4CR7A

Crystal structure of the n-acetyl-d-mannosamine dehydrogenase with n-acetylmannosamine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
261
structure length
260
Chain Sequence
GRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYEEPGAIPIACDLDRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGKDGRSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAMIFGGMREGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLMANNOSAMINE 1-DEHYDROGENASE
publication title Crystal Structures and Functional Studies Clarify Substrate Selectivity and Catalytic Residues for the Unique Orphan Enzyme N-Acetyl-D-Mannosamine Dehydrogenase.
pubmed doi rcsb
source organism Flavobacterium sp. 141-8
molecule tags Oxidoreductase
total genus 89
structure length 260
sequence length 261
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.1.1.233: N-acylmannosamine 1-dehydrogenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cr7A00
2BD0A 5EESA 2P4QA 1F14A 4IJKA 3HB4X 3I5MA 4YJFA 3WOHA 3W4KA 1CQJA 4RZHA 1G0OA 4CR7A 1PEDA 2PNFA 4E2XA 1SNYA 1VRWA 3MJEA 1ZEMA 3F6YA 3C7DB 2UUOA 1QV7A 4KUHA 4AJIA 1BW9B 2QHXA 4WCFB 5G4KB 3D5TA 6ADHA 3L77A 4CM3A 4DL9A 1Y5RA 5I7EA 1NX6A 3JYQA 2HMVA 3R3JA 2HU2A 1BG6A 4OXNA 3I1JA 3I9LA 4J4BA 4EI2A 2JAHA 3JQ8B 2CF6A 3KYDB 1XWFA 3P5SA 3C7CB 2EP5A 3RUHA 2HMUA 2YV3A 1HDGO 2ZIZA 4K26A 4PRKA 1SB9A 3ONFA 2JHGA 1WNTA 4GH5A 4WLOA 5G0TA 1SB8A 3E03A 4MPDA 3PQDA 4Z0HO 1GQQA 4E13A 3GEDA 1LEHA 2VN8A 1AXGA 2O7SA 4BNJA 4W7HA 4X54A 4PG4A 5L40A 3ZZNA 2BELA 4CL3A 3WR5A 2VZ8A 2YDXA 4RPHA 1C0PA 2PR2A 4J7UA 4UEJA 4E2ZA 4YT8A 4HFJA 4O1MA 1VJ0A 1NQ5A 1BSVA 1WW8A 4OAQA 3B6ZA 4YACA 4XJTA 4CMCA 1OC4A 4H7PA 4NMHA 2J5QA 5L7YA 3PJEA 3BXXA 3UFXA 3VH4A 3TZQA 3WSVA 1PS8A 4FS3A 3R0IA 2EGGA 3LF2A 1DXYA 1FF9A 5F5NA 4E2YA 2JFGA 1U7TA 4OQYA 1HWYA 1P1JA 3KRTA 4R69A 4A26A 4AJ2A 1KC1A 1GFSA 2IZ0A 5TQVA 3HUDA 5EN4A 4YRBA 4XR4A 2G17A 3JQGA 4II3A 3QVSA 3F5SA 2NU6A 4BKOA 3KBOA 4NDNE 4A0SA 3T7EA 5K0ZA 4CM6A 1H9AA 4E0BA 2DBZA 3CH6A 3DBLB 4INAA 3WLFA 3QE3A 1JN0A 3JSAA 3DZFA 3PJFA 1Q7BA 2OOSA 1WPQA 4L74A 4QEDA 3ZWXA 1RYDA 5G0VA 1Z73A 1LU9A 2GNAA 4BMNA 1PGOA 5G4LA 2PD6A 1PS0A 2IEDA 4BHTA 3KO8A 4XKJA 2X9VA 3MWEB 5DBIA 3IKTA 5KOIA 1QSGA 4PLVA 2CDCA 4WNCA 2YHIA 2X4GA 1Q1NA 4TRNA 3KSZO 4GMGA 3JQ9A 4JROA 2D0IA 4FFOA 2FRDA 2VT2A 2G76A 2NQTA 4Q3BA 4BO1A 1K3TA 3W4IA 1F17A 4NG5A 3ZI0A 2J8ZA 3GUCA 3VAZA 4BUCA 3T4XA 3D1LA 1R4MA 3TZKA 5CEEA 3DOOA 3NDRA 4W4TA 1DLIA 2P91A 1BHSA 1DIRA 1NHGA 2BFOA 2JAPA 1LSOA 3PEFA 3H8VA 9LDTA 4D0RA 1IZ0A 3ZHBA 4KTTE 4BGUA 1J0XO 2PGLA 4Y6PA 3GRKA 2I99A 1FDVA 4L4SA 2X5JO 4DIFA 5CG2A 3WBFA 3PWSA 1YL7A 3H3FA 3UAGA 4UVIA 4KUGA 4QQRA 3W6ZA 1UAYA 1XR3A 4OXYA 2HKIA 2CD9A 1ZMTA 2Z5LA 3COSA 1AUPA 2GR9A 3F4LA 2VYVA 3V1TC 5ENDA 3DHYA 1HSZA 5JCJD 2OL4A 4GVLA 3F46A 3WYBA 3ZU2A 3TZHA 4BQRA 1ENYA 3JQEA 3MZ0A 5A9TA 4CMKA 3OQ1A 1KVUA 4F6LA 4CQLB 3GEMA 4ROSA 3DB2A 2NM0A 2D5AA 5DDIP 1GPDG 5K6AC 3QWIA 1EVJA 3LDHA 3RUFA 3OA0A 1R12A 4FFPA 4XDZA 4JCOA 4FJ2A 3ITKA 2G1UA 5IFLA 5L95A 4DYVA 2UUPA 3GG9A 4DWVA 3GDOA 4CLOB 1N9GB 2RIRA 1ZH8A 4IY1A 1E1MA 1YO6A 1PL6A 3C1TA 5BSHA 3GH3A 1GY8A 1M6WA 4PLWA 1RM0A 1FK8A 2V65A 3TL2A 1KEWA 1MXFA 3LYLA 1R66A 2ZJ1A 4RJTA 3DWFA 3WGTA 5AOVA 2BI8A 1IPFA 2Q1TA 4XQCA 1SCUA 1FXSA 1I01A 2DUWA 2GO1A 2J3IA 4DTIA 2FR8A 2OGUA 4O0LA 4CM9D 3GZNA 3VTZA 5FEUA 3KSDO 4IS3A 1S7CA 4CM8B 5I7SA 4J7CA 3ZN2A 4Z3KA 1NVTA 2C2YA 3HDJA 3BMNA 3RJ9A 1TA4A 1O0SA 4R3WA 4NBWA 1ZW1A 4UEKA 4A2CA 1ISIA 2YFHA 4J4TA 1O5IA 5TNXA 1ENOA 5BNTA 3UUWA 3QY9A 1U8XX 3E18A 3I9OA 3N58A 3M6IA 4AL4A 4D41A 3JQAB 2DTXA 1GYQA 3D4NA 5KJEA 4YAKA 3ASUA 5JC1A 3X2EA 5JC8A 1D4FA 5DP1A 1MG5A 2PZMA 1Y5MA 3LT2A 4RDIA 2YHUA 5BSGA 1DPGA 4MKXA 2GF2A 4AJ4A 4BV9A 4BIIA 7ADHA 4I5GA 1QYCA 4FD3A 3JV7A 4YJGA 3OEWA 1E7YA 1DC3A 3S1LA 5IAAA 5I7VA 2ZTLA 1EDZA 4ITUA 5IDYA 5L53A 4YT2A 4FJ1A 3CXRA 3JD0A 4FFLA 4PG5A 2DBQA 1XA0A 3AU8A 2WE7A 4TZTA 1E1NA 5IZ4A 1PJTA 3NEPX 4YJHA 2VOEA 2CVOA 3FI9A 4IMRA 1Q0QA 2BLLA 3FBTA 4HP8A 2ZB3A 2NSDA 5DZSA 4CMEA 1Z75A 1BGVA 1E1KA 1GPJA 1HDZA 2GN4A 3GVHA 3A1NA 4HFRA 4Y6SA 3STHA 5HTOA 1KIFA 1EUZA 3QWHA 3ZNQA 5TIIA 4ONEA 4R1NA 4BGEA 2Y93A 4AJEA 2VRBA 5ER6A 4XD2A 1YBMA 3CE6A 4CODB 5DCWA 5GMOA 5KWEA 3LT1A 4QT0A 1K6JA 1LDGA 3Q2KA 3K8ZA 4A73A 3Q1LA 3K92A 4HV4A 1I3MA 1M76A 3TL3A 1TT5B 4OH1A 3E9MA 4A10A 1DFGA 4DRYA 1YB4A 2IDZA 1PJ2A 3NDIA 4Q3EA 2EG9A 3INGA 4WECA 5IZCC 1HDOA 1ENZA 3H5RA 3VVCA 1QLHA 1PZFA 4YB8A 1DIHA 3A28A 4FBGA 4QECA 3AOEC 2HAEA 1HF3A 3LQFA 3S2FA 4R9RA 3C3XA 4HY3A 1RM5A 5DF1A 1QRRA 4CMHA 4OOFA 1EMDA 4U6QA 3UCEA 4AJHA 4DMLA 4WLVA 2QW8A 4RZIA 3P7MA 1NASA 2I3AA 4GQAA 2BRUA 1ISFA 1HYHA 1Y8QA 2X9GA 4MVJP 1YQXA 2Y0CA 3GPDG 3TWOA 4JNKA 3QA9A 1LLCA 1ZSYA 3CZMA 3WG9A 4MVJD 3FF4A 2Q99A 2O2YA 5IXSA 4R51A 2QZZA 3BMOA 1U4SA 3SX2A 3W1VA 3G49A 2C2XA 5LDHA 4F6CA 1U9JA 4JBIA 3U4HA 5BNFA 4R5MA 1R37A 5LC1A 1SEPA 5JS6A 1ZK0A 4L0QA 5TJHA 3IUSA 4PRLA 3R1IA 4ILKA 4J6FA 1AHHA 2GYYA 3PYXA 2PZLA 1PQUA 2OHXA 4GKVA 1ADGA 1E7RA 5CPFA 3GDGA 3U3XA 2O3SA 4BNHA 1H9BA 1YBVA 4BO7A 2Z1MA 3NUGA 4XGIA 3EZYA 1E3IA 1XU7A 1EK5A 5ES3A 4MVJG 1Y9EA 3ANNA 5CAEA 4D44A 