 2PR2A 3MTGA 4MIOA 5C5IA 1BVUA 2Z5LA 1J0XO 1N92A 3GEDA 3U4DA 2HDHA 4MINA 1X13A 3FTNA 2BKAA 3D4NA 1LSOA 1R66A 2X5JO 1R4MA 1UUFA 4CLOB 1BWSA 2DBVO 2XXJA 5EESA 5A9SA 5EINA 5KTKA 1O6ZA 2OBNA 3MJVA 1ZKMA 3WJ7A 4D7AA 1D4FA 5IDQA 4LRSB 1CDOA 4YT2A 1MP0A 3MWEB 2FSVA 2DUWA 2WJPA 3K96A 3GAFA 2X5OA 2J3JA 4R69A 3I9MA 3NRCA 1ZXBA 2VRBA 4RF2A 3UF0A 4XYLA 1HWYA 1Q1NA 2CD9A 1CQIA 2X9VA 1NP3A 2QW8A 1H6BA 4MP6A 2W2LA 1PIWA 2J3KA 1KEWA 2J6IA 4OO3A 4P22A 2BGMA 4GMGA 4U6QA 4MPDA 3C1AA 2YV1A 4MVJA 5A05A 2DFDA 4A5OA 3JQAA 5JYEA 5BSHA 3HDQA 3WBFA 1LJ8A 5EL0A 3DBHB 1SC6A 3AW9A 4TVOA 3RWBA 3JQ9C 4RLSA 1BW9A 4HV4A 1Z7EA 3OMLA 2V6FA 2C0CA 3HHPA 3O8QB 1QYWA 1WNTA 1A4IA 1LSUA 3DC2A 1ONPA 4IY1A 4N5LA 1FJHA 2H6EA 3DZJA 3ROQA 2YQ4A 3JQGA 3ETEA 1P33A 2DUUA 1GZ4A 4BNGA 4DMLA 1QYDA 1ZUD1 2NU6A 4GX0A 4R1SA 4OM8A 2BELA 2GGSA 2RIRA 3E5MA 4D3DA 2C5AA 3HDYA 3ZWBA 4MIEA 1V9LA 2NWQA 4JNKA 3D5TA 2BH9A 2Y93A 4J7XA 2E6UX 1DIHA 3OM9A 2E4AA 1XSEA 4XJSA 2NNLD 4AL4A 1KIFA 1F12A 2YW9A 4TZTA 4DIBA 1C1XB 1PJ4A 1GYQA 3RUHA 1HF3A 3MOGA 4J1SA 1N7GA 5KIAA 5DDIP 5JSFA 3RC2A 1E3IA 1D7OA 4LGVA 4LISA 3EMKA 2GCGA 4A10A 2AA3A 1YQDA 1MV8A 4QECA 1OFGA 2NTJA 3RBZA 5GZ1A 2GSDA 4BGVA 3WFIA 2Z1MA 4XYBA 4BNZA 1NQOA 4J1QA 4YRBA 2WD8A 4PFJA 4MDHA 3M2TA 2VHYA 5JE8A 4BO7A 4D3FA 3RC9A 1GD1O 5AXAA 1N2SA 1HE4A 3BTUA 5DN9A 4IGFA 5C7IO 5IZCC 3ZHZA 1BXKA 3ZZNA 2R2GA 3V2GA 1WDKA 3SJ7A 1EQUA 3RUEA 3WMWA 4RJTA 2G82A 3GAZA 1HTBA 2PK3A 3PWSA 5A5FA 4BUCA 1U1IA 2YDXA 1JA9A 1C3VA 4RVHA 1P1KA 2X8LA 1BXGA 3RSHA 3KYCA 4JJIA 4KWHA 5CFZA 1YO6A 3FWNA 4LMPA 3HNPA 2EGGA 3JD3A 4IXTA 4LVCA 4YJGB 3KBOA 3E5RA 4RQTA 5LDGA 2RHRA 1BMDA 1YE3A 3NT2A 2IXAA 4W9NC 5TRTA 3NUGA 2IE0A 1ENOA 1MX3A 1KS9A 1MFZA 2CNBA 4OAQA 2PKQP 3OP4A 2AQHA 1QKIA 1T2CA 3RC7A 3RAJA 4M49A 2OBYA 1B0AA 1LTHR 3DOJA 3OFSA 4CODB 3PQFA 3QVXA 3IQDB 4BKUA 2Q45A 1NQ5A 1E3LA 3OIDA 4E4YA 4OL9A 5I9LA 4DIFA 4EUFA 1XWFA 3H3FA 4BNFA 1HLDA 3LU1A 4BB6A 4DLBA 4B79A 4PCVA 2JHFA 4TKLA 4DTIA 1LLDA 3GR6A 3OIGA 1H93A 5JDIA 1SOWA 3BTVA 3QWHA 4R3WA 2WEKA 1M2WA 2ZB8A 1ADGA 4IIUA 2Y05A 1V8BA 2PGJA 4JP2A 4WCFC 2VTEA 4P4GA 1LX6A 1KVSA 1XG5A 1P1FA 2EP7A 3E8XA 3GPIA 4CMKA 1EFKA 4FPXA 1K6JA 3GC6A 4CPDA 1SPXA 3K31A 2HAEA 3OETA 5T8KA 3TDKA 3H9GA 4RCVA 3FPCA 1Z74A 2AE1A 1TT5A 2O3JA 4YJFB 4CLHA 3QVTA 2JD2A 5JYDA 1R4NA 4NR0A 4GH5A 1HSZA 2GASA 1A9ZA 2V6BA 4XB2A 4NHEA 4B4VA 2FOIA 1DB3A 4BVAA 5B4VA 3H9EO 4YAJA 1O9BA 2V6GA 3L4BA 4GKVA 1I33A 1Z73A 3CKYA 1CERA 3QV1A 1LNQA 2ZB3A 3JQEA 5G0UA 1ZMTA 5I9MA 1LDGA 5U9CA 4XB1A 3BTOA 3PXXA 1X7HA 2PZLA 3FD8A 4UUPA 1PSDA 4IS3A 2O3QA 3ABIA 4XYGA 1GR0A 4YT4A 4O63O 1ZK2A 2J5RA 5KJCA 1OAAA 4U6SA 1T2FA 3ZH2A 1IZ9A 4IGEA 3AWDA 3VPSA 4AJ2A 3AUAA 4BNWA 1IYZA 3HWRA 5LDHA 1UZMA 2HQ1A 3B1JA 2O2YA 2HRBA 3NDRA 5JLAA 1V3TA 4YAEA 2GF2A 1MXHA 2HKIA 3WB9A 4B3IA 1E92A 2VQ3A 4BNMA 2Q2VA 4ZN6A 4CM3A 1HE5A 4NBWA 2EERA 3CTMA 3FNFA 2OO5A 4U0JA 3B1KA 1ZSNA 4IJUA 4E5YA 4NI5A 3C1OA 3EZYA 3VZRA 5ILOA 1MXFA 1NQTA 3BMQA 4FCCA 1LA2A 3UGKA 4N5NA 2BFPA 2YY7A 4U7WA 3LT0A 4JJFA 4GGOA 1MC5A 3GRPA 3MOIA 4PLPA 1UJMA 4BQPA 4XDYA 3TOZA 2CF5A 4IQ0A 2ZTUA 5GMOA 3BMOA 1UH5A 2EKLA 2C7GA 2R00A 4MIYA 3TN7A 1WP4A 5A3VA 5HS6A 4DLAA 2E37A 4MVJI 4MKRA 4FGSA 2VRCD 4FN4A 4DYVA 4CM7A 1E1KA 4E21A 4FD3A 4H15A 1Q2XA 4EYEA 2EW2A 4MVJE 5KJ1A 4RF5A 1W4ZA 5I7FA 3PJFA 3X2EA 1X15A 1LSJA 1CETA 3HE3A 2J8ZA 5TQVA 2FPPA 1I24A 1DRWA 3VZQA 3PRJA 2FR0A 4R41A 3SJUA 5COQA 2VZ0A 3L4SO 3WMXA 3TSCA 2P5UA 3PYLA 4OJNA 3V2HA 3CSDA 5HTOA 4ZRNA 2OFPA 3RFXA 3ZN2A 4EJ6A 3VH2A 2D5CA 4S3MA 3E03A 3VAZA 2PWZA 2I9PA 3H7AA 1ZZEA 4CLDA 3GQVA 1ISFA 1Q0LA 5I7SA 1LDMA 1YL7A 3DHNA 1EBUA 4DYDA 1O0SA 1CEQA 3DZKA 5I8ZA 1EK6A 1PL7A 3BAZA 4W7IA 4WLEA 2AEJA 3G1TA 4GLLA 2EF1A 3JQ8B 3S8MA 3TNLA 1Q0HA 3VOSA 2I99A 1HYEA 5H83A 4FJ0A 6ADHA 5F1KA 4CQMB 4E2YA 3JTMA 1I36A 3BMCB 2C2YA 3FBTA 1BDMA 4YB8A 3LF2A 2VN8A 3G3EA 2A35A 4FBGA 4LSMA 2GERA 3DTYA 4X54A 4CR7A 3GVIA 3E9QA 2UUPA 2BHLA 3ZWVA 4GX5A 3U5TA 2EW8A 3WLFA 3CMMA 1E6WA 3DO5A 5CEEA 2X9NA 4NU6A 3KYDB 2EV9A 3NDJA 3OA0A 5GZ6A 2Y1GA 5T5QA 3IKTA 5CDSA 1DJQA 1T26A 2DLDA 1LEHA 2I5PO 4Z3KA 