4CR6A

Crystal structure of the n-acetyl-d-mannosamine dehydrogenase without substrates
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
261
structure length
255
Chain Sequence
GRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYEEPGAIPIACDLRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGARSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAMIFGGMREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Functional Studies Clarify Substrate Selectivity and Catalytic Residues for the Unique Orphan Enzyme N-Acetyl-D-Mannosamine Dehydrogenase.
pubmed doi rcsb
source organism Flavobacterium sp. 141-8
molecule tags Oxidoreductase
molecule keywords N-ACYLMANNOSAMINE 1-DEHYDROGENASE
total genus 87
structure length 255
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.233: N-acylmannosamine 1-dehydrogenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cr6A00
4AJ1A 3KYBA 1JAXA 2JKVA 4CV1A 5ILGA 2C07A 3VZQA 5BNIA 4J7CA 3VKUA 1ID1A 1FDSA 2EF1A 1DSSG 4W99A 3WYCA 3VZSA 4B8WA 1GCUA 1VM6A 4L75A 3OSUA 4DMLA 2AXQA 4BNMA 5K0ZA 3TN7A 2PLAA 4FBGA 2C20A 2VTDA 4YXFA 1YBVA 4E21A 3GLQA 4B3HA 3CINA 3RUFA 4I9UA 3DTYA 1QYCA 4R3NA 4D0SA 5IZCC 3CPSA 2NADA 3JD3A 5G0SA 1R0KA 1U2GA 1IL0A 4TRNA 1C0LA 4N54A 4F46A 5COBA 3HUDA 4GGOA 2O7QA 3OHSX 1EFKA 2X1HA 5I9MA 3LT1A 4ROSA 1C0KA 4NG5A 4J9UE 2PNFA 1KY5A 4XA8A 4LCEA 3I6IA 3EUWA 2Q2VA 2ZJ0A 1BXZA 1GTMA 2O3TA 4QUKA 2JL1A 3C85A 5A05A 5A9SA 1VKNA 1ZSVA 3NJ4A 3ZWYA 5BQFA 4O5OA 1EQ2A 4YQZA 3JQEA 2VT2A 1Q7BA 1PJTA 1E1MA 2O2SA 2X0RA 2QZZA 2UUPA 1NVMB 2VHWA 3PYXA 1ONOA 3G79A 5K6AA 4NU6A 4F6CA 2CY0A 4R5HA 1I32A 3ONEA 3ONFA 3QJ5A 3LLVA 4LVUA 1E3LA 1OC2A 4IJKA 3WFIA 3RIHA 1CQIA 4XR9A 4H15A 4WNCA 4OXKA 3WNVA 1P1RA 2DT5A 1UXJA 4GAEA 3OH8A 2YUTA 1T2CA 3N74A 3F46A 1R0LA 4CR7A 4BO9A 3GA0A 3HADA 4OIMA 2ZB3A 4XCVA 5ITVA 3PWZA 4PLHA 1Y9EA 3VKVA 2XAAA 5THKA 3RASA 1KVQA 3UH1A 4PLCA 1PTJA 2QRLA 3AOEA 4IQGA 4CUKA 4CMIA 4F45A 4YRDA 5ENVA 2G5CA 4Q3CA 1NVGA 3T7EA 2B36A 2Q3EA 5FF9A 3W1VA 4L8VA 5EPOA 4BO1A 1UDAA 1HL3A 1GEEA 1NASA 3AK4A 1HDGO 3JD4A 4OGWA 4UVHA 2PGJA 1KS9A 3WS7A 3LVFO 4DGSA 4N5NA 3DZBA 5F5NA 3EZLA 3QHAA 3D3EA 3H5NA 2B5VA 1N9GA 5CG1A 3IJPA 5JO0A 1B3BA 4Z9YA 4F3YA 1LTHR 3SLGA 1A9YA 2RHRA 4IY1A 3BMCA 1Z73A 1EQUA 4UAGA 5J23A 1Z82A 3C7CB 5TJHA 3PHLA 3GMSA 1HE5A 1XLTA 2B0JA 5F5LA 3IOYA 3TOXA 1XR3A 5C5IA 2VZ0A 2F00A 1YONA 5IJZA 3PJGA 4J1TA 3RU7A 4AICA 5L7TA 3ON5A 1DFGA 4BB5A 2PZMA 2JCVA 4P8RA 4D7AA 3H9GA 1E3SA 1P9LA 4NHEA 3GY0A 1ZKMA 3OECA 1WPQA 4MKXA 3WMWA 1CIVA 4QFDA 4NBWA 4U5QA 1TT7A 5A5EA 5TS3A 4ZRMA 3WTCA 3FPCA 1GPDG 3ABIA 1YWGO 2V65A 1HDOA 5JCXA 2ZCUA 2VZ9A 2GDZA 2DU8A 3R6DA 1NAIA 2W90A 1OMOA 5CFZA 2AG5A 3ANNA 3N58A 4PLZA 4FB5A 2R2GA 1M67A 1CETA 1UJMA 1FDVA 2BGMA 1BRMA 1ZZEA 1NFRA 1PQWA 3DB2A 1BWSA 1GYPA 2XXJA 3E1KA 4H7PA 5LC1A 2D8AA 3ADPA 2V6FA 3BMQA 3NDIA 4CM8B 2DAPA 1VJ1A 1YBMA 3B70A 4IJVA 3C1AA 1AN9A 1IZ0A 1E1LA 4PZCA 3UFXA 4K28A 1M6HA 1N5DA 4Q3BA 1ZK0A 1DLIA 1JKJA 2EW2A 3UHAA 1N7HA 3F6YA 5BSEA 5GZ1A 3TZQA 3UN1A 1IHXA 2I65A 3LT2A 3D5TA 2Q45A 1R0SA 4XRGA 4D42A 3NAQA 1BGVA 1PJSA 4JJIA 3JQAB 3KO8A 2VWHA 1LNQA 2JD2A 4LCJA 2DBQA 3MTGA 4PLYA 4A73A 1IUKA 3DQPA 4MOWA 1Y7TA 1QV7A 3WG9A 3WIDA 3IS3A 1WDLA 3H8VA 3MWEB 4QSMA 3C7DB 3S2GA 1YDEA 5EMHA 5HM8A 1J5PA 3RVDA 2FPGA 4OAQA 2WMDA 4IDBA 2IZ1A 1LDYA 2HAEA 4CLEA 3MOGA 1PJCA 2B37A 4DC0A 2EW8A 3HJAA 2W8ZA 1GADO 4MVJM 1Y5RA 3Q6IA 4WCFB 3A9WA 1NNUA 3D5QA 4I9NA 3OJEA 1P1KA 2BGKA 5BSGA 3LC2O 3GZNA 4GVXA 1ZXLA 2D1YA 2G76A 1PGJA 1EE2A 2JD1A 3F4BA 4KDFA 4OXNA 1WVGA 1KY4A 3PQEA 4L4SA 3UICA 2IRWA 4DC1A 4XYEA 1JKIA 2D59A 4GMGA 4RZIA 1U7HA 4AJ4A 4BO0A 2WD7B 3WNQA 2DLDA 2PZLA 4IDCA 2AE2A 4BNNA 3NTOA 2VWGA 5DULA 3FD8A 1UZMA 2CF6A 3FN4A 4R51A 4PN3A 4XDZA 2C7VA 3PZRA 4M54A 3GVIA 4KQXA 2RBEA 1U1IA 2H63A 4GWKA 2PD4A 2PA3A 3IUPA 4HXYA 3RUAA 2IDZA 3GK3A 2VWPA 1E77A 2PKQP 2VWQA 3P2YA 5CP8A 3NEPX 2PGDA 3JQ9C 3FTNA 4M55A 1NHGA 4Z3DA 4ZVVA 4HV4A 1QYXA 2V6GA 4XGNA 4DQXA 2NSDA 2B83A 2EG9A 3PRJA 1BXKA 5KKAA 5KVQA 4GLOA 3L07A 2WJPA 4XQGA 2PH5A 3DO5A 1EBFA 1X14A 5GZ6A 3I3OA 5H83A 3QIVA 2LDBA 1H9BA 4CMEA 4R41A 1PWZA 1LSOA 3UF0A 4DREA 2Y1GA 3S1LA 5G2OA 3ZWOA 5I7EA 1NFFA 1K5HA 4D44A 1NFQA 3V2GA 1R6DA 4E5YA 3TRIA 5CDYA 3VVCA 2WEKA 4YACA 2DVMA 1HEUA 2P5YA 3AOEC 5F21A 4L0QA 3GPIA 2RIRA 4PG8A 1NX6A 2GPTA 1VI2A 4U0JA 1U28A 4RPGA 4OO3A 1P33A 3NGLA 1UR5A 1R4NA 2PKQO 4PG7A 4R4JA 3MJTA 2PFGA 3WICA 1Y8RA 1VE9A 5ER9A 4PFJA 4BNKA 1ZXBA 4EGFA 3E9NA 5DCYA 4QO7A 1FF9A 5IG2A 1MC5A 2RCYA 2JFFA 4XR4A 4Y67A 2ZTVA 2DBZA 4CMBA 4AJ2A 4XJTA 3RQSA 1K6IA 1V6AA 3RUHA 1XGKA 3V1YA 4Q3DA 2C2YA 1H6AA 2YHIB 1PZGA 2G0TA 1BW9B 1VL0A 2VOEA 2R00A 2H5LA 1SEVA 1GY8A 1Q7CA 5U4QA 3JQ7B 3KSDO 4XIYA 4IQ8A 3AI2A 3E82A 5THQA 3PXXA 3HZZA 3NT5A 2BMAA 4OOFA 3RUEA 3CZRA 2W2KB 4PG5A 1T2AA 5G4KB 3ZHXA 4ESOA 2X6TA 1ML3A 3GVHA 5G0WA 1YQGA 1X7DA 3DMTC 1U2DA 4D3FA 2Q2WA 3EK2A 2PK3A 2ZTUA 5TQVA 2UVDA 3OA2A 4ONEA 5L3ZA 4YAEA 3ZV6A 1D4FA 3TZCA 1L1FA 3GT0A 4CMAA 3F5QA 4MDHA 2I3GA 4U8GA 4OQYA 3AI1A 2NVWA 1K89A 5TF4A 1PU2A 1W6UA 3RAJA 1CJCA 5COAA 3WGZA 3ZWWA 1MV8A 2JFHA 5DP2A 3EAGA 1B26A 2FZEA 