2D4AA 1KOLA 3PXXA 5A3JA 3SVTA 2P5UA 4HFMA 3VKUA 1E1LA 1Y1PA 4MKZA 4FOOA 1YOVA 4YAJA 2IEBA 4K28A 1UZMA 3IP1A 3PDJA 4J2OA 2XXJA 4AJOA 1VJTA 4GVXA 1TEHA 2VTEA 4GX5A 4OM8A 3GK3A 3JYLA 3W8DA 1TT7A 4FFMA 5ENVA 3U0BA 3U49A 1A71A 5JW6A 4I8XA 2EEZA 3OQ6A 4YRDA 5ITWA 4ZQEA 1AGNA 2X9NA 3I83A 4J1QA 2P5YA 3DC2A 2EERA 1U3TA 1UUFA 2RHCA 1Y8RB 4NJMA 3ZWYA 3RASA 4I9HA 1YB1A 4NFSA 2J5KA 4LK3A 1ZCJA 3QLJA 1HLPA 4ZQGA 1KYQA 4ZGWA 3PHLA 5T64A 3UW3A 1F8FA 1EK6A 1GV1A 1UAGA 1BXZA 4U7WA 3A9WA 4L8VA 4LRTB 1R6DA 4HADA 1CIVA 1GADO 1FDSA 3OP4A 3VPSA 3PZRA 3JD1A 3KLMX 4DPKA 2AG5A 3PK0A 5B1YA 4KMSA 1QMGA 4G81A 3DZKA 3V2GA 4WE3A 3RU7A 4G2NA 1I2ZA 1RJWA 5L9AA 1U5AA 4LSWA 1BW9A 3E9QA 2YYYA 3BTUA 5G4KA 1ZK4A 1H6BA 2J3HA 5LDGA 3GNSA 4DGSA 2ET6A 4IQGA 5CHEA 2NVWA 1VE9A 4IZHA 3W4JA 3JQ8A 3KYDA 3C7AA 4FW8A 3HB5X 2C07A 3WSWA 3LT4A 3RCBA 4NBTA 1PTJA 5AQ1A 2C7VA 4BMVA 1LDNA 4WEQA 1KC3A 2X86A 2V6FA 4CM5A 4ZA2A 4YJGB 1K6XA 5KKAA 1L7EA 4MVJE 1ZJZA 3AI2A 4IPTA 4B7XA 4RF5A 2AE2A 4LVUA 3LZ6A 4JX8A 1YVEI 3OJOA 3HE3A 4ZN6A 4JLWA 5IN5A 4XX0A 4EW6A 2DM6A 4JXKA 1HYGA 4P22A 2WE8A 3FNGA 3WJ7A 4CUZA 4D3FA 1DB3A 4E5MA 4YJHB 1P1IA 4UEOA 3WTBA 5JFOA 2VQ3A 5HS6A 4OSPA 4BNIA 3GMDA 4XYMA 4Q39A 1R0SA 2BFPA 1UJMA 3NDJA 1WAMA 1VKNA 2C7GA 3CIFA 4J4HA 1FDWA 1CYDA 5DOZA 3WQRA 3JQBA 3Q3CA 4ZRMA 2W98A 4CQMB 4CLDA 1HSOA 2IODA 4UULA 1CERA 3QP9A 4TWRA 2PGJA 1MG0A 4RVGA 5CDSA 1EBFA 4UUPA 3HWRA 1Z74A 2CY0A 2DBVO 5A06A 4DLLA 3DBLA 1UDCA 1QR6A 1I10A 1YB5A 1IUKA 3BMQB 1O8CA 1UH5A 3DBVO 3M2TA 2GDZA 5AXDA 4M86A 3ZWAA 3AOGA 5CDTA 3VPGA 1N8KA 4ID9A 1DIGA 2PTGA 3ZV3A 1T24A 1HZJA 4DBVO 4EGFA 3GZ4A 4O59O 1HYEA 2YDYA 1A4UA 2Q2WA 1OOEA 3ROQA 1J6UA 1GUYA 1W6UA 2P9GA 2AA3A 4CPDA 1C0KA 3VTFA 4D45A 2Q4BA 4WLEA 1LXCA 4RQTA 1Z82A 4BNLA 2D3TA 2RHRA 3IMFA 1G1AA 1LUAA 3ONDA 3WIEA 3EZLA 1XQ1A 3AFMA 2HK7A 4IXTA 2EP7A 1Y8QB 2E49A 3AK4A 3ENKA 1CDOA 2UV8A 1KBZA 4CLRB 3ETDA 5B37A 1U8FO 4EDFA 4I08A 3ZWOA 1MB4A 4YQZA 2AEJA 5ADHA 1KVQA 1F8GA 1AN9A 4RVDA 4BKPA 1N7HA 5T8KC 2RBEA 3RIHA 3GA0A 4XRGA 1P1RA 3JQCA 2W2KA 3I9KA 2GZ1A 4EUEA 1UXGA 4CQLA 2PV7A 2EXXA 4WLUA 1DRUA 1ISJA 4WASA 3G17A 3GGOA 4R1UA 3O26A 5JAMA 2D59A 1ONOA 3JQ6A 1PIWA 4JN6B 4OJNA 1K5HA 3MTJA 3DAPA 5L7TA 1YJQA 4GGPA 4CLOA 2IZZA 1U1IA 1UXKA 1W73A 4NPCA 5CDYA 1FJHA 1I3NA 2IZ1A 3QVWA 4JP3A 3WGIA 2WDZA 5JAQA 3WYEA 1J49A 2DT5A 2YJZA 3IS3A 3GY0A 1LDYA 1PGJA 2E37A 6LDHA 1XIVA 3QJ5A 2HSDA 1LX6A 2Z1NA 1O94A 2EWMA 2ZYAA 3LF1A 4BNMA 1RKXA 1A72A 4A27A 1ZKMA 4HUJA 1ZSNA 1T26A 3N74A 4NR0A 1V9LA 3K31A 4H16A 5EL0A 5U1PA 2IYOA 1A27A 3F3SA 4MOWA 5DCYA 4IJWA 3S2IA 4J9VA 5H83A 1HKUA 1X15A 2W2LA 2WEKA 4I5FA 2AXQA 4R1SA 3VDRA 2IRWA 3ZWMA 4BO2A 4CM8A 4J1NA 3DZJA 1D3AA 1QP8A 2O4CA 3RUEA 3PQEA 4DLBA 4FDAA 2Q1UA 4XYBA 3PWZA 1ZMOA 3HN2A 1I3LA 1LSSA 3E8XA 5JO0A 1TXGA 1B2LA 1JVSA 2O3QA 2BMAA 4IZIA 4NK5A 5JNLA 3ORFA 1JAYA 3WGHA 2VWHA 5CDUA 5DT9A 3RUIA 3JQAA 3PGXA 1UP6A 3DBHA 3KUXA 3T7CA 3H6KA 4XQ9A 1Q7CA 1X7HA 5AXCA 5JBIA 1GZ6A 1P0FA 1B14A 5FI3A 1EBUA 3W6UA 3AU9A 4YEDA 5JY6A 1BXKA 3MOIA 1Q2XA 1RPNA 5CPBA 1EVZA 1HL3A 3V1YA 1X0VA 2CVZA 3QV1A 4Z0PA 5I7FA 2FOIA 1PR3A 3ZWCA 2VYND 3AUUA 3NRCA 1PX0A 3AUSA 4IQ0A 2FR0A 4TKMA 1E7MA 2ZTVA 1Z7BA 5A4DA 1PJ4A 2Q49A 2O23A 4RQUA 4KDEA 3TF5A 3OJFA 4C7JA 1MC4A 2Y68A 4B7CA 1XYGA 3EY4A 4ZICA 4IDGA 5DNAA 4K6FA 1NWCA 4BO6A 5DULA 4JIGA 5ER9A 3L9WA 2D5CA 3GT0A 3SEFA 3I9MA 4Z9XA 3KV3O 3GEGA 2PZKA 1ML3A 2ZQZA 4Z0TA 3KSUA 3D3WA 4R01A 1GCUA 2G0TA 5HS4A 3BTSA 4AJJA 4S3MA 1EQ2A 1ISGA 4RPKA 3LU1A 1H2BA 4BS9A 2HCTA 2BGMA 3HFSA 4FIZA 3UOGA 1PJSA 8ADHA 3DR3A 3GUYA 1WZIA 2FN7A 2WWRA 3DQPA 4ND2A 3Q9NA 4UVGA 4XCVA 4PLHA 4MP3A 2I6TA 1OMOA 3K2EA 4M8SA 2GN6A 4P38A 3DHEA 3MCVA 3UN1A 4RV9A 2C5EA 4ZVVA 4Q3CA 3ZHZA 1JQBA 1TT5A 2X0JA 3FSRA 1E3WB 4RF4A 1CETA 3CTMA 1LQUA 4B8ZA 1A7AA 4KWHA 3ETEA 9LDBA 4YVFA 4G5HA 1S6YA 4NFYA 2QX7A 3D4OA 5B12A 3NJ4A 1LDBA 3OF2A 4LMRA 4PGFA 4BV8A 2F1KA 3AY6A 3GGPA 2ZJ0A 1IPEA 2P9CA 4U0JA 1KETA 1L1FA 1DIAA 3DTTA 4EJ6A 3UHAA 1YH3A 2AE1A 3H9QA 3QVOA 3V5NA 4FB5A 1NWHA 1Z7EA 2GGSA 4GGOA 4N5MA 2B0JA 3E5MA 3OIDA 5T6BA 4OO3A 5A1TA 2BKAA 2DAPA 1DRVA 3H4VA 4NQZA 2X7HA 2IXAA 4GL4A 4A7PA 4IINA 2O3JA 2FP4A 2NADA 2V7PA 5CDGA 1C0LA 2O2SA 3ROKA 1P44A 5L4NA 1A9YA 2GZ2A 4BGIA 3FWNA 1NM5A 4D43A 5ILOA 2HLPA 1HDXA 3MEQA 2X1HA 1MP0A 4M54A 2BFAA 3DZGA 4ZRNA 1IHXA 4QX6A 2HMSA 5IF3A 1CF2O 2W2KB 3AI1A 3I23A 4TRRA 3TQHA 4EBFA 3K96A 3CKYA 1U3VA 2HQ1A 4P8RA 4RPLA 2UVDA 2YQ5A 2O3RA 4XB1A 3T4EA 3RI3A 4YYZA 5JY1A 4IBOA 4KUEA 3FNEA 5GZ6A 3H65A 1CWUA 3BZUA 3GDFA 1ADFA 1WMAA 3WMWA 3UCFA 2G82A 2UDPA 1DEHA 1PJLA 5KJ6A 1QORA 2WM3A 2Y1CA 3FN4A 5BR7A 1XLTA 3MTGA 2R6JA 1B8PA 1CEQA 2QRKA 4XEHA 1ZNQO 4QO7A 3EC7A 3UCXA 1UXIA 5JAIA 4E5KA 2JFHA 1KEVA 3WTCA 1B7GO 3I6QA 3L4BA 1Y8RA 5EERA 3TJRA 3V2HA 3L4SO 3WIDA 3FHLA 4JJFA 1W8DA 1ENPA 4ZQHA 3BTOA 3GHYA 3DMYA 5I8ZA 1HE4A 4YT4A 1MV8A 4PLGA 2Q1WA 1U7HA 2W2LD 4R41A 4E3ZA 1IHYA 4R4JA 5KVVA 1HEUA 3F1LA 4ND5A 4BB6A 4Y98A 3ZV4A 4GMFA 1DFIA 3GPIA 4WOKA 2NU7A 4E12A 2PKQO 2NWQA 3FNFA 1KS9A 4YJDA 5COAA 3QVXA 3PFWO 4KQXA 5F21A 3H7AA 3AUTA 5JMWA 1JWBB 4Q3DA 1QV6A 3AJRA 1XCBA 3ZW9A 4YWJA 3LVFO 4IDEA 1DBVO 5AXAA 3RROA 3JQAD 