4CR7A

Crystal structure of the n-acetyl-d-mannosamine dehydrogenase with n-acetylmannosamine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
261
structure length
260
Chain Sequence
GRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYEEPGAIPIACDLDRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGKDGRSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAMIFGGMREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLMANNOSAMINE 1-DEHYDROGENASE
publication title Crystal Structures and Functional Studies Clarify Substrate Selectivity and Catalytic Residues for the Unique Orphan Enzyme N-Acetyl-D-Mannosamine Dehydrogenase.
pubmed doi rcsb
source organism Flavobacterium sp. 141-8
molecule tags Oxidoreductase
total genus 89
structure length 260
sequence length 261
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.1.1.233: N-acylmannosamine 1-dehydrogenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cr7A00
3DC2A 3PJFA 1DXYA 1WDKA 1XCBA 3K30A 2HRZA 4FFOA 3EZYA 1DRUA 4WPGA 1NTOA 1E6WA 4NMHA 3TSCA 3P7MA 3JQ7A 4TROA 4PLYA 5EQFA 1PS8A 3KUXA 1GY8A 3JQ9A 4FJ2A 1DHRA 1KY5A 4CMEC 3Q3CA 3QLJA 3GQVA 3F3SA 1UAYA 1BXGB 3S2GA 5JCXA 4EI2A 4DBZA 3U62A 1I3KA 2YV1A 1E3WB 4MKRA 4PZEA 4O1MA 2DC1A 3M1AA 3OJLA 1K89A 3DL2A 4FN4A 2Y1FA 1QYVA 5DCUA 3RC9A 4ALJA 1DFIA 1T4DA 5I9LA 3STHA 3ROKA 4NK4A 4EITA 1FMCA 1YWGO 3KVOA 4BNMA 4EUFA 2Q4BA 1PU2A 4QFDA 3FR7A 1ONNA 2Y93A 3WMXA 3JCZA 1TT5A 2GZ2A 2BHLA 4Y6PA 1DRVA 4PG6A 5EESA 2B36A 2X5OA 3BHJA 3QV1A 5JBIA 4D42A 3UCFA 1ZEMA 4DA9A 1RM3A 2IEDA 3EGOA 3O8QA 2PGLA 4WLFA 3HFGA 1P1RA 2BFPA 2BFAA 3HFSA 2YHUA 1J0XO 3UF0A 1WAMA 2JAHA 5L4LA 3VH4A 1R37A 4TKLA 4J9UE 2NU8A 3PGJA 4RL6A 4HV4A 3PLRA 1KBZA 1EDZA 1LLDA 2R6JA 3K73O 3QHAA 4NH4A 2AE1A 3AU8A 5HWSA 2GO1A 4XYMA 3W4JA 1YQXA 4XYBA 3AY3A 3S55A 3T7CA 4F6LA 3FNFA 3ZWAA 1U5CA 1B8PA 1PZGA 2J3KA 4L75A 1MXHA 3JYNA 4UAGA 5FWNA 5BR7A 5DP1A 4BS9A 4KTTE 3MOIA 3BXXA 4WOJA 3F5SA 3NGXA 2A9FA 1LUAA 4R3NA 4BVAA 4CMIA 1NFRA 1QV7A 4BHTA 4EJ0A 3INTA 1PS0A 5IZCC 3VKUA 4ONEA 4ZQBA 1MLDA 3UICA 2RH4A 4LK3A 4J7CA 4HNGA 3WBBA 3W8EA 1LRKA 4LCEA 3GGGA 1YKFA 4P4LA 5JYDA 2GERA 3H3JA 4RDIA 4RF5A 1NWCA 3ETGA 2D4AA 2VOJA 2ZB3A 3D4NA 1DIAA 2D5AA 2GPTA 4XQCA 3PJGA 1XYGA 4DPMA 2WE8A 1KOLA 2GLXA 4U5QA 2VN8A 1E1LA 2PZMA 1J49A 4NHEA 4D3FA 2Q1SA 5EERA 5ER9A 5CG1A 1ISIA 1HL3A 3OF2A 2D3TA 2GN9A 1VL0A 1JN0A 1CEQA 1DIBA 4OGWA 4R69A 5TT0A 4XR9A 2G1UA 2X9NA 3JD2A 3MTGA 2AXQA 5CP8A 4BO1A 4YT4A 4U0KA 3GFGA 2CF6A 1NAIA 1XHLA 2Q2WA 4WNCA 1PGPA 3ADOA 3KLMX 2BLLA 3DZGA 3EHEA 1OOEA 3HNPA 4KUHA 3WOHA 4HX5A 2X4GA 1B3BA 4IPTA 3DHYA 1R15A 3ZV3A 1EDOA 2FY8A 1GUFA 2GNAA 3OIGA 4FFNA 5TLSA 2X0IA 2NM0A 4GWGA 4XQGA 3ST7A 4BQRA 4W9NA 1E0DA 1NPYA 4OMUA 5AQ1A 1HDGO 2FPPA 1QXSA 1DC6A 2VRCD 4IQ8A 2HRBA 4BO2A 4UVHA 2DVMA 5JXWA 1E1KA 4L9RA 1ENYA 4MVJE 2JL1A 4NI5A 3V5NA 1XGKA 3DZHA 4R51A 4BNZA 3ULKA 1EFLA 1TLTA 3U49A 1YQGA 4R3WA 4IS2A 4FC7A 2JCVA 5L3ZA 3E03A 4H16A 1F06A 1VSVA 3C7AA 1T26A 2A35A 2AG8A 5TX7A 4BMNA 4R68A 3WQRA 1B0AA 1NP3A 4MVJA 3RWBA 1K6XA 4DBVO 3INGA 5T6BA 1GQYA 4ZICA 4BNNA 2I67A 1YVEI 4FD3A 4AJLA 4DQVA 2GUGA 3C7CB 3OQ6A 3EZLA 4AJPA 1YS4A 3NTQA 3GNSA 2C29D 3LT1A 1UDBA 4MVJM 2GR9A 4BNFA 4D43A 2QZ9A 1Z45A 1DAPA 1ZK2A 1BVRA 4FFMA 1A71A 1T4BA 1ZSYA 4OM8A 5TJHA 1XU7A 3JQ7B 2DT5A 4ND2A 2DUUA 3AM4A 5A05A 1ZNQO 3PK0A 3NTRA 3Q0EA 1KVRA 1RYEA 4GX1A 3H9UA 3U3XA 3U4DA 3SJ7A 2G17A 1WNTA 1XLTA 4JP2A 1IHYA 4LVCA 1DO8A 3ONEA 1KC3A 3WLFA 4DGSA 2CD9A 1HLDA 1L1FA 4E2XA 1HDYA 3ASUA 4YT2A 1A72A 1BXZA 1CERA 3RKUA 4CODB 4P22A 2PD3A 4UVEA 3EDMA 5CDUA 1I3LA 1HYGA 1E7QA 3FNEA 4IM7A 2XPCA 1KC1A 1Z7BA 2VZ9A 2QG4A 3MJVA 1X15A 4R1NA 4ZU3A 5JAIA 1I2CA 4JIGA 3S1LA 4HUJA 4M89A 1UDCA 3DMTA 1NNUA 1TT5B 2G76A 3ZHZA 2WMDA 5L53A 1I10A 1B3RA 1KEUA 4J91A 1CETA 5GMOA 1UZLA 1R66A 1NASA 3O8QB 1F8FA 3QVSA 4WK6A 3G17A 4EDFA 5JY6A 5B4VA 3VH2A 1GAEO 4YRAA 5CEJA 1NR1A 1PJSA 1B26A 5CAEA 2AQHA 5A1TA 2HJRA 4UULA 4YJHA 4OHUA 3OA0A 3GVXA 1M75A 1ZKMA 5H81A 5F1KA 2WSBA 2HCTA 3IC5A 2AG5A 5CFZA 1CIVA 3ZWVA 3S2EA 3FNHA 3IKVA 4FJ0A 3W6ZA 3WFIA 3L0DA 4JJGA 4FJ1A 4QUKA 4J2OA 1YBVA 3GR6A 1DC5A 3RC1A 2F00A 3BTVA 2FRDA 5EINA 4ZA2A 4E21A 1PJ2A 3L07A 3OSUA 3PFFA 3QQPA 1ISJA 2PKRA 2X5JO 4JN6B 4E5MA 3G1UA 4CMIB 3FNGA 2W2KA 5JDCA 4O6VA 3BTSA 4CPDA 3GG2A 2QHXA 5A9SA 4AJ4A 1KYQA 1U2GA 5C7LO 1GQQA 2C82A 3ASVA 3FSRA 1CJCA 3LU1A 3RBVA 2C07A 4D44A 2DM6A 4B8ZA 4C7KA 4G65A 5JS6A 2BELA 5IDXA 3OA2A 4FB5A 1Q7BA 1VKOA 5JPIA 1XQ6A 2DLDA 4CM3A 1KVTA 3L4BC 4GKVA 1GYQA 3ZU2A 3ONDA 2X22A 3LT4A 3I3OA 1H2BA 2OGUA 2AEMA 5FF9A 4Q3BA 3UUWA 2JCYA 4RF3A 3WJ7A 4IQGA 5A03A 4DIBA 4MP6A 1I33A 1P1FA 1HETA 3GT0A 3WGGA 3WGHA 4DMMA 4IGFA 1E3JA 2ZQYA 3D4OA 3D5TA 3BTOA 2ZTMA 3LF1A 4L4XA 3JQ8A 3D5QA 3NEPX 4HNHA 2VWPA 4PLCA 2Y0EA 5JMWA 5F1OA 4EBFA 2BI7A 4U6QA 5B1YA 2O4UX 2HMWA 1SC6A 3TPCA 1HDOA 4PG4A 2VHWA 1YOVB 5KCZA 4WE3A 1Y5MA 2RHRA 4GH5A 4KWIA 3DOCA 4D0RA 3GHYA 3H5RA 4DC1A 4CLHA 1NPDA 1IHXA 1V8BA 4Z9XA 2FSSA 3R0IA 3OH8A 2Y1GA 4CLEA 1YGYA 3AWDA 4KQXA 5DULA 2NQTA 1SNYA 1TVEA 2Y0DA 4BKUA 2IYOA 3RROA 4QTZA 4AJEA 1I8TA 1LQUA 3GZ4A 3ONFA 5JAMA 1PL7A 3NDRA 5TRTA 