1BTOA 4KUEA 1SOVA 4I1IA 3WOHA 2VHVA 4A26A 4A2CA 3OQ1A 3NDRA 3HDYA 4RPKA 3IC5A 4QX6A 2EIHA 1G1AA 3OEYA 4IDGA 3LK7A 4FSHA 3BMCB 5AYVA 2PZKA 5A3JA 1QV6A 1Y6JA 2Q4EA 3NRCA 4ZD6A 1JWBB 3BHIA 5JY6A 1M66A 2YYYA 5G4KA 3SLKA 2PD6A 1XQ6A 1EUZA 4M49A 4CM5A 1C1DA 5CDSA 4E2WA 4OQZA 1E1NA 2O7SA 1D1TA 2CSUA 4Q3EA 3PFFA 4DIOA 4ND2A 3PHHA 3UCFA 3R3SA 4TZTA 4FS3A 4WCDA 1QLJA 1PQUA 4LISA 4B7CA 2HJRA 1UXGA 3C8MA 4CJXA 4I08A 1E3WA 2AQ8A 1PGNA 2DBRA 3DZHA 1C1XA 1UP6A 4ND1A 4XYMA 1SMKA 3HB5X 2X0NA 3GFBA 5KCZA 5IAAA 5CHEA 2ZTMA 2ZQYA 3GVPA 5ADHA 4RV9A 1QYWA 2Q1UA 4GKBA 4IJUA 4WLFA 2HMUA 4KTTE 2IODA 1XELA 2HRZA 1PGOA 2NWQA 2GZ2A 1L7DA 5TNXA 3BHMA 5DDIP 5JSFA 3FNFA 3E9MA 4CMKA 3INTA 4NK5A 2QYSA 4OL9A 1P3DA 1X7HA 1R12A 3MJVA 1R16A 4BQRA 3DL2A 2Q50A 2NVBA 1KEVA 2G82A 2J3JA 4QECA 2D4AA 5L7YA 3EVNA 4MVJA 1OZAA 3KEQA 3T4XA 1U7TA 1ZK2A 1MGOA 4NJOA 3ORFA 5JY1A 5H82A 1RYDA 5EERA 2OOSA 4RZHA 3IP1A 3RFVA 3W8DA 3GNSA 4WCFC 3JQ6A 3VPSA 1E3IA 4YAKA 2J6IA 1LSJA 3TQHA 3DBVO 2GF2A 2OUIA 3KBOA 2H1SA 3HG7A 4PZDA 1GR0A 1LX6A 3RC9A 2WTBA 1X15A 3QY9A 3BMNB 4BNZA 1HT0A 4WOKA 1CF2O 1V0JA 2EERA 4CR8A 2YJZA 2X4GA 3GAFA 4BKQA 2GNAA 1EK6A 4FJ0A 5HRUA 4JBGA 1A27A 3KLMX 3RJ9A 1VLLA 1N7GA 2DBVO 5TX7A 5IDYA 4YYZA 3LU1A 4U0KA 3OQBA 4ALNA 4L9RA 4BHTA 3JQDA 2C5EA 1A4IA 9LDBA 3CSDA 2YY7A 1KC1A 4R9RA 4CM9D 4J1SA 2ZYDA 2EWMA 4OXYA 2WD7A 3DEYX 3T4EA 4LGVA 2Q2QA 2WYUA 3GH3A 3RFXA 4A03A 4NBVA 2NU8A 4INAA 2A94A 1U4OA 3DHNA 4BV9A 2ZIZA 5TJ9A 3DZFA 1VL6A 3BTOA 3AUTA 2X9GA 1JAYA 4XB2A 4GWGA 3ZI0A 2I5PO 1YB5A 3OEWA 1E0DA 1W8DA 5FI3A 2Q46A 3ROKA 1O6ZA 4RVHA 4A7PA 2DTDA 4YAIA 3ZHZA 4QQRA 2VT3A 4E3ZA 3SC6A 4YCAA 3VPFA 1ZJYA 4AJLA 4AJPA 1B14A 3L4BA 1YXMA 4W4TA 5L9AA 4XQ9A 3B1JA 2CF5A 3H65A 5DCWA 1E5LA 4MVJD 3X2FA 4E4YA 5FWNA 4M89A 1Q0QA 3G3EA 3PEFA 4H16A 3NUGA 3L9XA 1XDWA 5TSDA 3UUWA 1M76A 2DQ4A 4I5FA 3JQAA 2HK7A 2AQIA 3AM4A 2Q99A 4UVGA 4DPLA 2HDHA 2QYTA 4R3WA 5JXWA 3B6ZA 4GQAA 1HWYA 1N1EA 3CZMA 4QT0A 3I9NA 4OSPA 2IZZA 5IZ4A 2J5QA 1MG5A 1NYTA 3VH2A 2GN4A 4CL8A 3GGPA 2HMTA 2BFMA 4NU5A 2VRCA 4XX0A 1W73A 1NR7A 2YFHA 4BB6A 4DYDA 2EKQA 1P44A 4H3VA 1LDNA 3E5MA 5IFLA 1YQDA 1NPTO 3ZU5A 1B2LA 1P1FA 5JAIA 4CM8A 1Z6ZA 3GN2A 4LN1A 1V3VA 3A4VA 3RKRA 1H93A 2Y67A 2J5RA 3UXYA 4DQVA 2EHDA 1YOVA 3OETA 1KERA 1DDOA 1E7RA 3OIFA 3HN2A 2P5UA 3ITDA 4CMGA 3WGQA 3W8EA 1I3LA 4CQLB 2GLXA 1HYHA 1DLJA 4J0FA 4HADA 4RF2A 1DC3A 4IGEA 4CUZA 3IKTA 2WE8A 4R1NA 1GZ3A 1Q0LA 2O50A 4E5MA 1T4BA 3Q3CA 2BGLA 4DPKA 1KEWA 4LMPA 4JCOA 3DHYA 5A02A 3D4PA 3JD1A 4RL6A 2Q1WA 4YJFB 4BVAA 1Z7EA 2VRCD 1C1XB 1DIBA 3JQ9A 3AFNA 1PL7A 4BNLA 4GKVA 4PG6A 3I9LA 4CM3A 1XU7A 1I5RA 4IINA 4ZQEA 1H6CA 4DLLA 1SNYA 4BO3A 3F4LA 4IPTA 4TMFA 3UGKA 4TRMA 2VUSA 3GOHA 1KVTA 2J5KA 3GEGA 2I3AA 3HNPA 2W2KA 3H4VA 3INRA 1BVUA 2BELA 3AM3A 1HLDA 1M2WA 3FWNA 3GEMA 5LDHA 5I7SA 1A4UA 3SC4A 4B4WA 1DIAA 2AE1A 3JQ7A 3TDKA 1EVIA 2O3UA 4ZRNA 4MKRA 3GMDA 1WP4A 3FTPA 3R1IA 4JBHA 1DRVA 2J3KA 3OQ6A 5BT9A 1JDJA 1IHYA 2ZYAA 5C3MA 4FW8A 4MIEA 4Z0HO 1ISMA 4MPDA 3GGGA 5MGBA 1FDUA 3ICPA 2C82A 3BXXA 4J1QA 4PRLA 3HN7A 1SAYA 4CV3A 1JN0A 1B8PA 1PJ2A 4DYVA 2CDCA 2FR1A 3SBOA 1YKFA 1LQUA 7ADHA 3IMFA 3LLSA 3ZV3A 1PR3A 3EMKA 3LT0A 4L4RA 3GHHA 2O4CA 4BNJA 4Z0TA 5JPIA 1TLTA 4BNGA 1R4NB 2A4KA 3W4JA 4E2ZA 2IEDA 2GGSA 5DZSA 2GYYA 3P5SA 4P38A 1SCUA 4D0RA 5KVVA 2FOIA 4YT5A 2WSBA 3H2SA 2P9EA 3C1OA 1BHSA 4DTIA 6ADHA 3KYCA 1YJQA 1WW8A 3OICA 1JQBA 4E5PA 4BNHA 3HB4X 4BMVA 4FGSA 3I1JA 3BA1A 3P2OA 3RC7A 1A9ZA 1Q1NA 3GPDG 1BW9A 1EDZA 1D8AA 2VYVD 4K1LA 1ZSNA 2Y1CA 2W98A 3NX4A 2DTXA 3I9KA 3K8ZA 3VTFA 1LJ8A 1HKUA 2VCYA 1XHLA 3AU9A 1K6JA 2E49A 3F1KA 3M2PA 1IOLA 1PL8A 3PFWO 3GQVA 2YV3A 4CLXA 1BG6A 3GZ4A 4UEKA 3U3XA 1F17A 4B79A 1AE1A 1LLQA 1CERA 4ALLA 5KTKA 4IIUA 5CAEA 2Q49A 4JP2A 3WBBA 2HJSA 1HYGA 4CM7A 5C7OO 2O3QA 2EKPA 3QWHA 4LSWA 2PD3A 3LZ6A 3NTRA 2NV6A 3LQFA 4BNVA 1PZEA 4RQUA 5JAZA 1DBVO 4LVCA 4I5DA 2BHLA 1Y81A 3WQSB 4E13A 4BGEA 1OI7A 4J2OA 3DBRB 1QORA 2VQ3A 3O4RA 1GQYA 1VL8A 2W2LD 4BS9A 4Y6SA 5A03A 4IBOA 2NQTA 1BSVA 2DUUA 3NT4A 4DMMA 2Y1OA 2WE7A 4RF5A 4M1QA 1HZJA 2X23A 3VDRA 3PLRA 3QVXA 3OF2A 4QFCA 4PLWA 4EEXA 4DXHA 2V6BA 3E5RA 3RD5A 4HNHA 1I3KA 3LC1O 4GL4A 2VHYA 2JFGA 4EZBA 4NJMA 4Q9NA 5C37A 1IZ9A 3BTVA 1GPJA 4WKGA 2PWZA 1Y8QA 4GGPA 1DOHA 1A5ZA 1NQ5A 1RM3A 1IPFA 2EV9A 4M87A 5EJ2A 3FR8A 4XIJA 1T2EA 1Y8QB 1IY8A 1ULSA 1EK5A 2V6MA 3QP9A 5BR7A 2I99A 3O9ZA 3MTJA 1O8CA 3DWFA 1HLPA 3M1LA 4W9NC 5KIAA 2EP5A 1ZEMA 2QHXA 3S2EA 2HCTA 2BH9A 1LLCA 3ITKA 2PY6A 1JTVA 4MVJP 1ISHA 1YH3A 1I30A 1WMAA 4J7XA 3KLPX 1UXIA 2Z1NA 5AXAA 4D3SA 1O9BA 5AXCA 5T8KA 1H2BA 2D0IA 4RCVA 1MLDA 1X7GA 2HU2A 1MFZA 1ONNA 2O48X 2C29D 1X1TA 4Z6KA 2P4QA 1F14A 1DB3A 3DBRA 3LDHA 4CMHA 4EBFA 1BMDA 2VZ8A 4JN6B 5KJEA 5HTOA 3TZKA 1PZFA 3I6QA 3UCEA 1YE3A 2AEMA 3LF1A 2C59A 2X9NA 5JDIC 4WLEA 3Q2IA 5T6BA 4GI2A 1YL7A 2BI8A 2DM6A 2OO5A 2Y0EA 3DZKA 3X2EA 3EDMA 2Y05A 3AY7A 5HS4A 1DRWA 1P77A 1SPXA 3ETGA 3MJEA 4FGWA 4K9DA 3ZWMA 1PJLA 1PSDA 3ZWCA 1ZK3A 5CDGA 1CEQA 3G17A 3EHEA 3SX2A 4DBZA 3VC7A 3KETA 4B3JA 4CM6A 3E9QA 4ZU3A 2NTNA 4QEDA 2JAHA 3OA0A 3AFMA 1U9JA 3WSWA 2VHZA 1N9GB 4XD2A 2BFOA 1PGQA 3FCOA 2OP0A 1AUPA 1X0XA 3QWIA 