4CRIA

Crystal structure of 53bp1 tandem tudor domains in complex with methylated k810 rb peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
publication title Lysine Methylation-Dependent Binding of 53BP1 to the Prb Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 28
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA01
3QIIA 1VQ5A 3OYCA 1YIJA 3OYDA 3CCLA 2RHXA 3CMEA 3MEWA 2GFUA 1VQOA 1XTDA 1YJ9A 3CPWA 2LCLA 3CCUA 3OYMA 3CXCA 1JJ2S 3OMGA 3L2VA 1K73U 1KD1C 2RHZA 3S3NA 2GFAA 3KUFA 2EQMA 3CC7T 3FEOA 2X4XA 1KHCA 3G6EA 3OYYA 1Q81U 1KC8C 2GF7A 4PLLA 1VQLA 2M1HA 1N8RC 2RI2A 2BUDA 2P0KA 1QVFA 1M1GA 1VQ9A 2L89A 1VQMT 3CCMA 2EQUA 3NTHA 1W2BA 2DAQA 2JNGA 4IUVA 1YJNA 1M1KC 5J26A 2G3RA 3I55A 1QVGS 4ZTFA 4EDUA 1WJQA 2R5MA 4QVZA 2JUFA 2EQKA 3OYIA 4PLIA 2DO3A 1K8AU 1VQPA 3H8ZA 1VQ7T 5C0MA 1Q86U 3L42A 2XK0A 3UWNA 5LL6S 2EIFA 2LRQA 3LGFA 3L2WA 3CMAT 1JJ2A 2JTFA 2E70A 3OYKA 3P8DA 2QA4T 4YTLA 2WACA 1M90C 2QQRA 3G71T 3S6WA 4ZN3A 5FROA 1KD1U 4BDZA 4Z02A 2F5KA 3CC2T 2R5AA 4IUUA 1YBYA 3OYEA 2LVMA 2D9TA 2LCCA 5FRNA 4HCZA 2FHDA 1RL2A 3QJ6A 1NPRA 1G5VA 1KC8U 2EKOA 2RI3A 3MO8A 3PNWC 1N8RU 3A5ZB 3OYJA 3FC3A 1VQMA 3CCJT 3OYGA 1VQKT 2K3YA 4OVAA 5IAYA 4II1A 4E7HA 2QEXT 3EAEA 2XHCA 1M1KU 2RHIA 3NTIA 3OA6A 3CCET 5D6WA 2OTJA 4C5EA 2RJFA 3PMTA 2X35A 4TVRA 2IG0A 2JZ2A 4C5HA 2RHYA 3F70A 2EFIA 2RJEA 4C5GA 3QBYA 3LGLA 5DLQE 5KCHA 2E6NA 3OW2S 1VQNT 3P8HA 3DB4A 3MP8A 1KQSA 2RHUA 4A4HA 1IZ6A 5A2QE 1KHIA 4L59A 2LTOA 2QA4A 3CD6T 1YI2A 3MEUA 3ASKA 1NPPA 3J81E 3OS1A 3CCST 5FRMA 3G71A 4RG2A 1M90U 1OZ2A 3CCVT 2L8DA 1YITT 1VQ5T 3UT1A 1VQ8T 4ZTJA 1YIJT 5FLXE 3CCLT 4A4EA 4E7IA 2E6ZA 4QQDA 4B9WA 5KH6A 3CCUT 3OS0A 4C5IA 3GOXA 1VQ4T 2R58A 3HKSA 2XDPA 5KE3A 3CPWS 4N4IA 3LYIA 3CCJA 3OYHA 3FDRA 3TREA 3S3OA 3CXCS 1VQKA 1VQ6T 3LH0A 5C6SA 2QEXA 3DLMA 2OTLT 3MEVA 1YJWT 4UC4A 3KBGA 4NS5A 5D6XA 1WJSA 3L2QA 1S72T 3CCRT 3OQ5A 3JAME 3OYNA 3OMCA 3MP6A 1VQ9T 3CC7A 4BE0A 1X6OA 3CEYA 5IN1A 3O8VA 5KCOA 1QVFS 4LD6A 5CIUA 2O4XB 4FU6A 3QKJA 4BD3A 2HQEA 5M9OA 3LLRA 4X34A 1OZ3A 1W2BS 1H3ZA 1VQNA 3MP1A 1YHQT 5IT9E 1UEBA 4PL6A 3OB9A 2K3XA 3CD6A 1QVGA 3OYBA 3CC4T 2RI5A 4IURA 4ZN1A 5D6YA 1BKBA 2YRVA 3CCSA 5KE2A 3CCQT 2HQXA 2M16A 1VQPT 2E5QA 3CCVA 1YITA 2BIVA 1EIFA 2RO0A 1VQ8A 1WJRA 1NZ9A 2CKKA 5J3BA 2LQ8A 1Q7YC 4E7LA 3PIPA 3J80E 4B9XA 4CRIA 1NJIC 4E7JA 2KVQG 3E9GA 4IUPA 1VQ7A 3L2RA 1VQ4A 1RI0A 2VYTA 4BE1A 3CMAA 3PMIA 1OYXA 3G4ST 4IUQA 4Q5WA 1VQ6A 2JVVA 1Q82C 3P8BB 2RJCA 2OTLA 4N4GA 1YJWA 1K9MC 4QW2A 3CPFA 1S72A 3CCRA 3I56T 2BKDN 2KDSA 2LDMA 3OY9A 3CC2A 3META 2MWOA 2DIQA 3DLLA 3CMET 2R57A 4BDYA 1VQOT 4BACA 3S3MA 3Q1JA 1YJ9T 1K73C 3L2UA 5HY6A 1XNIA 5DM7R 1SSFA 4QQ6A 4BE2A 4FL6A 3E9FA 3ER0A 3PFSA 1YHQA 2X4YA 2OTJT 3SD4A 1Q81C 1OI1A 3OYFA 2MWPA 3G6ET 4IKFA 3CC4A 2B8AA 5J39A 3CCQA 1VQLT 3FLGA 4QQGA 2L3RA 3CCEA 3OYAA 3C4SA 3CCMT 1N27A 2O4XA 3OS2A 3M9QA 3LX7A 3OW2A 1Q7YU 1NJIU 1YI2T 2RJDA 1KQSS 4E7KA 3J7AF 2JOYA 4A4FA 3BDLA 3ME9A 1YJNT 2EQJA 1MHNA 3MEAA 2X4WA 3ZEHA 3I55T 3NTKA 3G4SA 4GY5A 4IUTA 2DIGA 1WGSA 2M0OA 4A4GA 3DB3A 1Q82U 2QQSA 3H6ZA 1K8AC 3PIOA 1K9MU 2NLUA 1Q86C 3OYLA 3I56A 2MI6A 4N4HA 2PQWA
chains in the Genus database with same CATH superfamily
1KK7A 3QIIA 1Q95G 4M78E 1MMAA 3MEWA 2P0QA 1B7TA 1G3YA 1QP3A 4WTOB 2HBPA 1Y07A 1B34B 2ZPBB 5HK0A 1KQSP 1WI7A 3OYMA 1JJ2S 2KGTA 3EGXA 1KD1C 4OF1A 2D0NA 4BB7A 4C0DC 4M7AC 2IVWA 2DTHA 5ECAA 2E3HA 2EQMA 3PE0A 3FEOA 3M56A 3SB2A 1KHCA 3M0UA 4C92A 1GRIA 3CBOA 1VQLA 3HSBA 2DL7A 2DZ9A 1N8RC 4LE9A 2BUDA 3GNGA 2P0KA 1M90R 4J6XA 2DTOA 4KT0E 3RERA 2LT4A 4M7DA 3CCMA 4C8QA 2QDYB 1AWJA 1V29B 2PVDB 1SHGA 2JNGA 4PJNA 4M75A 5CK9A 5CKHA 5GMKj 5LJ5h 3E2UA 5GJVB 4ZNXA 3CCSQ 2CZ6B 1H3HA 1QVGS 3JCMW 4EDUA 1MMGA 4J6YA 3X25B 2FYKA 1D0YA 2F2XA 4MZMA 1PC0A 5GANe 1PRMC 2FZKB 2XMFA 2I2LA 4X1VA 3CBPA 3H8ZA 3A8GB 4XTVA 4MZPA 4M7DD 1WXBA 2XK0A 3UWNA 5LL6S 1W6XA 1IRXA 3LGFA 1JJ2A 1XQHA 2FRWA 3MCAB 4IIMA 3NFCA 1HXDA 1M3AA 2HAXA 2LZ6B 1ZUKA 1LVKA 2HNIA 2O9VA 3JCMg 1RACB 1AWOA 1M90C 5KYXB 5KYWB 1GCQA 4E47A 3JV3A 4Z02A 4LNPA 4CC7A 2RF0A 2R5AA 4A4KA 1YBYA 4XAXB 2EQIA 2O01E 1D3BA 4RG8A 4P5NA 2ED0A 2NWMA 1UGQB 2LMJA 4M7DE 1JO8A 2J6KA 4C8QE 3OYJA 6AT1B 2Y4YA 2DD5A 5LJ5j 4AFSC 1UE9A 1B34A 5GANh 1VQKT 5IAYA 2DL8A 1N6AA 4M75E 2QEXT 1VQKQ 1IGUA 1PRLC 1FMWA 4LDWA 2QEXQ 5CQYA 1BCMA 2RHIA 4M77B 2FEIA 1H8KA 4C5EA 2RJFA 2FG0A 1QVFP 2IG0A 1LOJA 4L6V5 2JZ2A 1D0ZA 3F70A 1QQJA 2RJEA 2PTKA 1ABOA 2XKOC 5KCHA 2KAFA 2A3LA 1TXQA 1VQNT 3X20B 3DB4A 5LJ3h 4J7IA 5LJ5d 1KQSA 2LQKA 3UA7A 1G8XA 2RHUA 1VQNQ 4AFZC 1ZSZC 4L59A 5GAMe 2LTOA 1UGPB 1M3BA 3ASKA 1ZUYA 3J81E 1WYXA 5FRMA 2EBPA 3HHTB 3A8MB 3RESA 4F14A 4WCIA 3UT1A 4ZTJA 5FLXE 1SRLA 2VC8A 3CCLT 3VRZA 2Y90A 4FYXB 2F69A 1WPYA 4E7IA 3CCLQ 4QQDA 3FIFA 2LQWA 4JRKA 3TU4K 4QVDA 5GANj 3GOXA 2BTTA 1VQ4T 1ARKA 4FSXA 5GAOp 1VQ4Q 3A8HB 1T0JA 4JDSA 3CXCS 1VQKA 5FWCA 1TOVA 2AT1B 2ABLA 3JCMb 4XU2A 1Q7YR 1HYOA 2ZCFB 3DLMA 2QEXA 1NJIR 3MEVA 1X01A 2K6DA 5GAMg 5HKCA 5KYXA 2EYQA 3VU3C 5KYWA 2DTIA 3OMCA 3JCMV 1VQ9T 1IO6A 4D6WA 4BE0A 3CEYA 1VQ9Q 2J7IA 1AT1B 5IN1A 5GAMh 1AD5A 2RQUA 4RTXA 4M7AF 3QJYA 1QVFS 3MKDA 1Q82R 5LJ3j 2HQEA 5M9OA 5GANd 1K9MR 4BI3A 1HJDA 1VQNA 1TUGB 1V76A 1U5SA 5GAOr 1RAFB 2K3XA 1NG2A 4IURA 4ZN1A 2DNUA 1QW1A 4KGXB 5FU6B 2E5QA 1WHJA 1PHTA 4E6RA 4M77A 3AT1B 2V1RA 1AWWA 1EIFA 5FW9A 2RO0A 3QPHA 2DKGA 1NZ9A 2CKKA 3QDFA 3RKWA 1Q7YC 4B9XA 4CRIA 5LJ3d 1WZOA 2E3IA 2P0PA 4E7JA 1NJIC 4LUDA 2KVQG 4EIKA 3SFMA 2K4YA 2LNVA 1UHFA 1VQ4A 