4H7PA 2QZ9A 2VYND 3WS7A 4D45A 2OXIA 4XGNA 4AJIA 4ZQBA 3TL3A 4EUHA 3KTDA 4INAA 4D42A 3NGXA 3OH8A 3O03A 3OJ0A 3WTBA 2GO1A 5JAZA 1TVEA 4CM4B 2A4KA 2P5YA 2IEBA 3UN1A 3JYLA 3ZU4A 4JBGA 4B4UA 3EHEA 3GT0A 4MKXA 3TZCA 4JN6B 1MUUA 2OP1A 2XF8A 1UAYA 3U4IA 1GCOA 2FMUA 2GZ3A 4J0FA 4YAKA 5IXYA 3PHJA 1ZBQA 1P1HA 4GL4A 5G4KB 5CDGA 1E1MA 3MTJA 1EZ4A 4KQXA 1JN0A 4GAEA 4NBUA 1PZEA 3RASA 3UXYA 1WZIA 1F0YA 4PG6A 4TVBA 1YXMA 5EIOA 5HRUA 1N1GA 1XA0A 1GFSA 5IN4A 3HZZA 1EBFA 4CMIA 2EGHA 3MZ0A 5T6BA 1L7EA 2I3GA 1I3KA 3WNQA 2JCVA 1EVZA 1E5QA 3P2YA 5F1OA 2BFOA 5ITVA 3WSVA 1JKFA 4DUPA 1PU2A 2PKRA 3CE6A 4JROA 3UVEA 1K2WA 1QP8A 2QYTA 1AHHA 3NAQA 4CMGA 4WJZA 2CSUA 5TT0A 4BMSA 4BS9A 3RUIA 5IZCA 3W1VA 2EEZA 2X9GA 1UDCA 4HFMA 4R1TA 3BHIA 3TFQA 1H94A 3V8BA 3NJ8A 3JD2A 3AOEC 3SC6A 1Y8RA 3QSGA 2AQ8A 3VDQA 2AQKA 3RJ5A 1UDAA 4UUMA 3I4CA 3D3WB 3TFOA 3NV9A 4E12A 3MEQA 5HBRA 4ND1A 3GFBA 1KETA 4TZKA 1VLLA 4LN1A 2CVZA 3FRJA 3NX4A 4UVDA 1O95A 2G5CA 4HP8A 1CIVA 5FF9A 3WIEA 1GUZA 4MOWA 4EW6A 4O59O 3GZNB 5EERA 2EJWA 3ZW8A 1HLPA 4J91A 3ZU3A 4TMFA 4A7PA 2VWGA 3RVDA 3SVTA 1HDRA 2GN8A 1DC6A 4XDZA 3ANLA 3BMNA 4TKMA 5JXWA 1DLJA 4OSPA 2BGLA 5CHEA 3HJAA 5JPIA 2ZJ1A 2YDYA 2VTDA 1D8AA 4CM1A 1LDEA 3GK3A 4PG5A 1V6AA 3UH1A 3H4VA 3IJPA 2Q1TA 5J23A 5TIIA 3PLNA 3ENNA 2PY6A 4J43A 5G0VA 1P0FA 4B7CA 1Y1PA 4P38A 4G5HA 1PJTA 4KQWA 1DFIA 2VT3A 3PZBA 3DZIA 1E3EA 3I6QA 4GX1A 2X6TA 3HFSA 2UDPA 3TZQA 2EWMA 1TA4A 1ZIDA 5IAAA 1IB6A 1E7QA 3ZU5A 1D1TA 2G17A 1EQ2A 3NT5A 3OICA 4EJMA 2QX7A 4WE3A 5F5NA 5L45A 1M67A 3P2OA 5BR7A 9LDBA 3TZ6A 1TI7A 4II3A 2NVUB 2WDZA 3OQ6A 4EUEA 3A14A 2NQ8A 1PQPA 3I9KA 4D44A 2FR8A 4P4NA 1N9GA 2PKQO 4UUOA 3E6AA 4M87A 4L0QA 4DGSA 1HXHA 4Q3AA 4O0LA 3ZWMA 1HDXA 1YOVB 4YACA 4BB5A 2D8AA 4CMJA 1DSSG 2DTEA 3DZBA 3F46A 1Y8QB 4BNXA 1VJ0A 2C7VA 3KUXA 3TPCA 3OA2A 1B8PA 3ADPA 2Y0DA 4BV9A 3CIFA 1H6AA 2XOXA 3IDSA 1QG6A 3ITKA 2AW5A 1DOHA 5JY1A 1NPTO 3GNTA 1AUPA 3QVWA 5EQFA 1VJ1A 4M55A 4XR4A 5FWNA 4PLYA 3TWOA 3UCXA 1QYCA 3JQ6A 2C29D 3F47A 4S1VA 4JQCA 5ER6A 5DP1A 4XIJA 4D0RA 4EDFA 1P31A 4FC7A 3UFXA 1RPNA 3WG9A 1KVRA 3D4PA 3KSDO 3SXPA 1KVTA 1XR3A 4OXYA 5DNAA 4EGFA 4HX5A 1R4MB 3BXXA 2P4HX 4ZGWA 2W2KA 3A06A 3WSWA 4OYRA 5A9SB 1ZK3A 1N8KA 5DBIA 1LU9A 3F1KA 3AU9A 2HK8A 4BO9A 2O3TA 3HN7A 4NH4A 4O1MA 1DO8A 1NBOA 1ISJA 1YQGA 2V6MA 3TF5A 5CDYA 1MB4A 1Y5MA 1YJ8A 2EP5A 4CQLB 1UXIA 5IN5A 1Y9AA 3QWIA 4EI2A 1NVMB 1YL5A 1HL3A 2NQTA 2NTVA 4C4OA 2YQ5A 5CG1A 1LRJA 1O89A 2XPCA 1MGOA 1PR3A 3ITDA 2Y1FA 1XQ6A 4LW8A 3JQAB 3LC2O 1LQUA 4E5MA 2VYNA 4PZEA 3U0BA 1ZK1A 3B1FA 3QY9A 3QWFA 4YEDA 3ANMA 1HDYA 1NPDA 1BW9B 5JO9A 5TS3A 2O7SA 4CV0A 3Q1LA 1H2HA 4Z0TA 5JAMA 2IYOA 4XD2A 3CUKA 3ZHYA 3L07A 5F21A 1QLJA 4FFMA 2AG5A 2GZ1A 1ISHA 4BIIA 4BNUA 3F5QA 3SLGA 2NU9A 4MVJM 4UEOA 4NFSA 4EEXA 4HFRA 4K9DA 3IOYA 4LRTB 2PGDA 2PA3A 1VPDA 1AXGA 1A7AA 2IYPA 1QLHA 2I3AA 4R9RA 3FNEA 7MDHA 5BQFA 1NPYA 4CM8A 4IIVA 4XJTA 3IP3A 1HKUA 2OZPA 3MJCA 4LCJA 1ZSYA 4URFA 4I5GA 2UYYA 4RORA 1XELA 2PLAA 2HMSA 4HFJA 4CM9D 1S7CA 5L4LA 4HADA 3DFUA 3RUCA 4CMBA 1RJWA 1D3AA 1ZEMA 1HE3A 3DMTA 2WD7A 4WOKA 2UAGA 4C7JA 4O6VA 5HA5A 1EK5A 4J7UA 4YAIA 3ZNPA 2VUTA 4I5EA 4IDAA 1XYGA 3P19A 1KY5A 3PDJA 3KO8A 5EPOA 2J5KA 3HB5X 2YJZA 5BSFA 3QVSA 2WE7A 3U3XA 2GUGA 3DDNA 4ZU3A 5IDYA 3KETA 1OC2A 4LSWA 4NG5A 3QP9A 3R3SA 3TZHA 3I9LA 3SC4A 1YBVA 5L53A 3SLKA 1DPGA 4J4BA 2IDZA 5TGDA 1X0VA 4UEJA 4L73A 4QXMA 4DA9A 4BNHA 3K6JA 1YB5A 1ENZA 1FDWA 3NTQA 1NNUA 1PZFA 2DFVA 1N1EA 4L74A 1ZK0A 2O50A 4LMRA 3OJFA 3Q3CA 4AJLA 3IIEA 1H6DA 1SOVA 1GV1A 1ULUA 1GY8A 3BIOA 4FSHA 4R16A 4L8VA 2JD0A 3RQSA 2WYWA 4UVEA 1BXGB 3HSKA 5F1PA 1HT0A 3KYCB 2VCYA 5KVVA 1GDHA 4BMVA 5JBIA 1ULSA 2AXQA 3ETGA 1JKIA 1NASA 3ONEA 4BO4A 1SB9A 3DZHA 2DPGA 4CUJA 3OEYA 4JX8A 4QFCA 1Z75A 2JJYA 1Y81A 2X22A 1U3WA 2CZCA 4YR9A 3WJAA 5AXCA 1R0KA 4KUHA 2AHRA 1ZXLA 1GU7A 1NR1A 3HN2A 2E49A 2PNFA 4ZQEA 1PWZA 2FPGA 4RO0A 1WMBA 3PWKA 1QYVA 5B37A 4JJGA 4J2HA 5THQA 4CMHA 4BGIA 5F3RA 2VWPA 3GMDA 2H5LA 2D3TA 3IUSA 3X2FA 4NBTA 2RAFA 4B4OA 5LCXA 3ETDA 3EDMA 1FXSA 3PFWO 2A94A 2J3IA 3JYOA 3R6DA 2Q4EA 1ZK4A 4Z9FA 2YV2A 2NVBA 