4TZKA 3CEAA 2P5YA 5DCWA 4B4VA 2BD0A 4M54A 1WPQA 1P1IA 2JCXA 1Q0LA 2YFHA 5KJ1A 1N7GA 2QYTA 2BH9A 2OBNA 4JBGA 4YAJA 4W4TA 1N9GA 4PVDA 4RVDA 1IUKA 1LEHA 5TIIA 4TMFA 2DKNA 1XELA 3UGKA 1H6AA 5CDYA 3GPDG 5DBGA 1WWKA 3WWYA 4C7JA 5ES3A 3RC7A 1SCUA 3MOGA 3BZUA 4YT8A 3IMFA 3LDHA 1PGJA 3ZW8A 3GNQA 4YTEA 3H4VA 3IJRA 3MWDB 5H82A 5TC4A 1NWHA 2YY7A 4MO2A 4RVUA 3NGLA 3TZHA 3PHJA 2Z5LA 5IN4A 5KOIA 2D2IA 5TSDA 1ZW1A 5EL0A 4CQMD 4ZD6A 4ZHSA 1L7EA 4BNXA 3FWZA 1P45A 1YRLA 5EJ2A 4RQTA 3ZV5A 3PHIA 2QW8A 2Y1DA 2JD2A 3KZVA 3FN4A 2B4QA 4F45A 4M87A 4J3FA 1VC2A 2WYWA 3ANMA 4XRRA 1QMGA 2ZTUA 5TS3A 4RF2A 2NTJA 3OEWA 4ZQFA 1O94A 3C24A 2EG9A 1KIFA 5A4DA 4I9HA 2W8ZA 4YACA 4B7XA 3ZI0A 5JFOA 3OICA 4NU6A 2X5KO 3GLQA 1Z74A 3PZRA 4K28A 1PTJA 2RH8A 1QYXA 4OQZA 4UREA 1F14A 3JQGA 2WM3A 4BNYA 4DTIA 3JD4A 3ICCA 2E4AA 5FEUA 1YB5A 2V6MA 4Q3AA 2NADA 3RBZA 4AJJA 1E6UA 2Q1WA 4MINA 4PG7A 3MJTA 1H6CA 4K9DA 1MC4A 3JQBC 1ZIDA 2I3GA 2B0JA 4YJHB 1UXKA 1WDMA 3DO5A 4NDNE 2VHZA 5KWEA 3OQBA 2D1YA 4I5FA 2I76A 3EVTA 3KTDA 2DTEA 2GCGA 2R2GA 2ZATA 2TMDA 1T2EA 4RVHA 1PGNA 1R4MA 5L7WA 1LSOA 3DHNA 1W4ZA 4QT0A 2C7GA 3GZNA 3WGQA 1SMKA 1LDGA 2QRJA 1DC4A 1G6KA 1B2LA 1ZMOA 1Z73A 2W2KB 3ANNA 4MOWA 1LTHR 4B7UA 3QSGA 3GK3A 5A9SB 1EK6A 4AJNA 4Y6SA 4PLWA 2C2YA 2DU8A 2FHSA 3O26A 1HSOA 5FFFA 2EIHA 3LLSA 1X1TA 3G49A 1GEGA 4MVJI 5L51A 2LDXA 2ILTA 4GVLA 1EZ4A 1B7GO 3HUDA 1S6YA 4P4GA 3JQFA 5C7OO 3ROQA 1VPDA 5A04A 4PZDA 3LT0A 3UCEA 3V2GA 4R1SA 3Q9UA 3RBXA 1PR9A 1VL8A 3GEDA 3S2IA 3BMCA 5DP2A 4Z9FA 2O3TA 1O89A 3OJEA 4RO0A 1UP7A 1LSJA 3TNLA 4TRMA 5TT1A 2CDBA 5BT9A 1HRDA 5F21A 3Q2KA 2BMAA 3K6JA 3E9NA 1ULUA 3WGOA 1MXFA 2A4KA 8LDHA 1JU9A 3DTTA 2BGKA 3BYZA 4PLHA 3WS7A 4E2WA 1XEAA 3M1LA 1E3LA 3FD8A 2C5EA 3EYWA 1JWBB 4RJTA 1WXDA 3LQFA 3PLNA 3UW3A 1UR5A 2RCYA 3EVNA 4S3MA 4A10A 1FDTA 2WDZA 5ER6A 4OSPA 1G1AA 1XQ1A 2IZ1A 2P4HX 5THQA 4RORA 4AG3A 1A5ZA 3WTCA 2HMUA 4NG5A 3MJEA 4YAEA 1VRWA 4E33A 2EEZA 3HDYA 3KHUA 3QJ5A 1GV0A 1YO6A 3E9QA 3KLPX 4GX2A 5DNAA 2IEBA 3AFMA 3SC4A 3BMNA 5HRUA 1NHGA 1VE9A 1RWBA 3DR3A 3C1AA 2FR8A 3V2UA 1YL7A 4KQWA 3MZ0A 4BV8A 3I9LA 2PTGA 3ADPA 1YXMA 3PHGA 4E31A 2JJYA 3QIVA 4WLUA 2YW9A 3GMSA 4XGKA 1M6HA 3AM5A 4B8WA 3VPSA 3JYQA 4BO6A 1LBEA 3DHEA 4YBZA 3G0OA 5BQFA 2HMVA 2V6BA 1N9GB 4H15A 4Y8VA 3NDJA 3QVXA 3FBGA 2AW5A 4ZRMA 3LT2A 2QIOA 1EE9A 4BQPA 1UP6A 4BB5A 5AXBA 2SCUA 4BNIA 1OC2A 3QWAA 1HDXA 5JDIC 2IRWA 2OBYA 1GZ6A 4R5HA 3TJRA 5BSHA 4NQZA 4LVUA 5A3JA 4PN3A 1GADO 3F9IA 1JKFA 3AUSA 4IMPA 1LDNA 2JFGA 4R16A 1TXGA 4YQZA 3E6AA 3ETEA 1XU9A 2CDAA 2VZ0A 2OFPA 4B4UA 3F47A 4NBWA 3BHMA 1MB4A 5K6AA 2DBRA 3VPGA 1C0PA 1HDRA 4GX0A 2BRUA 1NAHA 3PEFA 5G4KA 4IJKA 2OO5A 3PQDA 4YJFA 3PYLA 2JKVA 4AJIA 2J6IA 5TQVA 3JD1A 2E48A 1IOLA 4A2CA 3GEGA 3GC6A 4J7UA 4O0LA 1C0IA 2ZCUA 3BA1A 4GL4A 2CZCA 2HK9A 2Q1TA 3IS3A 3D1LA 3QE3A 2NLOA 3LC2O 3UCXA 1O5IA 4MVJF 3JQGB 2W90A 1K6IA 2J3HA 4N18A 3V1YA 3DQPA 2O50A 3WGZA 5IF3A 4CM5A 4NFYA 1CF2O 2RBEA 2YQ4A 1GZ3A 3H5NA 4YR9A 5JCJA 4L0QA 5EQDA 1JW9B 3RKRA 5DF1A 1T2FA 1N7HA 5I7VA 2C59A 1UAGA 1DLJA 3ZU3A 4FQ8A 3IJPA 4D41A 3TF5A 1EEHA 1MP0A 3H9EO 3H2SA 4Q39A 3WSVA 4DMLA 2X1HA 3CZRA 4FBGA 3NAQA 1JA9A 2FP4A 4R5MA 4AJHA 1F8GA 1PWXA 1QSGA 1R4MB 1GDHA 3PIDA 4MIEA 1C0KA 4F3YA 2GRAA 1DDOA 3GPIA 4I5GA 4WCFA 1SEPA 3GZNB 4A5OA 4I5EA 4F6CA 3A28A 1BSVA 2Y68A 4MPDA 5G0VA 4HFMA 1MFZA 2CNBA 4P38A 1U7TA 4NFSA 1WZIA 5JSFA 3A1NA 1YH3A 1GUYA 1MGOA 1OC4A 2QRKA 4Z3DA 3I9JA 1EE2A 2GYYA 1IYZA 4HY3A 5I9NA 1AXGA 5DOZA 1R16A 1PZFA 2X9VA 3NJ8A 2X23A 3P2YA 4O5OA 3JQ9C 1IZ0A 3I5MA 4JNKA 4WLOA 1HXHA 2DQ4A 1X7HA 2Q2QA 4PLGA 3AK4A 4NPCA 1ZSVA 2YV2A 1WVGA 4ZGWA 5IJZA 3VOSA 1OZAA 1BWSA 5DT9A 3BMCB 4IXTA 1HF3A 1HSZA 4MKXA 1DLIA 1VI2A 4DL9A 1H93A 1ZMTA 3AUTA 3PWSA 3M2PA 2CMDA 1J6UA 4GLLA 4NBRA 5JLAA 4CM8A 4ITUA 2FR1A 1NFQA 4LGVA 4R1UA 4XX0A 4ILKA 4BGUA 1YONA 3FTNA 5KIAA 2EV9A 3VZSA 4PGFA 4OQYA 5CDTA 4GQAA 5L4NA 3PJEA 1A4UA 4MP3A 1UP4A 3ZGYA 5CDGA 3S2FA 3TRIA 1ISHA 4XCVA 4GKBA 1A4IA 4HXYA 5JW6A 2OP1A 4R9SA 4CM1A 2PFGA 2ZJ1A 3NT4A 4TVBA 3BMNB 4CMCA 4GSKA 3S8MA 1W6UA 2YDXA 2HLPA 4D3DA 2GDZA 1E3IA 3VDQA 3PWZA 3RIHA 4IDAA 1E7WA 1NX6A 4J1QA 3RI3A 4AVYA 1HKUA 5AXAA 2QZZA 4GMFA 2Q2VA 4XA8A 4CM4A 2VT2A 5AVOA 1LU9A 4PZCA 2EJWA 3VZPA 3PFWO 1H6BA 4NNJA 1WP4A 3GDFA 1GD1O 2HU2A 2TMGA 4E5KA 3ZNPA 1H2HA 3I9MA 1QLHA 1GZ4A 2OXIA 4J0EA 3TWOA 1BDBA 3INRA 1MX3A 1W8DA 3UN1A 3AY6A 2YJZA 4IJVA 1JQBA 3AU9A 1IB6A 4QX6A 4H3VA 1DOHA 1Q7GA 4XRGA 4N5LA 4GLOA 2VYND 3ZHYA 3SEFA 1LQTA 3ROPA 1X1EA 3F4LA 3OIFA 1JTVA 4KOAA 4FGSA 2UV8A 3DZBA 2PWZA 3DOJA 4MVJG 4BMVA 2VOEA 2W4QA 3EY4A 4WLNA 3V1UA 1W73A 5ICMA 2J5QA 2NTNA 2WWRA 4CLOA 1UZMA 4O59O 1EFKA 4Y9DA 4YJFB 2NNLD 5CDSA 6LDHA 1UXGA 4XQEA 2VYVA 2ZK7A 1PJQA 3W8FA 3A9WA 3LC1O 1J4AA 2C20A 1OI7A 3IQDB 3UHAA 1O6ZA 4MIYA 2PH5A 3I6IA 1GV1A 3ANLA 3ENKA 3GGPA 1P1HA 4J43A 3O9ZA 4WECA 4DVJA 4Q3EA 1RM5A 2QYSA 1C1DA 4K6FA 3WR5A 4J2HA 2FPGA 1PWZA 3D0OA 4NZ9A 4NU5A 1NVGA 3C1OA 4W9NC 1WMAA 1ZEJA 3O03A 2ZB7A 1RKXA 1PGQA 4GGOA 1U8XX 4XDYA 4JBIA 4FW8A 1E7RA 4IS3A 3RFXA 1CWUA 2NVUA 4WCDA 3JV7A 5KVCA 4FC6A 1GL3A 3UOGA 5MGBA 2PV7A 2X8LA 3SXPA 4M49A 4TRJA 1PJBA 3O4RA 1ENZA 4IJUA 2DBZA 1CDOA 