1RI0A 1W2BP 4X9CA 2NUTB 4BE1A 2H8HA 3CMAA 3JCMP 4BY6B 3PT9A 1AZGB 1K0SA 4C92G 1Q82C 4C0DB 3TCJA 4JS4A 4M7AB 1K9MC 4QW2A 2EJ9A 4RUGA 3VS3A 2X3WD 1SG5A 3JB9I 1WX6A 1Z9QA 2LDMA 1JB0E 2XDDA 3OY9A 4C8QG 3META 2MWOA 2DIQA 2NYSA 3R6NA 2GTJA 3D7SB 4JZ3A 1VQMQ 2OX7A 4BDYA 4BACA 1VQOT 3S3MA 4M75G 2A7YA 2K5IA 1CKBA 3VYHB 1K8AR 1VQOQ 1PM3A 4HCBA 1ABQA 2G6FX 3G7ZA 2WSFE 2E41A 1RLPC 2OTJT 5L8RE 3SD4A 2C0OA 2OTJQ 1IXDA 3M58A 1M2VB 1NE8A 3LWIA 2CP6A 4M77E 4HCCA 2HL5C 1D1BA 3TSZA 3HPWA 2COWA 1TUDA 1E6HA 4RCCA 2P84A 3HRTA 3CCEA 4KH1B 2L2PA 3C4SA 1N27A 1BB9A 4GLKA 1QMCA 2XDBA 2LJ0A 4LDYA 5IXFA 3BDLA 3ME9A 4OMOA 4CC3A 4LDXA 3H0FA 3MEAA 3I55T 3NTKA 2YLCA 2QG9B 2YRDA 2ROLA 4XU1A 2DIGA 1MV3A 4RTZA 3I55Q 4PJJA 1UJ0A 3NGPA 1GXIE 1K8AC 3A98A 1W1FA 1CKAA 2NLUA 1I07A 3C94A 5DY9A 4CC2A 2MI6A 5I2MA 2QTXA 3X28B 3OYCA 1YIJA 1FMVA 2EJFA 4OGCA 4L5GA 1VQOA 1XTDA 1NM7A 3QG1A 2X3XD 2QI2A 2FO0A 1RAGB 2ED1A 5GANf 3OMGA 2NUTA 1K73U 2YUNA 2ZAEA 4V2SA 1X2KA 3OBWA 4ELYC 2GQVA 1WHGA 2WSCE 3QZ9B 3CC7T 3TEEA 1UGSB 2M02A 2VVKA 3RUXA 2DA9A 4M7AA 5CKEA 2C06A 3CC7Q 4GBQA 3OYYA 1Q81U 3T9NA 1WIEA 1UECA 2RI2A 4BUGA 1X69A 4JS5A 1M1GA 4OMPA 2DILA 1ZUUA 4B6MA 2L3SA 3BDUA 4WF2A 3VKIA 2RQVA 2LC4A 3NTHA 4M4ZA 4KGVB 1W2BA 2ATCB 2MF2A 2DAQA 5FU7B 3VS2A 2COYA 3I55A 1ZSZB 4ZTFA 4M7AD 1WJQA 2R5MA 1M2VA 5L23A 1TG0A 1SHFA 2HZYA 2ZGWA 2DXCA 2K5LA 1VQPA 1KIKA 3QWYA 1Q86U 2VXEA 3M0TA 2EIFA 3L2WA 3M0SA 3KXTA 1RI9A 2VB6A 7AT1B 1H92A 3JB9F 2CS7A 2E70A 2D6FA 2H3EB 1BK2A 2QA4T 2RB6A 2WACA 1UUEA 1BIAA 2QXFA 1NYFA 2QA4Q 2HEQA 3G71T 1R8OB 5FROA 3A1PA 3HL8A 1M3CA 1QVGP 3G71Q 1M2OA 5FWBA 4M7AE 3EG3A 3CC2T 2LVMA 3WVEB 1UB4A 1I8FA 3JB9H 2KNBB 3CC2Q 1RL2A 2RPNA 1JQQA 4DBFA 1S1NA 1KC8U 2EKOA 2RI3A 1LJOA 2XICA 5GAMf 2EYWA 3ZFJA 2DYBA 2KT8A 5HK3A 2FZCB 3FC3A 1YWPA 3JCMJ 2JTEA 2KROA 4JUVA 1PKSA 4DEXA 4F7UF 2KR3A 1LPLA 4M77G 2K2VA 1OX9A 4RCBA 1WFWA 2CUDA 3NTIA 4PFZA 1M1KU 4RMOA 4A53A 2E10A 4TVRA 1UGVA 4C5HA 1GBRA 2RHYA 3QHSA 2EFIA 3EG0A 1OV3A 3QBYA 3GBQA 5EG2A 3M0PA 1P92A 2VWFA 1UTIA 2CP7A 4AMCA 1YWOA 1OU9A 2LCSA 3MP8A 3MPUB 1M8VA 2D1XA 3EHRA 2M0YA 2QQ9A 3JCMe 4R56A 2QA4A 2OAUA 1WNLA 3PVLA 8ATCB 4ZGEB 3DKMA 1G3WA 2A28A 3OS1A 3CCST 3G71A 5CKDA 1ZSZA 4M78C 2CP0A 4EMKC 2QK0A 3FB9A 3CCVT 4BI8B 3UPUA 5GAOq 1VOMA 5AYFA 1VQ5T 2GCXA 4FW2A 3TVTA 1VQ8T 1QCFA 1VUBA 3OS5A 3CCVQ 1PSFA 5LJ5e 1VQ5Q 1KQ1A 1VQ8Q 2E6ZA 4B9WA 2O2OA 4RTTA 1MMDA 3REBB 3CCUT 4F17A 3M53A 4KUDK 3VS7A 1Q86R 1CSKA 1ZA1B 3CCUQ 2LJ3A 3FJ5A 3CPWS 4N4IA 3LYIA 2DL5A 3FDRA 3S3OA 2EAYA 4D8KA 2JM8A 2DPPB 2OTLT 3KBGA 1MMNA 4NS5A 1WLPB 2OTLQ 1OU8A 2B86A 2EYZA 4ME7A 1K76A 1TS9A 4FYWB 1X6OA 2GBQA 4PJMA 1NLPC 3JCMh 2DRMA 2ESWA 1BI0A 4FU6A 2DX1A 1KC8R 2AKKA 4QKUA 3LLRA 2SRCA 2EYYA 4X34A 2JMCA 3EH1A 2K3BA 3NHNA 3CXCP 3VV0A 4J9DA 4XTZA 4PL6A 4BI4A 3EFRA 2FPFA 1YN8A 1QVGA 5KYYB 1BKBA 2YRVA 3CCSA 2F5TX 2M16A 4E7ZA 4J6WA 3CCVA 1M1KR 2SEMA 5GMKl 1VQ8A 1WHHA 2LQ8A 1OEBA 3VS5A 2KRSA 3EG9B 4PJOG 2RN8A 2DM1A 1OOTA 1UDLA 3HFNA 1BI3A 4C0ZA 4C92C 3PMIA 1OYXA 4IUQA 3HTRA 2WSEE 2O88A 2JVVA 2OTLA 3V7SA 4HVWA 1UGRB 4C8QC 1LNXA 2ECZA 3I56T 3JB9D 3I56Q 4M78G 2F1LA 1PNJA 4M75C 4J83A 2V8IA 3CMET 4EMGA 1YJ9T 3CMEQ 3JRZA 1YJ9Q 1JU5C 3PTAA 1SSFA 4DA4A 4BE2A 3E9FA 1KQ2A 1C1AA 2F2VA 3VUBA 4XU3A 5DLOA 1OI1A 4OB0B 3G6ET 5GMKi 3JB9J 3JCMd 2B8AA 2DERA 2K5FA 3G6EQ 1SKUB 4LXCA 2QDLA 2L3RA 4N0AA 3L2ZA 3M4YA 1X2QA 2RQRA 2YSQA 3H0HA 3THKA 4MMKA 3G1JA 1KFZA 3OYAA 3URGA 3OS2A 3LX7A 2MCNA 3LWHA 1GCQC 4HCKA 2CP2A 1YI2T 4E7KA 2JOYA 5GAN7 1R0CB 2HDAA 1YI2Q 2DL4A 4ESRA 4GY5A 1YCYA 5KYYA 1SRMA 2M0OA 3ZBDA 2CYZB 2QQSA 3KFVA 2QTVA 2D0QB 3I56A 4LN2A 5CAIA 4E7SA 3I35A 3OYDA 2I0NA 3CCLA 2MAMA 2GNCA 2KK4A 3CMEA 2HL3A 1HD3A 2GFUA 4M78F 2DBMA 3EG9A 3CCJQ 1YJ9A 2VGMA 2LCLA 2D8HA 1KG1A 4PFPA 3CXCA 2CZ0B 3L2VA 1EFNA 4OB3B 2DE0X 2RHZA 3S3NA 2LNHB 1JXMA 2GFAA 2DF6A 3GLXA 4LDVA 5A0GA 2F2WA 2X4XA 3X26B 3G6EA 1A0NB 5I2SA 4XTWA 2J05A 1UG1A 4R55A 4O6JA 2E64A 5GJWB 4F16A 4AG1C 2OI3A 3BE3A 1MNDA 3ZL7C 4AFUC 2VGNA 5GAMj 2NUPB 4JJNK 2K79A 1QVFA 3MHXA 4M7DG 2ZPGB 1VQ9A 2L89A 2EGCA 1VQMT 2QQBA 1IREB 2W10A 1B07A 2EQUA 5AT1B 3WVDB 1IHWA 3HP9A 3H9NA 3HFOA 2RM4A 2OAWA 1OPKA 2A08A 4JPBW 1AEYA 4MDWA 1PD0A 2G3RA 5HCKA 3RKYA 3QXEB 4NL3A 8AT1B 2DEQA 1C0MA 1D0XA 4QVZA 2JUFA 2EQKA 4XQ3A 4PLIA 1I0CA 1RLQC 1AZEA 4EMKB 2CT3A 1OQKA 4OB1B 5GAMd 3EH2A 5GMKm 4A63B 3GNFB 2QQAA 4EMHA 2DYIA 5C0MA 2CSQA 1VQ7T 2LT1A 4J5YA 1ZLMA 1VQ7Q 1U8RA 2JTFA 3M0RA 3M57A 3OYKA 2HKNA 2O31A 3UDCA 3U23A 3QWXX 2QQRA 3S6WA 4ZN3A 5IXBA 1KD1U 2P4TA 4A54A 3OYEA 2DEUA 4LD9K 1YFNA 2LCCA 5FRNA 2EYXA 4HCZA 2ROTA 1SPKA 3EG1A 4JZ4A 4FSSA 4C92F 1G5VA 1AWXA 3OBYA 2DMOA 3MO8A 3JCMf 4KRTA 3PNWC 1N8RU 4RKUE 1QCOA 1WXUA 1JEGA 1VQMA 4O5VA 1VIEA 1WHKA 2K3YA 4C8QF 4OVAA 3ULRB 1X27A 4ORZA 4M77C 4II1A 4E7HA 2PNIA 4FT4A 4XU0A 4M75F 2OJ2A 2RD1A 3OA6A 1PD1A 2X51A 4HT8A 1M1FA 5D6WA 3UATA 2OTJA 1G3SA 3PMTA 1B3QA 1T0HA 2X35A 1WA7A 1ZBXA 2EJGA 1W70A 5GAN6 4J9FA 2NUPA 3SWNC 4C5GA 2MPXC 4C0GA 3LGLA 2AZSA 2CP3A 4D8DA 3OW2S 1D1AA 3P8HA 2DXBA 3UF4A 2BZXA 3VJPA 2XIDA 4FM4B 4A4HA 1IZ6A 4FT2A 1G83A 2AZVA 2DETA 4ELZC 2EPDA 2J6FA 3JSCA 3H0IA 1NPPA 1ZSGA 1M90U 2LQNA 1PG5B 3BY7A 2L8DA 5KYNA 1YITT 2ZPIB 1Y57A 4RTVA 2DXUA 1FX7A 1YITQ 4EMKA 4F04B 1M8MA 4OMFB 4A4EA 5GMKe 4JJBA 2MYSA 4ANJA 1Y96B 4LUEA 3I5SA 3OS0A 1BI2A 1PSEA 2R58A 1F1BB 2XDPA 3HKSA 5KE3A 1VYTA 2KT1A 3RMQA 1BU1A 4MZTA 3TREA 1QWFA 2L0AA 1R77A 1EX4A 1VYVA 2K2MA 2M51A 3LH0A 2XU8A 5C6SA 3V8KA 4JJDA 1MV0B 4KUIA 2K7AA 