2FWMX 4L73A 1MGOA 2FZEA 3U62A 1VSUA 4DPMA 3DBHB 1QYWA 4EEZA 1XELA 2PA3A 3HDQA 3I4CA 2ZCUA 1YONA 4MJLA 4ND4A 1P31A 4CJXA 3L9XA 2ZCVA 4YAGA 3OICA 4E32A 1PGPA 2RH4A 5AVOA 3LC1O 3K30A 3ST7A 1FDTA 2LDBA 3MJVA 4YR9A 4ZQBA 5TT0A 1E6EA 3JQFA 3GVIA 1OI7A 4B4UA 2FPGA 3OFSA 1I2CA 4FGSA 1GTMA 1V3TA 1WZEA 4M49A 4BGVA 1B15A 4BO0A 4W6ZA 4HFNA 3WQSB 3U4IA 5JCXA 4XWYA 3OJEA 1SEVA 1LRJA 4MINA 3VOSA 1T4BA 1M2WA 1NPDA 2X0NA 1VKOA 3PIIA 4K9DA 2FSVA 3W8FA 3TRIA 1U5CA 2V6MA 2C5AA 4ALLA 3D3WB 3S8MA 2EJWA 3DMTA 4PLZA 4BO4A 3VPFA 3B20A 3DDNA 1LLDA 1YGYA 3X2FA 2NUAA 2GLXA 4PLCA 2J5RA 4CMGA 3GOHA 2I9PA 1UP4A 1HT0A 4CQMA 1N1EA 2WYVA 1PJ3A 4BNXA 4CV1A 3WWYA 5EIOA 1B8VA 1DSSG 2CMDA 4B79A 4WKGA 5L51A 1ZK1A 2OP1A 4NIMA 3OJ0A 4DMMA 1B3BA 5C5IA 3M1AA 4J0FA 3EYWA 1PZEA 2FPIA 2AQHA 4C4OA 3E6AA 2O48X 3BMQA 3L07A 4XGKA 2O50A 3KYCB 5L45A 4CR8A 1I24A 3OQBA 3LSYA 4XQEA 1LDEA 3SC4A 2P68A 3ABIA 4Z3DA 2WYUA 2ZYGA 5BT9A 4OGWA 5JE8A 2JCVA 2FHSA 1P74A 3VDQA 3F1KA 4LW8A 1PJQA 2AQIA 1YXMA 3PPIA 2B37A 5JDIC 5G0UA 2J3JA 4DIBA 4PIVA 1D1TA 1XU9A 2AG8A 3O8QB 4NBUA 4J3FA 1NYTA 1QXSA 4NU5A 4XJSA 1DAPA 2C82A 3NTRA 4IXWA 3PYLA 4IDFA 4Z9YA 4PG6A 1C1DB 2JL1A 4CLRA 3K2BA 2Q4EA 2VWGA 4FCCA 4GKBA 1H93A 3M2PA 3TFQA 4GWKA 3NTQA 1SZJG 4XRRA 4ND3A 2E4AA 1TB4A 3G3EA 4MP6A 1K0UA 4PLYA 2XPCA 1LI4A 3EMKA 3VHRA 3KEOA 2VYVD 1G6KA 1DRWA 4FGWA 4NK4A 3RUDA 2VOJA 4NJOA 4Q3NA 2PH5A 2YQ4A 2ZATA 2OUIA 2X0RA 5HRUA 4PZDA 4LVCA 3DEYX 3AY3A 4MDHA 1VPDA 2Y0EA 5THQA 3VZPA 3ASVA 3AUAA 5F3RA 1DC5A 5CEFA 2I65A 3RC9A 2PWZA 3D3EA 4EUFA 3RAJA 3TPCA 3VH1A 2QQ5A 1I3KA 4RORA 2WYWA 5KJFA 3ROPA 4A5OA 3S55A 3I6IA 4PLFA 1T1RA 2P4HX 2PD4A 3ZWBA 4BNUA 2XF8A 3B70A 1OBFO 1DOHA 1SPXA 2X23A 2NNLD 1GDHA 2JKVA 3SLGA 3DXFA 4IDCA 2B5WA 3KYBA 3LT0A 1D8AA 4U5QA 4WJZA 1ZK2A 1ZBQA 4J2HA 1K2WA 4I5DA 4D0SA 1U3UA 3JQDA 3QWAA 3C1OA 3ZHXA 1X1TA 3ROMA 1RWBA 3N7UA 1MX3A 1X0XA 2EIHA 2EF1A 1YL6A 3KXDA 1PSDA 3RFTA 4JQCA 3PYMA 4TSKA 5DOVA 5EMHA 3RC1A 5C7IO 4CR6A 1P77A 4AVYA 4LCJA 1XHLA 2Q2VA 4LCEA 4OOEA 3HDYA 4JJIA 1WXDA 3CEAA 4ALNA 5FWNA 2X5KO 4Q3AA 4N5LA 5HA5A 1N5DA 3PWKA 3WS7A 1E77A 3OSUA 3K5PA 4NI5A 4BNVA 5A04A 4JP2A 1T25A 1YL5A 4AICA 2R00C 1I30A 1NAIA 4MIYA 1WDKA 1NTOA 1R0KA 3DOCA 3K6JA 4QSMA 2P2SA 2J3KA 4L4RA 8LDHA 1NVMB 5T67A 3DHNA 3E82A 3PIDA 4IS2A 1EE9A 1GUFA 2Q46A 1XGKA 5G2OA 4B7UA 3NTOA 3NT2A 3FPCA 3DAFA 3AM3A 4QXMA 4IDBA 4E31A 1Y81A 3INTA 2YV2A 3WFJA 5B4UA 5ICSA 4OYRA 3I9JA 3B1JA 3RVDA 4Z6KA 1GQYA 2AW5A 1EVYA 3EDMA 3Q11A 4YCAA 4BNNA 1IZ9A 4IUYA 1V35A 4OKNA 3CINA 3QVTA 3RKUA 3ULKA 3L6EA 1V8BA 4PCVA 2JHFA 3GN1A 1GAEO 1JAXA 3ICPA 2YY7A 2OBYA 3EK2A 1FDUA 4B8WA 3RWBA 5GZ1A 3TZCA 4CL8A 4CQMD 2GASA 1SOWA 4EJMA 3ENNA 2AEFA 1U28A 3EUWA 3PTZA 3BTVA 3C8MA 5TF4A 4D7AA 3L0DA 2JD0A 3JYOA 4ZJUA 1U4OA 2BF7A 2Y1GA 1UZNA 1U3WA 3OBBA 4J90A 1YQDA 2WD8A 1E92A 3ONEA 5DBGA 3FBGA 1E3WA 4FSHA 2A9FA 4GAEA 4Y9DA 5COBA 2VNSA 1E3SA 5KVSA 5KCZA 3KHUA 3I3OA 2CNBA 1YS4A 2I5PO 4J16A 4GLOA 5CFZA 2QRLA 3PP8A 4Y8VA 2B4RO 5EPOA 5A9SB 3DBRB 4R5HA 1WDMA 5U9CA 2VT3A 4CMIB 3ADOA 3CMCO 4AFNA 3DFZA 4AJNA 4J1SA 2B69A 4TVBA 2GERA 1E5LA 1BVRA 3VVBA 2IE0A 2NVUB 4E5PA 5MGBA 3GAZA 1E3JA 2BI7A 1ORRA 1EEHA 5JMPA 1NHWA 2VZ0A 5FI5A 5JYDA 1DLJA 3EVTA 3HNPA 2RAFA 4HWKA 3BHMA 1T2CA 2YZ7A 4GX1A 4XIJA 1GZ3A 1NQAO 2C0CA 3CMMA 3DONA 3JCZA 4YDRA 5TSDA 1NBOA 2Y66A 3HJAA 2Y1OA 4JJGA 3V2UA 1VM6A 3WWZA 5F1PA 3ANMA 4XA8A 3R6DA 4DPLA 4PLPA 2HJSA 4URFA 2R2GA 3Q0EA 3ZV6A 4DBZA 2OMEA 2Y1FA 3G79A 3WDSA 2E48A 1VJ1A 1CRWG 5IJZA 2ZQYA 3DFUA 4R3NA 4W82A 3ZWVA 2PGDA 2ZK7A 3IQDB 4HNGA 1HDRA 1HE5A 4MO2A 4ESOA 2D1YA 3JQ7B 3WXBA 1IB6A 3BHJA 4G65A 4AJ1A 3KTDA 1OAAA 4QUKA 3WICA 3KETA 2E82A 4BQPA 4XYLA 4U6SA 4F45A 3IL2A 5BSFA 4C7KA 3OEYA 1RYEA 2B4TO 3IUPA 3SLKA 1PWZA 5JCJA 3GQVA 4KDFA 3SXPA 4PG8A 1WWKA 4B3HA 2NTJA 1ZIDA 4JBHA 3RKRA 1UXJA 4DA9A 2GD1O 1EDOA 1XSEA 3HZZA 1ARZA 1R0LA 5K6AA 4EEXA 1YBAA 2ZB4A 3GG2A 3JD4A 3HN7A 3FPLA 4UREA 3BAZA 1NFQA 2JCYA 5B4TA 4FPXA 2J6IA 2H6EA 4NH4A 2QYSA 4W9NC 3PHHA 5BNIA 2Q3EA 1V6AA 1A9ZA 4ZQFA 5EINA 2H5LA 3W8EA 4YQYA 5FF9A 3ZU5A 1IYZA 3MJSA 3AM5A 4LMPA 3GRPA 2XXBA 5HWSA 4EUHA 4J7XA 3DAGA 3IDSA 3TOXA 3F5QA 3HG7A 1ZUD1 2Y67A 4IDAA 1ZFNA 1EQUA 4HXYA 4NU6A 2ZB8A 2PH3A 2X5OA 1X1EA 1P33A 1QYDA 1YDWA 1IULA 5JO9A 2DLDA 4UVDA 1NPYA 1DC6A 1XKQA 3GN2A 1HRDA 1YKFA 1JA9A 4BKQA 3MWDB 2QG4A 3KEQA 5A5EA 1LRKA 2EKPA 1LLUA 4J49A 4TMFA 2BFMA 4E5NA 1B16A 3P2YA 1P0CA 4I1IA 3IP3A 1KY4A 5G0SA 2SCUA 4WCFC 3GNQA 1HDYA 2DBRA 2IXBA 2NVBA 1XDWA 5C7OO 3JYNA 5A03A 2WMDA 5C37A 5JLAA 3WGZA 1QYVA 3QRWA 1TI7A 2FMUA 5CG1A 5LCXA 4XR9A 1C1XB 2C20A 2ZKLA 5KVQA 4WCDA 4CM4B 3RBXA 3ZU3A 4RPGA 4MVJH 3H2ZA 3IIEA 4U8GA 3UKOA 2X22A 4HBGA 1E7SA 1JLLA 4CM1A 3D64A 4GWGA 4FFRA 2NACA 1R15A 3PZBA 3ICCA 4BNFA 3OIGA 2TMDA 3I52A 1T1SA 1M75A 2A35A 3ZWPA 1V3VA 4YAIA 4TZKA 4Z9FA 3CUKA 3GVCA 4E6PA 4J0EA 1M67A 3V1UA 2D8AA 4W99A 3JTMA 5ILGA 2Q50A 4D79A 1KVRA 2PK3A 4GSLA 3GF4A 5DP2A 4NHEA 1R4NB 4IIUA 4L76A 1T2FA 3WFIA 4D46A 3GGGA 2NTVA 2X8LA 1B0AA 1I33A 3EHEA 2B5VA 2EJVA 4O6VA 3C24A 4Y6RA 3HQ4O 1W4ZA 1RM3A 4HNHA 4E2WA 1NR7A 1I32A 5MDHA 5F5LA 5IN4A 4BKUA 3OETA 3ITDA 3VZRA 2VUSA 5KKCA 7MDHA 