3CE6A 4E5NA 1F0YA 4OL9A 1ZZEA 3KYDA 3OBBA 4L4RA 1E92A 2IYPA 4BGIA 4R01A 3C7DB 5HA5A 1HTBA 1EUCA 4WCFB 1C1XA 1PJCA 4CMJA 3WGYA 1T24A 4CMHA 1RM0A 5G4LA 1KY4A 2A92A 1CRWG 4CM6A 1DPGA 4LSWA 1ZK1A 2RAFA 1QG6A 5EN4A 1ZH8A 5AYVA 3WBFA 5G0TA 2JHGA 3VZRA 4I8XA 2D59A 4OXKA 1R0KA 4CR8A 3ORFA 3BMOA 3EW7A 5GZ3A 1JAYA 1SO8A 3W8DA 3UH1A 3K96A 3RVDA 4CUZA 3GDGA 4U6SA 1ADFA 3ZHXA 1H94A 1P77A 3OJOA 5HTOA 1P9LA 2FMUA 4D3SA 5DZSA 4YJDA 4FOOA 4E13A 1UXJA 3GVIA 1V35A 5KJ6A 4MP8A 4XYEA 4CQMA 5C5IA 3EUWA 3V2HA 4WLEA 1PQUA 3K9QO 1YBMA 1R12A 3OMLA 2D8AA 3G3EA 4GGPA 1K0UA 5COAA 3RAJA 3CKYA 1FDWA 4CMGA 1QV6A 4XB2A 1P1KA 1SEVA 1ZCJA 3F5QA 5A9TA 1O8CA 1E7SA 4Y6RA 4CM8B 2WJPA 3TZCA 1LDBA 1ZXBA 3VH1A 3DMTC 3HDHA 4W99A 5IFLA 3PVZA 5G0WA 4EEXA 1G0OA 5GZ1A 1B8UA 3H9GA 3C3XA 1BVUA 2BFMA 2XOXA 3SJUA 2Y99A 1WMBA 4N5MA 3QY9A 4AJKA 3LF2A 1P1JA 5ENVA 1ADCA 4IINA 1PJLA 4N7RA 1EQ2A 5C7IO 1SB9A 7ADHA 4DYVA 3V8BA 4YPOA 2W2LD 4FR5A 1V3UA 4JCOA 1ZBQA 2AHRA 3DTYA 2PLAA 3U4HA 2VWQA 3RD5A 2V6GA 3DZJA 2Q46A 2WD7A 3HADA 3WLEA 2WEKA 4CM4B 5IXSA 4PLPA 3ZWPA 1DHTA 2AQ8A 4PVCA 3NKLA 4GWKA 3RUEA 4R1TA 4PRLA 3UVEA 5JDCC 1VKNA 1O9BA 4WOKA 5AXDA 3I52A 3GEMA 2PKQO 4MVJH 3OECA 3C8MA 3H6KA 3NT2A 2CUKA 4K6CA 4BNLA 3DEYX 3R1IA 4PIVA 1DIRA 1NVTA 4XYGA 1Q2XA 1U3TA 4ND3A 3TZQA 1B8VA 1PQWA 2CDCA 1PZHA 1RJWA 3FPCA 5CEEA 1E1NA 4CR6A 2LDBA 1T2AA 1BTOA 3QVOA 3VPHA 5IDWA 1GR0A 2HDHA 2VUUA 2B4RO 3FBTA 1HE4A 4PLVA 1M76A 1A9ZA 1EK5A 3QWFA 4TKMA 1YBAA 1LDMA 4CLOB 2Q1UA 4PRKA 4IIVA 2I6TA 1HE3A 4YDRA 4CL8A 2QRLA 2X6TA 1NQAO 5GY7A 1FXSA 5KVSA 2C54A 4NFHA 1E7YA 1LX6A 1P74A 2AA3A 1JDJA 3PYMA 3QP9A 2PR2A 3ZV4A 4QECA 2POQX 1F17A 2O3UA 5IDYA 2P5UA 4MDHA 3H9JA 1V3TA 1Q0HA 3ZWYA 1GUZA 2P91A 4JP3A 2Y66A 2NU9A 3TN7A 4IZIA 5BNTA 2HAEA 3H5AA 3WQQA 1C1DB 4DXHA 2J5KA 2EF1A 3CMCO 4RQUA 3OEYA 4CQLA 5T5QA 3PJDA 2YQ5A 1NYTA 2O2SA 3G79A 1GPDG 1KEPA 3CINA 5EPOA 5K0ZA 3DOOA 2NVUB 4WJZA 3EMKA 4IDDA 5I7FA 5JO0A 4G81A 1Y81A 4CLXA 5MDHA 2ZQZA 1E77A 3HDQA 4PLTA 3KYDB 4LW8A 1HYEA 5L45A 3JQAA 3KO8A 4UVGA 5HS4A 3IP1A 4XJTA 5CHEA 1LJ8A 3RSHA 3QVWA 4CUKA 1EMDA 1XSEA 1ISGA 1VJTA 2VHVA 1C1XB 3IUPA 3RUFA 4OOFA 2AEJA 1BW9A 4DQXA 1LC0A 4Q9NA 3M6IA 2I5PO 3T4XA 4LMRA 4CLDA 4INAA 3WYBA 2B83A 3ZW9A 4CJXA 2D5CA 1K5HA 5TGDA 1JLLA 1U7HA 3PDJA 3KYCA 3U4IA 3P19A 4P4NA 4W6ZA 1IPFA 1X0XA 3X2EA 4BNWA 3GA0A 3IL2A 3BMOB 4W7IA 1ZJYA 1ZSNA 4ALNA 3AW9A 1L7DA 3ZWWA 1MA0A 1EVYA 2R00C 3QA9A 1LSUA 2D0IA 4UUNA 1E7MA 3AOEC 4BO7A 4HFRA 1WLYA 3CTMA 5TF4A 3GHHA 4FDAA 4KMSA 2E49A 3ZV6A 4J6FA 3WIEA 4BNTA 4GSLA 5ILGA 5IG2A 1OFGA 1UJMA 1H0KA 1K6JA 2ET6A 1I01A 4U0JA 5HBRA 2BGLA 5I7EA 1DAOA 2H9IA 3KSDO 3FTPA 4YRDA 4ALLA 4RVSA 2ZIZA 3HJAA 2QQ5A 5L7YA 5BSEA 3LC7O 3E18A 2ZYDA 1UZNA 4L8VA 1KEVA 4NK5A 1V0JA 1TEHA 2VT3A 4U8GA 5ADHA 3TL2A 1RYDA 2OL4A 1Y9EA 1ISFA 4H7PA 3ROMA 1FF9A 3GRKA 3GH3A 2VTDA 1N1GA 2DAPA 4J1NA 1PEDA 1PR3A 4XIJA 5CEFA 1HT0A 2DFDA 4J4BA 4NJOA 1TI7A 2Q50A 5HS6A 3X2FA 4OIMA 4FPXA 2VHXA 2UDPA 3DBVO 3OJFA 2CVZA 3KEQA 4D79A 4ZN6A 2Y67A 2O4CA 1AXEA 1U4SA 3CUKA 4XKJA 1T1RA 3W4KA 2NTVA 4II3A 1N8KA 4BL5A 4Q3NA 5A06A 1QYDA 1PZEA 2NU6A 2JHFA 3LVFO 3HSKA 4PCVA 5L7TA 3ZZNA 2IZ0A 4BUCA 3ETDA 3JQ8B 2JD1A 1V3VA 1VL6A 1GFSA 1Z82A 4OOEA 2B5WA 3LYLA 4LISA 4ZQHA 5LC1A 4E3ZA 1W0CA 5HM8A 2JAPA 3GN1A 3N58A 4CLRA 3KRTA 4BMSA 1PX0A 4QFCA 4AJOA 4OKIA 3IP3A 3DBRA 4U7WA 1RPNA 3MTJA 3JQFC 2X7HA 4G2NA 4W82A 3WYCA 2PD6A 1Q1NA 3IAHA 1MV8A 3AJRA 3R3JA 1GEEA 4URFA 3ZWBA 2VTEA 3MEQA 3VPFA 5DBIA 3OHSX 4E2ZA 3GMDA 4JX8A 1DJQA 3BIOA 2EKPA 4HADA 3BMQA 5DCYA 4PG8A 2ZYGA 3Q1LA 1JKJA 3WFJA 1IPEA 1SOVA 1IY8A 4JQCA 4P8RA 5ICSA 2H1SA 5J23A 3I4FA 2GZ3A 3T4EA 3LZ6A 2J8ZA 4DIFA 4BGVA 1Y9AA 2Q99A 3AM3A 4UEKA 4EW6A 1OBFO 4AJ2A 1EQUA 1PSDA 1KEWA 2DFVA 1MFPA 2ZB8A 3DXFA 3MJSA 2PGDA 4UUOA 3K5PA 2P2SA 2I65A 5T8KA 2Q4EA 3WMWA 2B35A 4CR7A 1I3MA 2VNSA 4IJWA 2X86A 3ABIA 4NIMA 4W7HA 2CVQA 4KDEA 1E3SA 4UEOA 3DAFA 4CM9D 1NFFA 3KSZO 1C14A 4CQLB 2VNAA 1SBYA 1DBVO 2OOSA 2YFQA 4ALKA 4D7AA 3NDIA 1LI4A 3GN2A 3CPSA 4L74A 2P4QA 5F3RA 1ZK3A 4GX5A 4LRTB 5JO9A 3R3SA 4ND1A 3ZWCA 3A4VA 4RLHA 1Z7EA 4E5YA 4YT5A 4C4OA 3FPLA 2DBQA 2YHIA 3GUYA 3JTMA 5T57A 3JQAB 2EKLA 4ZRNA 1HYHA 1YL5A 3D64A 4O63O 2GF2A 4B7CA 1ENPA 1BW9B 2H63A 1QR6A 2EXXA 5BNIA 3O38A 3KEOA 3H7AA 3PPIA 4E12A 4UVDA 2G5CA 4XGIA 5COBA 5TJ9A 1T1SA 3U09A 4CMEA 1HWYA 2PGJA 2YZ7A 3KYCB 2BKAA 1WZEA 4QO7A 3E9MA 4HFNA 4DWVA 1H6DA 2B4TO 4IIUA 3ZU5A 3ZWNA 3L6EA 4BNGA 4TWRA 4DQUA 5JYEA 1KVQA 5K6AC 1GCUA 3GAZA 4YA6A 1NQTA 4LMPA 3OQ1A 1NVMB 2PKQP 4PLZA 4RDHA 1JVSA 2XF8A 1KS9A 2HUNA 1EVJA 3K2EA 5F5LA 2VRCA 1YQDA 2HO5A 3NT5A 3GY0A 4A03A 3JQCA 1PJ4A 1R0SA 2P9GA 4B4WA 3B20A 5A5FA 1D1TA 4BB6A 5DN9A 5A5EA 1BGVA 4BNUA 1YB1A 1ULSA 3PQFA 4DRYA 5C3MA 3PGXA 3LSYA 1K2WA 1LSSA 4IMRA 3HB5X 1VJ0A 4I08A 4UVIA 4JLWA 2Y1CA 4N5NA 3PXXA 2Y1OA 4YAIA 3VZQA 4LRSB 1GYPA 3K92A 1VSUA 1ML3A 1ZK0A 4B4OA 3K31A 4J1TA 2JFFA 3LK7A 3JYPA 4JJFA 3DAGA 5JC8A 4BIIA 2FR0A 2Q3EA 4JROA 1NBOA 2PD4A 3ZH2A 5FYDA 4HP8A 4GVXA 4BKRA 2F1KA 2HMTA 3I4CA 2OHXA 4EZBA 1QRRA 2J3IA 3F6YA 1UXHA 5B4UA 1M2WA 1FDSA 4R41A 5IZCA 3I6QA 2GASA 3WYEA 3UFXA 3PIIA 5U1PA 1X7GA 4IDCA 4WCFC 1ARZA 