2COZA 2PZ1A 5A0DA 3L2QA 3CCRT 1I81A 3OQ5A 3JAME 3OYNA 1VQLQ 2DRKA 3CCRQ 3CC7A 4M78D 5CQXA 1TU0B 3M54A 5CIUA 4LD6A 1RAIB 4Y91A 3QKJA 2HMAA 4BD3A 4J9GA 1AOJA 2DJZA 4JRIA 4QT7A 1KSWA 1ZQ1A 1H3ZA 3CPWP 5IHKA 2CUBA 2HSEB 1O9SA 1WDXA 2YHTA 3QYGB 2LX9A 5GAN5 2HKQB 3VS6A 1J3TA 4OMNA 3GIBA 4OGEA 3OB9A 3OYBA 2RI5A 5D6YA 3JCMX 1O75A 4AFQC 4OMMA 3H41A 2RQWA 1K73R 1T3SA 5I22A 4ZGDB 2DLPA 2AKLA 1YITA 1DJ7B 2CSIA 5CKFA 4DOVA 4DEYA 3RR6A 1E6GA 4PJOC 3J80E 2JW4A 2DZCA 2RQTA 4Z89A 1Q81R 2ENMA 3E9GA 2JTMA 4BY6C 4AG2C 2RH2A 5GAOn 2ZZDA 1TUCA 1FMKA 2RA2A 3SDZA 3M4GA 4Q5WA 2EGAA 1G2BA 1BYMA 2YT6A 4DBRA 1GBQA 1N9RA 1OPLA 2FB7A 1WXTA 2CH4A 2RJCA 3R6OA 4N4GA 2A0FB 3EGDB 3CPFA 5KYUB 1M30A 3FJPA 2C0TA 3TQ7P 5GAN3 2XG8D 3CCRA 2KMTA 2KXCA 2BKDN 2DD4A 2AHJB 1IB8A 1BCOA 2JM9A 5LJ5g 3CC2A 3EFOB 2JJ9A 4HXJA 3DLLA 2QGFB 1Y96A 1K73C 1Y0MA 4Z8AA 4F7UB 5HY6A 1RAAB 4Y28E 2BZ8A 2JMAA 2GTOA 4FL6A 2VUBA 3PFSA 4FIBA 3HRUA 4C92D 1Q81C 2MWPA 2MIOA 1RABB 4FW1A 2BZYA 1I5OB 3FLGA 4QQGA 2GQIA 2HBWA 1K4US 2O9SA 1UJYA 4M77F 1SSHA 2PVOB 1Y7XA 1M27C 1KJWA 1UFFA 4C8QD 4RTYA 4XK8E 2EVRA 3VYGA 1IHVA 4MMLA 5IHNA 1Q7YU 2L3QA 3CBMA 1K9AA 4M75D 1NJIU 2RJDA 1KQSS 1M4ZA 4A4FA 3J7AF 3INZA 1W4SA 3PGGA 2DJQA 2EQJA 1YJNT 4DBQA 2DVJA 2KYBA 3ZEHA 2X4WA 1YJNQ 2RK2A 2H3JA 4FCYA 4IUTA 1MNEA 3M5AA 3REAB 5LJ3e 1WGSA 3AHUA 4C92E 2FRYA 1WHMA 2DXTA 3JCMc 3DB3A 5GAOl 3SHWA 1Q82U 3H6ZA 5GAN2 5GANg 3PIOA 1K9MU 1Q86C 4JRPA 3TSWA 4DQ2A 4N4HA 4J9CA 3I9QA 2X9HA 4ATOA 5CKBA 1VQ5A 4KH0B 4X9DA 1LCKA 3A8OB 2RHXA 3V8JA 5IH2A 1MUZA 3GPLA 2KQWA 2EGEA 3BFMA 3CPWA 2D8JA 2ZPEB 2ZPHB 2IPOB 2HQHA 3CCUA 2YRCA 1NEGA 4JJCA 2E65A 1YNZA 3RBBB 2XD0A 2FZGB 3KUFA 4M7AG 1XOVA 1D09B 2GGRA 2BE7D 5LJ3g 2YLBA 3EGDA 5KYUA 1QP2A 1KC8C 2GF7A 2V8KA 4PLLA 2J6OA 4M7DC 1OX8A 2JXBA 2M1HA 1M9SA 3QSUA 2CH4W 1K1ZA 4J9HA 3EFOA 5FU7C 1U1SA 3SWNB 1MGQA 1ZHIA 2KXDA 4J9BA 4F7UA 1AVZC 2EWNA 2CDTA 3QO3A 4IUVA 2FL7A 5I21A 1YJNA 1M1KC 5J26A 1WQ7A 2KEAA 2ZPFB 1I1JA 4IIOA 5I11A 1YCSB 2FPEA 2YWWA 4NL2A 1FWZA 2FVUA 3FRNA 4KGZB 3OYIA 1N5ZA 3QZ5B 1NLOC 1V1CA 1BIBA 2YUPA 2DO3A 1K8AU 3V8LA 3EG2A 4PJLA 1GL5A 3NMZC 3L42A 2LRQA 3RIRA 3CMAT 4QVCA 2MMPA 2NUZA 5IHIA 3CMAQ 3N5BB 3RNJA 3M55A 3P8DA 2X4JA 1TWBA 4YTLA 4PJOF 4BDZA 3C95A 2RMOA 2LX7A 2F5KA 4IUUA 1ZX6A 2D9TA 1TH7A 3BW1A 2FHDA 2EW3A 3QJ6A 3VUZA 5EC7A 3VS1A 9ATCB 2CREA 3MJXA 1NPRA 3EGUA 1TSFA 2E12A 4K11A 3A5ZB 1X43A 2CZ7B 3OYGA 3CCJT 5A0LA 3M0QA 4F7UE 2IIMA 1VA7A 2YDLA 1ACMB 2A36A 1ZA2B 2DVEA 3EAEA 2XHCA 4KULA 4RTWA 2JT4A 3QDRB 2CT4A 4GLMA 1GFCA 3CCET 2K9GA 2M9UA 1X75C 2E1HA 1Z9ZA 5GAN8 1IGQA 3VS0A 3CCEQ 4ZGJB 2VASA 4HT9A 3L1AA 3EHQA 1RAHB 3QYHB 2DFUA 2E4HA 2KY9A 4LDUA 5DLQE 2LJ1A 2Z0WA 4PJOB 2E6NA 1SEMA 3RMSA 4OB2B 3SWNA 3E1SA 1HK9A 1QVPA 3GF5A 4J9EA 2KBTA 2VKNA 4PK4A 4AT1B 1EZZB 5A2QE 1KHIA 3WXMB 3CD6T 1YI2A 3MEUA 1PCXA 3NPFA 4M77D 4RG2A 3CD6Q 3EFSA 1OZ2A 1QCNA 2KRNA 1FYNA 2DL3A 2KE9A 1YIJT 5GAOm 4PKCC 2VV5A 1YIJQ 4CC4B 4M78B 1GFDA 3C12A 1RAEB 4EPCA 5KH6A 2KRMA 4C5IA 3UA6A 2JS0A 1NEBA 3OW2P 2KSSA 2L3PA 2PU9B 3OYHA 3CCJA 1JXOA 3VS4A 5CVIA 5LJ5f 2BE9B 1VQ6T 2EKHA 4XTUA 2KI7A 4KBMB 4N0AC 2C0IA 1VQ6Q 1YJWT 1H641 4UC4A 2Y4XA 5D6XA 3GP8A 1WJSA 1YJWQ 1S72T 1VYUA 4JRQA 1D1CA 1RADB 3MP6A 4R0KA 1S72Q 4PFOA 2VXFA 1YP5A 3O8VA 5KCOA 2KYMA 2V8JA 1QWEA 3V7CA 2O4XB 2FPDA 4MDXA 2QAZA 4FYYB 5CR2A 1VIFA 1OULA 2YXYA 4NOYA 2HD0A 2YUOA 2LP5A 1OZ3A 2V26A 1U1TA 1W2BS 3JCMQ 2JN0A 3SEMA 3MP1A 2AIRB 4M7DF 3PVQA 1JBMA 1YHQT 2AK5A 1PWTA 3RDVA 5IT9E 1UEBA 2PUOB 2V1QA 3LH5A 1JRIA 1YHQQ 2YUQA 3CD6A 3CC4T 3OSSC 4E2FB 3QUIA 5KE2A 2JS2A 4XTYA 2HQXA 3CCQT 1VQPT 3CC4Q 4DOWA 1I5LA 4VUBA 2BIVA 3CCQQ 3JB9G 2J06A 1VQPQ 1WJRA 5J3BA 2RK1A 4E7LA 3PIPA 4CI0C 1WHLA 4HVUA 4IUPA 4JLIA 3L2RA 1VQ7A 4PJOA 1PKTA 4OP0A 3EGXB 2L5QA 2VYTA 2QYZA 2RNAA 3G4ST 4J8OA 4XTXA 1VQ6A 2CP5A 1RUWA 3G4SQ 2CGHA 3P8BB 2HCKA 1AHJB 1YJWA 4JLGA 4PNOA 5CO7A 3X24B 1I4K1 1Y71A 4C92B 1M5Q1 3LW5E 1S72A 1U3OA 1QKXA 1E7OA 2KDSA 4J9IA 1X6GA 2K57A 3V7RA 4Y92A 3VRYA 4M7DB 4M78A 3IQLA 2R57A 4F7UG 1UHCA 4C8QB 3Q1JA 5LJ3f 4PJOD 1WQWA 3I5RA 5GAN4 1JJ2P 3RKXA 4RTUA 3L2UA 1G3TA 1R0BG 1SF9A 5D7UA 2MOXA 4M75B 1XNIA 5DM7R 2CZ1B 4QQ6A 3E19A 3ER0A 2DBKA 1N9SA 1YHQA 2X4YA 1C6VX 4HKEA 4FYVB 3OYFA 4J7FA 4IKFA 3CC4A 2A37A 5J39A 1HSQA 2PVGB 4C0FA 3CCQA 1VQLT 1QLYA 2HSPA 1KD1R 1XJWB 4OMLA 2QGGA 3A8LB 3HRSA 2W0ZA 3CCMT 2O4XA 3M9QA 3OW2A 4DBHA 3CCMQ 3M59A 4PJOE 3OSVA 1NYGA 1K0XA 1GCPA 1X6BA 2MK5A 3O5ZA 1N8RR 1MHNA 2DK3A 2E5KA 1NBEB 1FXXA 3G4SA 5FU6C 4OMQA 1TTHB 3CQTA 1QKWA 1ZBJA 5GMKh 4HVVA 4A4GA 3C0CA 1D3BB 5CCAA 2XI9A 1T3LA 2QASA 1BBZA 4HA8A 2P4RA 2PUKB 3OYLA 1U06A 2PQWA 1BI1A 4Z88A
chains in the Genus database with same CATH topology