4YT2A 3FNHA 1H0KA 3RUDA 4AG3A 1GZ4A 4NR0A 4B3IA 4CLRB 1DC5A 1U5CA 4IGFA 1LBEA 2FRDA 1Y5MA 4LRTB 3WGYA 1JA9A 3AOGA 1DHRA 1DO8A 1PGPA 3LYLA 3ZDFA 4DIBA 2R00C 4EJ6A 1KVSA 1SEPA 2AEJA 2Y1EA 2JHGA 1GZ6A 3I23A 3TNLA 3OM9A 5CDTA 1U3VA 4Y6RA 3TZ6A 4XQCA 4RJTA 3H9UA 4FN4A 2J3IA 2WDZA 3ZW8A 3TFQA 4BGIA 1A7AA 1VJTA 3PDJA 1L7EA 1DIHA 4BKPA 5IF3A 4J4TA 4PLFA 2NM0A 3H9QA 4WNIA 3B1FA 3FNGA 5JO9A 4LK3A 4DPMA 4L74A 3V5NA 3HE3A 4UUNA 3HFSA 5TGDA 4UVEA 1A71A 4RVGA 3Q11A 3WB9A 2ZB4A 2VYVA 1VSVA 3RUCA 4CM4A 4NK4A 1EDOA 3QA9A 4JP3A 3VZRA 1GUYA 4DLAA 1G6KA 2TMGA 3WGTA 2ZATA 4PVDA 3NJ8A 1KYQA 3TWOA 4I9HA 5JCJA 2QG4A 3RROA 1MXHA 3KVOA 4MJLA 3U09A 2GASA 3MCVA 3C1TA 1UP4A 1FJHA 4FJ2A 3UKOA 3WGOA 1GFSA 3JD2A 4ALJA 1ADFA 1E7MA 1MX3A 4BKUA 4EJ0A 4F6LA 3WWYA 4IZIA 3HDJA 3KM0A 3ZW9A 5DF1A 3FRJA 1QR6A 1HYEA 1Y1PA 3HFGA 4O59O 3BMOA 3F47A 1P1HA 3AUSA 5DN9A 3COSA 5JC1A 3D1LA 3W4IA 1TXGA 4IDDA 4K26A 3C7AA 1J49A 1HRDA 1VPDA 4RO0A 1I01A 4AJHA 4UVIA 3RC1A 1NP3A 4Y8VA 1IPEA 4TRJA 1QKIA 1XCBA 2QIOA 2C54A 5ES3A 2FSVA 3VPGA 4RGBA 3V2HA 4NBTA 1R66A 3ZWXA 1E3JA 1X0VA 4PGFA 1ULUA 3QVTA 5A06A 1KEUA 1ZJZA 2R6JA 4TWRA 4WECA 1DAOA 1RM4A 2NTJA 1MP0A 1T2DA 3IKVA 3IQDB 3L6OO 4CQLA 2B4RO 4EEZA 1E3EA 4ZA2A 1TI7A 5ENDA 1CDOA 3HHPA 1KIFA 1NQAO 2B69A 5IDQA 2NQ8A 1T25A 3HWRA 3DBLB 4L73A 2Q4BA 3FR7A 1NPDA 1YBAA 3AM5A 4WLNA 3S2IA 3CMCO 3IAHA 5JAMA 2OHXA 2HK9A 3AY3A 4RDHA 1G0OA 8ADHA 4E6PA 2G17A 1R4MA 3AWDA 1V9LA 1GEGA 2IYPA 2NU9A 2Z1MA 1K6XA 5IZCA 3GG2A 3PWKA 5T57A 2YDXA 4AFNA 4N5LA 1M6WA 1PZHA 4RPHA 3EZYA 1JW9B 4FFLA 4HFJA 3WLFA 4AJIA 2C0CA 4W82A 3Q0EA 2IYOA 5ER6A 3ONDA 4NH4A 1ZVMA 2HLPA 3H5RA 4XQEA 1QG6A 3B20A 4D41A 4UEJA 4B4UA 2NU7A 4NPCA 3WLEA 4E30A 5IDXA 2WWRA 1GYRA 2SCUA 3FF4A 3VVBA 1YJ8A 4KOAA 1N8KA 2I67A 1NR1A 1HE2A 5KOIA 1A7KA 4M86A 4EUFA 2X58A 4MVJE 4R5MA 3L9WA 1T26A 2HRBA 3DMTA 3L77A 2E48A 1H6BA 1W4ZA 2WM3A 3D3WA 3CTMA 2OBYA 2EP7A 2IZ0A 3A28A 3CMMA 3H3FA 4CR6A 1MA0A 3PGXA 4A5OA 4EITA 3ENNA 4BGUA 4IQ0A 1XWFA 2HMSA 4U7WA 2X0JA 3Q2KA 4J49A 4J16A 5A9TA 4JGBA 3ST7A 5JFOA 3Q1LA 4XRRA 4TKLA 4ZJUA 3I4FA 2QRJA 4ZN6A 4TROA 2JJYA 5I7VA 3RJ5A 2X5KO 3WBFA 2EEZA 1ADGA 1GV0A 3M1AA 2EKLA 5JMWA 3NDJA 5JMPA 1ONPA 3AUAA 2VNSA 1U8XX 2OORA 1C0PA 2H6EA 2AHRA 2H9IA 4ZICA 5IXYA 1LA2A 3QW2A 4YJGB 3ZGYA 3W8FA 2RHCA 4OYRA 4YAGA 3WXBA 4FFMA 2NVUA 1HDRA 4CUJA 3PYLA 2NU6A 1NWHA 4RLSA 3ZN2A 2GSDA 4R01A 1HDCA 5KKCA 1AXEA 3EGOA 4W6ZA 4MVJI 4RF3A 3W6ZA 5LCXA 3KB6A 1RM0A 3U4DA 2NLOA 4YRAA 1PJQA 3B1KA 1HE4A 2ZYGA 3WR5A 4YDRA 4ND5A 3E18A 3SJUA 3DBLA 4G65A 1RJWA 3HDQA 2I66A 2HUNA 4ALMA 3PQFA 4XJSA 5B4VA 4FDAA 1GUFA 1EE9A 3A06A 2CMDA 1OAAA 3ZH2A 5DT9A 4O1MA 3M6IA 1QLHA 4P4GA 2PV7A 4AVYA 2VUTA 1SBYA 4ILKA 4WE3A 4KQWA 3DZIA 5EESA 3D4NA 4IMPA 1K2WA 4J4BA 3PJDA 4JROA 5FEUA 2D2IA 4YA6A 1HSOA 5ICMA 1D1SA 4CLHA 4MVJH 2POQX 1LDEA 2YQ4A 3PWSA 5TLSA 1NVTA 1KEPA 4XB1A 4TVBA 3HDHA 1BVRA 3QWAA 2GN8A 3ZHBA 5BSHA 5CEJA 3JV7A 4GX2A 4NFSA 1Z74A 3CUKA 4WOJA 4AJJA 1ZIDA 1DHTA 4Q39A 5TT0A 3L6EA 2VNAA 1T4DA 1ADCA 2G1UA 4JK3A 5L53A 4Y9DA 1XA0A 1E3WB 1U3TA 2IXAA 4E32A 1R15A 5TRTA 3O8QA 5L4SA 4BNXA 3KV3O 1TT5A 9LDTA 3WJAA 1NHWA 2XF8A 4II3A 4DLBA 1MUUA 2FZWA 4HKTA 4BO2A 1JWAB 4MIOA 4KWHA 4ZHSA 1VSUA 4BO6A 1EBUA 1T24A 4TSKA 1DC4A 2ZJ1A 5B1YA 1PS8A 5L4LA 4BNFA 2ZB7A 2Y68A 3NT2A 3W4KA 2TMDA 2Y66A 4CMEC 1EVYA 3QV1A 3RBXA 3VPXA 4FIZA 4BKOA 2P2SA 4J91A 4A27A 4Z9FA 5KJ6A 2A92A 1Q7GA 3WGHA 5H81A 3ASUA 3T7CA 2PGLA 3PYMA 2C7GA 2X7HA 3GFGA 4B7XA 4CODB 3GN1A 3KHUA 5B4UA 1TB4A 3BHJA 2YW9A 4OOEA 3RKUA 2YV1A 3PJFA 1P1IA 1LDMA 2I76A 3D64A 1HSZA 5CPBA 2F1KA 1KC3A 2X86A 3C24A 3WQQA 3DHEA 3U5TA 3RWBA 2QQ5A 8LDHA 3EVTA 4YTEA 3V1TC 1TA4A 3WIEA 4KDEA 3ZNQA 4WLVA 1LRKA 1AXGA 2BFPA 2E4AA 2E6UX 4XKJA 3S2FA 4KUHA 4YT8A 3FSRA 4QO8A 2PR2A 1PIWA 2ILTA 2VN8A 4OSOA 3MZ0A 1ISGA 5CG2A 3RC2A 4FC7A 3G1TA 4TVOA 2Q1TA 1JKFA 1B8UA 4HX5A 3AY6A 3DDNA 1UP7A 5IN4A 5F1PA 1NXQA 1T1SA 2CDBA 1LU9A 1QYVA 4I5EA 4YBZA 4CLRA 4IZHA 4AJKA 2GZ1A 3ETDA 4IXTA 1D7OA 3SXPA 4R1TA 3K92A 1YRLA 3SEFA 3K5PA 1SB8A 4IMRA 1EFLA 2D5AA 3ZNOA 4B7UA 4NI5A 4G2NA 1RKXA 1S7CA 4YRBA 5G0UA 3QSGA 4YJHA 3NTQA 2BLLA 3U4HA 4E33A 4XGIA 3OJ0A 2W2LA 4DUPA 4D46A 1MB4A 1HF3A 3U4IA 2EJWA 5I8WA 1FK8A 3H2ZA 3AI3A 1IE3A 3VHRA 4IDFA 3GDFA 2WYVA 4GMFA 4NBUA 1KBZA 2HK8A 2XXBA 4JJFA 3AU8A 2FP4A 3DZGA 3K6JA 3PHJA 2AEFA 2Y0CA 4YT4A 4YVFA 2X0IA 4DA9A 4GX0A 3ZWVA 5L51A 3JYQA 4KMSA 5JNLA 4C7JA 4LSMA 2YFQA 3G0OA 2VHXA 2UV8A 4W7IA 1HTBA 1V35A 5AQ1A 3KRTA 4JJGA 1XYGA 3LF2A 2C5AA 4OJNA 3V8BA 4RPLA 1NQTA 5U1PA 3FWZA 3JQCA 5JBIA 1LXCA 2GD1O 3JQBA 1EVZA 1PJ4A 1QP8A 5A1TA 4J4HA 1DRUA 1F8GA 3U4CA 3NGXA 2BI7A 1D3AA 3PDUA 3NV9A 3RBZA 4XYBA 1Y9AA 3BZUA 3MWDB 3AUUA 3UVEA 2HMVA 3OJOA 4J9VA 1YS4A 2YHIA 3TOZA 4BNWA 1ADBA 1GQ2A 4JLWA 4GSKA 1SO8A 3K96A 1P74A 3RBVA 2JAPA 1ZMOA 5KVSA 4A0SA 2Q1SA 4OKIA 4G81A 3ROPA 2RH4A 1DPGA 4ND3A 4O0LA 2W4QA 4GX1A 1Y8RB 2X8LA 5C7LO 2YQ5A 4UVDA 5ILOA 1PWXA 4P22A 3WFJA 2Z95A 4ITUA 1IYZA 3DBHA 2CVOA 5KJ1A 1H5QA 2CVZA 3GDOA 4ZQFA 3H9JA 4GH5A 4CV2A 3DAFA 1AHIA 4NFYA 1O0SA 5EIOA 3ZNPA 4IDAA 3VOSA 1T2FA 4Z9XA 4HFRA 1P31A 2ET6A 4P4NA 3U0BA 5IN5A 4WCFA 1K0UA 4NQZA 3JQBC 