3CZMA 4YCAA 1Y1PA 3WSWA 3C85A 3P2OA 4II2A 3L9XA 4ND4A 5FI3A 3CXRA 4XDZA 5I7SA 1XKQA 4ESOA 3QWHA 2EWMA 1YJQA 3HB4X 3JQDA 2VWGA 2X0NA 4PLFA 2NVBA 2PK3A 3B1JA 3SBOA 5L95A 1PIWA 5JNLA 4KUEA 3ITKA 3VTZA 4CLRB 2XXJA 5A9RA 2UVDA 2ZCVA 1HLPA 1LLUA 2EP5A 3DBRB 3FCOA 4ZVVA 1EBFA 4TRNA 3PWKA 1WW8A 2E37A 3VC7A 2UYYA 3TFOA 3OM9A 1LDEA 1DSSG 4BOYA 4DC0A 3KV3O 4L76A 1LC3A 1O0SA 3B70A 1M66A 3BMQB 4YB8A 3Q2IA 1PQPA 4DPLA 5I9MA 3PZBA 2WYVA 4DLAA 3IOYA 3OP4A 4JBHA 3I9NA 3MCVA 2FZWA 2GZ1A 2G82A 2PNFA 4R4JA 4WKGA 4Z9YA 3W1VA 4D0SA 1NPTO 1JWAB 5KJEA 3D3WA 1OAAA 4HBGA 4IXWA 4IY1A 2PZJA 2NUAA 3L6OO 4LN1A 2NVWA 4TQGA 1WDLA 1SPXA 4KZPA 4E5PA 2DTDA 2VRBA 4YJGA 1ZK4A 3K8ZA 3ZWOA 3DDNA 4ZQGA 3SLGA 4AL4A 1I32A 1DFHA 2RIRA 2FN7A 4BGEA 1EBUA 1KVUA 2O48X 3H3FA 4WLVA 5KKCA 2BI8A 3HWRA 4KP7A 3RC2A 4Y67A 1KVSA 2E6UX 1P0CA 4CUJA 5G0SA 2O23A 4UEJA 4YWJA 5JCJD 2IE0A 3JSAA 3EAGA 5G4KB 3Q9NA 4F46A 5U9CA 3U9LA 3WICA 4CV1A 1N2SA 2YHIB 2O7QA 4RV9A 1N1EA 1A9YA 1ADBA 5JE8A 1AUPA 2W2LA 1YOVA 5DDIP 4TRRA 1G0NA 2V7PA 4GPD1 3GNTA 3NTOA 2PH3A 4BKQA 2OUIA 4DPKA 2X0RA 4A7PA 2YDYA 3AI1A 2C7VA 4YEDA 3D4PA 4CMKA 1S7CA 4RVGA 1ID1A 2Z95A 1MC5A 4GMGA 2Z1NA 1D7OA 2CY0A 4UUMA 3TDKA 3PP8A 3PQEA 4YVFA 1VM6A 3DWFA 4CV2A 4I1IA 4WASA 2OMEA 4Z6KA 4LCJA 3I1JA 3N74A 5IN5A 2NU7A 3WG9A 4TSKA 1DC3A 1Z75A 2P68A 5L40A 3FR8A 1NR7A 4LSMA 5EMHA 5F5NA 1GYRA 1H9AA 3N7UA 1BG6A 4JXKA 2O3RA 3R6DA 2OZPA 2CFCA 4ND5A 4YQYA 4E32A 1C3VA 3DB2A 3RU9A 5BSFA 4HFJA 4BNKA 4OXYA 5IAAA 2W98A 3UXYA 2DBVO 4A27A 1BRMA 3U4CA 2HSDA 3RCBA 5KJFA 3VPXA 4KDFA 1QP8A 1N5DA 3COSA 2X0JA 3I9KA 1H5QA 3FHLA 1HZZA 3VVCA 3G1TA 3DFZA 1DRWA 5A3VA 4IQ0A 4Z3KA 1HE2A 3B6ZA 1E6EA 1SAYA 4QXMA 9LDBA 4E0BA 4XYLA 4J16A 2X58A 3GVPA 4XEHA 1DJNA 3ZWXA 2UUOA 2GN4A 3QW2A 2AE2A 5CG2A 1GTMA 5JMPA 1Y8RA 3QWIA 3GOHA 1EVZA 3HQ4O 3LLVA 4RF4A 4QEDA 5BSGA 1GQ2A 1C0LA 4ZJUA 5JY1A 1E5QA 3TQHA 5H83A 1MG5A 3DBLA 3ENNA 3KXDA 4JGBA 4BO5A 4YRBA 3GFBA 4EUHA 2CSUA 3DBHA 3FWNA 3MJ4A 3WGIA 3NV9A 3E48A 2VQ3A 2IDZA 4BO9A 4PFJA 3FI9A 4OH1A 4XWYA 3DFUA 1ZVMA 4IDFA 4L73A 3TOXA 3HDJA 4S1VA 2PY6A 5JAQA 4EJ6A 1P0FA 2Y1EA 5KKAA 3RFTA 3RUAA 3HZZA 4EGFA 1TT7A 1HDZA 2J3JA 1JKIA 4B3IA 3KETA 4ID9A 2O7SA 4QQRA 1YDWA 1DIGA 1UH5A 1LLCA 3L4BA 1FDUA 2AMFA 4M1QA 3WNVA 1O95A 1DIHA 5TNXA 1ONOA 1D8AA 3DZKA 1V9LA 4WGGA 4X54A 3GF4A 3WTBA 4DREA 3IIEA 2WE7A 3OFSA 2FPIA 4OKNA 4ALMA 3CMMA 4CV3A 4Y98A 1U9JA 4DUPA 2Q45A 3PHLA 2RHCA 5ENDA 4NR0A 4RPHA 4GBJA 1B16A 4D45A 2YYYA 3GUCA 4WNIA 1AE1A 2I99A 3KSUA 2HKIA 2UUPA 4IDBA 5DOVA 1I0ZA 2G0TA 3L77A 1OMOA 5L9AA 4ZQEA 5EIOA 2UAGA 3D3EA 3E82A 2IXBA 4RGBA 4K26A 4Q3CA 1NXQA 1LLQA 1LNQA 1N92A 1U4OA 2FZEA 1P44A 4J9VA 1Y8QA 1E3EA 3P5SA 4OSOA 1I2BA 3V1TC 5KTKA 2VCYA 2VHYA 5KVVA 3HN2A 5C37A 1YDEA 2FWMX 1SZJG 2VYVD 3D3WB 8ADHA 2XXBA 5LCXA 1BMDA 3CSDA 1ZJZA 3I83A 2GN6A 3L6DA 1MG0A 5IXYA 3VKVA 5G2OA 3AY7A 3FF4A 5CPFA 4YYZA 1PL6A 4YJGB 4MVJD 5L4SA 1TB4A 3HHPA 3ZHBA 2I9PA 2O2YA 3DAPA 3SX2A 3VDRA 4J4TA 5I8ZA 4OYRA 4DYDA 1BXKA 2HK8A 1HZJA 2BFOA 1J5PA 4J49A 4K1LA 1IL0A 3H9QA 4BNJA 4OXNA 2EHDA 1YE3A 4HKTA 1IZ9A 5B37A 3WB9A 4M55A 9LDTA 1U8FO 1QYCA 1AGNA 1X14A 1X0VA 3KOUA 3WIDA 2GGSA 1BHSA 2ZTVA 2NV6A 1M67A 2P9CA 1LA2A 2O3QA 2JFHA 3Q11A 3RUDA 3B1KA 3AI3A 1DFGA 1ADGA 1ENOA 2YV3A 4TVOA 2O3JA 2GSDA 1P31A 1B15A 1T2DA 1A7AA 2EGHA 1I36A 2DUWA 3DMYA 3HG7A 4NBTA 1HEUA 4XIYA 2BF7A 3RASA 3TL3A 3E1KA 3C1TA 4CMBA 3E5RA 3HN7A 1Y5RA 2NWQA 5T64A 2HMSA 4FIZA 3OIDA 2B37A 2ZTLA 3QRWA 1BDMA 1T2CA 2WYUA 4EJMA 1R4NA 4YAKA 5JAZA 1RM4A 4NJMA 1U5AA 4GAEA 3F1LA 1FJHA 2EJVA 3DZIA 1B14A 3WGTA 4FS3A 1CQIA 1CQJA 1AHHA 2VUSA 1PGOA 3CH6A 3NUGA 3SLKA 4DLBA 4Z0HO 1NM5A 2QX7A 3NYWA 4BO8A 3E8XA 4PG5A 4E4YA 4QSMA 3T7EA 1EVIA 2ZJ0A 1EUZA 1UDAA 1DEHA 3PHHA 4OAQA 3PRJA 3IDSA 1NQOA 5AXCA 4I9UA 4GI2A 4DLLA 4E2YA 3NRCA 3PTZA 4FOSA 1XDWA 2J5RA 3RJ5A 3WX0A 3KBOA 3ZWMA 2HQ1A 3ZDFA 4BV9A 1DB3A 3KM0A 4Z0TA 1PS9A 1XA0A 1Q7CA 2R00A 1U3VA 3AOEA 3JQBA 3JQ6A 3OETA 4J90A 2HK7A 1I3NA 3JD3A 1D3AA 1QORA 2PZKA 5B12A 4J0FA 1Q0QA 4BNHA 5ILOA 4XQ9A 1Y8RB 4HWKA 3RUIA 4FFRA 1T25A 4NBUA 1IULA 4E6PA 1LDYA 3VTFA 3VVBA 1NQ5A 2ZKLA 4AICA 4IDEA 1JVBA 4CM7A 2AEFA 1ORRA 3E5MA 4RVFA 4XJSA 5B4TA 1UXIA 2Y05A 3M2TA 3FRJA 3DBLB 4CM9A 2P9EA 2C0CA 3NX4A 3PI7A 4I9NA 4M8SA 3DBHB 4E30A 2FSVA 4CQMB 1KERA 1V6AA 2V6FA 2EGGA 3L9WA 3VAZA 2A94A 3U5TA 1X7DA 3WQSB 3KB6A 3RUCA 1VJ1A 2EP7A 3WDSA 4ALIA 4FCCA 5KNLA 3HE3A 3WWZA 3RQSA 2ZYAA 1JAXA 1U28A 3BHIA 1I2ZA 2DPHA 3JYLA 4G5HA 3JD0A 1ZXLA 3A14A 3JYOA 2C5AA 2GN8A 3TFQA 5ITWA 2H5LA 1XG5A 4J4HA 3IKTA 4A0SA 1ISMA 4BO3A 1BXGA 1XR3A 4A26A 4Q3DA 1U3WA 2VUTA 2GD1O 4N54A 4RZIA 3MJCA 1E3WA 4R54A 1YB4A 4MIOA 1X13A 4XR4A 3SC6A 4IBOA 1SOWA 4QO8A 2I3AA 3TZKA 4RPJA 1Y6JA 2YUTA 3NJ4A 1F12A 2X9GA 4B3JA 5CPBA 1ZFNA 2XAAA 4D46A 3GAFA 3I23A 4AJ1A 1XWFA 3A06A 2Q49A 3U0BA 5LDHA 2WD7B 2EKQA 1E1MA 1Z6ZA 3BTUA 1A27A 4KWHA 2OP0A 1K3TA 1QYWA 3UAGA 1Y8QB 4WEOA 3UKOA 4MKZA 3F4BA 4FFLA 4RPLA 4EUEA 4J7XA 3AOGA 4BO0A 4RCVA 1U3UA 3GVCA 1GU7A 4XB1A 3ZN2A 3RFVA 3RJ9A 4FGWA 5COQA 2FOIA 4BNVA 4XZ3A 1ONPA 4M86A 1AN9A 3K2BA 1GCOA 2EW2A 4XD2A 5GZ6A 1AHIA 2V65A 1CYDA 1FDVA 2Y0CA 3H8VA 1SB8A 3F46A 1LRLA 