4ATOA 3QIIA 3X28B 5CKBA 1VQ5A 3OYCA 4X9DA 4M78E 1YIJA 3OYDA 3A8OB 3CCLA 2MAMA 2EJFA 2RHXA 2KK4A 3CMEA 3MEWA 2P0QA 4OGCA 4L5GA 1G3YA 2GFUA 4M78F 3V8JA 1VQOA 1QP3A 1XTDA 3GPLA 2HBPA 1Y07A 2KQWA 1YJ9A 1B34B 2ZPBB 2VGMA 2LCLA 3BFMA 3QG1A 2ZPEB 2ZPHB 3CPWA 5HK0A 2QI2A 3CCUA 3OYMA 1KG1A 3CXCA 1JJ2S 2CZ0B 5GANf 3OMGA 3L2VA 1K73U 1KD1C 4OF1A 4BB7A 4C0DC 2E65A 4OB3B 4M7AC 2IVWA 2DTHA 4V2SA 3OBWA 2RHZA 3S3NA 4ELYC 2GQVA 2XD0A 2GFAA 2WSCE 3KUFA 2EQMA 3GLXA 3QZ9B 1XOVA 3FEOA 3M56A 3TEEA 3CC7T 4M7AG 1UGSB 4LDVA 5A0GA 3SB2A 3RUXA 4M7AA 2X4XA 1KHCA 3X26B 3G6EA 5CKEA 2C06A 5I2SA 5LJ3g 2YLBA 4XTWA 3OYYA 1QP2A 4R55A 3T9NA 4C92A 4O6JA 2E64A 2GF7A 1Q81U 1KC8C 2V8KA 4PLLA 3CBOA 1VQLA 4M7DC 3HSBA 2DZ9A 2M1HA 1N8RC 2RI2A 2VGNA 2BUDA 4BUGA 1M9SA 3GNGA 5GAMj 3QSUA 2P0KA 4JJNK 4J6XA 3MHXA 1QVFA 4JS5A 4M7DG 2DTOA 4KT0E 1M1GA 2ZPGB 1VQ9A 2L89A 3RERA 2LT4A 1U1SA 5FU7C 4M7DA 1VQMT 3CCMA 2QQBA 4C8QA 3SWNB 3BDUA 1IREB 1MGQA 4WF2A 3VKIA 1ZHIA 2LC4A 2QDYB 2EQUA 3NTHA 1W2BA 1V29B 3WVDB 2PVDB 3HP9A 2MF2A 4F7UA 2DAQA 2EWNA 2JNGA 3QO3A 3HFOA 4M75A 5FU7B 2RM4A 4IUVA 2FL7A 5CK9A 5CKHA 5I21A 1YJNA 5GMKj 4MDWA 1M1KC 5LJ5h 5J26A 1WQ7A 2ZPFB 2G3RA 3RKYA 3I55A 2CZ6B 3QXEB 4NL3A 1QVGS 2DEQA 3JCMW 4ZTFA 4NL2A 4M7AD 4EDUA 1WJQA 1FWZA 2FVUA 2R5MA 4J6YA 3X25B 3FRNA 2FYKA 2JUFA 4QVZA 2EQKA 4XQ3A 3OYIA 4PLIA 3QZ5B 4MZMA 5GANe 2I2LA 4EMKB 1BIBA 4OB1B 5GAMd 3CBPA 5GMKm 2DO3A 1K8AU 2ZGWA 2DXCA 2K5LA 3GNFB 2QQAA 3V8LA 3H8ZA 4EMHA 5C0MA 1VQPA 1VQ7T 3A8GB 4XTVA 2LT1A 4J5YA 4MZPA 3L42A 2VXEA 2XK0A 1Q86U 4M7DD 3UWNA 5LL6S 2EIFA 2LRQA 1U8RA 3LGFA 3RIRA 3L2WA 3CMAT 1JJ2A 3KXTA 1XQHA 2JTFA 3JB9F 3MCAB 4QVCA 2MMPA 2CS7A 2E70A 3M57A 3NFCA 3N5BB 1HXDA 3OYKA 2HAXA 2D6FA 3M55A 3P8DA 3UDCA 2QA4T 5FRNA 2X4JA 2HNIA 3JCMg 4YTLA 2RB6A 2WACA 1BIAA 1M90C 2QXFA 2QQRA 4PJOF 3S6WA 3G71T 1R8OB 5FROA 4ZN3A 3HL8A 1KD1U 4BDZA 2P4TA 3C95A 4E47A 4A54A 4Z02A 4M7AE 2F5KA 3CC2T 2R5AA 4IUUA 4A4KA 1YBYA 3OYEA 2LVMA 4LD9K 4XAXB 3WVEB 2D9TA 1UB4A 2LCCA 1TH7A 1I8FA 2O01E 1D3BA 4HCZA 4RG8A 3BW1A 2FHDA 1RL2A 4P5NA 3JB9H 3QJ6A 3VUZA 4C92F 1NPRA 1G5VA 1KC8U 2EKOA 2RI3A 1LJOA 3OBYA 2XICA 5GAMf 3MO8A 3JCMf 1UGQB 3PNWC 3ZFJA 1N8RU 4M7DE 4RKUE 2E12A 3A5ZB 5HK3A 3OYJA 4C8QE 3FC3A 3JCMJ 2Y4YA 1VQMA 2CZ7B 2DD5A 3OYGA 3CCJT 4O5VA 1VIEA 5LJ5j 5GANh 2K3YA 1B34A 4C8QF 5A0LA 4OVAA 4F7UE 5IAYA 4JUVA 1VQKT 1N6AA 4M77C 4M75E 4II1A 4E7HA 2QEXT 2DVEA 3EAEA 2XHCA 4KULA 4F7UF 4FT4A 4XU0A 4M77G 4LDWA 4M75F 3QDRB 2K2VA 4RCBA 5CQYA 1M1KU 2RHIA 3NTIA 2RD1A 3OA6A 4M77B 4HT8A 4RMOA 3CCET 1M1FA 5D6WA 4A53A 2OTJA 4C5EA 1G3SA 2RJFA 2M9UA 3PMTA 1X75C 2E10A 2E1HA 2X35A 4TVRA 5GAN8 4ZGJB 1ZBXA 2IG0A 1LOJA 2EJGA 4L6V5 5GAN6 2JZ2A 4HT9A 3L1AA 4C5HA 2RHYA 3F70A 3QYHB 3QHSA 2EFIA 2RJEA 3SWNC 4C5GA 4C0GA 2KY9A 3QBYA 4LDUA 3LGLA 5DLQE 5EG2A 2XKOC 1P92A 5KCHA 2KAFA 2E6NA 3OW2S 2A3LA 4PJOB 3RMSA 4OB2B 3SWNA 1VQNT 3P8HA 2DXBA 3DB4A 3E1SA 1HK9A 3MP8A 4J7IA 5LJ3h 3X20B 5LJ5d 3VJPA 1QVPA 3GF5A 2LQKA 2XIDA 2QQ9A 4FM4B 2RHUA 4A4HA 1IZ6A 5A2QE 1KHIA 4FT2A 3WXMB 4L59A 5GAMe 3JCMe 4R56A 4ELZC 2LTOA 2QA4A 2OAUA 1UGPB 1WNLA 3CD6T 3JSCA 1YI2A 4ZGEB 3MEUA 3DKMA 3ASKA 1NPPA 1G3WA 4M77D 3J81E 3OS1A 3G71A 3CCST 4RG2A 5FRMA 5CKDA 3EFSA 4M78C 1M90U 1OZ2A 4EMKC 3HHTB 3A8MB 3FB9A 3BY7A 2L8DA 4BI8B 3CCVT 3RESA 5GAOq 3UPUA 1YITT 5AYFA 1VQ5T 3UT1A 2GCXA 1VQ8T 4ZTJA 1YIJT 1VUBA 2ZPIB 3OS5A 5FLXE 5GAOm 2VC8A 3CCLT 1PSFA 2DXUA 5LJ5e 1FX7A 4PKCC 2VV5A 2Y90A 4EMKA 1KQ1A 2F69A 1WPYA 4OMFB 4A4EA 5GMKe 4E7IA 2E6ZA 4M78B 3C12A 4QQDA 4EPCA 1Y96B 3FIFA 4B9WA 5KH6A 4JRKA 3TU4K 4QVDA 3CCUT 3OS0A 5GANj 1BI2A 3M53A 4C5IA 3GOXA 4KUDK 1VQ4T 1PSEA 2R58A 4FSXA 2XDPA 3HKSA 5KE3A 2KSSA 2PU9B 5GAOp 4N4IA 3LYIA 3CPWS 3OYHA 3CCJA 3FDRA 3A8HB 3RMQA 1KQSA 4MZTA 3TREA 3S3OA 4JDSA 5CVIA 5LJ5f 3CXCS 1VQKA 1VQ6T 2EAYA 3JCMb 4XU2A 3LH0A 4XTUA 2XU8A 2DPPB 4KBMB 4N0AC 5C6SA 2ZCFB 3DLMA 2QEXA 2OTLT 3V8KA 3MEVA 1YJWT 1H641 4UC4A 1X01A 3KBGA 5GAMg 5HKCA 2Y4XA 4KUIA 4NS5A 5D6XA 2EYQA 3VU3C 3GP8A 2DTIA 5A0DA 1WJSA 3L2QA 1S72T 3CCRT 1I81A 3OQ5A 3JAME 3OYNA 4JRQA 3OMCA 3MP6A 4ME7A 3JCMV 1VQ9T 4D6WA 3CC7A 4BE0A 4M78D 5CQXA 2VXFA 1X6OA 3CEYA 3M54A 5IN1A 3O8VA 3JCMh 5KCOA 5GAMh 4M7AF 3V7CA 1BI0A 2V8JA 3QJYA 4LD6A 5CIUA 2O4XB 1QVFS 4FU6A 3QKJA 4Y91A 4BD3A 4MDXA 5LJ3j 2HQEA 5M9OA 1VIFA 5CR2A 5GANd 2DJZA 2HD0A 4NOYA 3LLRA 4JRIA 4X34A 1OZ3A 4BI3A 1ZQ1A 1U1TA 1W2BS 1H3ZA 1VQNA 3JCMQ 2JN0A 3MP1A 4M7DF 1O9SA 3VV0A 1JBMA 2YHTA 3QYGB 2LX9A 5GAN5 1YHQT 5IT9E 4XTZA 1UEBA 4PL6A 2PUOB 3GIBA 4OGEA 4BI4A 3EFRA 5GAOr 3OB9A 2K3XA 1JRIA 3OYBA 1QVGA 3CD6A 2RI5A 3OSSC 4IURA 3QUIA 1O75A 5D6YA 4ZN1A 3JCMX 3CC4T 1BKBA 2YRVA 5KE2A 3CCSA 4XTYA 2F5TX 5FU6B 1QW1A 2HQXA 2M16A 3CCQT 1VQPT 2E5QA 4ZGDB 4DOWA 1I5LA 4M77A 4J6WA 3CCVA 4VUBA 5GMKl 2BIVA 3JB9G 1DJ7B 1EIFA 1YITA 5CKFA 2RO0A 3QPHA 2DKGA 1VQ8A 1WJRA 1M8VA 1NZ9A 2CKKA 5J3BA 2LQ8A 4DOVA 3RKWA 2RK1A 4E7LA 1Q7YC 3PIPA 4PJOC 3J80E 4B9XA 4CRIA 2DZCA 4CI0C 5LJ3d 2P0PA 1NJIC 4E7JA 2KVQG 3E9GA 4PJOG 2JTMA 4BY6C 3SFMA 2K4YA 2LNVA 2RH2A 4IUPA 4JLIA 3L2RA 1VQ7A 4PJOA 5GAOn 2ZZDA 1VQ4A 1RI0A 4OP0A 4X9CA 3HFNA 2L5QA 2RA2A 2VYTA 4BE1A 3SDZA 1BI3A 3M4GA 4C0ZA 3PMIA 1OYXA 4IUQA 4Q5WA 4C92C 3G4ST 3CMAA 4J8OA 4XTXA 1BYMA 2WSEE 4BY6B 3JCMP 1VQ6A 3PT9A 2JVVA 4C92G 1Q82C 2CGHA 1N9RA 3P8BB 4C0DB 2FB7A 3TCJA 2RJCA 4JS4A 3R6OA 2OTLA 4N4GA 4M7AB 1AHJB 1YJWA 4JLGA 4PNOA 3V7SA 1K9MC 4QW2A 5CO7A 3CPFA 3X24B 1I4K1 1Y71A 3FJPA 4C92B 5GAN3 2EJ9A 1UGRB 2XG8D 1M5Q1 3LW5E 4C8QC 3CCRA 1LNXA 1S72A 3JB9I 2KMTA 3I56T 2BKDN 2DD4A 2KDSA 2LDMA 1JB0E 2XDDA 3JB9D 2AHJB 2K57A 3V7RA 3OY9A 4C8QG 5LJ5g 3CC2A 3META 4M78G 2MWOA 2DIQA 4M75C 4M7DB 4J83A 4M78A 2V8IA 3CMET 3DLLA 1Y96A 2R57A 4F7UG 4BDYA 4C8QB 4BACA 1VQOT 3S3MA 3Q1JA 4M75G 5LJ3f 4EMGA 1YJ9T 2A7YA 2K5IA 4PJOD 1WQWA 3JRZA 5GAN4 3VYHB 1K73C 3RKXA 4HCBA 4F7UB 3L2UA 1G3TA 3PTAA 4M75B 5HY6A 1XNIA 3G7ZA 5DM7R 1SSFA 2CZ1B 4QQ6A 4Y28E 4DA4A 4BE2A 4FL6A 3E9FA 2WSFE 2E41A 2VUBA 3E19A 3ER0A 1KQ2A 1N9SA 3PFSA 1YHQA 2X4YA 2OTJT 5L8RE 4FIBA 3SD4A 3HRUA 3VUBA 4C92D 4XU3A 5DLOA 1Q81C 1OI1A 4HKEA 4OB0B 3OYFA 2MWPA 4J7FA 3G6ET 5GMKi 4IKFA 3JB9J 3CC4A 3M58A 1NE8A 3JCMd 2B8AA 5J39A 2K5FA 2PVGB 4M77E 4C0FA 3LWIA 3FLGA 3CCQA 4QQGA 1VQLT 4HCCA 2L3RA 3HPWA 4N0AA 3L2ZA 3M4YA 4M77F 2PVOB 1Y7XA 