1B15A 1YL5A 2P68A 5TIIA 3H5AA 1Q2XA 4WLUA 1U4SA 3PJEA 1UXHA 3MJ4A 2AW5A 4JBIA 3ZWAA 1FXSA 3DFZA 2OMEA 3GEDA 1HE3A 4KP7A 3I52A 2E37A 2P91A 2HMWA 2GR9A 1EVJA 2O23A 1O94A 4DQUA 5GZ3A 2E82A 3DXFA 1QXSA 2ZB8A 3NKLA 1JVSA 5U9CA 4E31A 1PEDA 3BMNA 1O95A 1KVUA 3MEQA 4PLGA 5F1KA 5BNFA 4A10A 4YR9A 2D3TA 3U9LA 5DBGA 1UDBA 1UUFA 4D79A 3O26A 1J4AA 3BTUA 1C0IA 3IP3A 1DEHA 4BL5A 4RVSA 4N7RA 4BMSA 2DPHA 4LW8A 3ZV5A 1Z45A 4MIYA 3PGJA 4WEQA 1A72A 2DPGA 3TL2A 3V2UA 1KETA 2EGGA 4PG4A 4IXWA 3GUYA 2Y93A 1WDMA 3DC2A 3JCZA 3QRWA 4RQTA 5DNAA 3TZHA 4CMCA 4DBVO 2GZ3A 3I5MA 4GSLA 5T8KC 1H94A 2OP1A 3TSCA 4WUVA 3G1UA 1EMDA 2X22A 1U5AA 4M8SA 3OJFA 3ZU3A 3WDSA 4ND4A 4Z0PA 2FSSA 1Z75A 5JS6A 1VJ0A 1YVEI 1YB4A 4KUGA 1GDHA 1HDYA 2JCYA 4HFNA 3ZU2A 3STHA 4R9SA 3ZCXA 5L40A 3CKYA 4DRYA 1ENYA 3EYWA 4EUHA 2YV2A 4EYEA 1NWCA 2BKAA 3LC7O 4K6FA 3L0DA 3RU9A 2QX7A 4NZ9A 1F12A 3GAZA 4GLLA 1ZW1A 1LDBA 2OL4A 2EJVA 2QRKA 5ITWA 3RFTA 1X13A 2FR8A 4PLPA 4J43A 1YB1A 4B4VA 3IUSA 1RYEA 5HWSA 1WWKA 4HY3A 1C1DB 3KYDA 4PVCA 5L45A 4R68A 3H6KA 1R37A 4AJNA 3BMQB 4O63O 4BGVA 4ZQBA 5IXSA 1LQTA 3JYPA 3VH3A 2BFAA 3ZHYA 2FHSA 5CEFA 4J7UA 4MVJF 4YB8A 1MXFA 1FMCA 2LDXA 5CEEA 2GRAA 4GVLA 1RWBA 4FC6A 2OGUA 2PZJA 5TT1A 3KTDA 5IDWA 3BYZA 2GUGA 1GAEO 3GRPA 5L4NA 1NPYA 4MVJG 3K2BA 5A04A 2CUKA 4MP6A 4U6SA 2X5JO 1CQJA 4UEOA 5K6AC 4NDNE 5DBIA 4YJFA 1ENZA 3JYOA 3V1UA 3KOUA 4I8XA 3DAGA 2CD9A 4IJWA 2PTGA 4EUEA 4YPOA 1Z7BA 2O4UX 1P45A 2I9PA 3WMXA 1XEAA 2ZK7A 2RAFA 3SVTA 3UW3A 3EC7A 3VZPA 3BMOB 5G0TA 4J90A 5T67A 3MJCA 1ZK1A 3PK0A 3GRKA 5KWEA 5T5QA 3C3XA 1WDKA 3RI3A 4RVFA 1ZCJA 3PIDA 1YOVB 4RDIA 1WXDA 2FMUA 3QWBA 1RPNA 4IIVA 1CRWG 3TL3A 5L7WA 4I5GA 3L6DA 4JNKA 1I33A 5JAQA 1UDCA 2YZ7A 3ZZNA 3SJ7A 5AXBA 3E6AA 4S1VA 3DOCA 3KYDB 3KUXA 1PJ3A 1ZNQO 3ZNNA 3ENKA 2YDYA 5HA5A 3BAZA 2DUWA 5EQFA 2JHFA 3WYEA 4CMIB 3PPIA 2O3SA 7MDHA 4FJ1A 4BIIA 3DMYA 1I8TA 2FPIA 1TT5B 1CWUA 1LDGA 2UUOA 2X5OA 3KSUA 4UREA 1NBOA 1ZEJA 4HP8A 3PHGA 2BD0A 4R54A 2P4HX 3GNTA 4KWIA 2HO5A 4WPGA 3JYNA 5JC8A 3EW7A 2DFDA 3UCXA 4N5MA 2D5CA 1P0FA 2CDAA 3UOGA 1ARZA 4UUPA 5GMOA 2QZ9A 3M2TA 4CQMD 1V8BA 2X9VA 5KNLA 2DFVA 1HDXA 1HXHA 2VOJA 4FQ8A 2Y0DA 4PIVA 2DC1A 4BNTA 2XPCA 3FI9A 1E6WA 1T1RA 3GUCA 4BOYA 3RCBA 1W0CA 3ANMA 1ZFNA 1LRJA 3QVOA 3ZU4A 5DP1A 2WYWA 3JTMA 5A5FA 1N1GA 3PHIA 1BXGA 1DIGA 1HZZA 5A9SB 1LUAA 5BNTA 1KOLA 4WK6A 4XZ3A 5FYDA 3ULKA 3JSAA 3ZWBA 3JQFA 1OC4A 3JQ8B 1WZEA 3S8MA 1LSSA 3DBHB 2ZTLA 3GGOA 3DR3A 1VRWA 4DWVA 1M75A 4EJMA 3F9IA 4RLHA 4DL9A 3Q9UA 4AJEA 4BNYA 3GVCA 1KVRA 4RF4A 4CLOA 3DOOA 3TJRA 5MDHA 5HS6A 4Y6PA 1QSGA 4C4OA 3ETEA 4LMRA 1XKQA 2Y1FA 1FDTA 1HETA 3GNQA 5AVOA 4URFA 1X1EA 1ZH8A 1NQOA 2GO1A 3P7MA 1N92A 3A1NA 3WTBA 4FPXA 5AOVA 1SOWA 2Y1DA 3ADOA 3L4SO 1XSEA 2NVUB 3QVSA 4IS3A 1XG5A 3DONA 5CPFA 5EINA 4B8ZA 3GHYA 3K2EA 4IUYA 2IXBA 3CE6A 3VDQA 4J0EA 1PS9A 3MOIA 1YL6A 4YQYA 1BDBA 3GDGA 1I24A 5GY7A 3GZNB 1V3TA 4R1UA 1QYDA 1C14A 2NTVA 1E1KA 3E03A 5AXDA 1B7GO 4O6VA 3H3JA 4FOOA 3DOJA 4NNJA 1B16A 1F06A 4HUJA 1UZLA 5COQA 2FN7A 5A9RA 1QMGA 3I4CA 4L76A 4MO2A 1E7QA 2IE0A 5B4TA 4WGGA 4E0BA 1H2HA 5BSFA 5CDUA 3O03A 4R69A 1SB9A 3PI7A 3H9EO 4P4LA 2RH8A 2HSDA 3GF4A 1DJNA 2CFCA 3I83A 4YJDA 1O89A 1JU9A 4TKMA 4YEDA 4HBGA 4QXMA 1XU9A 2XOXA 2C2XA 3GVXA 5JDCC 5FI5A 1DC6A 1SZJG 3VH4A 1MC4A 1O5IA 1GQQA 3A14A 3K9QO 4II2A 2O3JA 3N7UA 3RSHA 4CQMA 2BF7A 2GERA 1NTOA 1I10A 1AGNA 3R3JA 4R1SA 5EQDA 2OXIA 4PRKA 1FDWA 1N2SA 4NJMB 4CM9A 4TZKA 1B0AA 1U3UA 4E5NA 1GYQA 4MP8A 3ASVA 3WYBA 5KVCA 1E6EA 4RORA 5G4LA 1P0CA 2QW8A 2VRBA 3D4OA 1R4MB 3L4BC 1OFGA 3E8XA 3PQDA 4XYGA 4J2HA 4NBRA 2EXXA 2ZCVA 2VTEA 4G5HA 3G49A 1OOEA 1GL3A 1TEHA 1ISFA 5EN4A 3OIDA 3F5SA 3CXRA 2O2YA 3JQGB 5KJFA 1K3TA 2AA3A 4BUCA 1UZNA 1F0YA 3R0IA 4D45A 4W9NA 3FBTA 2A35A 1ZSYA 4ALKA 2UYYA 4OM8A 4PCVA 3TFOA 1LLDA 1WZIA 1PQPA 5DCUA 2ZQZA 4U6QA 3U49A 1F8FA 1LRLA 1Q0HA 2IEBA 4JX8A 4C7KA 5C7IO 5DOZA 3FHLA 2J3HA 5JDCA 4D3DA 4Y98A 3IL2A 1YO6A 5I8ZA 3KXDA 1PR9A 2P9GA 3OIGA 1JVBA 1JLLA 3I9OA 2PH3A 4YJHB 1HDZA 4FD3A 1E5QA 1RM5A 1GU7A 3QQPA 4TRRA 3F3SA 1E7SA 1DJQA 1VC2A 5A4DA 1DFIA 4JXKA 3TF5A 5I9LA 3LSYA 4FFOA 3HSKA 4X54A 5T64A 3JYLA 5K9ZA 2UAGA 3JQFC 3ZWNA 2JD0A 4MINA 4FFNA 1I2BA 4LRSB 3FPLA 1GCOA 1LC0A 3Q9NA 2NNLD 4BMNA 4FR5A 2B35A 4HNGA 4E2XA 3KEOA 3FBGA 3K30A 4CM1A 5I9NA 3QE3A 5JYEA 5TC4A 3KYCB 1ZK4A 3ROQA 4Z3KA 4N18A 1P1JA 2UDPA 1EUCA 4E5KA 1I0ZA 2I6TA 4BNUA 2A9FA 2FPPA 4AL4A 1GUZA 3QVWA 1LLUA 1YQXA 4MP3A 2VUUA 4WEOA 4CM4B 1BDMA 5L95A 4OH1A 4NMHA 1GD1O 3WX0A 3I9JA 2FY8A 1NAHA 1VKOA 1ZO8A 4L4XA 4B4OA 1ORRA 5F1OA 3PP8A 2GN9A 4D43A 5G0VA 2B5WA 2PKRA 1H6DA 3S55A 3WSVA 4GX5A 4BQPA 2NACA 2CZCA 4OHUA 4XDYA 1OBFO 3ZWPA 4QTZA 4IM7A 3DAPA 4BO8A 2Z5LA 2VYNA 3OP4A 4RVUA 3ROMA 4DIFA 3BIOA 4DVJA 1WNTA 4WASA 1CYDA 1ISIA 3GG9A 2AMFA 4MKZA 4CL3A 3OFSA 2DKNA 1B3RA 3MJSA 4ALIA 1EEHA 3VH1A 3U62A 4GPD1 4HWKA 4W7HA 1I3NA 1QRRA 3JQGA 2CNBA 2J8ZA 1ISJA 1TVEA 2GCGA 3DZJA 3LT4A 3PTZA 1E6UA 3IIEA 4WJZA 2AQKA 3P19A 6LDHA 1E92A 1YDWA 2NUAA 3INGA 4EDFA 3KZVA 5JCJD 3O8QB 3HQ4O 4EI2A 4Q3AA 1MFPA 2OZPA 3NYWA 3F1LA 3AW9A 3CIFA 4Q3NA 1LEHA 1U3WA 3WGGA 3CH6A 1GV1A 5F3RA 4WLOA 2OFPA 1I36A 3WJ7A 