4UVHA 1K3TA 2WYUA 3RC1A 3I23A 1K0UA 4XQEA 3NYWA 1YDEA 3O8QA 4C7KA 5JS6A 4TSKA 2QHXA 3KEOA 3W4IA 3N74A 1FDUA 1NHGA 1Y6JA 3LYLA 1P1JA 1KC3A 4RVDA 1RM3A 3E1KA 3F5SA 3MCVA 4XRGA 4BO2A 1XKQA 4MO2A 4ND2A 4BKPA 2CY0A 4RDHA 4DPMA 2FSSA 3DTTA 3JD4A 1ML3A 1PEDA 1ZMOA 1OBFO 2I76A 1Q7GA 4W4TA 1NVGA 3AFMA 3AOEA 3WLEA 5A1TA 4ESOA 1HDGO 3GEMA 4L75A 4Q3DA 3ZNOA 4DL9A 4NMHA 5AVOA 4ND3A 1ZJYA 3U4CA 1C0PA 4CV2A 5K6AC 4TWRA 4J90A 1Z82A 3I4FA 3GRKA 1A71A 1IY8A 2Q1UA 4GGPA 4YQZA 3I1JA 4CJXA 2BFMA 3L6DA 1QV7A 3FTPA 3ROPA 1E0DA 3ORFA 3KM0A 4KUGA 1RM5A 3ZV5A 4YAGA 7ADHA 3OEWA 2AEMA 1LXCA 3PQDA 2XXBA 1PJBA 2ZCVA 4IJVA 1YS4A 2BI8A 1PL8A 2JAHA 2OGUA 2PZKA 2CUKA 4DREA 4ZRMA 3KSUA 1DIRA 2QYSA 2VZ9A 3JQFC 2GDZA 4J3FA 4CQMD 5I9NA 2X58A 1GPDG 1T1SA 3RBVA 3RU7A 3PVZA 2FY8A 2B83A 2HU2A 2ZATA 1TB4A 3QVOA 1ZW1A 2EJVA 3WX0A 2G0TA 3GH3A 3COSA 2UV8A 4WLVA 1IPFA 1BG6A 3ASVA 4QEDA 4CMEC 4IM7A 3LDHA 4NU5A 1FF9A 1P3DA 5L40A 1GAEO 4YRDA 1PWXA 2O48X 4UREA 1XCBA 2EHDA 3BTSA 1ZO8A 4A0SA 4F45A 5A06A 4OH1A 1U2GA 2FPIA 4MJLA 3BMOB 2ZKLA 4ZQFA 4E2XA 3PJEA 4YJGA 4ROSA 3I6IA 2VWQA 1E3SA 3HG7A 3RI3A 4UAGA 3ZCXA 1JWAB 4E30A 1DRVA 5T67A 1G0OA 3RIHA 3K9QO 1U3UA 4MVJF 1BXZA 3AJRA 2BMAA 4R1UA 5ER9A 3KXDA 1GZ3A 3KV3O 4R5MA 1UXGA 4R3NA 5KJFA 1LC0A 1N5DA 2QZZA 3PJDA 3QIVA 4Y6PA 4Y9DA 2RH4A 5B12A 1CWUA 1C0IA 4DC0A 3LZ6A 3BZUA 3G1UA 4DPLA 3IUPA 3Q2KA 1B8UA 4JBHA 5H82A 3C7DB 3ICCA 4LCEA 4MVJH 3F9IA 3JQ7A 4J9VA 2YHIA 1T25A 2EKPA 2AE2A 2Y0CA 4J16A 5JMPA 4YYZA 5G0WA 4NBRA 1I2ZA 4CM9A 1JWBB 4BGUA 2C59A 3GY0A 2GRAA 1H5QA 4XKJA 4RVGA 4AVYA 4BO1A 3AI3A 1LQTA 2LDBA 4QUKA 3QJ5A 5COAA 3L6OO 3D0OA 2PFGA 4E2WA 2ZYDA 3Q2IA 3CZMA 3I52A 3D7LA 2B5WA 1T2AA 3VVCA 3VPHA 3U9LA 1KERA 1KBZA 3GPDG 4YJFA 1CQJA 4AJNA 4DBVO 2YZ7A 3M2PA 1A72A 4KDFA 1V3VA 2JCYA 4NK5A 4I9HA 5A9RA 1FK8A 3AFNA 4P4LA 4JP3A 1KEVA 5AOVA 1VSUA 3W6UA 3NGLA 1KVQA 3L6EA 3U49A 3WOHA 3FWZA 3QRWA 1FDSA 3KHUA 5ITWA 3G49A 3WGYA 3GLQA 3N7UA 4OIMA 4WKGA 2WSBA 4IZIA 1YONA 4BNKA 4CMAA 3PGJA 3BHJA 4OXNA 1YWGO 3VKUA 3I5MA 1E3JA 2Q1SA 2HK7A 1P74A 1QYXA 3LLSA 1LLUA 2B36A 3DMYA 3A1NA 2JHGA 3WR5A 1P0CA 2G1UA 3KB6A 4FJ2A 1ID1A 3DHYA 3MJEA 4ILKA 1YL6A 4Y98A 2YUTA 5EQDA 2GR9A 3A28A 4ZD6A 4DC1A 3ZWAA 2E82A 1XDWA 3K73O 5DCUA 4WK6A 1H9AA 5DCWA 1U7TA 3TZKA 3DBRB 3O26A 3PQEA 3Q9NA 3QWBA 4Q3BA 1CF2O 2ZYGA 4FFLA 4DQXA 1G0NA 5CPBA 1NTOA 4A26A 1JVSA 1Z6ZA 2HJRA 1UP6A 1KEPA 4BL5A 5C7LO 1IHXA 3AY7A 3VH4A 4QT0A 1NR7A 4IXWA 2ZQYA 4DQUA 1FDVA 2W90A 4RGBA 4PZDA 3ON5A 5A04A 2PZMA 2D59A 4GSLA 3T4EA 3GDGA 3BYZA 3RUFA 1UP7A 3JV7A 1PZHA 2WTBA 4DVJA 2E48A 1BVRA 3FBGA 2YFQA 4PLGA 1R6DA 2PD3A 2PD6A 4MKZA 3MJTA 1B3RA 3H5RA 1E3WA 4B8WA 3E18A 3JQ9A 1WDLA 2I65A 1UDBA 2IXBA 4DBZA 4FOOA 1QR6A 1WMAA 4GX2A 3L9XA 3ZHXA 1VM6A 5EN4A 3FI9A 1B8VA 1ISMA 3FHLA 4JXKA 2EG9A 1LBEA 3IAHA 4R4JA 1UXKA 1I8TA 3DBLB 1U4SA 1PTJA 2H9IA 2CDBA 2ZTVA 2VOJA 4YRAA 1DDOA 3K2EA 1Y8RB 4YJDA 2Q50A 3UUWA 4B8ZA 4KDEA 1GEEA 4XGIA 1IULA 1LDYA 2TMDA 2GNAA 3Q11A 4NJMB 5G4LA 4I9NA 4XQGA 2RHCA 3QWAA 4IDGA 3AUUA 3KEQA 2Q49A 3QW2A 4ND5A 2IEDA 4L4SA 4OSOA 2I67A 2I66A 1DC4A 4W6ZA 2R6JA 3FNHA 5IDWA 2UUOA 5JDCC 2X0RA 4IDCA 3KYBA 4GI2A 3JQ8A 2ZQZA 2WWRA 3ZV3A 4CLXA 1NM5A 4NIMA 3DOOA 4CQMA 1XU9A 3D4OA 4WPGA 1PGNA 3BMCA 3K2BA 4GQAA 1A9YA 1K5HA 1C1DB 1I3LA 4O5OA 4AJJA 2X0JA 3ENKA 4N7RA 3DONA 1V35A 1IHYA 2QIOA 3BMNB 4CR6A 4KTVE 1UZLA 4RPJA 8LDHA 1DHTA 4ALJA 1Y5RA 3O9ZA 3E9NA 4UVGA 3I9JA 3D1LA 2OUIA 3RKRA 3UHAA 1PL6A 1SO8A 2B4QA 3KYDA 2P2SA 1IL0A 3F1LA 3GGOA 3PPIA 4WLUA 4EJ0A 2QRJA 5TC4A 1EEHA 4CLEA 5AQ1A 4DIOA 2NLOA 1FDTA 4CUZA 1RM0A 1VC2A 1A7KA 5DCYA 2PH5A 3QQPA 4HUJA 3PDUA 4F6CA 1DXYA 1M66A 2FRDA 3TL2A 1HDCA 4BNJA 2GYYA 2A9FA 4WASA 1W73A 1P44A 4KZPA 3KSZO 1WDMA 2P68A 3GEGA 2O4UX 1VL6A 3GMSA 1HRDA 3RROA 4IQ8A 1SEPA 4W9NA 4CM4A 4NZ9A 4L76A 1P45A 3AM5A 3UOGA 5K9ZA 1KEUA 5DULA 2JFHA 5I8WA 4RF3A 2Q46A 4IS2A 2CDAA 3WYBA 1W6UA 4E6PA 5GZ3A 3RUAA 2Q2QA 2AQIA 4YDRA 4AICA 5MDHA 2C07A 5DP2A 4CLRA 5K6AA 4PRLA 4GSKA 4RF4A 3ZNNA 3E9MA 3EYWA 5G4KA 1SMKA 1I0ZA 1KC1A 2B4RO 3P7MA 1RWBA 1DBVO 4TROA 4RL6A 1EFLA 5JCXA 3W8DA 4PRKA 