4RCCA 3CCEA 3HRTA 4C8QD 4MMKA 3A8LB 3HRSA 3OYAA 3URGA 3C4SA 4XK8E 3CCMT 1N27A 2O4XA 3OS2A 4GLKA 3VYGA 3M9QA 4MMLA 2XDBA 3LX7A 4LDYA 3OW2A 1Q7YU 3CBMA 3M59A 4M75D 3LWHA 4PJOE 1NJIU 3OSVA 1YI2T 2RJDA 1KQSS 4E7KA 1M4ZA 2JOYA 4A4FA 3BDLA 3INZA 5GAN7 1W4SA 3ME9A 3PGGA 3J7AF 2EQJA 1YJNT 1MHNA 2DK3A 4LDXA 3MEAA 2X4WA 3ZEHA 3I55T 1FXXA 3NTKA 2YLCA 2RK2A 2H3JA 4GY5A 3G4SA 4IUTA 4XU1A 5FU6C 1YCYA 2DIGA 3M5AA 5LJ3e 1WGSA 3AHUA 4C92E 5GMKh 2M0OA 4A4GA 3ZBDA 2DXTA 3JCMc 1GXIE 2CYZB 2QQSA 3DB3A 5GAOl 3H6ZA 1Q82U 1K8AC 1D3BB 5GAN2 5GANg 5CCAA 3PIOA 2XI9A 2NLUA 1K9MU 4HA8A 2PUKB 3C94A 5DY9A 1Q86C 2D0QB 3OYLA 4JRPA 3I56A 2MI6A 5I2MA 4DQ2A 4N4HA 2PQWA 1BI1A 2QTXA 5CAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QII A;  1VQ5 A;  3OYC A;  1YIJ A;  3OYD A;  3CCL A;  2RHX A;  3CME A;  3MEW A;  2GFU A;  1VQO A;  1XTD A;  1YJ9 A;  3CPW A;  2LCL A;  3CCU A;  3OYM A;  3CXC A;  1JJ2 S;  3OMG A;  3L2V A;  1K73 U;  1KD1 C;  2RHZ A;  3S3N A;  2GFA A;  3KUF A;  2EQM A;  3CC7 T;  3FEO A;  2X4X A;  1KHC A;  3G6E A;  3OYY A;  1Q81 U;  1KC8 C;  2GF7 A;  4PLL A;  1VQL A;  2M1H A;  1N8R C;  2RI2 A;  2BUD A;  2P0K A;  1QVF A;  1M1G A;  1VQ9 A;  2L89 A;  1VQM T;  3CCM A;  2EQU A;  3NTH A;  1W2B A;  2DAQ A;  2JNG A;  4IUV A;  1YJN A;  1M1K C;  5J26 A;  2G3R A;  3I55 A;  1QVG S;  4ZTF A;  4EDU A;  1WJQ A;  2R5M A;  4QVZ A;  2JUF A;  2EQK A;  3OYI A;  4PLI A;  2DO3 A;  1K8A U;  1VQP A;  3H8Z A;  1VQ7 T;  5C0M A;  1Q86 U;  3L42 A;  2XK0 A;  3UWN A;  5LL6 S;  2EIF A;  2LRQ A;  3LGF A;  3L2W A;  3CMA T;  1JJ2 A;  2JTF A;  2E70 A;  3OYK A;  3P8D A;  2QA4 T;  4YTL A;  2WAC A;  1M90 C;  2QQR A;  3G71 T;  3S6W A;  4ZN3 A;  5FRO A;  1KD1 U;  4BDZ A;  4Z02 A;  2F5K A;  3CC2 T;  2R5A A;  4IUU A;  1YBY A;  3OYE A;  2LVM A;  2D9T A;  2LCC A;  5FRN A;  4HCZ A;  2FHD A;  1RL2 A;  3QJ6 A;  1NPR A;  1G5V A;  1KC8 U;  2EKO A;  2RI3 A;  3MO8 A;  3PNW C;  1N8R U;  3A5Z B;  3OYJ A;  3FC3 A;  1VQM A;  3CCJ T;  3OYG A;  1VQK T;  2K3Y A;  4OVA A;  5IAY A;  4II1 A;  4E7H A;  2QEX T;  3EAE A;  2XHC A;  1M1K U;  2RHI A;  3NTI A;  3OA6 A;  3CCE T;  5D6W A;  2OTJ A;  4C5E A;  2RJF A;  3PMT A;  2X35 A;  4TVR A;  2IG0 A;  2JZ2 A;  4C5H A;  2RHY A;  3F70 A;  2EFI A;  2RJE A;  4C5G A;  3QBY A;  3LGL A;  5DLQ E;  5KCH A;  2E6N A;  3OW2 S;  1VQN T;  3P8H A;  3DB4 A;  3MP8 A;  1KQS A;  2RHU A;  4A4H A;  1IZ6 A;  5A2Q E;  1KHI A;  4L59 A;  2LTO A;  2QA4 A;  3CD6 T;  1YI2 A;  3MEU A;  3ASK A;  1NPP A;  3J81 E;  3OS1 A;  3CCS T;  5FRM A;  3G71 A;  4RG2 A;  1M90 U;  1OZ2 A;  3CCV T;  2L8D A;  1YIT T;  1VQ5 T;  3UT1 A;  1VQ8 T;  4ZTJ A;  1YIJ T;  5FLX E;  3CCL T;  4A4E A;  4E7I A;  2E6Z A;  4QQD A;  4B9W A;  5KH6 A;  3CCU T;  3OS0 A;  4C5I A;  3GOX A;  1VQ4 T;  2R58 A;  3HKS A;  2XDP A;  5KE3 A;  3CPW S;  4N4I A;  3LYI A;  3CCJ A;  3OYH A;  3FDR A;  3TRE A;  3S3O A;  3CXC S;  1VQK A;  1VQ6 T;  3LH0 A;  5C6S A;  2QEX A;  3DLM A;  2OTL T;  3MEV A;  1YJW T;  4UC4 A;  3KBG A;  4NS5 A;  5D6X A;  1WJS A;  3L2Q A;  1S72 T;  3CCR T;  3OQ5 A;  3JAM E;  3OYN A;  3OMC A;  3MP6 A;  1VQ9 T;  3CC7 A;  4BE0 A;  1X6O A;  3CEY A;  5IN1 A;  3O8V A;  5KCO A;  1QVF S;  4LD6 A;  5CIU A;  2O4X B;  4FU6 A;  3QKJ A;  4BD3 A;  2HQE A;  5M9O A;  3LLR A;  4X34 A;  1OZ3 A;  1W2B S;  1H3Z A;  1VQN A;  3MP1 A;  1YHQ T;  5IT9 E;  1UEB A;  4PL6 A;  3OB9 A;  2K3X A;  3CD6 A;  1QVG A;  3OYB A;  3CC4 T;  2RI5 A;  4IUR A;  4ZN1 A;  5D6Y A;  1BKB A;  2YRV A;  3CCS A;  5KE2 A;  3CCQ T;  2HQX A;  2M16 A;  1VQP T;  2E5Q A;  3CCV A;  1YIT A;  2BIV A;  1EIF A;  2RO0 A;  1VQ8 A;  1WJR A;  1NZ9 A;  2CKK A;  5J3B A;  2LQ8 A;  1Q7Y C;  4E7L A;  3PIP A;  3J80 E;  4B9X A;  4CRI A;  1NJI C;  4E7J A;  2KVQ G;  3E9G A;  4IUP A;  1VQ7 A;  3L2R A;  1VQ4 A;  1RI0 A;  2VYT A;  4BE1 A;  3CMA A;  3PMI A;  1OYX A;  3G4S T;  4IUQ A;  4Q5W A;  1VQ6 A;  2JVV A;  1Q82 C;  3P8B B;  2RJC A;  2OTL A;  4N4G A;  1YJW A;  1K9M C;  4QW2 A;  3CPF A;  1S72 A;  3CCR A;  3I56 T;  2BKD N;  2KDS A;  2LDM A;  3OY9 A;  3CC2 A;  3MET A;  2MWO A;  2DIQ A;  3DLL A;  3CME T;  2R57 A;  4BDY A;  1VQO T;  4BAC A;  3S3M A;  3Q1J A;  1YJ9 T;  1K73 C;  3L2U A;  5HY6 A;  1XNI A;  5DM7 R;  1SSF A;  4QQ6 A;  4BE2 A;  4FL6 A;  3E9F A;  3ER0 A;  3PFS A;  1YHQ A;  2X4Y A;  2OTJ T;  3SD4 A;  1Q81 C;  1OI1 A;  3OYF A;  2MWP A;  3G6E T;  4IKF A;  3CC4 A;  2B8A A;  5J39 A;  3CCQ A;  1VQL T;  3FLG A;  4QQG A;  2L3R A;  3CCE A;  3OYA A;  3C4S A;  3CCM T;  1N27 A;  2O4X A;  3OS2 A;  3M9Q A;  3LX7 A;  3OW2 A;  1Q7Y U;  1NJI U;  1YI2 T;  2RJD A;  1KQS S;  4E7K A;  3J7A F;  2JOY A;  4A4F A;  3BDL A;  3ME9 A;  1YJN T;  2EQJ A;  1MHN A;  3MEA A;  2X4W A;  3ZEH A;  3I55 T;  3NTK A;  3G4S A;  4GY5 A;  4IUT A;  2DIG A;  1WGS A;  2M0O A;  4A4G A;  3DB3 A;  1Q82 U;  2QQS A;  3H6Z A;  1K8A C;  3PIO A;  1K9M U;  2NLU A;  1Q86 C;  3OYL A;  3I56 A;  2MI6 A;  4N4H A;  2PQW A; 
#chains in the Genus database with same CATH topology