1P33A 4IDGA 2IXAA 3ZNQA 2AQIA 3GVHA 1PJTA 3RUHA 3W6UA 4NBVA 3ICPA 5A02A 2B5VA 5KVQA 4ROSA 2NACA 4WEQA 5FI5A 3TZ6A 3BAZA 4OO3A 2HJSA 4L4SA 4BKOA 4KTVE 3VHRA 2BGMA 4B3HA 3PDUA 3RU7A 1LXCA 1MUUA 4J1SA 2O3SA 5JDIA 3KYBA 1GPJA 2IZZA 4JJIA 4R9RA 4BKPA 4YAGA 2B69A 4MJLA 3W4IA 3L4SO 4UUPA 1I30A 1VLLA 1XIVA 1YJ8A 3JQAD 7MDHA 1R0LA 3PYXA 3ZNOA 2EW8A 5IDQA 3F1KA 5IZ4A 1QLJA 2NSDA 4RZHA 3H65A 1KETA 2PA3A 3JQEA 1TA4A 1R4NB 4EYEA 5AOVA 4Z0PA 1YL6A 3D7LA 1PJ3A 4NJMB 2OORA 2VWHA 3WNQA 3TOZA 1IE3A 2VZ8A 3WXBA 3AI2A 5THKA 3DONA 4CMAA 3GDOA 1HE5A 3Q6IA 4RPGA 4WUVA 2IODA 3ZNNA 3QWBA 3VH3A 3CIFA 1U2DA 1PL8A 2C2XA 3MWEB 2DPGA 3QVTA 4TZTA 1R6DA 4YXFA 3GG9A 5KJCA 3GGOA 1P3DA 2ZB4A 5LDGA 5JC1A 3WJAA 3IUSA 2EERA 2I66A 3H2ZA 1UUFA 3B1FA 4IUYA 2PZLA 4RPKA 2WTBA 3I9OA 4BO4A 1ZO8A 5T67A 1NHWA 2DTXA 4KUGA 1ZUD1 2H6EA 5BNFA 1FK8A 4IZHA 4RLSA 4XGNA 5T8KC 4B79A 2E82A 4MVJP 4FFPA 1I24A 2CVOA 1EUDA 1I5RA 3AUUA 4FSHA 3OJ0A 4I5DA 6ADHA 2WD8A 3GRPA 3ITDA 2NQ8A 3ON5A 5DBFA 3ZU4A 4EEZA 3SVTA 1D4FA 3EC7A 1U1IA 3AFNA 1H9BA 3ZCXA 5ITVA 1D1SA 4IGEA 5G0UA 2Z1MA 3DZFA 3AUAA 1Y7TA 1E5LA 4DIOA 4JK3A 2AQKA 4OJNA 1QKIA 5I8WA 1LRJA 2CF5A 4AFNA 2VYNA 5F1PA 4CV0A 5K9ZA 5U4QA 4A73A 1M6WA 3EK2A 2JD0A 1A7KA 1HDCA 4CL3A
chains in the Genus database with same CATH superfamily
4ARIA 4N0EA 3PJFA 1DXYA 1WDKA 3H5WA 4HZIA 2HRZA 4FFOA 3R74A 3SDZA 1FS4A 1FFDA 1P7YA 4AG3A 1QIMA 3ZD8A 4E5UA 4LXTA 1WSDA 3U3KA 3R9XA 3OEEA 2BHTA 5ALIA 2QAIA 4A91A 4N3CA 3S1AA 4TROA 4GPTA 5EQFA 3KUXA 5LYJA 4O2RA 4BB0A 3ZHCA 1NJ5A 1DHRA 2WIGA 1U5BB 4US1R 4DDTA 3Q3IA 3OI7A 1R5BA 3DHVA 4JQZA 3GROA 3T34A 3QLJA 4CKEA 4QQFA 5LQKA 1SBHA 1M6VB 2H31A 4IWNA 3VR2D 1F0PA 4KLNA 4JX9A 4OQ4A 4EI2A 1EVKA 2YV1A 2PJZA 3WLHA 4BX9A 3LXUX 2AD5A 2B1JA 5EP1A 3L4JA 5DCUA 3L7LA 1RIIA 1F2UA 1I6LA 5AHXA 1NBAA 2FXIA 3PTAA 4HNQA 3IEMA 1EDDA 1Q20A 3N8HA 4ARBA 1K6MA 3HZRA 2ECQA 3FR7A 4FEEA 5JRDS 2H3EA 3WMXA 3ZCQA 1OYVA 1TT5A 2BMDA 2GZ2A 1G9XA 1ZNZA 1GGVA 4JELA 2BHLA 2B36A 1Q7RA 2OGTA 3ITNA 1B6GA 1CIPA 4DA9A 3LMKA 2IEDA 1A5TA 4YCDA 2H17A 5DMHA 3SXUB 3THYB 1M5RA 3P20A 5BMVB 1DDIA 4DCJA 3HFSA 3IAS6 1GPH1 3BAFA 4MV7A 5L4LA 1MIOA 2XBUA 3DWGA 3RRZA 3OAAD 3NHMA 1HOXA 4RL6A 3TO5A 3PDWA 3DMFA 2PQ2A 3L40A 3QBDA 4BFSA 1L3CA 1EDZA 2A5LA 1NQVA 4NH4A 1XWWA 4M9RA 1R8SA 2AE1A 1M1NA 2E9SA 2QTHA 3LXMA 4IV8A 1EESA 2GO1A 1QIFA 3UJCA 3AY3A 4REQA 2XXAB 5LQAA 3OQOA 2VCHA 5EWJB 1BMTA 2P79A 1BD3A 3O8LA 3TIGA 4WXMA 4MHSA 2DHRA 4MYCA 4UMDA 5FWNA 3HNRA 1MXHA 3JYNA 5JAUA 2YJ3A 3U7JA 5BR7A 3VTKA 5A0VA 4BS9A 4IDNA 4KTTE 4PPGA 3MOIA 3IT2A 4FBLA 3WZMA 4D2IA 1FSZA 2P1DA 1FDIA 2HXGA 3AB7A 3FSEA 1W1WA 5CHYA 4CMIA 5IM4A 3EEQA 3QV2A 4KQCA 4D3XA 1JNXX 4PZUA 4EW1A 1OPRA 1TU4A 4B32A 2PWPA 2CE2X 2I22A 5ALZA 1GKUB 5FO1A 2W9XA 4C22A 1W36D 4LK3A 1UM8A 1DE0A 2QZSA 4J7CA 4F3RA 1THGA 4HNGA 3W8EA 2GD2A 1LRKA 1LK7A 2XB9A 3Q8MA 2DB3A 3GGGA 4F4IA 1FLNA 1YKFA 4WN9A 4WNAB 1EFAA 1XEWY 1EUQA 1LKZA 1PT8A 3B9PA 4QDXA 4RDIA 3J7TA 5HKAA 3UPUA 5I7WA 2IS1A 1RAFA 3D4NA 5CMLA 5K2OA 3F4KA 3TLXA 3JATB 2VXYA 1YRAA 5GONB 1CS4C 2LCIA 3PJGA 1YCHA 3M4NA 1KOLA 2R60A 1J0DA 3L1JA 1GPBA 1FA9A 3ELDA 4F21A 3J80A 4GE3A 2C3OA 1J49A 2EZTA 4GOXA 3U3ZA 4XUDA 3QENA 4ZVKA 1PO7A 4UW9A 5CG1A 2NIPA 3N1UA 4GXRA 4IIHA 2J9FB 1CEQA 4HNRA 1N77A 5AI5A 4AP5A 4AY6A 3UT5B 1J8VA 4N39A 5ALUA 3A32A 4JDUA 5H3CA 2Z2IA 5IAJA 4XR9A 2G1UA 3EWNA 4LDAA 3W05A 3MTGA 3UV6A 2AXQA 3L8HA 4BO1A 4EKDA 4PZAA 4PYRA 4U0KA 1K5DA 3GFGA 4AWXA 1WHSA 5AIBA 3PUWA 2I8AA 2EF0A 4LI0A 1IXZA 1N6KA 1XU4A 4ZI3A 3IEIA 4XOIA 1QWOA 3TIIA 4KUHA 2VDWA 2Q3DA 1U8YA 2QL5A 2QK4A 4IG4A 1Y9DA 4C88A 2QA5A 2NYAA 1EDOA 1VTKA 1JE0A 1GUFA 2DGDA 2FY8A 2WF5A 3EXHB 3FETA 3NIDB 5BSRA 5B2FA 5LUAA 4GZ6A 3KT6A 5FEMA 1TJ5A 2OGWA 2NM0A 3A6LA 4GWGA 1IDOA 5JS7A 5I4IA 4QYIB 4W9NA 3EQZA 3MGCA 1NPYA 2Q3HA 5JR3A 3KXLA 3TKYA 1RRGA 4LGYA 3S27A 1G5RA 3BWXA 2CUNA 2YS6A 1CJSA 3C4VA 2VRCD 3CNLA 4HDAA 4IVPA 1KHTA 3V1KA 1K1EA 3AHGA 2QM7A 4Q3KA 4TM7A 3UMSA 3W78A 3RS9A 4AP9A 4WBNF 1YIAA 1KR2A 4NI5A 3P2IA 5DSZA 4PNPA 4BNZA 2O1SA 1K68A 5DNYB 4JOQA 4TLAA 1EFLA 1TLTA 2ZRFA 3KUDA 3R7WA 1S7GA 5FBHA 3QPBA 5L3ZA 4FLEA 1OXSC 2P6RA 1BDIA 3WWPA 5TPZD 1DS6A 1I4TD 3FPSA 2A35A 2M6LA 3HCCA 1WSBA 3A4TA 3OT4A 3DW3X 2CEAA 5HZHA 4HMOA 4BMNA 1CVRA 4J29A 3WQRA 1REQA 4MVJA 3LQ2A 3GBSA 5DTEA 3BL6A 4YMLA 3VO8A 4BNNA 2I67A 1YVEI 3FFAA 3VU8A 5BVHA 5GJBA 2GUGA 3EZLA 2ISSD 3HEAA 4H27A 3RIMA 2I8LA 2A3NA 2BR3A 3LT1A 1UDBA 2HA7A 3WYFA 3T9AA 5IPFA 1RXWA 1J8YF 4OV6B 3NMUF 2GR9A 4OAOA 2VKTA 2W5UA 3UXMA 1AZTA 3RG8A 2G9ZA 1DAPA 1ZK2A 4QGFA 3RABA 5CFLA 1YK1A 3ABSB 1B6RA 1A71A 1TYAE 3GDWA 4F56A 3T5PA 1ZVVA 1OXMA 5TJHA 3E1SA 3JQ7B 1XD2B 5ALVA 5F23A 3MCWA 5A05A 3A37A 3Q7TA 3TYXA 1F9EA 3PK0A 3W9BA 3ADDA 1KVRA 4O8ZA 1PV4A 2ACVA 4DLZA 2G17A 1AHPA 2CLDX 3TEJA 3ZLVA 1H5UA 4O33A 2I87A 4RTQA 1IHYA 3CR3C 1DO8A 1KC3A 1B00A 3WLFA 4H6XA 1OAKA 4ZU6X 1BH2A 2R6GA 3KD2A 3N6RA 1E2EA 5IDVA 2FOXA 4CODB 2EQAA 3FG9A 4P22A 4OL0A 1IXRC 2WVAA 4EMUA 4P4TA 1XZPA 4W5TA 5CDUA 3HL0A 1HYGA 1Q11A 1IY2A 4BJ6A 2RH9B 1EX6A 2PKEA 1Z7BA 2XPCA 3GQBB 3BSSA 1WLSA 2VZ9A 4O4JB 4R1NA 3SE0A 3P4UA 1UDCA 2G6BA 5D5QA 3S28A 2E5WA 1CUFA 3DMTA 1NNUA 