4M8SA 3D3EA 1CRWG 1NAHA 4RPHA 3O38A 4IDDA 3EVNA 2X86A 1M75A 3JYQA 1I10A 4XZ3A 4WCFA 5DOVA 3JQFA 4AG3A 2B35A 3DBVO 3H5NA 3C85A 4QTZA 4RPGA 1PZGA 3S2FA 3D5QA 1U3VA 3LF1A 4J2OA 4RVUA 5DBGA 5DF1A 5T8KC 4CM5A 1B7GO 2VNSA 5B4TA 4ZA2A 1T4BA 2QQ5A 4IDEA 1Q7BA 5L4NA 1OC4A 3NTRA 5CP8A 1P9LA 3WNVA 4BOYA 5C7OO 2FWMX 2O7QA 3VPXA 5IXSA 2ZTLA 8ADHA 4E13A 1UXHA 5U1PA 2FP4A 1GYRA 4ZVVA 1DIAA 2OP0A 2WMDA 1ZH8A 2YV3A 4Q3CA 3W8EA 1VI2A 2X7HA 3LVFO 2HMWA 4PG7A 4IINA 1Z45A 2X0IA 1JU9A 2LDXA 2CMDA 1DAOA 3L4BC 3SX2A 2X5KO 1ONOA 1PX0A 4YJHA 4OQYA 4AJHA 2VNAA 1L7DA 3C1TA 4CL8A 3ZDFA 1QSGA 1DEHA 1GQYA 3F4BA 1MA0A 4HXYA 5KCZA 4E2ZA 1FMCA 5CDUA 4AJEA 1PS0A 3EAGA 3WYEA 3H6KA 3DQPA 4NK4A 1PJCA 3DL2A 1IPEA 3GZNA 3WFJA 2DM6A 5FI5A 4FFRA 5CPFA 4A27A 4NJOA 4JGBA 1ADFA 1HDOA 5TLSA 1E77A 3GNSA 2HJSA 4II2A 3E82A 2VWHA 4FDAA 3S2GA 5ICSA 4Z9XA 3VTZA 3RBXA 3LSYA 1P1IA 4RQUA 2W98A 4ALIA 3CZRA 2Y99A 1AN9A 4CM8B 4PLWA 5DZSA 2DTDA 4DQVA 3ZW9A 3PIDA 1BSVA 4MVJG 2DU8A 3ST7A 1GQQA 5AXDA 2ZYAA 4EITA 1YGYA 4CUKA 1DJNA 2WD7B 3C8MA 1U9JA 1XQ1A 2Q1WA 2R00C 4XWYA 3WQSB 4PLVA 1I32A 4N54A 5U4QA 4B7XA 1AXEA 1EUCA 4ALLA
chains in the Genus database with same CATH superfamily
1JYSA 3WYGA 2YTZA 4I3GA 1O1YA 3HKCB 5COBA 5L4SA 3MYRA 4OGKA 2TMGA 3EGOA 4FYXA 2DBZA 4GI3A 1GFWA 1AS3A 3MTQA 4XYEA 3KD2A 1KK1A 4TV8A 2EKDA 1CUUA 2NUAA 1TCAA 3PFHA 4H2DA 1A8SA 1XVIA 2ASEA 4TQ9A 1TQ2A 3G8DA 4YP5A 3NT4A 5CAEA 4G26A 1SM4A 2G04A 1Z62A 4L4YA 2GD0A 4E7OA 2QLBA 3U3RA 3IQIX 4D0SA 4F93B 4D79A 4P8RA 2C2MA 3UC5A 4KH1A 2NU6B 1C9EA 5TQ2A 4BZWA 2PPVA 3LUAA 4JU9A 1ZRHA 4QYMA 5KYVA 3CPHA 2V7PA 1GGFA 3HB9A 1TM5E 2IGTA 3BKWA 3DC7A 1N34B 2V58A 3JAWB 1ZXXA 3WRWA 1OU0A 2AK3A 2W8ZA 1H2EA 1EGAA 2GZDA 1ESNA 4BKMA 5CDFA 1NIJA 1XRMA 2VHZA 4D56A 5EHXA 1X3LA 1ZM4A 4W1SA 3IXLA 3PXGA 2A9JA 4AG5A 2H29A 1TA9A 4EHAA 5HWSA 1MGPA 1AKVA 3KZOA 4V24A 3CN7A 4EZEA 4BAZA 2BAGA 2XKJE 2FZEA 4BEJA 4Z4QA 5G2OA 1WJGA 3DT6A 1ONBA 3B89A 1AKEA 2OFOA 3E7WA 1QHFA 1T24A 1UJ5A 3A6LA 4FXPA 5KBYA 2HZ7A 3KIPA 5BN3B 3NHAA 1FP4A 4RA6B 1XZIA 3CV3A 4I9UA 4ZO7A 4C0LA 4UUNA 1QIEA 3DOCA 2VUUA 5DHPA 2V3WA 4MR9B 4BJ3A 3EOZA 5FA5A 4KFCA 3IOEA 1TU4A 2Q3BA 2VH2A 1RKUA 5B2ZA 5JQGA 4CQLA 2VS1A 4ZHQB 5JW6A 4MLZA 3EZ2A 3RG2A 4EBBA 3HFGA 4UEWA 1C4KA 4UMVA 3EJWA 2QPAA 3RB8A 4CG1A 4QPPA 2YX1A 3FR7A 1X7ZB 3GLRA 4Q1EA 4ZODA 1IY2A 2ZRCA 3CRZA 2HC9A 4OUDA 5A4DA 1DRJA 4HDCA 4RPIA 1JQ3A 2PGNA 4E5KA 2NYAA 4CEHA 3HCCA 3B8HA 1J07A 2BF7A 2XMGA 2GETA 4OREX 2IHZA 4G37A 4JK3A 5FI3A 4NBNA 4HWKA 3VV3A 3GO4A 1V1RB 2JBHA 1N7IA 4NDNE 3T4XA 2IZZA 4WGGA 1FS5A 4ZVSA 1J5EB 2BFFB 4FTWA 1HUQA 4NCAA 5FLEX 1XD2A 5CB0A 3WP0A 2G5PA 3L4EA 1JI0A 1V26A 1CB0A 2AZ4A 3A6GA 1JQLB 4GLOA 1KQOA 3D6JA 3EFEA 3KWMA 4XOIA 3FRIA 3S3TA 1BU5A 1PJZA 5DASA 2PX4A 1OZAA 3F0TA 5LU8A 1IRIA 1HV8A 3NAZA 2G0AA 3UGTA 4F6RA 4LVUA 2FQQA 2Z6UA 4DR4B 3WB1A 2I29A 4CEJB 2QORA 2J3HA 1GEGA 1SBYA 3NKLA 3L92A 1N0HA 1QH1B 3GPCA 3VAYA 1SXJD 2JH3A 4MV6A 1E4YA 3VR3A 3CLUC 3FETA 4JJEA 1PWYE 4QA9A 4RYLA 4KP7A 4S2UA 3OPQA 3SEQA 3TLXA 9ATCA 2FQ1A 2HTFA 2D06A 2DLNA 3B13B 3ADCA 3HB0A 3G7SA 2FUEA 4PAGA 4ZI5A 1EWQA 3W6ZA 1NOIA 5BPFA 4XEHA 2HWUA 4BHTA 5GONA 4U7TB 2PX3A 3KLMX 1MX9A 1M7GA 1T3GA 4P93A 3ZU6A 2YINC 4MRNA 4DWOA 4F3TA 2F00A 5JDCA 4JY7A 1GQ2A 2XCSB 1XJCA 2VZEA 3W9UA 1ADJA 1BQEA 3MJ4A 5F1YA 1Z26A 1E7WA 2QQ0A 4O33A 3NHZA 4ZT5A 1RXYA 3LWDA 5SY6A 3SSAA 4BGEA 4A1OA 1Z0KA 3PGA1 2A7QA 2BLLA 2JG3A 1A95A 1BGVA 2WNHA 2X9LA 3CLSD 1BGWA 3OHPA 3DBHA 1NFFA 2QD3A 3MVEA 4Z5XA 4WEOA 2CWWA 2VAVA 3DCYA 4ASUA 5AVKA 4GKAA 5ECWA 4F5ZA 1T9GS 3VTFA 1PR0A 3TLYA 3Q6IA 3UKOA 4LHXA 3WGZA 4LJSA 3ZWOA 5K4GA 5CLQA 4QM7A 1H9CA 1F4VA 3HCEA 3FMIA 4J9UE 2DLCX 2Y68A 4B84A 1MC4A 3PX2A 3E1SA 2J85A 3OM1A 4HAXA 3V2UA 1QP0A 2PAAA 1AUQA 3DB2A 4FFNA 5TPZD 3FWHA 3DXFA 3TD2A 4G4SO 4V38A 1Z35A 3PEFA 4QUBA 2XWQA 1RQPA 4NAHA 1G2OA 1YKFA 2OV3A 4QSMA 5LYJA 4AMZA 3NALA 2BRUC 5KPDA 4IJ6A 1QE0A 4QO7A 1AGPA 2ECQA 3O3NB 2NU7A 1V9CA 1B16A 2WR8A 4GICA 3KQYA 3T1YB 3OZBA 1N6RA 2Z8ZA 4HNAA 1WCIA 3L8HA 5EE5B 1JIUA 3PTAA 4R6XA 1TVCA 1QAMA 3BFKA 2QKYA 2DB3A 3PWTA 1A5TA 2RHGB 