1MC5A 4DQXA 2JCXA 3WJAA 3JQBC 2QZ9A 1VC2A 2CDBA 3OM9A 2VTDA 1O6ZA 4GX2A 5A02A 2CSUA 4FFNA 4F3YA 2EGHA 4GLLA 2PLAA 5F1OA 2E6UX 3KYCA 2I3GA 3NGXA 3ADPA 1A4IA 1TVEA 1P45A 2I76A 4M55A 3PHJA 3EVNA 4N5NA 3QHAA 1BMDA 2OXIA 1HE3A 2FR1A 4RVSA 1LLQA 1JU9A 5IDWA 1PR9A 3PVZA 3BMCA 4TRJA 3O9ZA 1IL0A 4DC1A 2GUGA 2FSSA 4K6CA 4EYEA 3NGLA 3RFXA 1WDLA 1PQWA 1ZEJA 1P3DA 4IM7A 1DJQA 3R3SA 4ZHSA 1V3UA 4LRSB 3WQQA 3ETGA 3JD2A 3GC6A 3WGYA 1NXQA 1M6HA 3O8QA 3VPXA 3H5AA 3LC7O 4LISA 5IZCA 5JYEA 1AXEA 3RC7A 4R68A 1C0IA 2W4QA 2HMTA 5JDCC 1IY8A 1C1DA 1ZK3A 5KTKA 3GAFA 3E9NA 4YA6A 3AOEA 1NQTA 5JDIA 2Y05A 3RUAA 3DL2A 3CZRA 4RGBA 2JFFA 4PVDA 3KZVA 3M1LA 5IDQA 3TSCA 5C7LO 1Y6JA 1E5QA 3MJ4A 5F1KA 4IIVA 3U4CA 2B36A 1GYRA 2YFQA 4ALJA 1XEAA 2VCYA 3FCOA 5TLSA 2I67A 4E4YA 4RDHA 3WGOA 3IKVA 4UVHA 1VL8A 4JBGA 4RCVA 4BNGA 3HSKA 4MVJA 4OL9A 4BNKA 4O63O 2HUNA 4AJLA 2A92A 4LSMA 1YRLA 1O89A 1EFLA 3S2GA 2ZTMA 3AW9A 1DC4A 4ALIA 2O3TA 4WK6A 5L7WA 1NR1A 2HRZA 1I8TA 2WD7B 4GX0A 3HFGA 5C3MA 1MFPA 3FTNA 4CUKA 3F4BA 4JGBA 1P1HA 3NT4A 4CV3A 2HMWA 1H94A 2AQ8A 2DQ4A 3E1KA 4Y67A 4MP8A 5DBFA 4ZD6A 1JVBA 3H5NA 1X7DA 4LGVA 3KLPX 2CZCA 2C54A 4PVCA 5DN9A 3HDHA 2ZYDA 2HO5A 4RF2A 5L3ZA 1CJCA 2PZJA 3UXYA 3WX0A 4BNTA 4F46A 1X14A 3TZ6A 4DLAA 1P1FA 1O9BA 2Q45A 3H9UA 1K89A 4B4VA 1BXGA 1P9LA 3Q2IA 1N92A 1KY5A 2X0IA 1VI2A 3SC6A 3K9QO 1Q0LA 3MJTA 2QIOA 4BL5A 1GCOA 3WB9A 4N18A 3VH3A 1LQTA 3P2OA 4ALMA 1HTBA 2GRAA 1NP3A 1Y9AA 5AYVA 1EUDA 4BO5A 3PLNA 5TC4A 3DZBA 2BGLA 1A5ZA 5L4LA 4WLFA 3NX4A 2JD1A 2O7QA 5TX7A 3HADA 3WGQA 2W90A 1NNUA 4CLXA 2I66A 1LJ8A 3BIOA 4I9UA 5TS3A 4BNZA 1ONNA 4FOSA 2IYPA 1QG6A 3Q9UA 3QWFA 2VHZA 1T2AA 4ALKA 4UVEA 1F06A 4B4WA 3NKLA 3UICA 5K9ZA 3WYCA 4P4LA 2DUUA 2DTEA 2ILTA 1KVTA 2NTNA 2X6TA 3DOJA 2GN9A 2Q2QA 2QRJA 3B1KA 1LDMA 4KP7A 1HE2A 4LN1A 3TOZA 2B83A 3I4FA 1HETA 1UDBA 2D2IA 4MKRA 5TJ9A 4PLTA 4NFHA 4YJFB 2HDHA 1HDCA 2W8ZA 1J5PA 5CEJA 3U09A 5JXWA 2V6GA 3IJRA 2R00A 1JDJA 3P19A 4FQ8A 4N7RA 4TRMA 3RUCA 4D3DA 1BWSA 2X58A 2DFDA 5JSFA 4D3SA 1DHTA 1E7WA 3ZV5A 1VL0A 2DU8A 2YV1A 2WJPA 3RFVA 3ZNNA 4DQUA 2RCYA 3NAQA 5COQA 2BHLA 3MJCA 1PS9A 1GU7A 1PU2A 2EKLA 3KB6A 4DREA 1I0ZA 5THKA 4YPOA 3PGJA 3H2SA 3WBBA 4RLHA 1B26A 1JWAB 2XOXA 3LC2O 4GPD1 1ZZEA 4EITA 1Z6ZA 1SBYA 2VWPA 4IQ8A 4NNJA 4IGEA 1XG5A 2H9IA 3G1TA 3MOGA 4E30A 1VLLA 2G5CA 1BDMA 2OFPA 3G0OA 3V8BA 2OP0A 3ANLA 2DTDA 2YUTA 3ZHYA 1E0DA 4TKLA 3OIFA 4GSKA 4M87A 1EE2A 4OKIA 4R9SA 4WPGA 4XDYA 5EJ2A 4BNWA 4RPJA 5HBRA 5KNLA 3E48A 1OZAA 4DIOA 2GZ3A 3VZQA 4TROA 3VC7A 2VHVA 1ULUA 2TMGA 1YJ8A 2PFGA 4BO8A 4CLEA 5A9SA 3DBRA 4PN3A 1YWGO 3IAHA 2Y1DA 1MA0A 3F9IA 2P9EA 1Q0HA 2FZWA 3BMCB 5H81A 4DQVA 1LSJA 4WUVA 4CMIA 3L6DA 2OO5A 3VZSA 2O3UA 1EFKA 2NVUA 3SBOA 2A4KA 4PZCA 1LNQA 3VKVA 3U9LA 1E7QA 3D7LA 3SJ7A 4QFCA 5U4QA 3JQGB 3LK7A 1AE1A 1BDBA 3QIVA 4J9UE 2Y0DA 1R16A 3GNTA 2POQX 2DFVA 3DO5A 1GYPA 1GEGA 1HZZA 4O5OA 4BB5A 1P1KA 1SO8A 3JQ9C 5A05A 4CMAA 1KERA 1PZGA 3DZIA 3SJUA 3TFOA 1LRLA 1Z45A 2O4UX 4RVHA 4XZ3A 4R1TA 4RO0A 4IDDA 1HLDA 4UUNA 1H6AA 3OMLA 1U2GA 4MIEA 3DTYA 4B3IA 3PFFA 4KZPA 2CUKA 2VHWA 4MIOA 3GVPA 4CMBA 2YHIB 2Z95A 2ZB7A 2GN8A 3QW2A 4FR5A 2HK9A 3UH1A 3WMXA 4CV0A 3A06A 1IE3A 1N7GA 2JJYA 1M66A 2DC1A 3NV9A 3UGKA 3BYZA 1UP7A 2PKQP 4S1VA 5B4VA 2EHDA 3LLVA 1DFHA 1VL6A 4AJKA 3U4DA 1GZ4A 1KEPA 4XGNA 1R4MB 3QSGA 4MVJM 4TVOA 3IC5A 1BRMA 3JQ7A 1SOVA 4XB2A 3O38A 5T8KA 3C1AA 3AY7A 3RQSA 3EGOA 3PHIA 5DCUA 2PD3A 1NFFA 2PY6A 1CQIA 4BVAA 1ADBA 1JKIA 1QKIA 2VRCA 1DJNA 2DVMA 5G0WA 5FFFA 3OJLA 3FWZA 3JYPA 1MXHA 2F00A 3FR7A 3IJPA 3FR8A 3Q6IA 1B8UA 1PJCA 1JTVA 4K1LA 5IG2A 4NZ9A 2DPGA 1Y7TA 1K6IA 3OHSX 3AM4A 3RD5A 1J4AA 3H9GA 4FC6A 4XYGA 5FYDA 1XQ6A 2DPHA 1ZO8A 4WOJA 1B3RA 3RU9A 3L4BC 4CLHA 1BXGB 3NT5A 3TDKA 4WGGA 3TN7A 4W7IA 1EVIA 4TQGA 3K73O 3HHPA 4GI2A 3E5RA 1GUZA 1OC2A 4P4GA 3FD8A 1SC6A 4KWIA 5A3VA 3LLSA 3D5QA 3FNHA 4W9NA 4E5YA 5HM8A 4YRAA 2DKNA 3ZCXA 1DO8A 4QTZA 3H9EO 3PRJA 3CPSA 1PWXA 2VNAA 3CSDA 3UF0A 1JKJA 1GEEA 1PL7A 1PGQA 3PQFA 3GZNB 2XAAA 1PL8A 1F0YA 1LSUA 3D0OA 3ZWNA 1PQPA 1A7KA 5ITVA 2HK8A 3ZNPA 3BMNB 1KEUA 1C1XA 4CM4A 1TLTA 2C59A 3AI3A 4UUMA 4PZEA 1I2BA 5JAZA 1X7GA 1ULSA 3IOYA 3KVOA 4B4OA 2JD2A 4MVJF 1EUCA 5CP8A 5T5QA 1ISMA 4WCFA 1YE3A 3JQFC 3FTPA 2EW2A 2H1SA 1Q7GA 4FC7A 4YT5A 1ZXBA 4BO3A 4J43A 3RBZA 3PLRA 2NU9A 4FN4A 4MVJI 3RC2A 1AHIA 4L4XA 2VYNA 1R4NA 1T4DA 3NYWA 3PJDA 1LC0A 1BTOA 2WTBA 4CV2A 3WNQA 1ISHA 5KIAA 3QWBA 3ZWWA 4CMEC 4L9RA 2HRBA 4A03A 2OORA 2AHRA 1EZ4A 1E3LA 1H2HA 2LDXA 3OH8A 4OXKA 3DMTC 3BA1A 2UAGA 4YTEA 5EQDA 5TRTA 5L4SA 1WMBA 4DUPA 3FRJA 1H5QA 2YW9A 3PHGA 1UDAA 5KJ1A 3ZU4A 4CMJA 4AG3A 5GZ3A 3GFBA 2EW8A 3INRA 2GPTA 4HKTA 2PKRA 3RSHA 2AMFA 1V0JA 4OSOA 1U2DA 3ZNOA 3O03A 1C14A 1MUUA 4OHUA 5T57A 1T2DA 4OIMA 3VH2A 4NBRA 2CDAA 1UXHA 4WNIA 2Y1EA 4EZBA 5BQFA 3S2EA 1N2SA 4I9NA 4WEOA 4BMSA 5I9LA 4CUJA 4PFJA 4M89A 1QYXA 4R16A 5H82A 4II2A 4GBJA 2QYTA 4UAGA 1ZSVA 4DXHA 1NPTO 2HJRA 1UZLA 2BGKA 4IJVA 4RF3A 3WGGA 1YDEA 3GR6A 1E6UA 3C85A 2FPPA 4I5EA 1C3VA 1ZJYA 1DHRA 1ID1A 2Q1SA 2H63A 3WLEA 5EQFA 2AEMA 5AXBA 4OMUA 5GY7A 2OZPA 2UYYA 4ZU3A 2EV9A 1LA2A 3EW7A 4KOAA 4YBZA 1BVUA 1WVGA 3JD3A 2NU8A 4IJUA 5A5FA 1LTHR 