 1KK7 A;  3QII A;  1Q95 G;  4M78 E;  1MMA A;  3MEW A;  2P0Q A;  1B7T A;  1G3Y A;  1QP3 A;  4WTO B;  2HBP A;  1Y07 A;  1B34 B;  2ZPB B;  5HK0 A;  1KQS P;  1WI7 A;  3OYM A;  1JJ2 S;  2KGT A;  3EGX A;  1KD1 C;  4OF1 A;  2D0N A;  4BB7 A;  4C0D C;  4M7A C;  2IVW A;  2DTH A;  5ECA A;  2E3H A;  2EQM A;  3PE0 A;  3FEO A;  3M56 A;  3SB2 A;  1KHC A;  3M0U A;  4C92 A;  1GRI A;  3CBO A;  1VQL A;  3HSB A;  2DL7 A;  2DZ9 A;  1N8R C;  4LE9 A;  2BUD A;  3GNG A;  2P0K A;  1M90 R;  4J6X A;  2DTO A;  4KT0 E;  3RER A;  2LT4 A;  4M7D A;  3CCM A;  4C8Q A;  2QDY B;  1AWJ A;  1V29 B;  2PVD B;  1SHG A;  2JNG A;  4PJN A;  4M75 A;  5CK9 A;  5CKH A;  5GMK j;  5LJ5 h;  3E2U A;  5GJV B;  4ZNX A;  3CCS Q;  2CZ6 B;  1H3H A;  1QVG S;  3JCM W;  4EDU A;  1MMG A;  4J6Y A;  3X25 B;  2FYK A;  1D0Y A;  2F2X A;  4MZM A;  1PC0 A;  5GAN e;  1PRM C;  2FZK B;  2XMF A;  2I2L A;  4X1V A;  3CBP A;  3H8Z A;  3A8G B;  4XTV A;  4MZP A;  4M7D D;  1WXB A;  2XK0 A;  3UWN A;  5LL6 S;  1W6X A;  1IRX A;  3LGF A;  1JJ2 A;  1XQH A;  2FRW A;  3MCA B;  4IIM A;  3NFC A;  1HXD A;  1M3A A;  2HAX A;  2LZ6 B;  1ZUK A;  1LVK A;  2HNI A;  2O9V A;  3JCM g;  1RAC B;  1AWO A;  1M90 C;  5KYX B;  5KYW B;  1GCQ A;  4E47 A;  3JV3 A;  4Z02 A;  4LNP A;  4CC7 A;  2RF0 A;  2R5A A;  4A4K A;  1YBY A;  4XAX B;  2EQI A;  2O01 E;  1D3B A;  4RG8 A;  4P5N A;  2ED0 A;  2NWM A;  1UGQ B;  2LMJ A;  4M7D E;  1JO8 A;  2J6K A;  4C8Q E;  3OYJ A;  6AT1 B;  2Y4Y A;  2DD5 A;  5LJ5 j;  4AFS C;  1UE9 A;  1B34 A;  5GAN h;  1VQK T;  5IAY A;  2DL8 A;  1N6A A;  4M75 E;  2QEX T;  1VQK Q;  1IGU A;  1PRL C;  1FMW A;  4LDW A;  2QEX Q;  5CQY A;  1BCM A;  2RHI A;  4M77 B;  2FEI A;  1H8K A;  4C5E A;  2RJF A;  2FG0 A;  1QVF P;  2IG0 A;  1LOJ A;  4L6V 5;  2JZ2 A;  1D0Z A;  3F70 A;  1QQJ A;  2RJE A;  2PTK A;  1ABO A;  2XKO C;  5KCH A;  2KAF A;  2A3L A;  1TXQ A;  1VQN T;  3X20 B;  3DB4 A;  5LJ3 h;  4J7I A;  5LJ5 d;  1KQS A;  2LQK A;  3UA7 A;  1G8X A;  2RHU A;  1VQN Q;  4AFZ C;  1ZSZ C;  4L59 A;  5GAM e;  2LTO A;  1UGP B;  1M3B A;  3ASK A;  1ZUY A;  3J81 E;  1WYX A;  5FRM A;  2EBP A;  3HHT B;  3A8M B;  3RES A;  4F14 A;  4WCI A;  3UT1 A;  4ZTJ A;  5FLX E;  1SRL A;  2VC8 A;  3CCL T;  3VRZ A;  2Y90 A;  4FYX B;  2F69 A;  1WPY A;  4E7I A;  3CCL Q;  4QQD A;  3FIF A;  2LQW A;  4JRK A;  3TU4 K;  4QVD A;  5GAN j;  3GOX A;  2BTT A;  1VQ4 T;  1ARK A;  4FSX A;  5GAO p;  1VQ4 Q;  3A8H B;  1T0J A;  4JDS A;  3CXC S;  1VQK A;  5FWC A;  1TOV A;  2AT1 B;  2ABL A;  3JCM b;  4XU2 A;  1Q7Y R;  1HYO A;  2ZCF B;  3DLM A;  2QEX A;  1NJI R;  3MEV A;  1X01 A;  2K6D A;  5GAM g;  5HKC A;  5KYX A;  2EYQ A;  3VU3 C;  5KYW A;  2DTI A;  3OMC A;  3JCM V;  1VQ9 T;  1IO6 A;  4D6W A;  4BE0 A;  3CEY A;  1VQ9 Q;  2J7I A;  1AT1 B;  5IN1 A;  5GAM h;  1AD5 A;  2RQU A;  4RTX A;  4M7A F;  3QJY A;  1QVF S;  3MKD A;  1Q82 R;  5LJ3 j;  2HQE A;  5M9O A;  5GAN d;  1K9M R;  4BI3 A;  1HJD A;  1VQN A;  1TUG B;  1V76 A;  1U5S A;  5GAO r;  1RAF B;  2K3X A;  1NG2 A;  4IUR A;  4ZN1 A;  2DNU A;  1QW1 A;  4KGX B;  5FU6 B;  2E5Q A;  1WHJ A;  1PHT A;  4E6R A;  4M77 A;  3AT1 B;  2V1R A;  1AWW A;  1EIF A;  5FW9 A;  2RO0 A;  3QPH A;  2DKG A;  1NZ9 A;  2CKK A;  3QDF A;  3RKW A;  1Q7Y C;  4B9X A;  4CRI A;  5LJ3 d;  1WZO A;  2E3I A;  2P0P A;  4E7J A;  1NJI C;  4LUD A;  2KVQ G;  4EIK A;  3SFM A;  2K4Y A;  2LNV A;  1UHF A;  1VQ4 A;  1RI0 A;  1W2B P;  4X9C A;  2NUT B;  4BE1 A;  2H8H A;  3CMA A;  3JCM P;  4BY6 B;  3PT9 A;  1AZG B;  1K0S A;  4C92 G;  1Q82 C;  4C0D B;  3TCJ A;  4JS4 A;  4M7A B;  1K9M C;  4QW2 A;  2EJ9 A;  4RUG A;  3VS3 A;  2X3W D;  1SG5 A;  3JB9 I;  1WX6 A;  1Z9Q A;  2LDM A;  1JB0 E;  2XDD A;  3OY9 A;  4C8Q G;  3MET A;  2MWO A;  2DIQ A;  2NYS A;  3R6N A;  2GTJ A;  3D7S B;  4JZ3 A;  1VQM Q;  2OX7 A;  4BDY A;  4BAC A;  1VQO T;  3S3M A;  4M75 G;  2A7Y A;  2K5I A;  1CKB A;  3VYH B;  1K8A R;  1VQO Q;  1PM3 A;  4HCB A;  1ABQ A;  2G6F X;  3G7Z A;  2WSF E;  2E41 A;  1RLP C;  2OTJ T;  5L8R E;  3SD4 A;  2C0O A;  2OTJ Q;  1IXD A;  3M58 A;  1M2V B;  1NE8 A;  3LWI A;  2CP6 A;  4M77 E;  4HCC A;  2HL5 C;  1D1B A;  3TSZ A;  3HPW A;  2COW A;  1TUD A;  1E6H A;  4RCC A;  2P84 A;  3HRT A;  3CCE A;  4KH1 B;  2L2P A;  3C4S A;  1N27 A;  1BB9 A;  4GLK A;  1QMC A;  2XDB A;  2LJ0 A;  4LDY A;  5IXF A;  3BDL A;  3ME9 A;  4OMO A;  4CC3 A;  4LDX A;  3H0F A;  3MEA A;  3I55 T;  3NTK A;  2YLC A;  2QG9 B;  2YRD A;  2ROL A;  4XU1 A;  2DIG A;  1MV3 A;  4RTZ A;  3I55 Q;  4PJJ A;  1UJ0 A;  3NGP A;  1GXI E;  1K8A C;  3A98 A;  1W1F A;  1CKA A;  2NLU A;  1I07 A;  3C94 A;  5DY9 A;  4CC2 A;  2MI6 A;  5I2M A;  2QTX A;  3X28 B;  3OYC A;  1YIJ A;  1FMV A;  2EJF A;  4OGC A;  4L5G A;  1VQO A;  1XTD A;  1NM7 A;  3QG1 A;  2X3X D;  2QI2 A;  2FO0 A;  1RAG B;  2ED1 A;  5GAN f;  3OMG A;  2NUT A;  1K73 U;  2YUN A;  2ZAE A;  4V2S A;  1X2K A;  3OBW A;  4ELY C;  2GQV A;  1WHG A;  2WSC E;  3QZ9 B;  3CC7 T;  3TEE A;  1UGS B;  2M02 A;  2VVK A;  3RUX A;  2DA9 A;  4M7A A;  5CKE A;  2C06 A;  3CC7 Q;  4GBQ A;  3OYY A;  1Q81 U;  3T9N A;  1WIE A;  1UEC A;  2RI2 A;  4BUG A;  1X69 A;  4JS5 A;  1M1G A;  4OMP A;  2DIL A;  1ZUU A;  4B6M A;  2L3S A;  3BDU A;  4WF2 A;  3VKI A;  2RQV A;  2LC4 A;  3NTH A;  4M4Z A;  4KGV B;  1W2B A;  2ATC B;  2MF2 A;  2DAQ A;  5FU7 B;  3VS2 A;  2COY A;  3I55 A;  1ZSZ B;  4ZTF A;  4M7A D;  1WJQ A;  2R5M A;  1M2V A;  5L23 A;  1TG0 A;  1SHF A;  2HZY A;  2ZGW A;  2DXC A;  2K5L A;  1VQP A;  1KIK A;  3QWY A;  1Q86 U;  2VXE A;  3M0T A;  2EIF A;  3L2W A;  3M0S A;  3KXT A;  1RI9 A;  2VB6 A;  7AT1 B;  1H92 A;  3JB9 F;  2CS7 A;  2E70 A;  2D6F A;  2H3E B;  1BK2 A;  2QA4 T;  2RB6 A;  2WAC A;  1UUE A;  1BIA A;  2QXF A;  1NYF A;  2QA4 Q;  2HEQ A;  3G71 T;  1R8O B;  5FRO A;  3A1P A;  3HL8 A;  1M3C A;  1QVG P;  3G71 Q;  1M2O A;  5FWB A;  4M7A E;  3EG3 A;  3CC2 T;  2LVM A;  3WVE B;  1UB4 A;  1I8F A;  3JB9 H;  2KNB B;  3CC2 Q;  1RL2 A;  2RPN A;  