3DTTA 3VAZA 4RPJA 3RUIA 1ZUD1 3D7LA 2FR0A 4JIGA 2OBNA 3FNEA 4YJGA 4KTVE 4NIMA 5JYDA 1V3UA 1S6YA 3OJLA 4PLVA 5JLAA 1XQ1A 4J3FA 1PS0A 5ICSA 3VPHA 1PJBA 3I9MA 3PLNA 1ZMTA 3PIIA 3QLJA 5EL0A 1WLYA 4OKNA 4R16A 4FCCA 4E12A 2B4QA 3VTZA 3OMLA 1U8FO 4HFMA 3WGIA 2V7PA 3OBBA 3ICCA 4BKRA 1XIVA 1ENOA 4K6CA 1WMBA 4BO5A 2WD8A 4BV8A 4IS2A 1G0NA 2VYND 4EW6A 4JQCA 1DXYA 4UUOA 3K73O 3QWFA 1H9AA 4CV0A 4RVDA 2YHUA 1DFHA 1C3VA 4BNIA 4PLTA 3CEAA 5HBRA 2AG8A 4KZPA 4ZQHA 2CVQA 3IJRA 5DBFA 2AQHA 1UXKA 4FFPA 5FFFA 2B4TO 3ZV4A 1DIRA 3D0OA 4NFHA 4S3MA 4UULA 4XYLA 1ZBQA 5B12A 3AJRA 1AHHA 2HQ1A 1LC3A 2ZKLA 4XEHA 4CLDA 3WWZA 4YAJA 1DAPA 4AJOA 1MG0A 4CPDA 1I2CA 4J1NA 2P9CA 1I2ZA 3E48A 3H7AA 4XWYA 1E7YA 4ZQGA 1YGYA 5A3VA 3TPCA 2GN6A 2HKIA 4FFRA 4FOSA 5JE8A 4CQMB 4J6FA 1UAGA 3O38A 1ENPA 3EY4A 4GBJA 4OMUA 3IDSA 5I7FA 1LI4A 5B37A 4YWJA 5JDIA 1PX0A 3PZBA 5JW6A 3WQRA 1E7WA 4TQGA 4CMJA 1J0XO 3GC6A 3UAGA 4ID9A 4PZEA 2FWMX 4IDEA 3K31A 1UH5A 4CLOB 4BO7A 1PL6A 1SC6A 1IB6A 1LSUA 5LDGA 2DTEA 4E2YA 2Y99A 2O3RA 4XGKA 3JQ8A 2BRUA 3KSZO 1EZ4A 3BTSA 3JQAD 3DFUA 2JCXA 4ZGWA 3W6UA 1I3MA 1IULA 1BXGB 5DOVA 3PVZA 1NM5A 3D3WB 3JD0A 1EUDA 1WAMA 1UAYA 2EGHA 3ANLA 1J6UA 4UUMA 3GR6A 5KJCA 1B8VA 4BO4A
chains in the Genus database with same CATH superfamily
4UMFA 2JKVA 4B3FX 2VAVA 1E3QA 3CX3A 1EX1A 1I94B 3QKUA 2C07A 5JATA 4JUIA 5DLPA 1L7AA 2PUBA 4FFWA 1ID1A 3MINA 4HGZA 4W99A 4Q18A 3WYCA 2TECE 4GMKA 1VM6A 4L75A 1C9MA 2AXQA 3IRVA 3IVCA 4OLJA 1IZYA 4ZJYA 3E8SA 2CHFA 2DWQA 3I04M 1V6SA 3RSGA 4YXFA 1YBVA 5F7OA 3KHSA 4TV9F 3VR3A 5KEIA 4PC2A 1XA3A 1W48A 5KYTA 1SCDA 3DTYA 1QYCA 4HDOB 4ZI7A 1AQLA 3CPSA 4D0SA 2NADA 3ZXXA 5G0SA 1REQA 1U2GA 5H68A 1L7QA 3EVEA 4NRDA 1R8YA 2P2DA 2YR0A 2JLWA 1U2DC 2JDID 4N54A 2XSZA 1OHHD 3X1MA 2P0YA 2Y0PA 4ZKEA 1G2IA 1JSLA 5EIBC 2I6UA 4GGOA 4U2CA 1TUBA 3TW8A 2IHUA 5F4BA 4KIWA 1EIWA 2A0UA 4I55F 5ESRA 1NSYA 1C0KA 5M2QA 4NG5A 1IUNA 4RIEA 2PNFA 4XA8A 4D9BA 3QY0A 4DBLC 1DV2A 1A1SA 5IM4A 2Q2VA 3GLFA 4G63A 1GTMA 3QI2A 1F5SA 2FGJA 1VKNA 1ZSVA 2GBCA 2M32A 5K0BA 1XLUA 2E3JA 4M6WA 3RC3A 4DCVA 4LDPA 1CUGA 2ETXA 1G5RA 4NYJQ 2ZB2A 1VA5A 3CU5A 1E2PA 1M8JA 3NHMA 5E3JA 5LP6F 3I2JA 1RJFA 4EX7A 2F1JA 2O2SA 4ENUA 1DKUA 2UUPA 3TDMA 2VHWA 2ZP1A 1ONOA 4O4LA 3G79A 4DMFA 2C2MA 3G6WA 3H87A 4CKWB 2FN8A 3AFGA 3FDFA 4MEBA 3QJ5A 3LLVA 1MBZA 1E2BA 2PIAA 2H52A 1OC2A 1CY7A 2PSSA 4BQOA 5LJIA 2V7UA 2NPOA 4YJ2A 4JQZA 1BEUB 3NCHA 1M3SA 1U1EA 4L02A 3WFIA 1OY1A 4GD3Q 4UHJA 4H15A 4XUCA 5G40A 2EWVA 4YMHA 2C7OA 4INJA 2DFTA 3OH8A 1KI1A 1P7VA 1T2CA 2G9QA 1K88A 1E1CA 3WVNA 3BKXA 4U2BA 2ZB3A 2QMYA 5K20A 4F9TA 3B5JA 3IA2A 3PFKA 2IUYA 3RASA 1KVQA 2R66A 5EIFA 3UH1A 1CB7A 1Z5PA 2QRLA 3AOEA 4O4LB 1N78A 4RZ3A 5EJ5A 4YRDA 5AVXA 1Z6YA 2LVBA 3D0KA 3DW1X 4Q3CA 1AMOA 1U2SA 1PP4A 2OQ2A 1RWWA 1YZLA 2Q3EA 4L8VA 5CH3A 5FF9A 3T7EA 4CL2A 1OGYA 2BMDA 1UDAA 1YZTA 1NASA 4ZREA 1X1DA 1HDGO 3WMFA 3CJQA 2PGJA 1KS9A 2Y0BA 3MJHA 4JLBA 3MBOA 2IY8A 3DZBA 4N5NA 2BC9A 2PEYA 2CXQA 1JS1X 4OGLA 3EZLA 4AN4A 5BPFA 1UC5B 1LPMA 3H5NA 2B5VA 5EWJB 1N9GA 1U0HC 4QRIA 5TEVA 4DUGA 1B73A 1B8NA 1U2ZA 1WBJB 2FUNB 3FRIA 3HNRA 3IJPA 4Q16A 4Q66C 4Z8XA 1KPIA 1LTHR 4Z9YA 4G1CA 2FPXA 1Z73A 2OC9A 1IATA 3S27A 4B87A 2O8BA 1JWLA 2CCGA 3LAWA 1UADA 3NOXA 1EJ0A 1L5SA 3GMSA 1HE5A 4LE1A 3OI7A 5HPYB 1SKUA 5FD8A 3GRZA 2VZ0A 3IPXA 3WMGA 5IJZA 3PJGA 5CD9A 2VC2B 2O14A 4Z7NB 1RHQA 3PV0A 1D6SA 2ODNA 4P8RA 1U9CA 4FGJA 2IXDA 3B8HA 1Z2OX 5CLFA 1A98A 5HF6A 5JJKA 4CIVA 1E3SA 4H17A 4DCPA 1CBUA 4XXHA 1W4AA 3GY0A 4JODA 5CYFA 1TFRA 5E4TA 3T3MB 3DAHA 1TPZA 1ZKMA 3ZE9A 1DX4A 1WPQA 3GDHA 2VYQA 1CIVA 2P3QA 3EDOA 4LTDA 4REQA 5FUBA 4QFDA 2Q5JA 4U5QA 3T5AA 1J99A 3I34X 1H2XA 2ARKA 2C5GA 3WTCA 1GPDG 4D0NA 1YWGO 2JI8A 1V8DA 2ZCUA 5AKJA 4M7OA 4C3OB 2RDMA 5FL3A 4AU1A 5CFZA 3ANNA 3CJTA 1YCGA 3N58A 1SIWA 4JWTA 4FB5A 4TYMA 4WBNF 2ODAA 621PA 1UJMA 1FDVA 3DF9A 1JDVA 5HZKA 2C9YA 4M7WA 1E18A 4AS1A 1IEWA 1PQWA 1U98A 1BWSA 5FBHA 3QU4A 2BEWA 2J0UB 2AT1A 1JXAA 3ADPA 4C3UA 1RXCA 2DAPA 2I6QA 4ARVA 1VJ1A 2XT0A 1L5HA 3WL6A 3II6X 3UWSA 1W59A 1U5BA 5HK8A 1BH6A 4PPNA 1IZ0A 2OESA 2R85A 5AI0A 4HDCA 3NJRA 2QG9A 3DMRA 1M1YB 1Y1RA 3KZNA 1N5DA 2DUMA 4WA7A 4PY2A 2IYAA 1RXIA 2EW2A 4UU8A 3CLTD 3F6YA 3VX4A 1WB4A 1L6RA 3D5TA 5GONB 3AILA 4MWGA 5KQGA 4AI6A 4D42A 3C3DA 5JAHA 3NM6B 1QO9A 4EGAA 3AVTA 1HI9A 1W1WA 4NV1A 5ITSA 3IAFA 3S2ZA 4CDNA 3RYCA 3HA3A 4MKFA 4UD6A 4LCJA 3MTGA 4PLYA 4WN9B 5GOZA 4A73A 5L3SB 3PD1A 5CM8B 4EY7A 1Y7TA 2ZEJA 1CS0B 1TCUA 1VKJA 1Q83A 2Z1DA 3GQBB 4WERA 2QJOA 1NF3A 2JAWA 4QTXA 1G4HA 3M6FA 3OUUA 2IZ5A 1FUKA 5EMHA 3INYA 1K9VF 4KSCA 3RVDA 4W1PA 3TXYA 4Q00A 2RGDA 3A4NA 4ZU1X 1H3NA 2BHRA 4D41A 4ECAA 1RRFA 3I92A 4B48A 5KOHA 3MOGA 3TLAA 3R7LA 1SD5A 2FA9A 2B4YA 4IEIA 3FGZA 1KZ1A 3FFTA 2W8ZA 3HM2A 3UYLA 2YXEA 1NXPA 3JASA 1OWMA 3EHDA 1TFUA 4I9NA 2P9HA 1P1KA 1AO3A 4GVXA 1A9RA 3AHIA 3BXFA 4JB0A 2IPAB 1GNTA 2Q1XA 5E4JA 1X70A 3B48A 2D1YA 3EDRA 3EE6A 5B55A 2JD1A 4KDFA 5I4CA 4DC1A 4BO0A 4GMGA 2AKAB 5CUQA 4TL6A 1U7HA 5CD1A 1PYGA 4MQBA 5EMNA 4EPTA 2VPQA 4BNNA 4P2BA 2I6XA 5EVCA 2QBYB 4WXYB 5DULA 1GQOA 2BWJA 3D4LA 3SQNA 1Z6TA 3ACCA 3B2QA 4XDZA 3IEUA 3J7TA 4M54A 4FMCB 4HDNA 2RBEA 