2OBNA 4DVJA 2CF5A 4YAEA 2V6BA 2RH8A 1ZXLA 2VWQA 4BNYA 2GCGA 3G1UA 5I9MA 3PI7A 1HXHA 5IDXA 2VUUA 1NAHA 3DZHA 1RM4A 1GD1O 1KVSA 4XYEA 3GLQA 3A4VA 5JPIA 4JK3A 2B4QA 4FJ0A 5A9RA 4NBVA 1N1GA 2A94A 3ZW8A 5I8WA 5JDCA 2AQKA 1WP4A 3ZDFA 5ICMA 2GSDA 4Q9NA 1L7DA 1H0KA 2CVQA 2NLOA 4PG7A 1JW9B 1I36A 1H6CA 3H3JA 5KJCA 1D1SA 3I9NA 4R54A 3GFGA 1PJBA 4KTVE 3GHHA 2C29D 2VUTA 3TNLA 4XQGA 4L75A 1PGNA 3L6OO 1I5RA 3F47A 2WD7A 3BMOB 1OFGA 1NVGA 1ONPA 3KOUA 4QO8A 3PJGA 4UUOA 1ZVMA 1IOLA 2CFCA 4H3VA 3O4RA 4OQZA 5IXYA 1E6WA 4U0KA 4BOYA 5KVCA 4B3JA 1NFRA 4J91A 2VRCD 5I9NA 3BHIA 1H6DA 3OECA 3H9JA 3ZH2A 1QLJA 4CM7A 1E3EA 4XIYA 4EJ0A 3U5TA 1YQGA 4M1QA 1SAYA 2BH9A 3A14A 3WNVA 2VZ9A 3QQPA 4AJPA 4IMPA 3EAGA 4BO9A 2EKQA 3VPHA 1PZHA 1MFZA 1MLDA 4E33A 1W0CA 5TT1A 2Y99A 3GMSA 1JKFA 3NJ8A 1N9GA 4RLSA 4E21A 4J1TA 2FY8A 4HX5A 4RL6A 4RVUA 3AWDA 4DC0A 1YOVB 1DDOA 2NV6A 3UVEA 4YXFA 3D4PA 4H15A 3B1FA 1GL3A 1LC3A 4KQWA 4IGFA 5TGDA 3GVXA 1DIBA 4DYDA 1GR0A 2VHYA 2ZTUA 3RJ5A 4BKRA 1O95A 3AFNA 4QFDA 2NQ8A 3ZGYA 1DAOA 3RBVA 1WLYA 1X13A 4CM9A 1ADCA 1F12A 3PDUA 3OA2A 3KM0A 2VHXA 4RVFA 1GQ2A 4NJMB 5J23A 4D42A 1SMKA 4P4NA 1GV0A 4ND1A 1T2EA 1UR5A 3ON5A 1NQOA 1VSVA 4N54A 1LBEA 2WSBA 5BSEA 2B35A 1G0NA 1D7OA 4WLNA 1FMCA
chains in the Genus database with same CATH superfamily
4HJRA 5EESA 4HAUA 2CDRA 4TTTS 1GNLA 1V1MB 1F14A 4ZEVA 1L2TA 2ZIGA 4WKNA 5IWAB 3IDQA 2R65A 4DV7B 5IH7A 4HLDA 1PEDA 3GD5A 2GCOA 1DQRA 3SEZA 2I8AA 1ODTC 1YF3A 1R8JA 3OP1A 1ZEMA 2UUOA 3U13A 4EAQA 3BXPA 3EIUA 1L5VA 3NALA 4X61A 1CJBA 3D2CA 3LKDA 3L7DA 5G4KB 1BX1A 2ZRFA 1IMJA 5EJIA 4DE5A 3EXIA 2HMVA 2WB2A 2VPQA 2ZJAA 2XA9A 1VE3A 2XZTA 4JWTA 2GEUA 1J25A 1QX4A 2C98A 2PH1A 3KQTA 5J2UF 4EI2A 4J4BA 1WX1A 2JAHA 5AJTA 4DLKA 2QN3A 2F55A 1TO1E 3HXTA 3C7CB 3ID6C 2EF0A 4RIFA 2HMUA 2UVPA 5L3SB 4JWKA 1HDGO 4BU0A 2AMYA 3NBXX 1ISSA 2WSMA 4WLOA 4PN7A 3R9XA 3JWPA 1SB8A 2LIPA 3E03A 3NRBA 1GQQA 3GEDA 3ZQUA 1LEHA 2QM8A 4A23A 5C1DA 3FCUB 3QUQA 4G0QA 2QVZX 3LP8A 1U8YA 3R6GA 3GFQA 3QVVA 3ZZNA 5LMZA 1RD4A 1WSBA 3NQ41 2VZ8A 1Y1KE 3LO8A 1QTIA 3LWBA 3LZDA 1JFRA 5IP5A 2Z9CA 4G24A 1QTRA 1QANA 2PR2A 1VXOA 2EZ4A 3S5JA 4YT8A 1N6HA 1BSVA 1SU6A 2G77B 3B6ZA 3F6RA 1TKBA 1P4HA 2N75A 3AJAA 1U28C 3FLAA 4XJTA 4YJ2A 2CSXA 3AVVA 4KQIA 2EG5A 1TJNA 2J5QA 4P7BA 3PJEA 3QHQA 3K5IA 3BG5A 4X66B 1SM4A 3LA8A 2UZ4A 4KQHA 2FDRA 3E8SA 4PTYA 4F4UA 5FADA 3EX7C 5KAPA 2F1IA 5IDVA 2JFGA 1VLHA 3KRTA 4CIVA 2D2EA 1KC1A 3C3BA 2R6ZA 3KPYA 4BQNA 5HZMA 1EXVA 2XI4A 2IZ0A 4B34A 4C4PA 3OZBA 5C34B 2ZSAA 3DULA 3DVRX 1KJ9A 4XR4A 3WSTA 5AWFC 3JQGA 2V7VA 5HBGA 3BRQA 4II3A 3TCNA 3FMOB 5BWMA 5I8PA 1FIUA 2FK8A 4QBTA 4A0SA 2I0FA 5CLHA 1DKUA 5E6SB 3CH6A 4INAA 4KSYA 3JSAA 3BWCA 4MUXA 4NY1A 5HRCA 5GVSA 1JHMA 4P31A 2HXGA 4QOIA 2GNAA 1KORA 5HOQA 1PGOA 3ZXYA 3DLHA 1AQNA 1U7ZA 3AETB 5T57A 3C5EA 4B48A 3IKTA 1P0PA 1QSGA 2P8JA 2WTMA 4CDGA 1OH6A 3HJNA 5EHIA 3U3DA 2A33A 5LP1A 2YHIA 3PD0A 3BH7A 3HCEA 4FE4A 1KI4A 4L50A 4O5AA 1ZOPA 1QWSA 3KSZO 5J63A 3VR5H 3WNBA 2WVJA 4KO1S 2D0IA 1D09A 3H4IA 2FRDA 4KVAA 1V39A 1RPTA 2G76A 2NQTA 3DOUA 4ZAFA 2F43B 5J40A 4U2BA 2OLJA 4NG5A 5J47A 2J8ZA 1V1RA 2D00A 4BUCA 1R4MA 1MTZA 5C4MA 2CHEA 1A9RA 1V7QA 3EZFA 4URHA 3VKFA 1NHGA 4B09A 1W29A 2JAPA 3O1IC 3SF8B 3QPUA 3UANA 5A2GA 5HX7A 2ECQA 5ITZA 3FUTA 1UC4B 4KTTE 4XLLA 5BQOA 4BGUA 4EUSA 1J0XO 1E18A 1CT9A 4Y6PA 5D87A 4N9WA 5LD2C 4L4SA 5CG2A 4XVUA 3TR5A 3E3NA 3HL4A 4Y2VA 2PDAA 3H3FA 4HLCA 3IV7A 4UVIA 4F9TA 3QLTA 4ZHQF 2O0KA 3IHTA 4KUGA 4NZOA 3W6ZA 2F1OA 1N32B 2PJZA 1KSHA 2HKIA 2P2ZA 4I4TF 1JHUA 1JV2B 2O2XA 3N7AA 3TW0A 2PX3A 1DE0A 2VYVA 1JDZA 2JFWA 3DHYA 3FYTA 4P83A 4GVLA 3ZDZB 2Z6VA 3F46A 1TVKB 4PGAA 3P0EA 3MZ0A 3C0KA 5FBKA 2REXB 5AJXA 4CQLB 3EGIA 3TRDA 4BVFA 5EIAA 2ODBA 4ROSA 3DB2A 2HQBA 2NM0A 5HTKA 2BJVA 4OBEA 3ZXXA 5AVZA 1G55A 2BL4A 1AN0A 4JOCA 4BDTA 2BHSA 3IT3A 4M83A 4UKDA 2OHGA 3FWYA 2XY4A 2HK6A 2PQ2A 2AKYA 3OA0A 4LYJA 4A8JA 3D0KA 4DDUA 2G1UA 5JNVA 3F5FA 5EE3A 5L95A 4DYVA 3FZNA 4DWVA 4I55F 1N9GB 4IY1A 1GKIA 2CFTA 3LYHA 4BAZA 2VXYA 2IH2A 1PL6A 3KJHA 4O4IF 1IHUA 5K0LA 3WLSA 4L28A 1T1GA 1FYDA 1GY8A 2H3HA 5BSHA 2A30A 1JB1A 1FK8A 1CIPA 1RM0A 2V65A 3CR8A 4PY2A 4M8KA 5BSRA 5FV7A 5KPDA 4HBZA 2ZI7A 3MBIA 3OI7A 4DHWA 1HFKA 2B8JA 1NT4A 1I01A 1SKUA 2WF6A 1O08A 4RIIA 3ND5A 2J3IA 4DIUA 1M6YA 2QT0A 4RIEA 5J5CA 3UUFA 4O4LA 4DTIA 4CM9D 1YCDA 5FEUA 1QZXA 3DE6X 1QQAA 2RAPA 4A2PA 2EBUA 3CPJB 3ZGOA 1NNEA 1FYVA 2C5FA 2PHZA 2WVHA 3NGMA 2GARA 4JH0A 1BQ3A 1Q83A 4AKEA 1U0LA 4RW0A 1RLUA 2HNAA 2BONA 5DX8A 3IQWA 3CRVA 2RG7A 3TPZA 2FX3A 4R3WA 1VECA 4WN9A 4LF7B 1ZUNB 1G42A 1XZJA 2C7OA 2J9FB 4PYIA 2HPVA 5LQKA 2FSHA 1DAGA 5C46F 5BNTA 5EQJB 3LI2A 2DP4E 3IKLA 2ZRPA 3OTGA 4GBGA 4HGPA 4QARA 1IZ7A 3CVXA 4AL4A 1TFUA 4AY6A 4XX1A 4MGIR 2W7TA 4BZZA 2HR1A 2DTXA 3A4LA 3IQHX 5MN4A 2DKOA 1T9KA 2YS7A 1KFJB 3KTAA 3L5OA 4XH9B 3VR5A 3MRVA 4PPNA 3WC4A 2CC2A 3EMVA 2PT7A 2QAJA 2D2FA 4W5NA 2BISA 1JA0A 2H48A 1Y5MA 3LT2A 4P3XA 5HJ2A 3FVVA 1FUEA 2QPLA 5JD6A 4UMDA 1R5JA 3DV0A 3FB4A 1PFQA 2Y2UA 4QYIB 4I5GA 1QYCA 2B9VA 4FD3A 4YJGA 2J0QA 4UHHA 1FSZA 1Z28A 1UPCA 1E7YA 1NLUA 2J5XA 3ESBA 3D8RA 2CXOA 2GFQA 4F2PA 1EDZA 2IY9A 3R3HA 4UMVA 2EQBA 4B83A 