4R8RA 4BNDA 1XIVA 4S1OA 5SY4A 1CU1A 3TE6A 4BE9A 2WJZB 4U1RA 2LV8A 3T7CA 3AY3A 4YMSA 3Q0TA 3RLIA 4KC0A 4A2PA 1S8OA 5AM3A 1N2CE 1ENPA 2PZJA 2R6FA 1I5RA 3FPKA 1HZJA 4KAXA 1N7JA 4KQHA 1L5FA 1PWEA 2VTKA 3SYKA 1EUDA 1ZY2A 3ZHQA 4HNRA 2FTKE 4NECA 2RBEA 3NVKI 5DI9A 4GP9A 1R8XA 3H8JA 3ORSA 1RYYA 3AG5A 2HLDD 4RKRA 4QD3A 5J2UB 1JQEA 1W46A 2PSEA 3A10A 1INLA 1QZZA 2WFAA 2ZSDA 3OESA 4NBSA 5TQ0A 2NU8A 1I7DA 1VGQA 3BWDD 1R27A 4JOSA 3DMHA 5H8WA 1E98A 1CUCA 1J8VA 2X8JA 5DNWA 4I2VA 4I1IA 4YV2A 1UKBA 2YWXA 2YYYA 3HADA 2GOYA 5ALZA 3KSMA 1JJIA 4YVFA 3DL4A 2CDNA 3MWDB 5GY7A 3ZS8A 1RC8A 1U3FA 3COYA 3OLZA 1PGJA 2HF7A 1PUJA 3OSUA 4YRPA 4AFNA 3OPMA 2GJ9A 3I1FA 2HO5A 3JRNA 2Y1CA 3D9QX 3ONFA 1PZNA 4N6OA 2G4CA 4LI3X 1YA6A 3WWZA 4M1WA 1EVKA 4PXAA 1OKKA 2AR0A 3N2LA 1BX3A 4K6GA 5GOZA 4TZ0A 3THXA 2ZJ7A 3PFIA 2JGJA 2ZJAA 2DQKA 2NADA 4Z99A 2IH4A 1NQUA 3FNRA 1JDZA 1T9HA 2OK7A 5CEJA 2H2FA 1ZS9A 2R85A 3INNA 4ND8A 1LC3A 4L8LA 2J9ZB 1Z0SA 1QV6A 3TXYA 1GYPA 1YZTA 4WOCA 2XCTB 1E8NA 3OFVA 1V5EA 4WIAA 2WIKA 5HIMA 2DBQA 2OY0A 3JSAA 3KT0A 1GG5A 1HG0A 1P5HA 4P34A 4E32A 3EW7A 1PGPA 3IS3A 3QLUC 2X4LA 1SUDA 3UHPA 2GN9A 1VXOA 1ZGZA 2H8GA 1F8FA 1FMJA 3P0FA 3RYHA 4W7HA 2YIVX 3NTVA 4NU0A 4RD4A 4ZI7A 1JJ7A 4TT3D 2B4YA 1HYQA 2ADOA 4JZKA 4OHFA 3IV9A 1USKA 2FPPB 4WUTA 521PA 2FZGA 3BIXA 4MWDA 2XMBA 4PVDA 1HZZA 3EJ6A 2ZYSA 2C96A 4WJKB 2YMLA 3CLHA 1I3CA 3FA2A 4C0SA 4OFWA 3OKPA 1VLQA 5ESRA 2OCGA 4W5NA 1JNYA 3K1AB 2CLOB 4AY2A 3L77A 1J4AA 2JH9A 1L4UA 3BERA 2R97A 1SA0A 5KTNA 4TXLA 3CF4A 4IQ4A 4QJBA 1EFCA 1UC5B 2CFCA 2HXSA 5BR4A 3HXQA 4Z49A 4R1MA 2Y77A 4R7TA 4GNKA 1J6UA 1FUYB 1UZNA 2A5FA 3QUCA 2QPLA 4ZAVA 1IEWA 3ISJA 5IBQA 1XMVA 2JATA 3TAUA 4AKEA 4KHPB 1E2JA 3D6NB 1XXHB 4AZVA 4RANA 3W1WA 2MHCA 3TDNA 1J42A 4CKBA 1A2QA 5CDFE 1F8UA 4CBVA 1QS0B 2RJNA 5AUPB 3ZY6A 5HJ5A 1E7RA 1UK6A 5DBHX 2QRMA 1QPZA 1MW9X 3H13A 4OXRA 4B32A 5IANA 4UJ3A 3WL4A 4Y67A 3OAAA 4IV0A 4Q9AA 4BO9A 2Y6UA 3KU4A 2XYHA 1R0XA 3GF4A 2ET6A 1PBTA 3ZNQA 5H70A 3VO2A 1HA3A 1LY1A 4N18A 5LQSA 4DV7B 3V2IA 1HNWB 4JKIA 4DDKA 4AWXA 2DUNA 1XVLA 1V45E 1CT9A 2WM2A 4YT5A 3DT8A 3H8VA 1ZD8A 4I99A 4ZHQF 2PEZA 2V7QA 2Z9CA 2ZPTX 2R7NA 4MUNA 5ENDA 1T34A 1G17A 3LYHA 3UOWA 1CLEA 1Z5UA 4UHBA 1FVFA 1R0SA 1ZONA 1L3CA 1GZDA 1N7HA 1JP7A 1UJ4A 3LI2A 3PK0A 3NAMA 3TI7A 3TOVA 2P91A 3I01M 4P80A 4BPBA 2H48A 3ZCTA 1HT1E 4UPEA 3EPLA 4KWTA 5HOQA 5KKCA 2IZ1A 1E3WB 2X3YA 4QGBA 4TL8A 2DR3A 5ALLA 3RE1A 4PSUA 2AN9A 3T8YA 4A16A 1XLTA 4QTTB 2O8EA 1F14A 1QH8A 3O8BA 1PS9A 2AJBA 2DSNA 3E22A 4MUXA 4RETA 5KQGA 3DVSX 1O57A 3IIIA 1LPPA 3CS3A 3KKPA 4PAMA 4B3GA 1BFDA 2BCEA 4Q39A 4YA6A 1KDZA 4P7BA 3P5SA 1EA5A 4I1UA 3TPFA 4AJPA 4YLYA 1VJTA 3GELA 4U9UA 2F1HA 1RYHA 1CBUA 4TWBA 4ZYVA 2WE8A 1YFZA 4L16A 1QORA 1OSNA 1P1RA 3QF4B 4PRYA 1CQPA 4Z2YA 3F4LA 3E48A 5INTA 3ZDCA 3O3OB 3PHGA 1Z83A 3GJ4A 2FLVA 4G8DA 1XVAA 4K28A 2NO7A 4CQJA 4FNAA 5JCOC 3KQUA 3RYTC 2ZJ4A 4D6YA 4DCVA 1RFGE 3UK1A 4DT1A 2OLJA 2JFFA 4LG1A 3TBKA 2NXNA 2WP0A 3P45A 2O2GA 1GT91 2FEMA 3TI9A 4B46A 5B1YA 1R5JA 2C2XA 1SXQA 2C9CA 1W36C 1EFPB 2Y1KA 4MRMB 1BAPA 2LKCA 4YWJA 1YR6A 3E7DA 1ZCZA 2W48A 3IOMA 3ZHBA 2XXAB 4L08A 1GL6A 3QELA 2HT6A 1SEVA 2IIPA 4D5GA 4MRVA 3TVYA 3NTUA 4E14A 1E0JA 1YKGA 3PE4A 1MU0A 5EJMA 4MMYB 4PZLA 3AIMA 4X20B 3UK2A 5EMHA 1YH3A 2F17A 2I4IA 2PTGA 3S2UA 3SOPA 4IFBA 1ECCA 1C30B 4JWKA 4IUYA 3SXJA 2CMKA 3T06B 1BD3A 2Q9UA 2X2FA 3GIWA 2OM2A 4TKUB 4EOGA 5LQNA 1V2HE 3JVVA 5TY0A 4B6PA 4ZJPA 2Z4TA 5C3UA 4UTVA 2JFZA 4HAUA 4MGYR 3TLMA 1OBCA 3I9OA 2P67A 4IPTA 6Q21A 3UJ9A 1G8GA 2X4GA 4RGQA 3CZPA 4BAGA 3QLJA 5ALUA 1D5CA 2FNAA 1WQ4A 1FFYA 1XBTA 3VI4B 3DZFA 3RTDA 4HPXB 1EDOA 1YQXA 5AHKA 3HCAA 4ZVMA 1VE9A 4IUDS 1K4MA 2GEDA 5KKAA 3EASA 3P0JA 2JKVA 3UHJA 3C6XA 2GEFA 2D1TA 5REQA 3TGLA 3OZFA 4ARUA 3OQJA 3AF0A 2GUWA 3WGNA 1WKCA 2PV7A 4HPWA 1WUJS 2GTHA 4LY3A 4TTIA 3IVMA 4BQIA 1JR2A 5CM9C 2DBRA 4FGZA 4CIXA 2E4YA 3H16A 2WHRA 1Y80A 3IXMA 5E7MA 3VGPA 5KOIA 4QASA 1GHTA 4QFBA 4OHYA 3TS1A 2QG4A 1Q3KA 5B1IA 2JIOA 2GXUA 2JCSA 1VYVA 1BDJA 3COJA 4PY2A 2IWHA 1VDMA 1ORWA 2PVCA 3AU8A 1V5FA 3BCUA 1UKZA 1E3QA 1HRKA 1PFQA 3L7YA 