5AUOB 3SQOA 1JJ7A 1G16A 2I1WA 1GG2A 3NXSA 3Q87B 4NEGA 4ZOLF 1V5IA 1AH2A 4FHCA 3RUAA 3IH5A 3G2HA 5ERXA 5K8JB 3SVLA 3UOWA 4IH1A 2VWPA 1RHKA 2LWIA 4FLEA 3F8SA 3JAKB 3LNTA 4BFWA 4MI3A 4M55A 3FTNA 1NHGA 1WB9A 4V38A 2H29A 2QOEA 2V6GA 4MUFA 3NHZA 3OOEA 1JEQA 5DSZA 2EG9A 3O5AA 3PNYA 3EF3A 5KVQA 1WZUA 2JJ8A 3L07A 2IBMA 4GLOA 4XQGA 4Q4AB 3MSXA 3DO5A 4UW9A 1X14A 3EGDA 4IRUB 2NUAB 1M34E 2HUPA 2W0MA 5EYPB 3EFEA 5GZ6A 2OCYC 4M8LA 3GIDA 1NVEA 2PUWA 1LSOA 2QSZA 4F4IA 1AKUA 1QE0A 5JZVA 4DREA 2Y1GA 3C8ZA 1J00A 1Z36A 4ZPJA 3EZ6A 3OFJA 2VAWA 1KJZA 4OXIA 5G2OA 1EWYA 1K5HA 1NFFA 2GK3A 2FSIA 4NJEB 1TUGA 4KYVA 5CJ2A 1R6DA 2O7VA 2VSOA 4QOHA 3TQRA 5LYJF 1AUOA 2IL1A 1IJKA 3DXZA 2CVPA 3HCNA 1K68A 4HR7A 3RGWS 4FWTA 2XDAA 4I1YA 3O31A 4E4RA 1JEDA 3AOEC 1KF0A 1C41A 4N1AA 2CZQA 2HY7A 2RIRA 4PG8A 3X2SA 2FSHA 2GPTA 2GZAA 1VI2A 2Q62A 4ACBA 1U28A 3L0PA 4I1RA 1DEAA 4OO3A 4RPGA 5FO0A 3NGLA 1XEXB 3U44B 1E2LA 1TYEB 1VMKA 2B2CA 3P96A 3SIXA 1YS1X 1PK7A 1GITA 2ZAIA 4HHEA 4ENPA 4PFJA 1WM1A 4X64B 2CD7A 1Y5NA 1RI5A 3CW8X 3H1BA 3NALA 4KW7A 1SXJE 4RJIA 5DCYA 1JR3A 3MWGA 4X8MA 1CTQA 1HFEL 1MC5A 3D5EA 4K9RA 4TTAA 1KXZA 5EJ9A 4CG2A 3ZHUA 2AN4A 2ZTVA 5CLIA 1Z07A 2Z2XA 1DTWA 3CY6A 2QXTA 3K3PA 5FB3A 3RVKA 4KJXA 4AJ2A 3TZBA 1QQ5A 5B1DA 3ZU6A 3GWZA 3RUHA 3VTKA 2JFVA 3EGEA 4Q3DA 2IW3A 5AVJA 1KMMA 3SEZA 3TCNA 1OILA 3FZQA 3G5TA 1BW9B 5DK4A 1JLRA 2DKOA 4ABTA 2R97A 2R00A 3KEGA 1Q7CA 4NNOA 1JNXX 5CH5A 3GARA 5IMBA 4Q6WA 3KSDO 2A57A 2C5SA 3DCYA 3QLVA 3TLEA 5KREA 4N8EA 3DTVD 4ZDIA 4IMJB 5LJLA 2I91A 3EFHA 4Q1DA 3AI2A 5THQA 3L0SA 1QYRA 4DMUB 1JU3A 1QHYA 1DXHA 3BXGA 4G26A 3IIIA 3IB3A 4UHDA 4BYMA 5SZKB 3CZRA 5CITA 2W2KB 2WJVA 2XITA 3QYJA 3ZHXA 4C08A 5FWXB 5G0WA 1USUA 4RWZA 3IKMB 2VP6A 3DMTC 1U2DA 1YR1A 3WP1B 1XWWA 2JGDB 2XYHA 4FDTA 1JR2A 4ONEA 3RS5A 3LHFA 3RRMA 3W5SA 1KHHA 5NULA 5C5CA 3W2TA 1D4FA 1O94D 2WLTA 3SXJA 5F7JA 3D8TA 2V96A 4HMQA 3UV3A 3EDYA 3GT0A 4PHHA 4O0MA 2MDTA 4A6XA 3DOEA 1ACJA 2VUHB 3F8TA 3OX4A 4NICA 4U8GA 4DQKA 3DE1X 1UWCA 4LRWA 2GB4A 4CNBA 5BXQC 4LOJA 5TGTA 1G59A 1W6UA 5TPZD 2F67A 1R10A 2JFHA 3WMRA 4CIYA 1QB8A 1Z2PX 2X3YA 3EAGA 2O07A 4FSDA 2FZEA 2GSWA 3JQPA 3NW9A 2B61A 1R50A 3GGSA 5EKDA 3M6UA 2VHVA 4MITA 3A3YA 4IH9A 3OQ1A 1YA8A 4KGXA 2HBQA 3HDYA 4RPKA 5C0OE 2OQVA 2ZJBA 1VFPA 4IHJF 2IV3A 4MROA 3FNIA 1QF9A 3C8HA 2AEEA 3A2KA 1NOKA 1QV6A 2PT6A 1DKRA 3R3ZA 3HS3A 1PSZA 3DL7A 2Z5VA 1JWBB 1L4LA 1Z39A 1V8PA 2F62A 2YIJA 3EYAA 1E2UA 3OZIA 5CT9A 5G4KA 3TQCA 4LTMA 3UC9A 1WQ4A 2YS7A 2ZUVA 4L3WA 4M49A 3VYTB 3GLIE 2G09A 2OY0A 1QP0A 5A7GA 3RW9A 3LLCA 3CNNA 3HMQA 4E2WA 1Z8HA 1E1NA 5DNUA 2SHKA 3Q7RA 1IBKB 1U0RA 3KKLA 1EM8A 3ZVLA 2Y76A 4A6DA 4DIOA 3CB2A 2XA1A 3AHDA 4CL0A 3IT2A 2QD5A 1NKTA 1TCCA 5AJTA 3UCFA 4EZIA 3IJ5A 4FS3A 5HJ7A 3B78A 4JB2A 4XVHA 4B7CA 5ICMA 2ROQA 4DA6A 1PGNA 3FIUA 4D98A 1VHDA 4HBZA 4ND1A 1JIUA 2VAXA 2VBCA 3PUYA 3MLAA 1OU0A 2Q3JA 3GFBA 4JA2A 4TLAA 1LTQA 4ZCPA 5IAAA 3EDCA 3K6SB 3FPSA 2ZZKA 1QYWA 2FW1A 2RAVA 4WLFA 4BX0A 1JHYA 3C8DA 3VR5H 2OENG 4KTTE 4QHYA 2HRZA 3RANA 1QWSA 1KP2A 1TEVA 1Y1LA 2ZYIA 3UPTA 1L7DA 2C8KA 3BHMA 5DDIP 5JSFA 2A59A 3SYTA 4A8JC 4CMKA 2E4XA 1KJNA 1JP7A 3INTA 1C7RA 4U6NA 3C3YA 1RKQA 5AOAA 2IEZA 4W1RA 1R16A 1UBUS 2NVBA 1US8A 3AUYA 4I14A 3L7MA 5DI9A 3WA7A 2WKWA 2WG2A 3PPYA 1U7TA 1Y1QA 2FDRA 1J2EA 5FH9A 4NJOA 4IDQA 5DB4A 5INTA 4YP7A 1L5WA 4G8DA 1AA9A 1J70A 1PG5A 2BFFB 1F48A 5H82A 5HCUA 2PWYA 4DJJA 1RYDA 4LXYA 4PSKA 3PU6A 1IXRC 3W8DA 1QHXA 2UYQA 5EJFA 1NVXQ 4G4IA 3OD1A 1YI8A 4YAKA 5LMCA 2C96A 2UUAB 4XX0B 1X8JA 4CN8A 2RG1A 1NDHA 4Q9IA 2OYRA 2YINC 4LRQA 2FG5A 2FW6A 1OAKA 2GF2A 2HQRA 3EQ2A 4QU9A 3UIEA 1GA6A 2H1SA 4X6YA 4PZDA 1GR0A 3RC9A 1Y33E 1E8MA 3I32A 3TW8B 4C4PA 4F3TA 1EU1A 2WTBA 1WCYA 3VAAA 1X15A 2WDPA 2VDWB 3BMNB 1I9CA 1H22A 2OXTA 5ALJA 2AOTA 2VH1A 1CF2O 3ZXUB 2OBXA 3ME5A 2YJZA 2X4GA 4BKQA 1N77A 1TADA 4ENWA 4Z9BA 1N7GA 1S1CA 2DBVO 2OQIA 3VR4D 3LU1A 4U0KA 5IT5A 3K5WA 3OF3A 1WUIS 4C21A 4UNQA 1S2DA 3K0AA 1ECBA 3FPJA 2CXOA 4LZAA 1ZI8A 4C6RA 1NW4A 1E1QA 4ZZ3A 2VDJA 1MABB 2H3HA 2HPHA 2PJZA 1DCFA 1L4HA 2YY7A 2WMOB 3CSDA 3IQXA 1CDZA 3GJ6A 5HKOA 5EJ6A 1I1HA 2EWMA 3FUTA 3GD7A 4FNMA 2YHAA 5GOTA 3LI2A 2YVUA 2Q2QA 2WYUA 1Z33A 1AA6A 4J0JA 1TAUA 1COZA 2E4WA 2ZIZA 2PNJA 2EFYA 5TJ9A 3BREA 5CMLA 4NTZA 2GHQA 3I9V1 3E4DA 3CUUA 3FPEA 3NP7A 2ZM6B 1VL6A 1NRJB 1JAYA 1SKAA 3LYUA 5E8RA 4GP7A 5BSUA 1XRLA 3EOZA 3NVAA 1C8VB 3HYNA 3FJYA 1XZQA 4NC9A 1E0DA 5LLDA 2WHQA 2ZYTX 5GTDA 4RVHA 4OH7A 1Q1QA 4A7PA 2DTDA 4YAIA 1W7AA 2EBWA 4HDKA 1ZMBA 3AXSA 4AF8A 5JJCA 5SYMA 4NBSA 1T8TA 3SC6A 1G7TA 3GP3A 2DFLA 2H1LA 4CEIB 2ID7A 3BDIA 4XQ9A 5LU9A 2YOGA 2G40A 3H65A 4LSGA 4MVJD 4E4YA 5FWNA 5JEEA 2JIRA 4EG7A 4IAOA 4Y9TA 3SN6A 4OKSA 3HLKA 3F3MA 1CS0A 3G3EA 3IFSA 4H77A 3L9XA 4C76A 1HNNA 1XDWA 4RQBA 3UUWA 4MA0A 2GWHA 4JVNA 2G1JA 4WA8A 4H7DA 1GAJA 3IBTA 2HK7A 2AQIA 1H0RA 3JQAA 4I5FA 3G2MA 1P9WA 2R7KA 3H13A 4RHYA 3U7JA 4E03A 2G5PA 4PGAA 2AWNA 4YCCA 7GPBA 1HG1A 3C1UA 2E0IA 2AYZA 4BV2A 2WKQA 1J90A 3B6ZA 4PBSA 5EKSA 5BP7A 5HVNA 3H18A 4B47A 3CZMA 4H4DA 2X0KA 3CONA 2GLUA 2O59A 2X4IA 3OE7D 4WV3A 4X0EA 3W5UA 4K6OA 1DQPA 3VH2A 5CH8A 4P3XA 1BE8A 1EM8B 1DDGA 1SGWA 