2XCSB 1XTJA 4AKTA 3U5ZB 3D6UA 1ODFA 1H5UA 5LA6F 3AYZB 3CXRA 3NP7A 1CR4A 3JD0A 3F3YA 1XA0A 3FLBA 4ZEWA 3VAYA 3IAEA 3T3IA 1VCOA 1XVAA 2IQ5A 1OXTA 4LHXA 5HQ3A 5IZ4A 5JZVA 3NIGB 5DCLA 3OJCA 3K70D 4AZ0A 4OP3A 3DBOB 1ESNA 2NNWB 5DMXA 1Q0QA 2BLLA 1JMVA 2VHJA 3AEUA 3FFAA 3WLQA 2ZB3A 4KR0A 3G5TA 3PGKA 4JBYA 3USCS 1Z5PA 4KLAA 4TMVA 3A1NA 2R8RA 5JI2E 1OPXA 4K9MA 1L7NA 4K9KA 2WJAA 1YFKA 4H1WA 5TE9A 1P73A 3V4VB 3K1AA 1T91A 4FYKA 1UPTA 2V74B 2EATA 4X84A 1NNSA 3KQOA 4LUCA 2VRBA 5ER6A 1YQEA 1Z6QA 1SOUA 3CE6A 4EDHA 4L16A 1D4OA 2HYIC 1U1DA 4CXMA 3UFBA 1YUNA 3ODPA 5DCWA 5GMOA 2Q3JA 4G1FA 3N6RA 1GCGA 3DTVD 5GM1A 2GZRA 3WQRA 3EXG2 3OY7A 1ZGBA 1CJSA 1EM8B 3TSZA 2YRWA 3FETA 1AG9A 1AMUA 1HEIA 1M76A 3TK1A 4FHFA 3TL3A 2DHEA 1HGXA 3INYA 4CF5A 1BO6A 4Y1EA 4DJAA 4OH1A 5K8CA 3E9MA 1DFGA 2BMVA 3QFCA 5ALSA 1HQCA 4Q3EA 1PJ2A 1W35A 2JFYA 3WAJA 2GHIA 2YMQA 4GR5A 5IZCC 1VHQA 1MAVA 1RPAA 1XO1A 3NCHA 1C41A 3VVCA 4IFTA 2VYQA 2FWAA 4YB8A 4DR7B 2G5PA 3OLXA 4E94A 1X19A 2SNIE 3A28A 3VUFA 3KKMA 3BGOS 3LG2A 3S2FA 3KDAA 4MQUA 3EWIA 3C3XA 4HY3A 1RM5A 4GPEA 4MXDA 1ZD3A 4WN3A 5DF1A 4B2IA 3MIZA 4CMHA 2Q2OA 4QSHA 3DO6A 1R2QA 1KQGA 3RLIA 1KDVA 4MMXB 2QMHA 3UCEA 4AKIA 4E46A 4BQFA 3J80A 4RZIA 4GQAA 3CSSA 4BFCA 3P45A 3GPDG 5DXAA 4YCCA 2N0SA 2VTKA 3LA6A 3PNBA 4HH0A 2ORED 3WIVA 2X2EA 1ZSYA 3CZMA 1V1RB 3CUUA 3WG9A 1J0EA 1M5TA 1SY7A 4MVJD 2JIZD 3QPBA 3FF4A 4B6JA 4DMUB 1T4CB 5IXSA 1QB7A 2YJTD 4LV5B 3URKA 1SVSA 1WEKA 1OLSB 5LDHA 3L4EA 1SKYE 3PQ4A 1ZC4A 1SK8A 1KNXA 4FZ5A 4JBIA 5FPQA 3U4HA 1CZHA 3E9ZA 3AQ4A 2WNHA 1OD6A 2J4FA 1NBMA 2JIMA 5NLLA 2IUSA 3N0RA 1QHFA 1QH8A 1RMQA 3IUSA 5TJHA 2CV1A 2DKFA 3R1IA 4ILKA 4Z4IA 3PYXA 2PZLA 1BXRA 3GRCA 3L0YA 4TZ6A 2VPWA 2EHJA 1EK2A 2W4IA 5CPFA 3UJAA 3CVUA 2O8DA 2DH5A 3KAPA 2O3SA 4I14A 4E33A 1JZTA 3IE0A 4JJAA 3AGPA 3QTBA 5FTNA 4EG7A 4PCUA 3X1YA 1E3IA 1XU7A 1EK5A 1Z0UA 2H4YA 3GP3A 3FCXA 3NYRA 4M1ZA 5IULC 3RTDA 1RQPA 2D4AA 2CBXA 4MQBA 2L19A 3PXXA 1N7IA 2XBMA 3NXSA 4W1RA 2XNDD 3AKZA 3D1VA 1KK1A 3TDMA 2OGWA 3R5TA 2P5UA 2VH5R 4L8WB 4TMKA 1E1LA 4QBFA 3VKUA 4QDKA 5LP6F 4KODA 1VKJA 4YJFA 1JZQA 1QHSA 4ZV9A 1ONSA 2PIDA 4FMCB 4AJOA 1R6AA 1VJTA 2YFYA 3GB9A 1XKXA 3GUUA 1NURA 3EZ2A 4ZMRA 5LIPA 2KLBA 2OILA 3BVPA 3FXAA 2JLCA 1TT7A 5AJYA 2IIVA 3V3TA 1A71A 3KJEA 3OC0A 3PCTA 3HU3A 3WHLA 1AO0A 2CNWA 1GN8A 4BFSA 1ULZA 2WJVA 3ZGLA 2X4DA 3O31A 5I9IA 1W4CA 1AGNA 1M7GA 4DV0B 1NXXA 4LRYA 1KP2A 3UIEA 4Q1CA 2PLRA 3KHSA 4EGQA 1ZNWA 2J5KA 1ZCJA 3QKSA 4B3BA 3ZZ0A 5ALPA 4Q7EA 3QBTA 1MU0A 3LWZA 2X13A 4LYHA 2ZYHA 4R2MA 3A6HA 5EJ5A 1BXZA 3DH0A 3KOOA 4YHBA 3TNFA 1CD5A 4LRTB 2QVYX 2YWXA 4HADA 2RGEA 1V4NA 2VHEA 5FFNA 1SVMA 1WBJB 5FIUA 2VQFB 4PSVA 1MB3A 2H8KA 4ZJZA 2WTUA 4LJ5A 3PZRA 4WN9B 3KLMX 3JRNA 4ZYXA 3PK0A 1YS9A 1KU6A 2I34A 3A4MA 3GPCA 4OGKA 1ETUA 1K4YA 2C4VA 2E18A 1M54A 3DZKA 3JZIA 4G2NA 2XLBA 3KR2A 4G81A 4XB6B 3I6YA 1I94B 1I2ZA 1Y3HA 2DPLA 4LSWA 1BW9A 3E9QA 1Z0SA 4KN5A 1ZK4A 1H6BA 1LPBB 3PCRB 5JR3A 3V48A 2X5NA 5IC4A 2WPDA 1A77A 3VJLA 3KD2A 1RJ9A 4BHTA 3KTAB 1OHHD 1SVWA 1FU8A 3K0FA 4IHQA 5CHEA 1DKOA 5ALIA 5BYJA 1VE9A 3MHPA 4X64B 2VJMB 5GADl 5KWIA 4MRMA 3U7FB 3PX2A 3S5UA 1O6GA 3HB5X 1W9HA 1PW5A 4C0XA 1QOQB 1WOMA 1XZKA 3HYSA 3FPKA 4BMVA 1R74A 3CS3A 5JD3A 3QKTA 2KBFA 4YJGB 1JWLA 3FGOA 2QRHA 1XVUA 2UYOA 2UZIR 1TA0A 2PX0A 4B7XA 1LX7A 4RF5A 1GCAA 4FR2A 2FPGB 2R6DA 4KG7A 5KSZA 4ARIA 2AN9A 1M2JA 3UATA 4EMBA 3ILYA 4P2GA 3HE3A 5SY9A 2C5HA 4JLWA 5IN5A 1WULS 3PDWA 4B45A 4EW6A 3SJAA 1FS5A 1TUEA 4ZYTA 1L5MA 1LD3A 4KQJA 5HQ3B 4G41A 5B58C 1IEXA 4W8GA 4E5MA 1JIVA 3KOWA 4R31A 1W4RA 3IBTA 4Q1FA 1DU4A 3O2QB 3K0CC 3BXGA 2OT3B 1SVNA 1EX6A 4OSPA 3TBFA 1HLFA 2Q3DA 1O96A 1NY6A 1R0SA 1KH2A 2PZEA 3ZXIA 4N65A 1P75A 3BB4A 5M34A 2FMXA 1G8KA 2C7GA 1OFHA 3CIFA 1FDWA 4NC9A 5DOZA 1OR8A 3JQBA 2NUAB 5AUNB 5HIJA 2HB6A 2AN3A 4B7ZA 5TQ2A 3EEBA 4CLDA 4K0KB 4NESA 1G16A 4YRNA 4JYCA 2PGJA 1C81A 1ZNZA 1U0RA 4YECA 1PBTA 3AR9A 4UUPA 3WKAA 4BX8A 4GRDA 2OXEA 2WAOA 2QTCA 3AVQA 3WHIA 1CY6A 1H2XA 4DLLA 5A06A 4V0OA 2OO5C 1JALA 1N6KA 1N0VC 1QIHA 1XZEA 1Z0FA 3GGSA 3K9CA 2CVFA 2G5GX 4MZXA 1YR3A 4PBTA 1QTQA 5ALZA 1FTSA 1UH5A 3DBVO 3M2TA 4GW3A 3ZDDA 4QWWA 3FJYA 4HJXA 4MQLA 2XT0A 1DIGA 3VV3A 4C6TA 3Q15C 4C3ZA 1I4TD 5ENZA 4EGFA 2FSIA 3E3MA 4IFEA 1FFDA 4O59O 2VJAA 4B85A 5JNRA 2YDYA 1A4UA 3BGWA 1WXQA 1GUYA 1W6UA 1BWRA 2AEEA 5JSKA 4JI5B 2ODTX 3D0QA 4CPDA 3VTFA 5JMOA 2Q4BA 2BI4A 1W34A 2OCKA 2OG2A 3IOEA 3PC6A 4MA0A 4OQ4A 1TMKA 3HY4A 3U0VA 4KE9A 4LXTA 3K4QA 3MERA 1YR8A 2R68A 3U7QA 3TRFA 3KVNA 1QIGA 3QFRA 2QUZA 2GNPA 1UQRA 3GJSA 2D3TA 2EGUA 2RHRA 3KOXA 2OHHA 4NU8X 4ZVMA 4LTMA 3WIEA 3L79A 3EZLA 4AUKA 3FBWA 1YK1A 1BVHA 1X8XA 2EP7A 4ND7A 1EWKA 1CHDA 4KLNA 1B42A 3I5XA 3PDHA 1QLWA 2BOVA 4L07A 2PUWA 1TQHA 1U8FO 1ZLYA 3N2KB 4EDFA 3V8EA 4MHTA 3TCXB 1KEZA 1VB3A 3HSYA 3H17A 3KOYA 3VPCA 4ANFA 3ZWOA 1E2KA 1MRZA 4J0GA 1INLA 3A6JA 2BJWA 2BZGA 2VPYA 4KQCA 3N07A 2QP3A 1H1DA 3I1YA 4RHTA 1P1RA 4CFZA 2EFYA 2Q5FA 3I9KA 2O8DB 5HEKA 1GG8A 3PA6A 1NNLA 1C7FA 1GPYA 1TYEB 3VU9A 1DDGA 4PZ9A 3MSXA 4LOJA 2D59A 3L93A 1ONOA 5JXGA 2AC4A 2VP0A 3KZKA 4UCQA 3RK0A 1PAUA 2P7IA 1BN7A 1CFZA 2IY8A 2BEWB 5CK4A 1U1IA 1CUBA 1W73A 3PNLA 