4QPNA 3VZSA 1BMFD 2DAPA 5BSGA 2C2WA 3IBYA 4ER7A 3AKYA 2RGUA 3WRVA 4BVBA 2Q0QA 4HAIA 2CDCA 4HFNA 4CT5A 2JB9A 3PZRA 5DNCA 4FFWA 4M54A 5BSKA 4IOLA 4BCCA 3MJFA 2EQ5A 3KHTA 4JI7B 1A9PA 2QN8A 5EE0A 3ND6A 2CLMB 1VB5A 1IJKA 2OBXA 4BFLA 1D1QA 3BFJA 2LZ0A 2CXSA 4HPJB 5J2UF 1YJAA 2EG5A 3LUDA 3AHGA 3R5JA 1N2BA 4UM5A 3ROMA 3RS7A 3X44A 3UMBA 4AZ0B 4JMPA 3ZGOA 2ZB7A 1ZCAA 5EKTA 3UCEA 1G64A 1JTEA 3FF4A 3PD1A 4GEGA 4JEIA 3MMPA 4DJJA 3HXLA 3UNXA 2DPMA 2PD4A 5KJEA 2HX1A 3D8RA 2O23A 3P0EA 5JI2E 4U7PB 1OIWA 4NCXA 3BBLA 4C0HA 3VYTB 4NV3A 3G79A 3VU9B 1GXSB 2O2DA 2R8ZA 2BEUB 3L6RA 2JLSA 2F2TA 4HB3A 4LF7B 4P33A 2OC4A 2H7CA 2VYVA 3HCNA 3FKQA 3LDFA 3N2YA 2BM0A 3IA2A 2YN0A 3KTOA 3AKEA 3EGXB 3B36A 4PTZA 4US1R 5I9TA 5HRAA 2HGZA 2WINI 1GCIA 2NZ8A 3QVLA 5TPWB 1T2DA 3PJGA 4WNAA 3CVOA 2OB1A 3HEBA 3IJRA 3OPVA 1QIJA 2JEOA 2XMPA 3N58A 3GJ6A 3DBLA 3GPLA 2RJOA 3Q9SA 5ADHA 4RQAA 2P9GA 1FMLA 1M76A 2BFCB 2UVDA 5TMPA 1EDZA 1UFVA 1XDUA 5CB4B 1UAGA 1OHHA 2BRUA 2Q4DA 4JB2A 2IP2A 2VPWA 3NIGB 4LI0A 5FPSA 5A7GA 1Q3TA 4RJLA 4U7GA 4PGMA 3K9BA 4GRDA 1IHOA 5D01A 3VM6A 2P2ZA 1SHKA 5BSTA 3BRCA 4AQYB 2Q7OE 3CR8A 2V1UA 4YX9A 4YJHB 4L95C 1ZOOA 1TQ8A 3DNPA 3LC1O 4B48A 4DB2A 4BLSA 2BHSA 1DKNA 5C4GB 2OUKA 2WM3A 3F6EX 1O9HA 2A30A 3TIIA 3K9FC 5I4IA 4KBFA 2B4TO 2UUCB 4J03A 5H4HA 3EXG1 3FGNA 1Q0QA 3QI2A 1VRWA 4XIFA 3O95A 3EGCA 4GE0A 2J6BA 4DLUA 3C24A 3NIDB 5FUYA 2XAAA 3VVBA 5JQWA 1C1DA 4Y1GA 3T5GA 4XVUA 2VPYA 3A05A 5JMWA 1UJ2A 4E1AA 2Y71A 1POXA 4O8CA 1MJGA 3N2ZB 4MB2A 4D4JA 2EDCA 2XADA 1FL9A 3JVIA 3R44A 4NCHA 1EFAA 4L8YA 2OAEA 4NJEB 3EZGA 1XZDA 2KHZA 3M6LA 4BMCA 1NWCA 5AM4A 2C58A 2HK9A 2JFOA 5ADUS 5JAQA 5K0LA 3OEED 1EMDA 4BZXA 3CNHA 1TRHA 3C3KA 4AX4A 2DC1A 1ZEJA 4LQDA 5BSWA 4X65B 4JVMA 2IX9A 3FPHA 3VNUA 1IHPA 2X15A 3CKMA 3ZWDA 1J5XA 3NEJA 3SEFA 3UJNA 1HT3A 5LBIA 2Z57A 3AVWA 4ZCTA 1YDFA 5AKKA 1P9NA 1QPGA 5JG7A 4LF5B 2I22A 2ZT7A 1P60A 2DTXA 4DXHA 1EK2A 1M2VB 1VHJA 1WU7A 1U1EA 2DKNA 4Q5IA 4YMWA 4IMPA 3V9PA 3K2IA 3U44B 1X1TA 1GRVA 3A9CA 2JI6A 3FNGA 1X7GA 4ZEXA 2O1XA 3ELYA 3FR8A 1VKOA 4KSYA 3D3WA 4LZJA 1HK7A 5JC1A 3U4MA 1J5PA 1GAQA 1Q7EA 2A8YA 3GZ4A 5JYBA 4MRRA 4QL3A 2O2IA 4HKTA 1FXWF 4RK7A 1U7PA 4AJOA 4AMVA 1CHDA 4E51A 1I3MA 4NQZA 4TTQA 1ZP6A 4TTRA 3AOGA 2YVAA 1MB0A 3E3AA 3G88A 1Q44A 3VH3A 3TLGB 3D2LA 4GVLA 3TLJA 4PBTA 2H1LA 3S5JA 4UQLA 2P65A 3WXMA 1Z34A 2CHEA 3NBUA 2ZTHA 4MI9A 1AQJA 3FTDA 3FPLA 1DJMA 2ZK7A 1Q83A 3O31A 4K03A 2O0MA 3ITNA 4GM1A 1CCWA 2VHUA 3DM5A 5FEUA 2GM5A 1CNMA 3OZAA 3AJAA 2WSYB 3P71T 3R7AA 2W6JA 2O3UA 5FUQA 3ZH9B 5DGCA 1T8SA 5JY6A 4LE0A 4UM7A 1KOGA 3A2LA 3IA7A 4PLHA 4QELA 3RREA 5FBZA 3G0HA 2BD0A 3J81k 1KI1A 2TECE 2CVFA 2OO5C 3TRJA 1H66A 1ITZA 4NMXB 1U8FO 1CULC 1FUKA 2NO9A 2WWIA 1JDBB 4FHFA 2NNWB 5DBOA 1QDUA 5J1TB 4BJHB 2IH2A 1U65A 4RTNA 3F2IA 3R3WA 4I2NA 2VA8A 4MDEA 5JEEA 4IFEA 2BBWA 3TR5A 1VL1A 2Q6VA 2V96A 2FG7C 4UE3S 1TW2A 1AK1A 5I7OA 5SZIA 3LO8A 3U6KA 1W93A 2RBKA 4E70A 4OFZA 5TXGA 3GLUA 2RMKA 1Z6XA 2HJGA 5CLJA 5KHOC 5L9AA 4DDTA 1YS2X 2FHPA 3HV2A 4RD6A 5KTOA 3NI2A 1R16A 2WF7A 1PJ3A 1T8UA 3QBVA 4EA7A 3HGTA 2XYVA 5EXTA 3O8CA 4Z0HO 5D3ZA 3B51X 1MHTA 1C50A 1H2BA 1ORTA 2MSEB 1UIMA 1QGZA 3DOUA 3UKJA 1XYYA 1L4EA 1WZUA 5E1BA 2H2HA 1R3UA 4R5HA 2Q3CA 4UXHA 1I0LA 4B7XA 4R54A 1T43A 3GLKA 3INTA 3WGGA 4F11A 3U56A 1QRRA 2DHQA 4YQEA 3PDHA 3B2EA 2G63A 3FMPB 3P26A 4RV9A 1X7XB 4Q7KA 1Y8QA 3LKDA 1OVGA 4Y9UA 2KI5A 1MPTA 5FUVA 5B6IA 4ZEVA 2XI4A 2XUHA 3F6BX 4OKSA 3S2EA 5AVRA 3NJ4A 3WY9A 3GJQA 1Y4SA 3FX2A 1DBRA 4FYJA 1FRQA 4IJWA 4GWKA 3DM9B 2V7GA 1XVTA 2X19A 2XZDA 2YWBA 3L9WA 2ZCUA 3GVPA 4U8GA 4CW7A 4IEEA 1C4OA 1B26A 1FS4A 1EFUA 1HDZA 2OPBA 3B20A 3EARA 3IDFA 5K03A 3F6SA 3M6VA 3KTAB 5HP4A 1R0RE 3G0GA 5F12A 5A3QA 1Q1BA 1XTKA 4PNHA 3WK7A 5K0ZA 3AV3A 3MTGA 2B4KA 4MIOA 5C5IA 3L1HA 2Z9BA 1Y37A 1J0XO 3DEIA 3AFGA 3GEDA 4C4XA 5T4EA 4M8KA 4YMIA 2BKAA 3D4NA 2PTHA 3D02A 4H4DA 5FQOA 2YIMA 1BWSA 2J9YB 5HF8A 1OXXK 2DBVO 3IBSA 2SHKA 3ZY4A 5IK2A 4FCWA 1RZVA 3N2IA 5JARA 1O96B 3PT9A 4R81A 3MJVA 2JAUA 1ZKMA 3TLCA 5IDQA 1FU4A 3ORQA 2GZMA 3VNSA 1TKRA 3SS7X 1MP0A 1X38A 3MWEB 5KSPA 4JLKA 5BWCA 