1JQQ A;  4DBF A;  1S1N A;  1KC8 U;  2EKO A;  2RI3 A;  1LJO A;  2XIC A;  5GAM f;  2EYW A;  3ZFJ A;  2DYB A;  2KT8 A;  5HK3 A;  2FZC B;  3FC3 A;  1YWP A;  3JCM J;  2JTE A;  2KRO A;  4JUV A;  1PKS A;  4DEX A;  4F7U F;  2KR3 A;  1LPL A;  4M77 G;  2K2V A;  1OX9 A;  4RCB A;  1WFW A;  2CUD A;  3NTI A;  4PFZ A;  1M1K U;  4RMO A;  4A53 A;  2E10 A;  4TVR A;  1UGV A;  4C5H A;  1GBR A;  2RHY A;  3QHS A;  2EFI A;  3EG0 A;  1OV3 A;  3QBY A;  3GBQ A;  5EG2 A;  3M0P A;  1P92 A;  2VWF A;  1UTI A;  2CP7 A;  4AMC A;  1YWO A;  1OU9 A;  2LCS A;  3MP8 A;  3MPU B;  1M8V A;  2D1X A;  3EHR A;  2M0Y A;  2QQ9 A;  3JCM e;  4R56 A;  2QA4 A;  2OAU A;  1WNL A;  3PVL A;  8ATC B;  4ZGE B;  3DKM A;  1G3W A;  2A28 A;  3OS1 A;  3CCS T;  3G71 A;  5CKD A;  1ZSZ A;  4M78 C;  2CP0 A;  4EMK C;  2QK0 A;  3FB9 A;  3CCV T;  4BI8 B;  3UPU A;  5GAO q;  1VOM A;  5AYF A;  1VQ5 T;  2GCX A;  4FW2 A;  3TVT A;  1VQ8 T;  1QCF A;  1VUB A;  3OS5 A;  3CCV Q;  1PSF A;  5LJ5 e;  1VQ5 Q;  1KQ1 A;  1VQ8 Q;  2E6Z A;  4B9W A;  2O2O A;  4RTT A;  1MMD A;  3REB B;  3CCU T;  4F17 A;  3M53 A;  4KUD K;  3VS7 A;  1Q86 R;  1CSK A;  1ZA1 B;  3CCU Q;  2LJ3 A;  3FJ5 A;  3CPW S;  4N4I A;  3LYI A;  2DL5 A;  3FDR A;  3S3O A;  2EAY A;  4D8K A;  2JM8 A;  2DPP B;  2OTL T;  3KBG A;  1MMN A;  4NS5 A;  1WLP B;  2OTL Q;  1OU8 A;  2B86 A;  2EYZ A;  4ME7 A;  1K76 A;  1TS9 A;  4FYW B;  1X6O A;  2GBQ A;  4PJM A;  1NLP C;  3JCM h;  2DRM A;  2ESW A;  1BI0 A;  4FU6 A;  2DX1 A;  1KC8 R;  2AKK A;  4QKU A;  3LLR A;  2SRC A;  2EYY A;  4X34 A;  2JMC A;  3EH1 A;  2K3B A;  3NHN A;  3CXC P;  3VV0 A;  4J9D A;  4XTZ A;  4PL6 A;  4BI4 A;  3EFR A;  2FPF A;  1YN8 A;  1QVG A;  5KYY B;  1BKB A;  2YRV A;  3CCS A;  2F5T X;  2M16 A;  4E7Z A;  4J6W A;  3CCV A;  1M1K R;  2SEM A;  5GMK l;  1VQ8 A;  1WHH A;  2LQ8 A;  1OEB A;  3VS5 A;  2KRS A;  3EG9 B;  4PJO G;  2RN8 A;  2DM1 A;  1OOT A;  1UDL A;  3HFN A;  1BI3 A;  4C0Z A;  4C92 C;  3PMI A;  1OYX A;  4IUQ A;  3HTR A;  2WSE E;  2O88 A;  2JVV A;  2OTL A;  3V7S A;  4HVW A;  1UGR B;  4C8Q C;  1LNX A;  2ECZ A;  3I56 T;  3JB9 D;  3I56 Q;  4M78 G;  2F1L A;  1PNJ A;  4M75 C;  4J83 A;  2V8I A;  3CME T;  4EMG A;  1YJ9 T;  3CME Q;  3JRZ A;  1YJ9 Q;  1JU5 C;  3PTA A;  1SSF A;  4DA4 A;  4BE2 A;  3E9F A;  1KQ2 A;  1C1A A;  2F2V A;  3VUB A;  4XU3 A;  5DLO A;  1OI1 A;  4OB0 B;  3G6E T;  5GMK i;  3JB9 J;  3JCM d;  2B8A A;  2DER A;  2K5F A;  3G6E Q;  1SKU B;  4LXC A;  2QDL A;  2L3R A;  4N0A A;  3L2Z A;  3M4Y A;  1X2Q A;  2RQR A;  2YSQ A;  3H0H A;  3THK A;  4MMK A;  3G1J A;  1KFZ A;  3OYA A;  3URG A;  3OS2 A;  3LX7 A;  2MCN A;  3LWH A;  1GCQ C;  4HCK A;  2CP2 A;  1YI2 T;  4E7K A;  2JOY A;  5GAN 7;  1R0C B;  2HDA A;  1YI2 Q;  2DL4 A;  4ESR A;  4GY5 A;  1YCY A;  5KYY A;  1SRM A;  2M0O A;  3ZBD A;  2CYZ B;  2QQS A;  3KFV A;  2QTV A;  2D0Q B;  3I56 A;  4LN2 A;  5CAI A;  4E7S A;  3I35 A;  3OYD A;  2I0N A;  3CCL A;  2MAM A;  2GNC A;  2KK4 A;  3CME A;  2HL3 A;  1HD3 A;  2GFU A;  4M78 F;  2DBM A;  3EG9 A;  3CCJ Q;  1YJ9 A;  2VGM A;  2LCL A;  2D8H A;  1KG1 A;  4PFP A;  3CXC A;  2CZ0 B;  3L2V A;  1EFN A;  4OB3 B;  2DE0 X;  2RHZ A;  3S3N A;  2LNH B;  1JXM A;  2GFA A;  2DF6 A;  3GLX A;  4LDV A;  5A0G A;  2F2W A;  2X4X A;  3X26 B;  3G6E A;  1A0N B;  5I2S A;  4XTW A;  2J05 A;  1UG1 A;  4R55 A;  4O6J A;  2E64 A;  5GJW B;  4F16 A;  4AG1 C;  2OI3 A;  3BE3 A;  1MND A;  3ZL7 C;  4AFU C;  2VGN A;  5GAM j;  2NUP B;  4JJN K;  2K79 A;  1QVF A;  3MHX A;  4M7D G;  2ZPG B;  1VQ9 A;  2L89 A;  2EGC A;  1VQM T;  2QQB A;  1IRE B;  2W10 A;  1B07 A;  2EQU A;  5AT1 B;  3WVD B;  1IHW A;  3HP9 A;  3H9N A;  3HFO A;  2RM4 A;  2OAW A;  1OPK A;  2A08 A;  4JPB W;  1AEY A;  4MDW A;  1PD0 A;  2G3R A;  5HCK A;  3RKY A;  3QXE B;  4NL3 A;  8AT1 B;  2DEQ A;  1C0M A;  1D0X A;  4QVZ A;  2JUF A;  2EQK A;  4XQ3 A;  4PLI A;  1I0C A;  1RLQ C;  1AZE A;  4EMK B;  2CT3 A;  1OQK A;  4OB1 B;  5GAM d;  3EH2 A;  5GMK m;  4A63 B;  3GNF B;  2QQA A;  4EMH A;  2DYI A;  5C0M A;  2CSQ A;  1VQ7 T;  2LT1 A;  4J5Y A;  1ZLM A;  1VQ7 Q;  1U8R A;  2JTF A;  3M0R A;  3M57 A;  3OYK A;  2HKN A;  2O31 A;  3UDC A;  3U23 A;  3QWX X;  2QQR A;  3S6W A;  4ZN3 A;  5IXB A;  1KD1 U;  2P4T A;  4A54 A;  3OYE A;  2DEU A;  4LD9 K;  1YFN A;  2LCC A;  5FRN A;  2EYX A;  4HCZ A;  2ROT A;  1SPK A;  3EG1 A;  4JZ4 A;  4FSS A;  4C92 F;  1G5V A;  1AWX A;  3OBY A;  2DMO A;  3MO8 A;  3JCM f;  4KRT A;  3PNW C;  1N8R U;  4RKU E;  1QCO A;  1WXU A;  1JEG A;  1VQM A;  4O5V A;  1VIE A;  1WHK A;  2K3Y A;  4C8Q F;  4OVA A;  3ULR B;  1X27 A;  4ORZ A;  4M77 C;  4II1 A;  4E7H A;  2PNI A;  4FT4 A;  4XU0 A;  4M75 F;  2OJ2 A;  2RD1 A;  3OA6 A;  1PD1 A;  2X51 A;  4HT8 A;  1M1F A;  5D6W A;  3UAT A;  2OTJ A;  1G3S A;  3PMT A;  1B3Q A;  1T0H A;  2X35 A;  1WA7 A;  1ZBX A;  2EJG A;  1W70 A;  5GAN 6;  4J9F A;  2NUP A;  3SWN C;  4C5G A;  2MPX C;  4C0G A;  3LGL A;  2AZS A;  2CP3 A;  4D8D A;  3OW2 S;  1D1A A;  3P8H A;  2DXB A;  3UF4 A;  2BZX A;  3VJP A;  2XID A;  4FM4 B;  4A4H A;  1IZ6 A;  4FT2 A;  1G83 A;  2AZV A;  2DET A;  4ELZ C;  2EPD A;  2J6F A;  3JSC A;  3H0I A;  1NPP A;  1ZSG A;  1M90 U;  2LQN A;  1PG5 B;  3BY7 A;  2L8D A;  5KYN A;  1YIT T;  2ZPI B;  1Y57 A;  4RTV A;  2DXU A;  1FX7 A;  1YIT Q;  4EMK A;  4F04 B;  1M8M A;  4OMF B;  4A4E A;  5GMK e;  4JJB A;  2MYS A;  4ANJ A;  1Y96 B;  4LUE A;  3I5S A;  3OS0 A;  1BI2 A;  1PSE A;  2R58 A;  1F1B B;  2XDP A;  3HKS A;  5KE3 A;  1VYT A;  