1O03A 2WMDA 2HT6A 4G4GA 5FPQA 3VISA 2FEAA 5L53A 5KNDD 3THWB 1C9NA 2LIPA 2Q9CA 3UMVA 4J91A 4PSAA 5GIPE 1CUWA 3T3PB 4NESA 5L3SB 2UU9B 4KIFA 1ICIA 3L7KA 4G41A 5JJCA 2RE8A 2V4UA 3G17A 4NZYA 3RU3A 4BJ3A 4E7PA 3A6DA 2WMOB 2Z30A 3K16A 1ODLA 2CL6X 3PA8A 4C2BA 5B4VA 1OI3A 1Q74A 5CEJA 2N75A 2F3QA 2ZPAA 2FFBA 1DUVG 3RHTA 2QUBA 2WK1A 3U6BA 1O0BA 4Y0NA 1AD2A 5CFZA 4ARCA 5TGTA 3W6ZA 4CF3A 2PUBA 3WFIA 1XVVA 3W7BA 3L0DA 3VX4A 5GVSA 1LW6E 1R4AA 4BZPA 1KMNA 3GR6A 4L5BA 4UDYX 2YYAA 5EJMA 2R48A 1TQ8A 4EG6A 4M1OA 3RS5A 1PJ2A 3L07A 3T3HA 1X8XA 1EH5A 5C1DA 4B40A 3BEDA 5FOXA 2X5JO 4JN6B 4K6KA 4EHJA 5BUZA 1B0PA 3G1UA 3KELA 4OB8A 2W2KA 1A2QA 1CNFA 3AW8A 2GCEA 4LYDA 5JDCA 4CPDA 4RV4A 3BICA 3BD7A 4PU0A 4F93B 1B1CA 1KYQA 1Q1ZA 2HRQA 1U2GA 3GMIA 4KN6A 4Q66C 4URZR 4ZV7A 1XE3A 5BXQC 4DT1A 3ASVA 1JPNA 1RXYA 3EY9A 4WKBA 2DY0A 4JOCA 3PD7A 4I0WB 5FTWA 3HKEB 2L69A 4D44A 1ESNA 4X7BA 3HDVA 1FTSA 3SMVA 3OA2A 1AQYA 2HZ7A 2GBPA 1THMA 4EJSC 3HY6A 1KVTA 4RY9A 5FI1B 3ZE2B 5CB0A 2XMRA 1C3LA 3VR0A 3MWJA 3WIVA 3I3OA 4DIEA 4B6FA 4UASA 4Z8YA 1RAHA 2BGNA 2YX1A 4OUDA 1O4VA 3UUWA 2JFWA 5EMMA 2YXEA 4FX2A 1L5HB 2HSEA 3A4YA 5A03A 2OE2A 1FBNA 3IURA 2EWVA 1PFQA 3NPAA 5K3DA 2AR0A 4M9ZA 3SVZA 3ESZA 2V7UA 1HETA 1PG2A 2A14A 1TVKB 3TW8A 1K06A 2ZGVA 4JLDA 4DMMA 2EWWA 1XC7A 3CZ9A 1GZSA 3QI2A 1DV1A 4IGFA 4L1KA 3K70B 4YCLA 3D5TA 3BTOA 1J42A 3D5QA 3HEMA 4G89A 4S35A 1FFYA 2X77A 4EBFA 2BI7A 3IDFA 2XR1A 3DFIA 5B1YA 3UOWA 5BNZA 4N47A 3Q7SA 4FCTA 1SC6A 3NNDA 1HDOA 5LPNA 2Q4DA 5ARDA 2B6NA 4L07A 1OLSB 3THOA 2C4MA 4D0RA 3GHYA 3H5RA 5C53B 3AGQA 4D8UA 4Q48A 1IHXA 1OX5A 1SHLA 2BM9A 2VSNA 2XOKD 2H2GA 3B2EA 4L4UA 2PNJA 3OH8A 2Y1GA 2A0YA 1YGYA 3LWNA 4LWOA 3P0FA 4KQXA 1FL9A 5B3JC 2NQTA 1TVEA 2Y0DA 4YHBA 3MS4A 2D5LA 3E15A 4F1WA 2RCNA 2QE7D 1OILA 3X1YA 1UOEA 1BO6A 3OT1B 4AJEA 3NWPA 1LQUA 3GXOA 3OZAA 4EF5A 1S89A 5TRTA 4P32A 4X85A 4KX5A 1XRRA 2IK8A 4B4VA 1ZP6A 2PZFA 4PQRA 5EHGA 2GVNA 2QP9X 1P1IA 1U0HC 2Z09A 4HUQB 1FX0A 1J97A 1G64A 2BH9A 3IIIA 4MV9A 2EZ4A 1LS1A 1N0UA 2IKQA 1OYWA 1NYQA 2IT1A 4MITA 4TV9F 3BFVA 1NF9A 1IUKA 2BP7B 2KBEA 3C70A 2E6KA 4GMXA 5B57C 2IYTA 3K32A 5AI9A 5KSPA 3UGKA 1Y3CE 3KJEA 3VGJA 1JLRA 4AZWA 3WWYA 1S4QA 2A0XA 2LTAA 4H59A 1CLEA 2CZQA 3Q10A 4WOPA 2LR0A 2UYGA 4C08A 4C7BA 3IMFA 3RLIA 4YT8A 3IMKA 3GNQA 3TJMA 3LTNC 3QX3A 4RADA 3PQ4A 3RVJA 3VKGA 5JMTA 1KSJA 3LX5A 4MO2A 2XMSA 1RWOA 2BUAA 3GAAA 3DHWC 5IN4A 4TTTS 5KOIA 1FJ2A 2D2IA 1ZW1A 2FEWB 5CLQA 4ZHSA 1BWRA 1XNHA 3COWA 2XCIA 5BW8A 3ACCA 4IO1A 5EIXA 3FWZA 3IP8A 5FB3A 1DJMA 5TARA 3N2YA 3ZV5A 2Y1DA 4IJ5A 4PFSA 2IY8A 3UMFA 3O4GA 4W8HA 2B4QA 1J9ZA 2YH2A 4F45A 1NY5A 5BWLA 1FB5A 3AJDA 3CJRA 1QMGA 2ZTUA 4O2BF 1P5ZB 3HY4A 3QFFA 1V5WA 4XWKA 1D0IA 3NIBA 2XT6A 4F4UA 3OEWA 4U2DA 3L18A 5CA1F 5E8JA 3L0CA 1KI3A 4HNAB 4CIVA 4JIMA 1L4FA 5BT8A 1KIFA 1A1VA 4YACA 3H2BA 3ZI0A 5JFOA 5B5SA 1KO7A 4NU6A 1CIJA 3AEKB 4D8WA 1QIJA 2WSSD 5DX0A 3E2PA 4U2KA 2AOWA 1R8XA 1VKJA 2ZRPA 4FFBB 4YRSA 3O4FA 5K3EA 3UJNA 1QYXA 4TSRA 1RLIA 5E2IA 1F14A 1LPNA 3DT6A 4DMRA 5JLJA 2PE5A 3A9TA 4WK0B 5JG7A 4RTRA 2WM3A 3VTAA 1ECCA 5LQDA 2YWRA 3WL7A 4AUNA 3G68A 3ICCA 1YQUA 1L4UA 1TCCA 4H3KB 3UWPA 2E4AA 5GV8A 5FEUA 4Q3AA 5C80A 1Q44A 4JBWA 2NADA 1HMYA 1XTTA 2HJHA 3RBZA 1T29A 3DNMA 4B4KA 2YVUA 1QHNA 2NPIA 2ZT5A 3LYUA 4KV9A 4MINA 4PG7A 3WLAA 2QLMA 2ZJ8A 4LGCA 3MJTA 1NBMD 4R05A 4X41A 4Z2YA 1HTTA 2HEGA 6ADHA 1SUCA 1T3HA 1SKYB 3JQBC 3LP5A 4QDKA 2H5JA 4YJHB 4PWYA 1DCFA 2YASA 1WDMA 4H0NA 3KAPA 3UFBA 5K2MA 3T7KA 1NNSA 5DM1A 2GAJA 4MQFA 4DIDA 4MUAA 1GZDA 3H13A 1OREA 1GR1A 3KTDA 1OASA 1W94A 4NONA 3DTVD 4JSTA 2BGJA 5HG0A 5LXTB 5AVXA 5IU6A 5L7WA 4AQ7A 3K6RA 3DHNA 2QORA 3ZDBA 4LY3A 1VPVA 1E4OA 4JUFA 3WGQA 1RXVA 1IM8A 2AUMA 1YTUA 5EZ6B 2AWNA 1DC4A 2A84A 2QMOA 4UBNA 4MQMA 1G6KA 2JH9A 1CTQA 1A50B 1Z73A 1GFWA 3ANNA 4B7UA 2PSJA 1T9BA 4LYGA 1N2HA 4UTVA 3EIOA 4UTOA 3GK3A 1M83A 4XVQA 3EEOA 2UYOA 2A1TR 2GILA 2YMQA 4AJNA 2W2TA 2CWWA 4X1IA 3RTDA 1G8SA 4ZANA 5IEBA 2EIHA 4TQ9A 1Z9BA 3OLCX 4MVJI 4W1QA 2H9YA 3RVNA 2LDXA 4R2LA 4BYGA 4IXMA 2PKWA 4FMPA 2C61A 2ZUDA 1T35A 2IW3A 3JQFA 3LHFA 4G36A 3VSBA 3W1WA 8MHTA 3MF4A 2ODBA 3N2KA 3OG9A 2BGUA 2VATA 4WFQA 4HATA 3TOVA 2JIBA 3IHKA 3RDPA 3V2GA 3U1VA 4U5XA 3Q9UA 3BK7A 3P52A 1ATIA 1I5EA 1PP4A 1PR9A 3GEDA 3BMCA 4QC2A 4Z9FA 3W5CA 1A98A 5H4HA 1T5BA 3C7KA 2GEBA 3UAOA 4M98A 2FEMA 3TNLA 5A3SA 3HJHA 4Q15A 3CKKA 1WRBA 5F21A 3GUHA 3VOBA 4CZ2A 2QTTA 4P7BA 3O1HB 3A10A 3ZD6A 2PXCA 4P3OA 1AIPA 2GNPA 3KKEA 2VKQA 3DTTA 3V4PB 2D13A 4PLHA 1OVGA 1NJGA 4E2WA 1YA4A 1XEAA 2OO7A 1UZAA 4U7PB 2ZUWA 2C99A 4QHSA 3WSTA 1SY7A 1Y8CA 5ICEA 3FD8A 3HCFA 1QP4A 3TRDA 1JWBB 2ZVPX 1X1QA 3FROA 1HEIA 3FWKA 2QRVB 2H2WA 1E64A 1B23P 4A10A 5ER6A 2SECE 4M9SA 2GJ4A 1NF3A 1VXRA 5THQA 1H8HA 3NYRA 4KYIB 3TB4A 1UKAA 1A5ZA 4KC0A 3WWOA 3ZOZA 4WUTA 4ENTA 1P5RA 1P81A 1X94A 1PFKA 3KL2A 4YAEA 4RETA 3BKWA 3O93A 4GX2A 1GV0A 1YO6A 3KLPX 3LPMA 5EZYF 3U3RA 2IEBA 3I42A 1K8RA 1FZTA 2EFEB 3BMNA 5HRUA 4R8VA 1VE9A 2GXUA 4Y9TA 1BHQ1 1RWBA 4Q5IA 4EUSA 3KCNA 1EB8A 4KPUB 4YDSA 3K0AB 1CJUC 4KQWA 3MZ0A 4BV8A 3RT7A 4FX5A 1RLOA 4AWBA 4JT2A 1V5EA 3DAOA 4FFSA 3GBVA 4ZGBA 1UCFA 3K94A 5IULC 2YW9A 4XGKA 1AM4D 