5E8RA 2QW1A 2ZBVA 3B8HA 4PQEA 1PI3A 1DCKA 5FOSA 5HF6A 2LUOA 1OXKB 3RODA 3DVLA 3WGIA 1HA3A 2ZUBA 2H57A 4JEMA 4OGFA 1IOVA 2VRNA 2G1PA 3GY0A 1LDYA 4FDUA 5BNZA 2E37A 4GICA 3HB9A 4LAFA 4LRXA 4OQDA 5A2QA 3PNQA 2QUKA 2A9JA 4IIXA 2ZRMA 1X6VA 1EK1A 1ZOIA 2HT6A 2WM8A 1FVOA 1A72A 2PU7A 3A1WA 3EF3A 3HCRA 1ZKMA 1JDUA 2YIDA 1ZSNA 1SCIA 3IXLA 4HUJA 4NBLA 5E7IA 2QU8A 4DLTA 5C81A 5K0GA 3ZDCA 3IUNA 2IYOA 4YI5A 1GZ7A 3RSLA 2C9DA 4MOWA 2QJTA 3BD7A 1T5IA 1HKUA 4BO2A 4JYZA 3ZWMA 4I5FA 2PEZA 2YZGA 2GB4A 2PS0A 4ATNA 4Z7OB 4GS5A 2HTFA 3E05A 2WC1A 4GDMA 4ARCA 1Z8FA 1ZQ1A 5DGTA 3QKSB 2FFBA 5ARDA 4CYMA 4HDNB 4RE6A 4PR3A 1F4VA 4NTZA 3HN2A 1ZBDA 1LSSA 1I1OA 1V5GA 4TQUS 5JO0A 1KAGA 1LZKA 2BMAA 2P9QA 4IZIA 4OQMA 3KLNA 5FBZA 5JNLA 2Q07A 4ZT3A 3QY0A 4ECAA 5IVPA 2RHMA 3ISTA 4YQEA 4ZV4A 2Y2VA 3N3AC 5I6DA 3PGXA 4BAGA 3DBHA 1A8UA 4AYWA 3ZI4A 2DCUA 3BF8A 1YIOA 3PFNA 4YUZA 2PUHA 3H6KA 1E6KA 3OE4A 3OFVA 4OUKX 4YRMA 1Q7CA 1DCFA 3I2KA 1GZ6A 4PS1A 4WXYB 4DANA 2QTNA 2IZ7A 4N7MA 4BMDA 5FI3A 1EBUA 1GWNA 2VAVA 1II9A 5JY6A 2OV1A 3MOIA 2H9AA 1Q2XA 4IRMA 4RMHA 2PWBA 5K3EA 4N3BA 3ROTA 3UB2A 3V1YA 3Q72A 4FMBB 5JYBA 1FNNA 1UOEA 3ND9A 4R83A 3FOFC 5DTIA 2FOIA 1SXGA 4B6OA 1YDFA 2RGUA 3AUUA 3SHWA 4AECA 3DE0X 4I46A 1Z5NA 2H0RA 2ZTVA 3NH6A 1CRLA 4TKMA 4XIFA 1LWNA 4V1CA 2Q49A 1NX9A 5ALOA 1SQ0A 4RQUA 3EDQA 3E0XA 4KDEA 3TF5A 3OJFA 3F73A 5FD8A 1MC4A 2Y68A 3H6HA 3MAAC 4B7CA 2TYSB 3HBMA 3PSAA 3ENWA 1R5BA 1SXJD 5FBLB 4HH3C 4FNGA 1MQAA 2C3UA 4NBKA 5DULA 1TAQA 3SS8A 2HLHA 1JJAA 1AVTA 2ZSHA 3GT0A 3N05A 3KV3O 4ENRA 3RNOA 2WJ3A 5EE0A 4U02A 3WLRA 4ECEA 3OTIA 3OM8A 3NBYC 4R01A 3B3QA 2P0AA 4IH4A 4V03A 5DHFA 1T5HX 2XUGA 3CKKA 1LVHA 1SJ9A 3UMGA 1V1JA 1EFCA 3SHQA 4EVRA 4RPKA 2AFHE 3LU1A 4LA4A 1H2BA 1O96B 1OXSC 3O2JA 4L95C 3DJFA 3NVKI 3FRIA 3HFSA 4AX8A 4JLMA 3AEZA 1ZCZA 1POWA 1LPAB 1QAQA 3N8IA 2K87A 5ECYA 8ADHA 2PXAA 4B76A 2VKQA 1FP2A 1TU0A 2C9YA 3L8ZA 4GOLD 4HMQA 5GAJA 4BCDA 2K7FA 2GCPA 2OFXA 3SC2B 4AO6A 1OMOA 3K2EA 4M8SA 4JJZA 2GN6A 4OLFA 1A98A 2F48A 3DHEA 3MCVA 3UN1A 5JTUA 2QNBA 4NCHA 2H7XA 4DWJA 1H4TA 4OL0A 3A1CA 3BWMA 4RSGA 4HS9A 5LWQA 3HLTA 2ZT5A 2C83A 1KJZA 2RGRA 1CETA 4LNUA 1W8IA 3D3JA 2Q9UA 4KWHA 2CUTA 2WAYA 1KI8A 1ULBA 3E70C 1FTGA 1S6YA 1CZRA 1FW8A 3MXOA 4MUAA 5FJJA 1ZN8A 3AESB 1SBHA 1Q7RA 2IT1A 3B5IA 3D4OA 2XT6A 3NJ4A 3MMXA 1Q20A 3HEMA 1NE7A 3OF2A 4LMRA 4WFIA 3ED5A 3TPFA 4HNUA 2VO1A 2F1KA 1OU0A 1TGYA 1Z56C 1U9IC 4MVCA 3AUYA 3CPEA 1UM8A 1STOA 4AB1A 3DTTA 4AIRA 1XZQA 2JCGA 2IXEA 4PO8A 3N3BC 1TRKA 2FP3A 3TIXB 4BBJA 2E5LB 2RGXA 4F6RB 1V6CA 1KMHB 1YH3A 2DWUA 3IVRA 3OWOA 4I7EA 4F96A 1M7BA 2AE1A 1XTVA 1Y63A 2BGIA 3FOBA 3QU7A 4G4SP 4GOMD 2HJGA 4ARZA 2H4FA 4FB5A 3V5NA 2GZAA 2MDTA 5SY4A 2ADOA 1RBYA 3KFLA 2B0JA 3VM6A 2H2FA 3GBVA 3OIDA 5T6BA 1QGUA 3QBDA 1U3FA 3COPA 3U44B 1DRVA 3ZUGA 1QAMA 3M4NA 4MW5A 3LBFA 2IXAA 1YR6A 3QYAA 4A7PA 3DQQA 3ZDYB 4P0QB 1RRGA 2O3JA 2YINC 2FP4A 2NADA 2PLFA 4I2NA 5JARA 3RADC 3UAYA 3MMPA 3BUSA 5JJLA 2Y4OA 1UBUS 4XVRA 2O2SA 2CXSA 3ENZA 1NSFA 1P44A 5EY5B 3AB8A 3NBKA 2QNRA 3B7WA 3KALA 4HNAA 4DB2A 1FRQA 3U60B 3QLUA 5A4MS 4U4AA 1M1XB 1RWWA 4UM5A 4GOOD 3TAUA 4D43A 1JSLA 4EW3A 2DFNA 4CN8A 4XWTA 2X1HA 2XA1A 1MP0A 1PFGA 1Y37A 3PTLA 4REMA 1OYVA 4DNXA 2O7VA 3SD7A 4ZRNA 5INTA 1Q7TA 3R6TA 3LKVA 3K9BA 3Q6NA 1OBCA 1UIRA 5CUQA 4RABA 1UF9A 4TRRA 5AW8A 3L1JA 3A04A 1HT2E 4V24A 3K96A 3M5DA 4FBMA 1GTRA 2Q6VA 5EA2A 1CNEA 1H4SA 1G66A 4YYZA 5JY1A 2BFEA 1I80A 3RI3A 1OJLA 5ECDA 4FLFA 5EIHA 3NLLA 2ZANA 3HHEA 3H65A 4JSYA 5GZ6A 1WMAA 1QC5A 1WMSA 2QRVA 2C8JA 2W6NA 4KPFC 3WMWA 1LV7A 3FYDA 3IUYA 4KWEA 4RUKA 5EP4A 2WF5A 5KJ6A 1PJLA 2Y1CA 4UD6A 3IP9A 1LWOA 5JAPA 5BR7A 1RWXA 3L40A 5JJCA 2RHDA 3HCCA 4F2WA 1U2ZA 2NX2A 1L4LA 2WINI 1KKUA 1P9NA 2KJQA 4J1TC 3VC3A 4C76A 2V4MA 4PC2A 3R3WA 4XUDA 2IEZA 13PKA 1D03A 3EC7A 3L8FA 4J0KA 4IG4A 4TXLA 5JAIA 1JFSA 5AW5A 1KEVA 1O95D 3L7IA 4AO7A 1TYAE 3COVA 3I6QA 4IQFA 4W6QA 3L4BA 4Y0AA 1OBHA 4KDRA 3FHLA 4TUYF 1ENPA 1YI0A 4RHFA 4YCDA 5I8ZA 3SEAA 1YU6A 1I3OA 2CK3A 3MINA 1CUEA 3QEKA 5DM2A 5JCOC 4M0LA 2CLKB 5L8VA 2XNSA 4QFBA 1IJKA 1CZUA 2VUHB 1HEUA 1R00A 3AJ8A 4FN5A 4NV1A 3WL4A 4BB6A 1B6TA 3D3KA 1TLFA 2VDUE 1VLVA 3ZV4A 2CNDA 4GMFA 3RF6A 2NMVA 1EJ2A 4RCZA 2NU7A 4B3MB 2HUPA 1MBZA 2NWQA 3FNFA 2GM9A 2DZDA 2IF0A 4DLSA 1L7OA 2AZXA 3AYXB 2XB9A 1P2TA 3H7AA 3O92A 2YJ5A 3AUTA 4NDZA 2IV2X 1JWBB 2OVBA 3AT1A 3KSBC 3ZW9A 3RRMA 1PYGA 3VJMA 4IDEA 3RB8A 4W9RA 2P2YA 3UXMA 1ACLA 3U3RA 5AI8A 4QTUB 3T3MB 3DBHB 3E9EA 1MAHA 4X1YB 4K86A 3ADDA 3OWXA 2PA3A 3AKDA 3HDQA 3I4CA 4L5IA 5B7PA 1CQZA 1L5YA 4ESVA 5TEWA 1ZVJA 5CHYA 2TRSB 4AKGA 1KMQA 1VP3A 4DR5B 1M2EA 2J87A 5JD4A 2SCUB 3TOVA 3SC2A 4OXQA 3L6UA 1FDTA 1CZNA 3KXPA 5TT0A 4NENB 1OF1A 1CEYA 2IH5A 1CVRA 1RRPA 3JQFA 5D1NA 3GVIA 4LDAA 3WLJA 1OI7A 4BVBA 1C8LA 1Z6PA 5B7QA 1I2CA 1BFKA 1BFDA 2FPLA 2RK3A 4V1CB 4M49A 4JMLA 2W0MA 1BA2A 5BWNA 4W6ZA 4FILA 4HFNA 2LPMA 1MC8A 5LXTF 5BMVF 2VC2B 2YRFA 1V43A 2J3QA 2FMFA 4MV5A 1LRJA 4OMFG 3SICE 4JVMA 1T4BA 3KC2A 4M8LA 3IUMA 1CSEE 5CB6A 4DLPA 1VKOA 1RC1A 1T8PA 5EWMA 3M4YA 2CMHA 3TRIA 2V6MA 1E9AA 2EJWA 4ZTUB 5B53A 3DDNA 1FP1D 1LLDA 2QN6A 4X3PA 5FTWA 3EZ9A 4GOKA 1XZAA 1MOQA 1MAWA 4HH1A 