4OP1A 4QVGA 3A2NA 2VSQA 1W73A 1FDOA 2YFHA 4C4RA 4DYDA 4H3VA 1LDNA 1FFGA 1I14A 2G1KA 3K1JA 5AKZA 2GQ0A 4OATA 1FYVA 1WS6A 2PGOA 1UM8A 5EIEA 1Z6ZA 3J7AC 4B4DA 3SMQA 1JEOA 3FMOB 2OBLA 7REQB 2Y67A 1DX6A 1ZH4A 2JHPA 2QN2A 2XVZA 3LUKA 2I2AA 3BWVA 3UQZA 3V46A 3OETA 2HCJB 4B6SA 1LCIA 1E7RA 3QEMB 1U0BB 2XD4A 1RI4A 1QZZA 1RWPA 1NTRA 3WGQA 3EIWA 1RYYA 4CMGA 4EENA 4IFBA 1USVA 3NVDA 1XVUA 1YI0A 4QAQA 3VHXA 1K2VN 5FNVF 4F0JA 5JD5A 1HYHA 1DLJA 3GRAA 2AN9A 4FLMA 3QYFA 4WKCA 5MFPA 2BKVA 4JI2B 3H1GA 3UAYA 5KYXB 1DAKA 3IVGA 4E5MA 2BGLA 1UCFA 4J0KA 1SVKA 2SCUB 4JCOA 3LPLA 5K0SA 4DHEA 3GXOA 4PICA 4ZP1A 4CHGA 5IKXA 3IAXA 4I4TA 3WL4A 3KB1A 4K88A 4R2LA 1WXIA 4P3OA 4YJFB 1UKZA 4CKBB 1GDTA 4JXJA 4AP6A 1S3GA 3G0IA 1ZOSA 2G0NA 3NHWA 4KXWA 1XU7A 1I5RA 1NJFA 5FO1A 1Z6QA 4G9GA 3L2OB 5EJIA 1H6CA 5AUQA 1NN0A 1RAIA 2A4MA 1C0EA 3RV3A 3F4LA 4A16A 2EQBA 3B6MA 4TMFA 3UGKA 4G5XA 2CMGA 1KZ4A 4TRMA 3PGVA 3NC0C 4DJ5X 1LBTA 3HNPA 2W2KA 4Y2JA 5K3BA 2CLSA 1RJDA 1J1UA 1UKAA 3INRA 1C30B 4N8DA 1BS9A 1JG1A 1BVUA 3AM3A 2FHPA 4PU0A 5IVKA 1VRVA 2KM1A 1YNSA 5H59A 4INPA 1M2WA 3VC3A 1FXUA 2Y1XA 4A9AA 3PL5A 2QTFA 3BIXA 3W7BA 4OHBA 3SC4A 3TSZA 5GINE 2AE1A 4YV1A 4LZNA 1T15A 1DWUA 2IBTA 2IYRA 4K0RA 1EVIA 2HNKA 2O3UA 2BFEB 1JHQA 1SN7A 3IAS6 1WP4A 3FTPA 3R1IA 4FGUA 1DRVA 1TZMA 5BT9A 1JYFA 5E1MA 2IV7A 4Q21A 3SHOA 3TLXA 2B2XA 3AIIA 3D2CA 3R20A 4YO7A 1SHUX 4L5IA 1PFUA 1DMSA 2FH5B 2X8JA 4JLDA 1VYHA 5K0NA 1QIHA 3UT5B 5LOVA 5JZMA 1B0PA 4DG9A 1JTEA 4LV6A 3ZCVA 2GVDC 3WSTA 2M6LA 1B8PA 3KD3A 3IO5A 3SJAA 1L5LA 3N5CA 2ZAOA 4M0DA 3ZYCA 1ZNWA 3LHDA 1S8NA 3K1YA 3B1ZA 3IHTA 1JHUA 2RARA 1N6RA 4L4RA 4LZLA 3U80A 3GHHA 3JYHA 2O4CA 3ECSA 3KXPA 1MOPA 1E2QA 3W4JA 4CCYB 4H18A 4E2ZA 1O6BA 2BFBB 1JR4A 1XHEA 2GGSA 3NAGA 4XARA 2ZUEA 2C3OA 3AMVA 4P38A 3UJ9A 3ZI7A 3BB4A 5DWQA 4K6HA 1L7NA 4QULA 3EH1A 1SCAA 3QKRA 5KVVA 1BD4A 4YT5A 4CZ2A 1NXXA 4DZRA 4ZPXA 4D6XA 2P9EA 4PHTA 4DTIA 4WCVA 1QM5A 1PVVA 3SKYA 1EA5A 2YXLA 3NWPA 1NNLA 1OREA 2P5TB 4E5PA 3CH7A 5BO5A 3AIKA 3A37A 1JDUA 5I7RA 4D8TA 1LV7A 3RS8A 1CCWA 3BA1A 3E7FA 3OIUA 4O2AF 5EXDA 1A9ZA 3ES9A 3GPDG 1ZD4A 1X7XA 3STWA 2Z6UA 4Q4AA 2I4MA 1MCZA 3MW8A 3DE2X 1N57A 5JVDA 2PO5A 4OGKA 1HKUA 2I03A 1K6JA 3AU9A 4QTUB 1OA1A 3F1KA 4B3DA 5FA6A 1PL8A 4QU8A 3MBIA 2QNRA 1RI1A 3PFWO 5JMOA 3B9PA 1II8A 2YV3A 4XDGA 3QGMA 4V0ME 1M6VA 4IV5A 3QQ5A 1L1EA 1XTKA 3EIFA 4G0XA 4B79A 1REQB 4YIHA 1CERA 2BL4A 1BKDR 4JD5A 4XPZA 3KSBC 4XM2A 2GM4A 4FW9A 1RAHA 5LU8A 4JP2A 3WBBA 1OBVA 1KDZA 4Z7QB 4CM7A 3LUCA 2FAXA 1X1RA 2EKPA 4IJ5A 4Q9KA 2D00A 3NTRA 2ATIA 3HC7A 3HYSA 5FADA 1AKWA 2JFXA 3G6KA 3LQFA 1PZEA 4DIMA 2YIMA 4DG5A 4P4SB 4MW5A 4BN5A 2P11A 2R8BA 3C4JA 2BHLA 3KB2A 3WQSB 2R8XA 1OI7A 4EFMA 1BU5A 4HH4A 1DUIA 3ZE7A 1RPAA 3C48A 5AW9A 3PF8A 4M83A 1QK4A 3O4RA 4GI1A 2W2LD 1F9EA 1KXJA 1SQ5A 2DX7A 4Y6SA 3VBCA 4H0FA 4BLUA 1L3CA 1UJ2A 3W2HA 5KOJB 3HXMA 5KPJA 3HB9A 1QGYA 3CX7A 5EYPA 3VI4B 1CUAA 2V8OA 2A0XA 2Y1OA 3QX7A 4IGKA 3FMVA 1RYMA 3E5HA 2FSUA 3K9BA 1VL1A 2F8LA 3NUZA 4A23A 4X8HA 3H1PA 4EEXA 2V6BA 3E9YA 3O2QB 4FS8A 3RD5A 4DARA 4EGJA 1I3KA 3KCQA 3OT1A 4GL4A 4FGLA 1VPWA 4EZBA 5MN5A 4R31A 1F8YA 2VEDA 3KVVA 5K2MA 3FSJX 5LYYA 1RLMA 3RUPA 1KI6A 3I2IA 4KYUA 1L2TA 3AR7A 3FVWA 1A5ZA 4HN9A 3ID6C 3W5AA 2ZT7A 1NC3A 2QQGA 3WGLA 3UMCA 4RMGA 2EV9A 4BB0A 3G8BA 5C1PA 4XIJA 1DQSA 2ZAMA 1IVNA 1T2EA 1VQ1A 2QBYA 2KHZA 1ULSA 4FFVA 5A2QA 2WJIA 4IIEA 4AECA 3H0EA 2GJ4A 2MT9A 1BKYA 1JZSA 4FSXA 3MTJA 1NJ1A 1O8CA 3OT1B 4WNYA 4MS4B 5IKOA 1L5QA 3DWFA 2WYIA 1KK0A 1FMJA 1KYWA 2EP5A 2QHXA 3O75A 3OE4A 3S2EA 3R5KA 2C9CA 3KQLA 1H65A 4MRNA 4W9RA 3ZCRA 4N40A 2KX7A 4W63A 5JWHA 3W79A 3DFMA 3J81k 1U9YA 4YRPA 4K2AA 2HNBA 1UXIA 2YMPA 4A2PA 5AXAA 3ZW7A 4BP1A 2BTEA 1O9BA 1GGNA 1ODSA 5T8KA 4CI0B 5CB0A 5C9ZA 1MLDA 1IZ7A 1RADA 3I39X 1FJXA 4F2GA 2HU2A 5KU7A 2FX5A 2O48X 1X1TA 1QFSA 3DLPX 3LDHA 1DB3A 1M2VB 2WWXA 1SCJA 4JYBA 2ZUUA 2P78A 1JTFA 4GMDA 2QVYX 1BO6A 3G0CA 2QQFA 5CVUA 121PA 5KJEA 1APBA 1FFYA 3I6QA 1YE3A 3LF1A 1MRSA 5FNVA 1SCIA 3OPXA 1SC1A 3H1FA 3AVVA 1WXQA 4WLEA 5T6BA 3UHFA 2NU7B 4MHOA 1QHSA 2XJ9A 2BI8A 2Q7XA 2QAIA 1HURA 2FFJA 2Y0EA 2Y4NA 3BDAA 2AGVA 1X7WB 2XVMA 3CSSA 1LPOA 2QXYA 3ZDZB 3A70A 2YZGA 3NDPA 1ZU5A 3M83A 5BR8B 2VF7A 1SPXA 2ZBFA 3AP1A 4LYHA 4P36A 3TIFA 5LA6A 3DM9B 1PSDA 4BXOB 3F6EX 1JKJB 2FUCA 2NUBA 3TLKA 3LY9A 3N07A 4XWAA 8AT1A 1XDUA 1I4LD 4P5DA 3SX2A 2Z2YA 5EIAA 4JB3A 3KETA 1YS7A 2QJRA 2WQ7A 2HCRA 5BQXA 3E9QA 2O1EA 1L5HB 1T6BY 1XXHB 3B9QA 1MO2A 4G8BA 4MW6A 2NO4A 4QEDA 4Y30A 5EZQA 3OA0A 3WFZA 2AN1A 4D4IA 3K9WA 4XTRA 1ESDA 3WHLA 4D3YA 1N9GB 5C35A 1PDOA 3D6AA 4F4CA 3HCWA 3MM4A 4X7MA 3PQ6A 2OV3A 3QWIA 4HGOA 4LYYA 5DTIA 4RHUA 3RK0A 2VJDA 4A0HA 2WV7A 3QPUA 4AG3A 3RAFC 1GRCA 1JHRA 3KTAB 3OU7A 3IQWA 3P97A 4KWTA 4QELA 4B3IA 4M1EA 1SK9A 3U4QB 4DDTA 3LOPA 3FCSB 1VJGA 1Y5MA 1PYDA 1UDRA 2JBAB 3I8XA 1DHRA 3HUTA 4LRTB 5EVJA 3ZDFA 1KO8A 4L3OA 4E11A 4EJ6A 2OGWA 1SEPA 2AEJA 3E4CA 3L7KA 4G37A 4KHPB 1EWKA 1GZ6A 3D3QA 3TAXA 1MJNA 3N8DA 4I19A 5FULA 4ZCMA 5LBIA 4B43A 1L4EA 1W29A 1RLUA 1EIZA 4HYEA 8MHTA 3FZYA 4XQCA 4GZ6A 3THYA 1TU3A 1JIKA 2J3IA 3FVRA 2XZLA 1NOIA 3TFQA 4DG8A 2IF2A 1VJTA 3IAM1 3QOXA 4KQMA 1JH9A 