4D2IA 2ZPUA 2IXGA 3K96A 5FV4A 4RMIA 2RKWA 3DE5X 2E7ZA 2ZSHA 2HA0A 5EPUA 5FL3A 2VRBA 1BMQA 3D59A 4AI6A 4XYLA 1QHSA 2CD9A 4URWR 4XI9A 3OTHA 3TW4A 1DPFA 1SPBS 3VOTA 3IIJA 5JJKA 1YJBA 1U0TA 2OXEA 2IYZA 3QEJA 4OO3A 2ID9A 2XDQA 4L4ZA 5ARCA 4U6QA 4EHKA 4LNUB 3C1AA 4MVJA 4MRPA 2VP3A 3MMXA 3CBQA 1ZI6A 3WB2A 2IUSA 2LW7A 3KQSA 4FLEA 3V4RA 1OW3B 2EFYA 3AUFA 3AR6A 3WBFA 3G85A 3HKCA 5EL0A 5K4AA 3A1SA 3DQQA 1O54A 2UZIR 4RJ2A 4OHPA 4QVKA 4YC7A 1P2SA 1XZKA 1PSZA 4Y2GA 3BB1A 4WHMA 1ONPA 1T3HA 1ZIPA 2WT9A 3E7XA 4BMYA 1L4GA 2MR5A 3C14C 4MX8A 2RG7A 4X1KB 1FJHA 3CTPA 3LBNA 3R7DA 3H4MA 3AJ9A 4JBWA 4LBWA 1CS0B 3EF1A 3ROQA 3V1MA 5CD1A 3QE9Y 3ETEA 4MLDA 3HU3A 1DKLA 4YRCA 5FWXB 1AGYA 3CVJA 2YFKA 1PTJC 1VIVA 2GBGA 2HHAA 2NU6A 4GX0A 5BOSB 5KNCH 1BJTA 4HDQB 4ZPXA 2XEDA 2GGSA 2ZIAA 3E5MA 1ELOA 3EEIA 1PT8A 4NQRA 3L04A 2QL9A 5KI6A 4D3DA 1B23P 3G9UA 3HDYA 3JAWA 1TRKA 4DFDA 5CB4F 4MIEA 1JKXA 2VK2A 4LXGA 5ALJA 3ZLVA 4JNKA 3D5TA 3EEBA 2CNKA 1SUEA 4KLNA 4OM7A 3QVJA 4PW0A 1OXKB 1DIHA 1NR5A 4IIJF 4P7GA 3T3IA 1VCOA 4GOJA 2AMVA 1N2JA 2HJWA 1JLHA 3FLAA 4OP1A 4DIKA 5E1DA 1GYQA 1JSCA 3RUHA 3A9VA 3L0BA 3Q4GA 5JNUA 2HREA 3RF6A 1Z8DA 1LW7A 3FVVA 2QWXA 5DDIP 4D9HA 5HKBA 3HA7A 4DUYB 3NM5A 1D7OA 1U8YA 1YTUA 1SN7A 1JZSA 3EMKA 2L17A 2I34A 2GCGA 4A10A 2AA3A 5BN3A 1HNNA 4RA6A 5DI3A 2OXFA 2XDYA 4QECA 3RBZA 2YC4C 3QJGA 4QUJA 4Z51A 2RONA 1O94D 2GSDA 4MR9A 4QUAA 4HDSA 2Z1MA 1XCLA 2QU8A 4O2RA 5CK4A 5I7UA 3ZGVA 4ZZ0A 4FHGA 2EWVA 5IHXA 3MTAA 4ZHQA 2CV1A 3O9VA 4JLPA 3M2TA 2VHYA 3FFXA 5T6MA 5JE8A 2UZ1A 5JCPA 2C57A 1YI0A 2P11A 3UY4A 2EHJA 5A4FS 5AXAA 1N2SA 1ZGBA 3BTUA 1CFJA 1R0WA 1UBFA 1TCCA 5KQPA 3BXGA 3EY9A 4CKYA 2XMRA 3ZHZA 2VIIA 2GWHA 2HY7A 4NSNA 4AUMA 1D03A 4RXTA 3L46A 4F2WA 3AVTA 3ZTTA 1ULZA 1EQUA 3AILA 3LLMA 3RUEA 4X45A 3SJ7A 3NVMB 3WMWA 3I5YA 4F5WA 1HTBA 1CVRA 1ZGAA 4A8PA 1EQAA 1GZVA 1P73A 2QY6A 4P7JA 4RZQA 2BFFA 2EX1A 3PWSA 4PPNA 1YF3A 1WVIA 2NN3C 1V2GA 4RVHA 3ICQB 3NFYA 1MC1A 3NOXA 2X41A 1PK8A 3QXCA 2JLUA 1GPYA 3BWEA 2J31A 4RW0A 3V80A 1U31A 3FWNA 4LMPA 3W5JA 2WWWA 4LVCA 2ZWMA 1VG0B 4QOJA 3VJMA 4BDSA 1WZCA 4AG6A 3WMEA 2PUDA 2R7MA 2ASVA 1FFWA 3HPQA 2EU8A 3O75A 1YE3A 3K0BA 4W9NC 1A1SA 4E7PA 2Q6KA 1LZLA 1ZD1A 1Y4UA 5KZMB 1QH1A 3JZMA 1RWKA 1XO1A 4XWAA 5DTJA 1XZNA 1MX3A 2LBPA 1ORDA 1WP9A 1KS9A 2QX8A 2WTXA 3V1LA 1JFSA 2WPDA 1N2ZA 4YGXB 2AQHA 3TJZA 1QKIA 2HCRA 3SNKA 5A5GA 4B9EA 4Q9KA 4M49A 3RAJA 1RQ7A 2OBYA 4QDXA 3UXHA 5K3EA 1WL8A 1B0AA 3M6MD 1SCUB 3OMWA 1NZJA 4P3OA 5JSUA 3UQYS 3EEQA 3OFSA 3PQFA 3CT4A 4LE2A 3BZWA 3IQDB 3AQ4A 1OWOA 3WLJA 3OIDA 1FVHA 5AD1A 3ETHA 4FMDB 4OL9A 5I9LA 1X1QA 4DIFA 2E5LB 1UZAA 3T1QA 2OAQ1 3H3FA 3CVYA 3DJYA 4DLBA 1ZISA 5E7QA 4BB6A 2JHFA 3OIVA 1LLDA 1SHZA 3PXEA 5FR1A 1KDPA 4AM8A 2GLTA 2QROA 4R3WA 1KTVA 1JFFB 1M2WA 3H2BA 1XUOA 1YS9A 4GZ5A 1ADGA 3GXOA 3PDWA 4KV9A 4YRFA 2I9KA 2OSBA 2ZVQX 3TRDA 1YI8A 4I9GA 3LS2A 3VTAA 1XG5A 4EP1A 3GPIA 3HDVA 4H60A 3HGMA 5FUXA 1CPYA 1SUIA 5L8VA 3GC6A 1X80A 2WILA 1NLFA 2VRNA 1SCJA 2IOFA 3UYLA 3ZIAD 1YTLA 4J7AA 3EZ6A 5T8KA 4ZVOA 4QPCA 5IKPA 1EGHA 2GX6A 4RCVA 1FNSA 1Z17A 3FPCA 4UQPA 1EFTA 1B41A 4H18A 3PBKA 4J8PA 4C3OB 3FHTA 1CQJB 3VSCA 4G5OA 4Z7OB 2R1ZA 3CEMA 3PEWA 4M0CA 1A82A 2BSAA 2E4XA 4IKOA 4XB2A 5JWHA 3NS7A 3AF4A 2ZUWA 3PCTA 2FOIA 2RHDA 1PI3A 4RAOA 4RY9A 1ZM7A 3T0IA 4LWQA 1WKBA 1QHEA 1P4SA 4FYKA 1DVRA 2NO6A 3ZOKA 1O9BA 2V6GA 4ZV7A 1IZ7A 1GQSA 1LCIA 1NZDA 1PLKA 2UYOA 4MKGA 3IAFA 3IBTA 3PGKA 4NS1A 1CERA 3AYXB 4ATNA 1KZGB 2ZB3A 5G0UA 3OEHD 2JFXA 3L6UA 4X71A 1TX4B 2A1UA 2PZLA 3KPUA 1P4HA 4XYGA 1UT8A 1BRTA 1UQTA 2YY6A 4OQDA 1W52X 5HZMA 1O95D 1T2FA 2I03A 3UBTA 5EKSA 4H3SA 1NKTA 4GOND 4JC0A 3AF1A 4DV5B 2BP7A 2HCBA 3AWDA 4NVRA 4AJ2A 4BNWA 2HQ1A 2ATCA 4BRWA 2W6IA 3DV9A 4B7AA 5J2UA 1GITA 2ABWA 2AN5A 4JVOA 4YI5A 1U0RA 2VEDA 2GF2A 1GILA 3D6UA 4JZYA 4ZVNA 5C8DA 2SICE 4UOZA 1NYLA 2VQ3A 1H65A 4GOOD 4YR7A 4N4AA 2Q2VA 3HY4A 3GZJA 3VA7A 1ZH0A 3LHKA 4U39A 3ZHRA 2ZYTX 3BL5A 3FNFA 2OO5A 4LC0A 1GKYA 4U0JA 2H92A 1Q0TA 5A0VA 4BBPA 3B1KA 3W78A 4HOYA 2MOKA 4JENA 3ROXA 2A4MA 2MSLA 2R2AA 4E5YA 3D3QA 2R751 4NI5A 1R6VA 4XFJA 4GDFA 4CF7A 1FTNA 