3H1EA 3DQZA 4JB3A 4Q9JA 5ERYA 4B8WA 5FTLA 4NDAA 2F43B 3P9NA 1LBEA 2WDPA 3HBMA 2G5GX 2EX0A 2BY4A 3G0OA 3I6BA 4O4IB 2QQGA 3H5VA 1XCOA 2QTAA 2HMVA 3CUWA 2V6BA 3L7BA 1IAVA 3OPQA 4H15A 4IKPA 4QOSA 4Y8VA 3PA6A 5K0SA 3QVXA 1EIWA 3PNBA 4LHSA 4RACA 3TFWA 2VHQA 1EE9A 4DNPA 1YFJA 2FEPA 2SCUA 3LCMA 4AKEA 1OLUA 4AS2A 4YC7A 3A3OA 2JH3A 4YP9A 4AKIA 4G9GA 3C97A 4TQAA 1UK7A 5IFKA 2JFZA 2R25B 4H9GA 4RJJA 4MYRA 4PN3A 3F9IA 1R0WA 1QOPB 4R16A 2O5EA 3MFYA 1BRTA 2XA9A 4G26A 4YQZA 3TSYA 1XNRB 2B9VA 4N6GA 4NQRA 4TZ6A 2CDAA 2P4UA 3I09A 2QRMA 2CMFA 2G08A 3NFRA 3WRXA 5GQSA 2CWDA 2JLZA 3BJZA 3HYTA 1NRWA 1HDRA 3IR6A 4YDHB 3T12A 3HVIA 1HRKA 2BRUA 3PEFA 5G4KA 4CIDA 3PQDA 1SK8A 4AJIA 2HGSA 4JJ7A 1UKCA 1COWD 3AVXA 2E0IA 2J30A 4KXWA 5ADVA 2E4ZA 5A7FA 3T1TA 4OFBA 2P4EA 3GEGA 3QU9A 4FT4A 4DJJA 2R2AA 1RFGE 4ER5A 1NUAA 3NHPA 4IGKA 2PMCA 5K4AA 5BW4A 2R751 1AT1A 5K4GA 3ZKAA 4GBGA 1Y8AA 4YP1A 3IS3A 1U2DC 3D1LA 4EY7A 5CB4F 1JYFA 2NLOA 3LC2O 3RYFA 1J0BA 3WYNA 3R75A 5ICGA 4J3NA 2W11A 2QAGC 1E1RD 2CLHB 1WOYA 5PGMA 3NHZA 2GPSA 3JQGB 3QGMA 3U61B 3CFYA 4RWZA 4MIKA 1AKQA 2PUHA 4RKRA 3V1YA 1WUIS 1H3FA 1TGYA 1P2DA 3HPRA 4LBZA 5LMCA 1CF2O 3HB9A 4YRGA 1NZFA 1XZJA 4YJ3B 1T9CA 4BLUA 4YR9A 5EQDA 3RKRA 2O8VA 3L0YA 1OH5A 4X3OA 4CHGA 1IONA 3EFOA 3VNAA 1V1RA 1SUFA 2AC4A 2Y2UA 1LPSA 1CZKA 4Y7CA 1K0FA 2BFDB 1J24A 3L02A 2ID4A 1UAGA 2JHAA 3DG9A 4FQ8A 1SHZA 4QTUB 4EPTA 4NSNA 2ZWMA 5G40A 2ON6A 2VHEA 1MP0A 3TF5A 2YR0A 4DMLA 5E6RA 3NAQA 1JA9A 1BE8A 2FP4A 2PT7A 4O3FA 3OE4A 4AJHA 3VPAA 4F8YA 4ZYLA 3RPEA 1QSGA 2J67A 3NC1C 3Q2OA 5DHUA 1GDHA 3ILYA 2REXB 3K05A 1J56A 2GRAA 3LXXA 4I5GA 1SEPA 3D4LA 1MMFB 4F6CA 3IYLW 2VL7A 2YZKA 2HHLA 4MPDA 1TYZA 3EXFA 4OVKA 1MFZA 1T1EA 2AMYA 1WJGA 2P0AA 4DJAA 4JBNA 2BZ1A 3CLVA 5ESRA 2QRKA 4Z3DA 1OC4A 2GZRA 2WJZB 2AVDA 2WM9B 2A33A 2W2PA 3DVRX 1WE2A 5G1OA 2X3FA 5E7IA 6REQA 1IYZA 5AVRA 5CM9C 3UXHA 2QLTA 2JHCA 5HOQA 1NVWQ 3NJ8A 4LPKA 4BTEA 4O5OA 5ALNA 1M5UA 1TCVA 3U9SA 3ZE0B 3A6KA 4WLOA 4EO9A 2QTVA 3JY6A 1NNLA 3VNSA 2Q2QA 4PLGA 2YV2A 2JEZA 1X80A 1N1DA 3LQYA 5CXUA 5IJZA 3PGKA 1K8QA 4BU1A 1Y6RA 2NYVA 2FU5C 4IXTA 1HSZA 4KFTA 2PUFA 2RGCA 4CKXA 1NVKA 2IY7A 4L3VA 3D6MA 4N5HX 1WXGA 3AF4A 3DPUA 3PENA 4IIXA 4MRRA 3KQYA 4JB2A 2PSEA 1WQ1R 5H59A 4J1TC 3WYAA 3DOIA 3OQPA 1BS2A 2BKXA 4D9FA 2CMDA 4LX8A 1JEQA 4ZZ2A 5IJ0B 4QOJA 5KYGA 2HWYA 1D2GA 2XUHA 4LMAA 4OQLA 3OX4A 5CIWA 1EFDN 4FI3F 2FVXA 4ITUA 1NFQA 2OOKA 4L9AA 4B9AA 5LOVB 1YA6A 2FZCA 4PC3A 4BGUA 1P4AA 1E99A 4HDNB 2JFNA 2VDNB 3H6GA 1UK9A 4BMDA 3VA7A 4PGFA 2Y4NA 2JAQA 5JJBA 2FN3A 5LMNB 4RIFA 4MP3A 2VH1A 1G5FA 3EGXB 3LE8A 4ZU1X 5T3UA 4OHFA 3V9AA 3KSAC 1QZZA 2IF2A 5TV2A 5C7LO 1ST3A 1NXPA 3EEIA 3WL6A 1U2EA 1GKIA 2BVNA 2XADA 1ISHA 3OLXA 2QN3A 4XCVA 3UJPA 2OP1A 1II8A 1Z15A 2FFQA 2VNHA 1XN1A 3C5WP 1JGTA 2RG1A 4UPDA 3VR4A 3B6IA 4YP5A 3QQ5A 2VJPA 5M29A 1KI8A 1ZC4A 2BDUA 1ZYUA 2WJIA 3VDQA 4YO8A 4ZOLB 2YV5A 5JQGA 2XEXA 1E7WA 2LW7A 4M3NA 5BY2A 3T1QA 2QZZA 3ORHA 4XA8A 3SFVA 1ZWLA 4PZCA 3BFJA 2CCKA 4C6RA 1YZHA 1H6BA 4MGKR 5C4IA 2G4LA 3IVAA 3EN0A 3MUFA 5CYPA 2ECPA 2XYPA 2HU2A 2IYLD 1A8SA 1KORA 3VZDA 2ZYVX 1UJNA 1JR3E 4ZO4A 1QLHA 3GGCA 2WMYA 1XZNA 1U11A 3B3JA 1LH0A 5FQOA 4LQLA 4C87A 3INRA 1MX3A 3AY6A 1FRZA 1JHUA 3NC0C 4ISCA 3PKJA 1CPYA 1JQBA 4PC6A 2V1UA 3EIQA 3AU9A 5AIAA 1UF9A 1Q7GA 4LDJA 4N5LA 4GLOA 3ZHYA 4C2AA 4D6YA 1Z62A 1ZICA 3PUYA 4MUXA 3U7IA 3ADCA 1T8YA 2MSKA 3OIFA 1JTVA 4MVXA 3N8NA 3FDZA 4RHUA 1V16B 3G0DA 3O82A 4JUIA 1M2OB 1AKTA 3IUEA 4FGSA 2QJWA 1Z6GA 3AILA 4Q93A 4TZ0A 2PWZA 2ZRMA 5T4HA 1L6IA 4BMVA 4GKKB 3V1UA 1W73A 2W48A 1K7EB 3DKIA 4QYTA 2QR5A 3FH0A 3OEED 2QMZA 2YXLA 3KSRA 3NBKA 5LQSA 3H83A 4IEFB 4ZO9A 1IXYA 4L85A 1UXGA 4XQEA 2F67A 3FPFA 3P1JA 3PL5A 1ZITA 3W8FA 2O7VA 4NMXB 1QQ6A 1SZDA 1OYYA 1R5OA 4UXIA 1QFYA 1TYDE 2C20A 1OI7A 1PK8A 3IDOA 4QG7A 5CT4A 2PH5A 2CKMA 3S2UA 4DILA 3WDKA 1OI2A 3PUZA 3GGPA 4HT3B 4MA4A 1G6Q1 3O9ZA 3G2PA 2FJPA 1BEEA 4GOND 1AKYA 1XK6A 4K6FA 3L6CA 4XPIB 3QBTA 3PT5A 1BVHA 2OA0A 1RHMA 4NU5A 1NVGA 3WNDA 3C1OA 4FDUA 2ZUUA 3NTLA 4W9NC 4TV8B 2ADFA 5E1OA 4AF8A 1N36B 2DQKA 2ZB7A 4MLPA 2HGZA 5DI9A 1Y3DE 1IMOA 2J5BA 3AIOA 4WKNA 2I7CA 2YN4A 1JDUA 3ISJA 3KYIB 4FW8A 4IS3A 3RFXA 4CIYA 2B21A 2MYNA 2FSPA 3DLTA 1MX1A 3FY4A 4FC6A 1Z2OX 2HK6A 2PV7A 5TPWB 1JQ3A 1UZUA 1WZNA 1KTVA 5C34B 1A9RA 1CDOA 1QTRA 1TAHA 1D6JA 1ZUWA 2I4LA 2OAQ1 3LO5A 3OBBA 4LEIA 3GZJA 4L4RA 1BJKA 3QXJA 4BV2A 1BS9A 1E92A 4MCAA 3EQ7A 3NHRA 3LFHA 4KEAA 4QPPA 5ELXA 4BGIA 4F4FA 1USWA 4PYNA 3FYCA 2HRRA 1YR1A 1ORIA 4G1VA 1PE0A 3DMHA 4ZKDA 1QU3A 2C9YA 3MB5A 2I3BA 4EA7A 4KDCA 2IBSA 2P3LA 2DHEA 5B1SA 1W8IA 4P34A 3DZCA 2TYSB 5D00A 4PGMA 1WL8A 4IYRA 3NEAA 5K99A 1C50A 2VDRB 5TQJA 2OV2A 1XKTA 5EP3A 1RYFA 3ORFA 1X70A 1PZMA 3OZIA 3EW7A 1ACLA 2HPZA 2X76A 2VPYA 4PWZA 4G0VA 3KR9A 3K96A 1G2QA 1P73A 1QRSA 4IILA 5K8TA 2OM2A 3NPMA 4N41A 5DBOA 3RRYA 1P77A 3V4RA 2ZRKA 4YIHA 4D3SA 5DZSA 5JJ5A 1KAGA 3CG4A 4EGAA 4DBLC 3VR4H 3FB4A 1NXWA 1TF7A 4MP8A 4YALA 2YN0A 4IRMA 4CQMA 3EUWA 4P3PA 2ZI5A 1NV8A 1PQUA 4OMCA 1R12A 4M88A 5F4BA 4S1TA 3QE9Y 4DCUA 2D8AA 1XTSA 2A0UA 3TLGB 2IYUA 1K0UA 1N7JA 2R4TA 3RAJA 1FDWA 4CMGA 2DERA 3G8YA 5C9ZA 5BO5A 1L6RA 1XQ9A 4KFRA 