4UUBA 2I9PA 2PR7A 3VOAA 2Z5FA 3L7CA 3F6EX 4RU1A 2WYVA 5DK4A 1V5FA 1B8VA 3IMKA 3EQ6A 3CF4A 4R2KA 3D7MA 5JADA 1EK0A 4KI7A 2ZRGA 4PYOA 3MD0A 3DA8A 5A4AA 1QK4A 5EPEA 3K70B 3BH0A 1GR1A 3CF0A 3H2BA 4LK2A 3DYIA 4MPRA 1B3BA 3SM3A 5C5IA 1U2RA 3IODA 3UMJA 3WWOA 3KKOA 1O87A 2YBEA 1PZEA 4B3TB 1PDVA 2XVXA 3UMVA 1WPXA 2QZ4A 3DD1A 3IAS1 3FA2A 4FGUA 4H3HB 5LU9A 3DL7A 1Y98A 2YCLA 2F4VB 3BMQA 4XGKA 2GK6A 3KB2A 4CEJA 3N2NA 1FJGB 4CR8A 3OQBA 3LSYA 1ZM7A 3SC4A 2G6TA 4BFVA 4QPDA 4LNUB 1E0AA 1DL5A 2G0AA 5IKMA 1L5WA 2YN0A 2JG3A 5BT9A 4OGWA 5JE8A 2XCTB 3PGMA 4RHEA 3W6OA 3BXEA 1M34A 3QJGA 3X2SA 3DTVB 5TMBA 2FHPA 2O05A 2EX0A 4GRIA 4I50A 1XZIA 5E9JA 1PJQA 2IQIA 5GOTA 3VO8A 1F1JA 1QPGA 5BV7A 4D4HA 2B37A 1ECJA 2C94A 5JDIC 4E70A 2PFSA 2G09A 1KYIA 3NBMA 5H5JA 1XPOA 4KO2S 2FPWA 2CW5A 1G3IA 5A3SA 5EXDA 2FW1A 3O8QB 3VR6D 2B1GA 4NBUA 1E0SA 3A3NA 5H02A 3W7BA 4DWWA 4NU5A 4XJSA 1F2DA 3HP7A 4IXWA 4O29A 2R1VB 2RGNA 2IUUA 1KR2A 1E4YA 3I2IA 1K88A 2FRDC 1C1DB 5P8WA 4LF5B 3RAFC 4TL6A 4BLRA 4D5EA 1YA4A 4Y30A 4AMBA 1UKYA 1EFHA 1DAEA 2ZBQA 4GKBA 3IH5A 2C4MA 4N39A 4UBJA 2ZR0A 3M2PA 2E55A 3ZD6A 2OBXA 5CYOA 3T5TA 4TLCA 3R0QA 4Q47A 1BMTA 4BKMA 1LK0A 1TZJA 2GN0A 2XDQA 2B1RA 3MIIA 4XRRA 2R87A 3TR0A 5I7AA 1E4VA 3ZE9A 1TB4A 3G3EA 5E38A 3WWEA 3LW7A 1BQ4A 4V2UA 4HNAB 2G28A 2QD3A 5TY0A 2BBOA 2V0NA 2BDUA 1F1BA 4F84A 2YOFA 4F0JA 1JQLB 5HVNA 1ORDA 1ZG3A 1AT1A 1I7NA 3RUDA 4QDOA 5LQJA 2Z04A 2PQ6A 4R1OA 3VU8A 3GJ5A 2OUIA 5HRUA 2JGMA 4JOSA 2XQIA 2OMKA 2BFNA 3Q9SA 2VG8A 1FTWA 3OTQA 4QFMA 5THQA 3MJRA 5F3RA 3C6XA 2A0XA 4BX2A 3PUZA 3RYHB 4LJYA 2I65A 3SSAA 1RLMA 3JR3A 1RXVA 4MS4A 5WRFA 1FC0A 1IZZA 2EFGA 3IDFA 4AMVA 4L7QA 4QJ3A 4NMXB 2AHOA 3WLKX 1PUJA 1XTKA 5EMLA 2PMEA 3RTAA 2YNMC 4H59A 3VH1A 2QRVB 3CUVA 3KVVA 2P62A 1PT7A 2PKYX 4A8JC 5KJFA 2BPOA 1Z16A 1SU4A 5AJUA 2ZUDA 3UWKA 4A5OA 3N0TA 1NN3A 3I6IA 3R9KA 2RH5A 1NKVA 4S1OA 2GQ0A 4IFIA 1P2GA 4ZO6A 3RAPR 4GOXA 4PAMA 2NAPA 5LQAA 1XD2B 2NNLD 1TMOA 3AHIA 3RS8A 1GDHA 5I01A 4M9XA 4RIGA 1IIBA 2JKVA 2E4UA 2M98A 5IRCD 5AW9A 3DXFA 2ZUCA 4L0MA 1U0OC 3G6KA 3MPUA 2B5WA 3ZTYA 1D8AA 4S24A 3VSBA 3MINB 1ZK2A 5EP2A 2R5WA 3AFHA 1FMLA 1RI2A 5BVHB 2BM9A 2HRCA 3ZKWB 4JY7A 1P6UA 4HN4B 1RQGA 2HJWA 3WYGA 1JEYA 1RZRD 3QYFA 4LZWA 2L18A 5DM4A 3K9NA 1ND5A 5FWXA 5ALUA 3KXDA 4LHWA 3NHSA 3PT9A 4RETA 3A1FA 3PYMA 4GNRA 3RC1A 5C7IO 2JH3A 3BL8A 3PEEA 2JFVA 1XHLA 4LCJA 4OOEA 1DXOA 3HDYA 3ZC3A 4C5AA 1WXDA 2E4ZA 4F91B 3UJBA 4HDSB 1AS3A 2PMWB 5HA5A 4OFZA 1FP4A 3ZDEA 1L5HA 4M7RA 4X20A 3PF9A 4HNSA 3R8CA 1FQJA 3K5PA 4NI5A 4BNVA 5A04A 1IUOA 4AUMA 1YL5A 4HX2A 2DHRA 2WOOA 1SH7A 1DIOB 3DNFA 1NAIA 3LHDA 4ZGBA 1NTOA 3OQJA 1P5HA 1LW6E 2EL9A 3DOCA 3ELDA 3K6JA 2XUHA 2J3KA 4HEA6 4L4RA 4L7VA 1QE0A 5CVDA 3WNZA 1YJBA 2OFOA 3DHNA 2CLLB 3U40A 4UZFA 2GCNA 1A9QA 4BTEA 3ANSA 1VKZA 3FWKA 1I9GA 3WB0A 3H4TA 5G2OA 1Z17A 2XIJA 2PAAA 3NWPA 5H80A 4C7XA 2VQSA 4TGLA 3SDBA 2YC2C 1IN4A 2JLSA 4MS3A 4PPFA 1YBHA 1VE6A 5EPUA 3OZWA 2PLNA 5LQSA 4XAQA 1UEJA 4KB5A 3E3OA 1TJ3A 2VUIB 2YV2A 2F17A 2V5VA 4EFLA 4D3YA 1X3SA 2BCJQ 2GPJA 4V39A 1PK7A 4B5KA 4OYRA 1RWQA 2G83A 1PQ4A 3B1JA 1CUYA 5DHQA 2FZKA 2PBLA 2B25A 3EGVA 3Q87B 5HF9A 3WJ2A 2Q4RA 3AP3A 3CINA 3QVTA 3F98A 3BERA 5ITSA 3HV2A 1VZ2A 1V8BA 4G0WA 4EY7A 4AKHA 2JHFA 3DEHA 1GAEO 2OBYA 2FEMA 3VZDA 5GZ1A 1XTPA 2WYHA 3IMCA 3NASA 4U5XA 4CL8A 3L3BA 1WEHA 4EJMA 3ENNA 2WU8A 2WY2D 3CJRA 3SE0A 1REQB 2EDCA 3BTVA 2X3UA 5TF4A 1RTKA 3L0DA 2ZE7A 3NC1C 4KIWA 4OBWA 4Q1EA 3ZEIA 1WZ2A 4TYWA 2QX8A 4WK2B 1ISRA 5DTJA 4ZJUA 5BN3B 4RKFA 3RHSA 2DWOA 2GA8A 1UZNA 2OUKA 1P0MA 3KZOA 3M49A 2YIJA 4PFQA 5HNKA 3AIKA 3P26A 1YQDA 4E5VA 1CUWA 2CHVA 2BTQB 5B2EA 4DA6A 2RI6A 4KOEC 5I4KA 1SVOA 3E9YA 1E3SA 3OEHD 5CBKA 2OCIA 5EGSA 2VT7A 4C21A 5ESWA 2I5PO 4CEJB 5E6RA 4CKYA 1MNAA 5EPOA 3DBRB 3UV7A 1N6IA 1Z06A 1FUYB 2IPLA 4EKNB 2W2TA 2GRJA 4EEKA 3W5UA 1U0HC 1WXXA 1V6SA 2BE9A 3DKIA 4CMIB 4DLNA 2Z1DA 1PNTA 1SUDA 3DFZA 4AFNA 3NIDB 4XCXA 4WY2A 1E5LA 1BVRA 3K9LA 3TLGB 3KFVA 4I50B 1QIJA 4NMMA 1N2XA 2HYDA 2ZLBA 3C8ZA 3GAZA 5EUBA 2BI7A 3M9XA 3PD7A 5FI0B 5IK2D 2QRNA 1JS1X 4NCBA 2B2NA 2YMMA 2CLSA 1NHWA 1NIPA 3SS7X 2NPOA 2WPNA 3EQZA 3H4MA 1QCDA 4JJKA 3QX3A 3HVKA 4FD2A 4KAAA 1O1YA 4CKBA 1UBTS 3HNPA 3T7KA 2BFFA 3GJTA 4JUAA 2WWYA 2SBTA 4C03A 3IB3A 2WKSA 3GT4A 1IXRC 4YUAA 4X8LA 3RTEA 1NVEA 1W85B 3CRQA 1NQAO 4LZJA 5ALRA 3C6ZA 3GEBA 3JCZA 1E9EA 2HJHA 2NZXA 2Y77A 4A36A 3RIXA 4MPPA 5I3ZA 4ARBA 1AHNA 4RYLA 4S1NA 4XA8A 3O8OB 4FEYA 5EXPA 2L69A 1THGA 4ENUA 2SHKA 3V7NA 2VBFA 3W3AH 2XDQB 5KNDA 3ZV6A 2BGWA 3G79A 4LJLA 1Z4MA 2HXYA 5HXAA 4KRFA 1ZY2A 2ZWOA 3FFTA 2B20A 4YMHA 1TQ4A 3LL7A 4E1VA 2Z6QA 3BPSA 5GJVC 3ZWVA 3U4GA 2PGDA 4LXGA 1B8NA 3UAXA 3IQZA 3EXHB 3EULA 4PC1A 2JFBA 3BE5A 2D1YA 3KHKA 1XT6A 4K03A 3ES9A 3OC6A 4G65A 4GXQA 5CBPA 3P0RA 3KTDA 4QUKA 3K0BA 1S8NA 5KREA 4JI0B 4IIJA 4DQDA 1CUVA 4F45A 4EYOA 4UPEA 3IL2A 4EPTA 3LPNA 1TA9A 3OEYA 4I4CA 4Z3OA 4S35A 1QBKC 1D6MA 4PG8A 4QRIA 3VTAA 2M1XA 2H2HA 5IVKA 1UIMA 1ZIDA 2MINB 4JBHA 1L8LA 3RKRA 5JOQA 1ZNYA 1ZL2A 1ARZA 1R0LA 2OGSA 2FGJA 2FZVA 2XMSA 3SEQA 3FHTA 4C2AA 4COKA 1JYEA 2WJWA 1TFRA 2ZB4A 1CLUA 1R7RA 2EYQA 2I6QA 3QOWA 2CVPA 5MHTA 3FPLA 2XSZA 4UREA 4UHJA