1SVNA 5THXA 3CUWA 4DLRA 1HE1C 1LA2A 3IP8A 3H75A 3LT0A 1BKYA 4JJFA 2WUWE 3UB2A 2A5LA 4LDJA 3GRPA 5K3FB 2CF5A 4IQ0A 5GMOA 5IJ0B 3UAOA 1GSOA 2PDAA 5H7XA 3CGGA 4YCNA 4MIYA 4RZSA 2UYCA 1WP4A 1RXCA 5A3VA 3UYKA 2QL6A 3MTDA 1GT6A 3O0TA 4MKRA 2ZZMA 1TAQA 2Y92A 3KS9A 2B8TA 1U0FA 2JLBA 3AEQA 4CM7A 4EYEA 3PC7A 1O5TA 1V11B 4M9QA 5E1MA 4JYAB 3OCJA 3MT0A 4MVJE 5KJ1A 4RF5A 4QYXA 4IFTA 5I7FA 3W7VA 2OLKA 1VBFA 1ZHOA 2RGRA 2VPIA 4CDMA 1PRYA 3T7TA 2FPPA 3M83A 5TMEA 3E05A 3SJUA 4UHCA 4MCHA 3K16A 4N9WA 2BM9A 4ANFA 1XTBA 2P5UA 3GJ7A 3IIMA 3V2HA 2CXTA 1D9ZA 2OFPA 2IKSA 1Q3HA 2WMOB 1R00A 4EJ6A 2HJVA 1GKUB 1R6UA 3ABQB 3RRBA 2H4ZA 4G0UA 9GPBA 3FUCA 4S3MA 3K1AA 5ENZA 3UJBA 2IA5A 3WMRA 1JDBC 2I9PA 4CI9A 2HQBA 5CVCA 4IIEA 3S1AA 4YY3B 6REQB 1XA3A 1YCDA 1K8ZB 3WOHA 1USGA 4AKGA 3EMBA 1G6Q1 3GNLA 3HRHA 4K8RB 1EBUA 1IK4A 4GPBA 1CEQA 3KJHA 1XXHA 4B3FX 1EK6A 1PL7A 3BAZA 3UAVA 4C7BA 2P4EA 3R3UA 4LJ6A 4DRXB 2AT1A 3MRSA 1E9FA 2G80A 3L8FA 3DFMA 2JLQA 3F4KA 4GLLA 2AZDA 2EF1A 1Q11A 3PV0A 3QVGB 3WI7A 4DA6A 2V9ZA 1AKTA 1V8DA 3DE4X 1QE3A 3UANA 5TF0A 4CQMB 4E2YA 1H3FA 1P2DA 4ZK6A 1COWD 3VJRA 1POWA 1DQSA 4S24A 4B8YA 5AESA 1BD4A 2A9KA 2X0EA 3P9XA 2AI1A 5EMJA 3VC2A 4EVIA 2SBTA 2VN8A 2GERA 2CD7A 5LIPA 1CR1A 1YHYA 5HIAA 1OI2A 1MX5A 3CLRC 1ZNZA 3QPUA 4GX5A 3U5TA 2EW8A 1C1HA 4FFBA 3CMMA 4OYHA 4YI3A 2X9NA 2CZGA 3KYDB 4NMMA 4U2KA 5GZ6A 4HDKB 2C8KA 2Y1GA 4F3CA 1X77A 5T5QA 4D3YA 4PFSA 4RD3A 2P78A 2DLDA 2F9MA 1QH9A 4QJ4A 3OZUA 1Y0BA 1BXRB 5ALNA 1JG6A 2UZ3A 1NC3A 4N01A 5FRDA 4JUAA 2GCPA 1PFKA 1FTSA 3N3BC 4BYMA 4ZQBA 1FFAA 2NX2A 4WWHA 3JSXA 4EUHA 5EJAA 5HUQA 1Z9BA 1X70A 4H7FA 1RLUA 1KFEB 1F6WA 2ZR7A 4KNWA 3ZLTA 4BUJA 1EFVB 4DY6A 1GM5A 5JAZA 4M8NE 4FDLA 2TRSB 4CM4B 4BCBA 4KMMA 3AIOA 4NZMA 2G36A 4TN5A 3OE1A 2P5YA 4JBGA 1YR8A 3ZHOA 4KAFA 1BJRE 2QE6A 2AFIB 2R65A 4MKXA 4PTLA 3OM8A 3KQKA 1EFPA 1U9YA 3U4IA 1AA9A 4MRMA 4YAKA 3BSYA 3H6GA 4HH0A 5DM70 1W44A 1I7PA 1JQAA 4O29A 2C77A 5CDGA 5H16A 3L41A 1THMA 4FHDA 4X7RA 2V0NA 1CE8A 1SK8A 4ZMSA 1ZLXA 3PNKA 1RXUA 4DMHA 2YBDA 1ULBA 4FMDF 1G8JA 4TVBA 1YXMA 3I5AA 4QBFA 4BCDA 1U2TA 1XA0A 1I1OA 1GVHA 3P52A 4X20A 1AKYA 3STXA 4F3KA 1UC9A 3HZZA 1EBFA 3ICWA 4ZOEA 3TB6A 3OY7A 1C30A 4PFQA 3DUWA 3FTFA 2FKAA 1EE1A 4WVFA 1FEZA 4TKUA 1QGAA 1OT3A 4O08A 5J9FA 1KPIA 1YC5A 3WLKX 3R6TA 3TUIC 1EVZA 2PG3A 3NUZA 5F1OA 3LIPA 3LWBA 3D1JA 3WSVA 5B7QA 3KP1A 2XQGA 4TWZA 5ITVA 1YAHA 4DUPA 4KIWA 1JKJB 2XUJA 3FWKA 4Y6QA 1K1EA 5FUBA 3AHIA 4TYWA 1DUVG 4YMUA 2IEAA 1QP8A 1MENA 2PJZA 5LKRA 3NAQA 2HRQA 4KK4A 3LBFA 4WJZA 4ZVRA 5TT0A 2JAQA 3RUIA 2OKGA 1Z5OA 2EEZA 1UDCA 3TFQA 3LA6A 1M1ZA 4FB4A 2NG1A 2YYAA 3KJQA 3SDSA 1T8YA 4AZSA 3FDJA 3JD2A 3Q3IA 5DWQA 1Y8RA 2W2XA 1J09A 4MTCA 1DO2A 4ENQA 1V8PA 5EIXA 1M2KA 3RJ5A 5KB3A 3AQIA 3G82C 1MO3A 2Y4NA 3HABA 4MW5A 4QDZA 4UAJA 5ALRA 3TFOA 3NV9A 3SZGA 1I6LA 5GV7A 1KHHA 3MEQA 5HBRA 5KYUB 1GZUA 1QKJA 3E3OA 3FRJA 2QL7A 3CZCA 4UZEA 4HP8A 2PM8A 2BKEA 2D0DA 3THOA 3IBFA 3IUQA 3PNYA 3WIEA 4EW6A 4ZYYA 5EJ9A 3ZJ5A 2QYHA 2W2TA 3LCMA 5EERA 4UUAA 4OQQA 2X40A 1YB6A 3WHPA 3JARA 5CFPA 1JFRA 3ZU3A 1ZUHA 3FFWA 1YNOA 3B1VA 2LKDA 3SVTA 2A9RA 2GN8A 2ZJZA 4LX0A 5E6SB 3STVA 3SY8A 4XDZA 3ANLA 2I54A 3GRVA 2NV2B 3FCSB 3HZOA 3QU9A 1OV4A 2BGLA 5CHEA 2JGLA 2BVNA 1OTHA 2YHBA 4PF1A 1SUPA 4AD8A 1RABA 2QTLA 1ONSA 4GL2A 4AZ0A 1V6CA 4HH3C 2XWSA 4R2LA 2XGMA 4PG5A 1PV2A 1S0UA 2Q1TA 2Y1LA 5J23A 3PLNA 3TW6A 3J7AC 1UBNA 1WMFA 4EMSA 2JCGA 3D3KA 3ENNA 3VU3A 3B3QA 2PY6A 4ZAWA 2EF0A 4L0DA 3DMNA 3ZJ4A 4D8WA 2WKSA 5AR1A 1LPAB 2O2HA 2VT3A 1GPAA 4FD2A 1GXSA 4L3OA 3PZBA 2AI2A 1E3EA 2BEUA 3DZIA 5HF9A 1MAVA 3F3YA 2UDPA 3N2EA 1XZPA 2FW1A 3E27A 1I1HA 1ZIDA 5E2AA 4CKEA 3ZU5A 3EGXA 2G17A 1K27A 2JGDA 3QE0A 5TPWA 4EJMA 3UWSA 3HKBB 4TM7A 2QX7A 4WE3A 5F5NA 3P4UA 3MJDA 4A0HA 3P2OA 2WJVA 5BR7A 9LDBA 1UAAA 3GFPA 1EUCB 2XY4A 4QKQA 3PUHA 4UM9D 5AM2A 1EP1B 3A14A 2GXQA 3ZYZA 3U7HB 2BFCA 4P4NA 2L69A 3IERA 3M3PA 4M7WA 3C5EA 5IASA 2ODAA 3E6AA 3IP7A 4M87A 4L0QA 1YCGA 5CNIA 3G5TA 5IULC 5J4LA 5KYKA 1HDXA 1YOVB 4YACA 4II7A 3TMYA 3R7LA 2D8AA 2E1PA 2AR7A 3D7NA 5AUOB 4RK0A 2C9BA 1VG9B 1VJ0A 1JF8A 3BCHA