1ZCJA 4DNXA 1N6NA 1O8CA 2G8LA 4CM8B 5HSGA 2HCRA 4EABA 1JU4A 2OVFA 5HDQA 1LDBA 5BOVA 5SYMA 3VH1A 3DMTC 5LKAA 3HDHA 1WF3A 3KLBA 4G5OA 1WMFA 3EYAA 4LXHA 4F7DA 2XWQA 4OHKA 4UARA 1KWGA 1NZDA 1Z5GA 4TS3A 5EKDA 5EHXA 2IU6A 1ZGCA 5J2TF 3GRVA 2GEDA 1OHHA 2AL7A 1L8OA 2OYSA 5C32A 3O4HA 1SXPA 1ADCA 4U00A 5H80A 2BFWA 3TLKA 4ER3A 3CZ5A 4F9FA 2WU4A 3OF5A 2A1IA 1Z6AA 3MTEA 7ADHA 4YPOA 1IN8A 4XUGB 4UDXX 5JALA 3NVKI 3K9NA 1DXQA 1O95C 1Q7TA 1G20E 5HW0A 1CX9B 4KR0A 4P3KA 3DTYA 3U4HA 3GFSA 4M21A 4EVRA 5JIBA 2JC3A 4HDSA 1Y6ZA 3DZJA 3IPLA 5KTMA 1JH8A 4JEMA 3WLEA 1FDOA 4ZPXA 4ZYVA 2IU4A 2G1JA 3ZWPA 1KH2A 5ITZB 4LCBA 3LBNA 2XIJA 5FUVA 4PNEA 1MPXA 4PVCA 3VMFA 1QPZA 1ZI9A 2GVDC 4YMTA 3U56A 5D84A 1U7WA 3V8QA 1RXSA 1HT1E 1U0GA 3FGNA 4CWAA 1JJFA 3LYAA 5G53C 3UVEA 5JDCC 2XAUA 3VNVA 3M33A 1VKNA 2BMVA 3I32A 4JI1B 5LWQA 2J33A 4L5YA 1U2GC 3OCCA 1M1UA 3H6KA 2CUKA 3NHWA 4GDFA 3K0KA 4J0QA 4KBYA 4QD3A 5E4FA 4BFWA 3GCGA 2YIVX 3G2IA 1JF8A 4TVSA 4HXFB 1I94B 1XDSA 1OQAA 2CXQA 2DH5A 3DH0A 4R2HA 3NNSA 1OX6A 1B8VA 1C8KA 1RJWA 5BRNA 1NVDA 1QMPA 1EK1A 3FFXA 2WTEA 1VDZA 3FJOA 5F77A 2VDLB 3ZHVA 3BT7A 2QPLA 2EARA 1X7YB 1M76A 1EK5A 4ON9A 4NY1A 1H66A 5F78A 5GP1A 1TYEB 2FRVA 3D31A 4RW0A 3O5AA 5EMJA 1RJFA 2I6TA 4K6MA 1HE3A 2ZCJA 3U6KA 2X6TA 4A82A 1NQAO 2D7DA 5DLEA 2AOXA 4NFHA 1BA3A 1E18A 1LX6A 2B6HA 3K5IA 3L93A 1XJQA 3DE4X 4L3WA 4ME6A 2J0QA 2L0XA 1OV6A 2EZ9A 4QECA 3A25A 4KGDA 4HQ6A 4I3GA 1ZD1A 4R8MA 1BIFA 5IDYA 2P5UA 3EQ9A 3P9SA 2FMIA 4O2AA 5AHRA 4BCCA 2YHAA 4AS3A 1GUZA 3TAXA 4JP3A 1KK0A 2NU9A 2Q3BA 2HAEA 3PFKA 3GPCA 4MGIR 1I9CA 4QJBA 2FG5A 5KI6A 1C1DB 4DCMA 4DXHA 3PEEA 4IVNA 5KHOC 1EJ0A 1JHYA 3BGWA 4CIWA 1GNVA 1VE6A 2WYOA 4YK7A 1NMXA 2P11A 2VTKA 1JG7A 2I34A 3DR5A 5JCOA 5T5QA 3KZMA 2NV2B 1YJBA 4LYFA 1KK3A 4DV3B 4YJ2B 2O2SA 1M6NA 2KB0A 3EISA 3G79A 1GPDG 1XMSA 3EDQA 5HILA 1RLTA 1UFRA 4OA5A 2CT8A 3GWZA 5EPOA 1H2WA 3DOOA 4MR7B 4WJZA 2GQ0A 4AYTA 4FMCB 4QNRA 1AK1A 4TKUB 1LWNA 3QH4A 4G0PA 3TRKA 2ZB2A 4PGAA 5DK6A 3V46A 5MDHA 4JVLA 1WA5A 1E77A 4FLMA 1AKUA 3OHPA 5DTRA 3ZDAA 1J06A 5L8VA 3D7NA 3JQAA 2Q3LA 1DKPA 1SUPA 3KO8A 4H18A 1NBWB 1N5MA 1P72A 3PX3A 4XJTA 3DULA 3STWA 3M6FA 2F9FA 5E3IA 5DTQA 2XLBA 4EOGA 1O95D 2OBFA 3VR5A 1VJTA 4C9BA 4DDWA 4YRQA 2AEJA 3BGIA 3NOXA 4XXHA 1LC0A 4YMVA 1FTWA 3A26A 5AUPB 5I3CA 2I91A 2D7JA 2Z3VA 1LBSA 3PX2A 4INAA 3WLOA 4XAQA 2RKBA 2V5VA 1M73E 2D5CA 5ES4B 2VAWA 1J2JA 1U7HA 3MCAA 2ZROA 1OA1A 2DWUA 4E88A 1VYUA 5ALGA 3X2EA 4BEVA 1OBVA 4BNWA 4RJLA 3IT0A 1K7SN 3BRSA 3WY9A 2B5OA 4AN0A 5A5VA 1UPFA 3AW9A 4R7TA 1DT5A 1JLKA 1ZBDA 1BEZA 1XVUA 2PTHA 3CF0A 3WMGA 1Z0IA 4D0NA 4E2FA 3VUFA 3O2JA 3LECA 2M9MA 3BORA 4YASA 1LSUA 2D0IA 3TOSA 1E7MA 4Q3OA 4XLTA 5ALHA 5EE1A 5K09A 2ZUVA 2C8VA 4DCTA 3BD9A 5L3VA 1JZSA 1IJEA 1P29A 1CW2B 1WCV1 2EFDB 4D9JA 5K6TA 3CTMA 1MORA 3QVKA 4LYEA 1M1ZA 5IAEA 3ZV6A 1IH8A 3HB7A 2XUGA 4J6FA 2ZWAA 1P5FA 3EG9B 3DD5A 3FZYA 4N65A 3W7VA 3WIEA 2REOA 4URHA 5E9JA 3V7YA 4BNTA 5BRAA 5E6UA 1UJMA 5KDLA 1QX4A 1H0KA 1K6JA 1W9HA 2OUKA 4GMKA 1Y4UA 4U0JA 4B33A 2AG1A 5I7EA 2G7ZA 3RVQA 2H9IA 1ETUA 2OAGA 2GEVA 2K4MA 3FTPA 4CU5A 4L15A 1Z7GA 5ALLA 4ALLA 4UNQA 4CQJA 3J81k 4XW2A 1UC4B 3HJAA 4BWFB 2XQVA 1JHQA 2OAEA 3KWFA 5FUWA 3RR2A 5K8IA 1XQXA 4TTAA 1GLNA 2WJ6A 2QG9A 1PR0A 1UZNA 4L8VA 2CNNA 4U8GA 1BKYA 4MQ5A 1QO7A 1VDMA 4FKMA 4KVFA 2OL4A 3MMPA 1ISFA 4YRIA 5E6SB 2Z3WA 3MWLA 2DAPA 5CIQA 2H7CA 5TEWA 4F38A 2C7PA 1FFHA 2B8TA 1HE1C 1RHUA 4LBWA 1XF9A 1HT0A 3BFKA 4NJOA 1TI7A 3MWGA 4Q02A 4D9HA 2BFNA 2XCOA 1NR5A 3MT9A 4JQOA 4YCSA 5DM70 1N5OX 3IOBA 4OIMA 4IIDA 2PVPA 5FYQA 2Q5QA 3JR7A 4PYLA 4WH0A 2YWGA 1W25A 2WQ6A 2CVZA 2FPWA 3ZU6A 2WLSA 4D79A 4CETA 4DV4B 2Y67A 2JBWA 1M6YA 1VIYA 2IKSA 3DLIA 4ACBA 4WJKB 1X7XA 1E3DA 1W1IA 3W4KA 4IUDS 1KEEA 1N2GA 2VF8A 1IZYA 1XD9A 5BV8A 1FP1D 1E2GA 1QYDA 3KJGA 1PZEA 3K0CA 5SYNA 1IOVA 3L7MA 3W79A 3OM1A 1ZWKA 4PSCA 2JHFA 3QVVA 3LVFO 3HSKA 1G20B 4PCVA 4J8PA 5ALTA 4DZZA 2J31A 5LBUA 3BBPA 3OQIA 5FLXA 1CQPA 2A9PA 2ID9A 3R3YA 2C2MA 1Q5PA 2B94A 3BD8A 1L7RA 3JRWA 1CUSA 1Z82A 2GM3A 2Q5EA 1BFDA 2B3TA 2B5WA 3FMIA 4LISA 5IABA 3SQWA 1YQQA 3GN1A 4OUKX 2K6GA 4KI7A 4N49A 3KRTA 1QIIA 5B7QA 1Z5VA 1PX0A 1Y5NA 4LF7B 1U31A 4OKIA 4AJOA 1AO0A 4DR7B 1LVUA 1RPNA 3CZAA 3MTJA 2I4MA 3JQFC 4W82A 4LZLA 5AK6A 4QODA 4XVHA 2FA9A 1ODKA 2PG3A 1MV8A 5IBQA 3BXPA 2IGTA 1QVAA 4EQ6A 3MEQA 3VPFA 1NW6A 2AFHA 2RHTA 4E2ZA 7YASA 2M2IA 4WDQA 1DJQA 2EKPA 1G8AA 3QE0A 3REOA 4DXAA 1RZVA 2QXUA 3WFJA 1ACMA 1OIWA 2C96A 3UK2A 2Y76A 4RIHA 1FLVA 2H1SA 1CE8A 4L2IB 3T35A 3PC4A 3LY8A 5KYXA 1YA8A 4ZOAA 1MDFA 1OBFO 5EFZA 4CCYB 1EQUA 1ORHA 3CUVA 2QENA 2WPDA 4BY9E 3T7IA 4LRQA 1AS2A 1YZFA 2MINA 2PWYA 3DXFA 1JG4A 3T1YB 1RKBA 4EENA 4LDZA 3K5PA 4DE5A 1QV9A 2I65A 2Q4EA 1Z4KA 4WZAB 3BJEA 3BKXA 2QD1A 4Q6WA 1DQRA 3ABIA 1X7ZB 4PBSA 3UMCA 1AVTA 1HR0B 1SOUA 3E2IA 4EMTA 4TLMB 5B58T 3DPSA 3QNUA 4CQLB 3GGSA 3BERA 5CGQB 4R2KA 5DTMA 3WIBA 3IR5A 4D7AA 3OZBA 4WBSA 3NDIA 4QOIA 3P8ZA 3PUJA 4E70A 1NZJA 5C35A 3GYBA 1LY1A 1VZ2A 1N6OA 3MAGA 1SBTA 3R3SA 3COJA 3LPDA 3U4MA 1AS0A 4RLHA 5LJIA 3PJRA 3L1UA 4RHYA 3TXYA 4PZYA 4N3GA 3G9XA 4H1VA 3T99A 1JMYA 2WY2D 2V7WA 3JTMA 2JBHA 4FGUA 4C0JA 1BA2A 2C31A 2V9PA