1L7EA 1DIHA 2OFWA 2ZRMA 4OX9Y 2QAJA 1ZUHA 2NM0A 3H9QA 4I8DA 3FNGA 4LK3A 5LXTB 4PC3A 3HE3A 3FTEA 3H97A 4NABA 4P3PA 4TV8F 5EUQB 1RAFA 4RVGA 1JJVA 3DOIA 1VBMA 4QGAA 1KKLA 1U99A 4ZXPA 3EWNA 4FDLA 3BGSA 2VF5X 2ZKIA 4HC4A 2AD1A 2OAGA 4FIDA 4XM1A 5AWFC 1FNNA 1UT5A 3RUCA 5D3MA 4DCNA 2I7TA 5J47A 1MGPA 4TSRA 3WRXC 1LI5A 3GRCA 1VIAA 1J56A 2TMGA 3QENA 4CCWA 1W36C 1I7PA 2B82A 1OJ7A 3PVSA 4W7SA 3SF8B 4C88A 4AZWA 1Y7IA 3TWOA 2H1CA 1X8LA 4I6EA 5JCJA 1G8HA 4XWTA 1P7WA 3C16C 4JJ8A 3RROA 2HR1A 2PUFA 2WU3A 3GJ3A 1W0JA 1OYOA 1TX4B 2CXTA 4LKOA 5DFAA 5C4GB 4UQOA 3MCVA 1G98A 2ECFA 3D3JA 5ABPA 4FKZA 1AQ6A 2WSYB 1AQJA 3D6UA 3C1TA 1MJFA 1FJHA 2QUJA 1VA4A 2EDAA 1ADFA 1X2BA 5A4KA 3UATA 1CZKA 2PLRA 3UK7A 4DE5A 1UIMA 1QO7A 3WWYA 4EJ0A 3BX1A 2I62A 5EJEA 2P9TA 3WQHA 4OFXA 1OASA 4WGFA 5DF1A 5K0JA 4TYQA 4NCKA 4YYEA 1FP2A 1SJ9A 5J58A 4ZYLA 1T10A 1B74A 3AUSA 2ZJYA 3KWMA 4MHTA 3PUVA 1ZUNA 4CEHB 2XRYA 3OPYB 5DYGA 1TXGA 1KDVA 5ALKA 1JLLB 4AJHA 1I01A 3KDPA 3RC1A 4CKBA 5IJWA 3HBFA 1K3FA 1O4WA 4XASA 1IPEA 1G5TA 4YJ2B 1A7JA 3K05A 5L3QA 2A14A 5FWYA 3DZ8A 2C54A 5ES3A 4P83A 4RGBA 3RHTA 1DC8A 2AJCA 3KL2A 2P4SA 4MICA 4OXRA 5E3IA 1NUTA 4ZDJA 1E3JA 3AUKA 4TS3A 4W5WA 1EFCA 4PGFA 4ECEA 5BWCA 8GPBA 3QVTA 4RHTA 4DCTA 1EFVA 2DCMA 1PFKA 1L5OA 1WCXA 2R6JA 3BG5A 4TWRA 2XQGA 3PDIB 3ZK7A 1MP0A 1T2DA 4M0PA 5K05A 5DI3B 1V43A 4CF3A 5KQMA 1SQ6A 3AR9A 3ETLA 1D9XA 3I2GA 3KKQA 4EEZA 2ZJ8A 1KYZA 5F2NA 2GESA 4RKFA 1DCMA 1XC7A 4BTVA 4P82A 5ECWA 2B69A 2ZUDA 3BJEA 1P17A 3FYUA 3ER6A 3OU2A 2NQ8A 2OECA 3CZPA 3H2KA 3HWRA 3R41A 2X0EA 4WZAE 2Z8YA 1SULA 3FR7A 4WLNA 3LUDA 4E2FA 1Q57A 3AVPA 4XJXA 1B1AA 5I01A 1ECLA 4RDHA 5LSAA 3O84A 2P2LA 2VNKA 4KKVA 4DZZA 1XMOB 4KR2A 4C04A 3QLVC 1V9LA 1GEGA 4U7HA 2NU9A 1W5EA 1K6XA 1XD2A 1SCBA 4F86A 3L5OA 3GG2A 2WV9A 5J2UA 4LMAA 1DNPA 4YWHA 3U26A 4FM9A 1ECFA 1MJ5A 3FCEA 2WU0A 4FFLA 2G71A 2CSXA 4B85A 3O1LA 4W82A 2ZIGA 2I80A 5IPFA 1GM5A 1NBMA 3TG8A 4NH4A 4OHZA 2HLPA 4G4GA 4HDMA 3IDFA 3UJPA 2Q3DA 2H7VA 2Q9BA 4S1NA 1YGPA 3D2AA 2NU7A 4BB9A 2CNKA 2H1VA 4E30A 1B93A 4GWLA 4P93A 4U8HA 1MPXA 2HA2A 3VVBA 1YK0A 4MA5A 3K8QA 4LAFA 3M6MD 1SFRA 1ZOLA 4F85A 2G70A 5KOIA 4M86A 2J7KA 5REQA 3I0NA 2C84A 3TLYA 2KLHA 4MVJE 4EUFA 4FHGA 4C0AC 5HZHA 3S7TA 2IX3A 5BRAA 1SHTX 4ZCTA 2BGGA 4GOOD 3RTCA 3L9WA 1T26A 1WF3A 2PGAA 1V1JA 4P3KA 3D3WA 4QU5A 3GNLA 3EIUA 3UA3A 1HKHA 4UDYX 1M1NB 3JRWA 3CTMA 3CMMA 4M8NE 3T9AA 1Y89A 3A28A 1HUQA 4U5XA 3R3XA 4CR6A 1MA0A 3A6EA 1E9FA 3ENNA 4KQCA 4DV3B 3T3HA 1GVNB 3NM5A 1CQXA 2A3NA 3ZXYA 2ECPA 2OV4A 5AVSA 2ERXA 5JFOA 4JGBA 1RXSA 5C8VA 4XRRA 2IOHA 3B6EA 4TKLA 3VYVA 5BYKA 1T36B 2GKGA 2P69A 5F12A 2XHEA 1P39A 2XGOA 4TROA 5I7VA 4X91A 3NPMA 1T1GA 3PITA 4ZCLA 3WBFA 5AI5A 3SX0A 2WWGA 3ZLUA 5REQB 1JA0A 3NDJA 5JMWA 1GU0A 1ONPA 3MTDA 4RJLA 2QENA 4I1PA 3K32A 2VNSA 3K0FB 1GL7A 1TYBE 2DWPA 2Q5FA 1TQ6A 3RFCA 1B76A 2CB0A 2AHRA 2B7CA 2H9IA 2V7EA 2VJPA 4QDXA 5FPSA 4B7AA 5BN3B 2OYSA 1D2AA 2VAMA 2JATA 3AVOA 5KSOA 2E21A 4ARAA 4YAGA 1IBSA 1C1YA 1H3EA 3OOWA 3U4AA 5DMHA 4IGIA 5I45A 4EY3A 1C80A 1XKXA 4UMVA 4W1SA 3QTTA 3PYLA 1XN1A 3DLBA 4G8CA 4JP1A 4GP9A 3PXGA 2GSDA 1RKBA 4R01A 5KKCA 1AXEA 4PPYA 1F9AA 3ZCTA 2HHHB 4RF3A 3C5WP 4KXFB 4H4CA 5LCXA 2AYYA 3W6ZA 1FSFA 1NE2A 2FQYA 2V4ZA 1RU3A 4TTVA 3P9RA 3S4YA 1TVMA 2HA4A 4TXHA 4YRLA 4YRAA 2E7ZA 4JVMA 2GEBA 3B1KA 2ZYGA 1TLFA 2O5VA 2ZITA 3E18A 4NSNA 2PGIA 1Y8AA 3DA8A 3P9ZA 3X1JA 1Y7HA 2C03A 1DP4A 5BR1A 3HDQA 2I66A 3LCVB 3PQFA 4XJSA 2JFYA 4MI9A 4RD2A 5KDLA 4RELA 2GYVA 1DL5A 2X15A 3DE7X 3I2YX 2WU1A 4O1MA 1K7SN 3R8FA 3Q3VA 3IUEA 2J9FA 3RVBA 1G8KA 3E0XA 4IIBA 2ONKA 3AR5A 3GJSA 5DM2A 5JZBA 1JDBC 1CVIA 5HJEA 3D4NA 4IMPA 4MJXA 1K2WA 3FSGA 1QLWA 3LYHA 3LPCA 1JB1A 2C98A 2O2JA 4J4BA 4KIFA 3PJDA 4UHBA 3T9CA 3LV8A 3H4TA 1MVLA 2GDJA 3DLAA 3MUEA 4ZVKA 4Q01A 4CLHA 3PWSA 5B2EA 3L8EA 4TM7A 5HE9A 1KEPA 2UYCA 2MIIA 4WESA 3VR0A 5CEJA 1MO5A 4ERXA 1GFIA 4JYAB 1ODFA 2UKDA 2XMGA 3CUKA 3KPVA 2ZCJA 4EWLA 4Q39A 3UJHA 4Z9AA 4OQNA 3UWMA 2BAGA 4H9GA 2QJWA 4DF3A 1EFAA 1QFYA 5DO9A 2KMLA 4EVQA 4LCBA 1UOPA 4C6TB 3H6HA 1U3TA 1P9OA 4JZKA 4E32A 3D3NA 2Q27A 3O8QA 3S99A 5L4SA 3ITNA 2XDQB 5ESXA 1EAMA 5JASA 1CEYA 5BN4B 4HKTA 4BO2A 3HJRA 1U3FA 2XUQA 4Q4JB 1DBIA 2IFTA 3GEEA 4KWHA 5DYWA 5A6VA 1E0AA 1KEEA 4K40A 1BHJA 1KMCA 1ABFA 5DBEX 1J8FA 5A0FA 5B1YA 1G8FA 1GLGA 1OSNA 4D8UA 3N7AA 4B81A 2Y68A 3ADKA 4MUBA 3VU3A 5BT8A 3PLAE 1EVYA 1TZJA 5ULLA 2PKEA 1MQ8B 3GZJA 3A6JA 4MVWA 2WP0A 1L4MA 2P2SA 2BE7A 4J91A 1NBWB 4A27A 3HKDA 3DE3X 3TZLA 3I8SA 5KJ6A 1VZ2A 4KK4A 2H4FA 3W7AA 3NIFB 3KS9A 1G8AA 3ZQUA 2A92A 2IZOA 5IC5A 5JI2E 4R2XA 3WGHA 3O3MB 2R8RA 5H81A 3DPUA 3JATA 2VBFA 1DAMA 3FYTA 2C7GA 3DB1A 3GN1A 4B73A 1ZJWA 3OQIA 5AM3A 2YV1A 1P1IA 1U7UA 2I76A 2WM8A 1QV9A 2ZBEA 1QAQA 1GSHA 1RQ7A 4I50A 4L15A 4UE6A 3T5CA 4XWWA 3LVQE 2HQBA 2X2EA 1X7YA 4MPRA 3C24A 4OA5A 4ICIA 5D1HA 1Z4JA 2XCUA 4IKEA 1IH8A 2ZI9A 3L7CA 3U5TA 2CCJA 3HLTA 3EVTA 2QAGB 2YVKA 4YI3A 2QVXX 1TA4A 3ZHOA 3TEJA 4E94A 2A1IA 4KDEA 1UM9B 3GLGA 2BFPA 1AXGA 1G6Q1 1U0NA 2E6UX 4MQLA 3S2FA 2HTEA 2JCBA 4KUHA 4F6RB 5I7HA 2L42A 2SICE 3Q40A 1RXYA 3W2IA 4URYR 4JEIA 4BLRA 1GVHA 1KYYA 2IP2A 4XDHA 4LJAA 3QUTA 4KXQA 1OZFA