2KT1 A;  3RMQ A;  1BU1 A;  4MZT A;  3TRE A;  1QWF A;  2L0A A;  1R77 A;  1EX4 A;  1VYV A;  2K2M A;  2M51 A;  3LH0 A;  2XU8 A;  5C6S A;  3V8K A;  4JJD A;  1MV0 B;  4KUI A;  2K7A A;  2COZ A;  2PZ1 A;  5A0D A;  3L2Q A;  3CCR T;  1I81 A;  3OQ5 A;  3JAM E;  3OYN A;  1VQL Q;  2DRK A;  3CCR Q;  3CC7 A;  4M78 D;  5CQX A;  1TU0 B;  3M54 A;  5CIU A;  4LD6 A;  1RAI B;  4Y91 A;  3QKJ A;  2HMA A;  4BD3 A;  4J9G A;  1AOJ A;  2DJZ A;  4JRI A;  4QT7 A;  1KSW A;  1ZQ1 A;  1H3Z A;  3CPW P;  5IHK A;  2CUB A;  2HSE B;  1O9S A;  1WDX A;  2YHT A;  3QYG B;  2LX9 A;  5GAN 5;  2HKQ B;  3VS6 A;  1J3T A;  4OMN A;  3GIB A;  4OGE A;  3OB9 A;  3OYB A;  2RI5 A;  5D6Y A;  3JCM X;  1O75 A;  4AFQ C;  4OMM A;  3H41 A;  2RQW A;  1K73 R;  1T3S A;  5I22 A;  4ZGD B;  2DLP A;  2AKL A;  1YIT A;  1DJ7 B;  2CSI A;  5CKF A;  4DOV A;  4DEY A;  3RR6 A;  1E6G A;  4PJO C;  3J80 E;  2JW4 A;  2DZC A;  2RQT A;  4Z89 A;  1Q81 R;  2ENM A;  3E9G A;  2JTM A;  4BY6 C;  4AG2 C;  2RH2 A;  5GAO n;  2ZZD A;  1TUC A;  1FMK A;  2RA2 A;  3SDZ A;  3M4G A;  4Q5W A;  2EGA A;  1G2B A;  1BYM A;  2YT6 A;  4DBR A;  1GBQ A;  1N9R A;  1OPL A;  2FB7 A;  1WXT A;  2CH4 A;  2RJC A;  3R6O A;  4N4G A;  2A0F B;  3EGD B;  3CPF A;  5KYU B;  1M30 A;  3FJP A;  2C0T A;  3TQ7 P;  5GAN 3;  2XG8 D;  3CCR A;  2KMT A;  2KXC A;  2BKD N;  2DD4 A;  2AHJ B;  1IB8 A;  1BCO A;  2JM9 A;  5LJ5 g;  3CC2 A;  3EFO B;  2JJ9 A;  4HXJ A;  3DLL A;  2QGF B;  1Y96 A;  1K73 C;  1Y0M A;  4Z8A A;  4F7U B;  5HY6 A;  1RAA B;  4Y28 E;  2BZ8 A;  2JMA A;  2GTO A;  4FL6 A;  2VUB A;  3PFS A;  4FIB A;  3HRU A;  4C92 D;  1Q81 C;  2MWP A;  2MIO A;  1RAB B;  4FW1 A;  2BZY A;  1I5O B;  3FLG A;  4QQG A;  2GQI A;  2HBW A;  1K4U S;  2O9S A;  1UJY A;  4M77 F;  1SSH A;  2PVO B;  1Y7X A;  1M27 C;  1KJW A;  1UFF A;  4C8Q D;  4RTY A;  4XK8 E;  2EVR A;  3VYG A;  1IHV A;  4MML A;  5IHN A;  1Q7Y U;  2L3Q A;  3CBM A;  1K9A A;  4M75 D;  1NJI U;  2RJD A;  1KQS S;  1M4Z A;  4A4F A;  3J7A F;  3INZ A;  1W4S A;  3PGG A;  2DJQ A;  2EQJ A;  1YJN T;  4DBQ A;  2DVJ A;  2KYB A;  3ZEH A;  2X4W A;  1YJN Q;  2RK2 A;  2H3J A;  4FCY A;  4IUT A;  1MNE A;  3M5A A;  3REA B;  5LJ3 e;  1WGS A;  3AHU A;  4C92 E;  2FRY A;  1WHM A;  2DXT A;  3JCM c;  3DB3 A;  5GAO l;  3SHW A;  1Q82 U;  3H6Z A;  5GAN 2;  5GAN g;  3PIO A;  1K9M U;  1Q86 C;  4JRP A;  3TSW A;  4DQ2 A;  4N4H A;  4J9C A;  3I9Q A;  2X9H A;  4ATO A;  5CKB A;  1VQ5 A;  4KH0 B;  4X9D A;  1LCK A;  3A8O B;  2RHX A;  3V8J A;  5IH2 A;  1MUZ A;  3GPL A;  2KQW A;  2EGE A;  3BFM A;  3CPW A;  2D8J A;  2ZPE B;  2ZPH B;  2IPO B;  2HQH A;  3CCU A;  2YRC A;  1NEG A;  4JJC A;  2E65 A;  1YNZ A;  3RBB B;  2XD0 A;  2FZG B;  3KUF A;  4M7A G;  1XOV A;  1D09 B;  2GGR A;  2BE7 D;  5LJ3 g;  2YLB A;  3EGD A;  5KYU A;  1QP2 A;  1KC8 C;  2GF7 A;  2V8K A;  4PLL A;  2J6O A;  4M7D C;  1OX8 A;  2JXB A;  2M1H A;  1M9S A;  3QSU A;  2CH4 W;  1K1Z A;  4J9H A;  3EFO A;  5FU7 C;  1U1S A;  3SWN B;  1MGQ A;  1ZHI A;  2KXD A;  4J9B A;  4F7U A;  1AVZ C;  2EWN A;  2CDT A;  3QO3 A;  4IUV A;  2FL7 A;  5I21 A;  1YJN A;  1M1K C;  5J26 A;  1WQ7 A;  2KEA A;  2ZPF B;  1I1J A;  4IIO A;  5I11 A;  1YCS B;  2FPE A;  2YWW A;  4NL2 A;  1FWZ A;  2FVU A;  3FRN A;  4KGZ B;  3OYI A;  1N5Z A;  3QZ5 B;  1NLO C;  1V1C A;  1BIB A;  2YUP A;  2DO3 A;  1K8A U;  3V8L A;  3EG2 A;  4PJL A;  1GL5 A;  3NMZ C;  3L42 A;  2LRQ A;  3RIR A;  3CMA T;  4QVC A;  2MMP A;  2NUZ A;  5IHI A;  3CMA Q;  3N5B B;  3RNJ A;  3M55 A;  3P8D A;  2X4J A;  1TWB A;  4YTL A;  4PJO F;  4BDZ A;  3C95 A;  2RMO A;  2LX7 A;  2F5K A;  4IUU A;  1ZX6 A;  2D9T A;  1TH7 A;  3BW1 A;  2FHD A;  2EW3 A;  3QJ6 A;  3VUZ A;  5EC7 A;  3VS1 A;  9ATC B;  2CRE A;  3MJX A;  1NPR A;  3EGU A;  1TSF A;  2E12 A;  4K11 A;  3A5Z B;  1X43 A;  2CZ7 B;  3OYG A;  3CCJ T;  5A0L A;  3M0Q A;  4F7U E;  2IIM A;  1VA7 A;  2YDL A;  1ACM B;  2A36 A;  1ZA2 B;  2DVE A;  3EAE A;  2XHC A;  4KUL A;  4RTW A;  2JT4 A;  3QDR B;  2CT4 A;  4GLM A;  1GFC A;  3CCE T;  2K9G A;  2M9U A;  1X75 C;  2E1H A;  1Z9Z A;  5GAN 8;  1IGQ A;  3VS0 A;  3CCE Q;  4ZGJ B;  2VAS A;  4HT9 A;  3L1A A;  3EHQ A;  1RAH B;  3QYH B;  2DFU A;  2E4H A;  2KY9 A;  4LDU A;  5DLQ E;  2LJ1 A;  2Z0W A;  4PJO B;  2E6N A;  1SEM A;  3RMS A;  4OB2 B;  3SWN A;  3E1S A;  1HK9 A;  1QVP A;  3GF5 A;  4J9E A;  2KBT A;  2VKN A;  4PK4 A;  4AT1 B;  1EZZ B;  5A2Q E;  1KHI A;  3WXM B;  3CD6 T;  1YI2 A;  3MEU A;  1PCX A;  3NPF A;  4M77 D;  4RG2 A;  3CD6 Q;  3EFS A;  1OZ2 A;  1QCN A;  2KRN A;  1FYN A;  2DL3 A;  2KE9 A;  1YIJ T;  5GAO m;  4PKC C;  2VV5 A;  1YIJ Q;  4CC4 B;  4M78 B;  1GFD A;  3C12 A;  1RAE B;  4EPC A;  5KH6 A;  2KRM A;  4C5I A;  3UA6 A;  2JS0 A;  1NEB A;  3OW2 P;  2KSS A;  2L3P A;  2PU9 B;  3OYH A;  3CCJ A;  1JXO A;  3VS4 A;  5CVI A;  5LJ5 f;  2BE9 B;  1VQ6 T;  2EKH A;  4XTU A;  2KI7 A;  4KBM B;  4N0A C;  2C0I A;  1VQ6 Q;  1YJW T;  1H64 1;  4UC4 A;  2Y4X A;  5D6X A;  3GP8 A;  1WJS A;  1YJW Q;  1S72 T;  1VYU A;  4JRQ A;  1D1C A;  1RAD B;  3MP6 A;  4R0K A;  1S72 Q;  4PFO A;  2VXF A;  1YP5 A;  3O8V A;  5KCO A;  2KYM A;  2V8J A;  1QWE A;  3V7C A;  2O4X B;  2FPD A;  4MDX A;  2QAZ A;  4FYY B;  5CR2 A;  1VIF A;  1OUL A;  2YXY A;  4NOY A;  2HD0 A;  2YUO A;  2LP5 A;  1OZ3 A;  2V26 A;  1U1T A;  1W2B S;  3JCM Q;  2JN0 A;  3SEM A;  3MP1 A;  2AIR B;  4M7D F;  3PVQ A;  1JBM A;  1YHQ T;  2AK5 A;  1PWT A;  3RDV A;  5IT9 E;  1UEB A;  2PUO B;  2V1Q A;  3LH5 A;  1JRI A;  1YHQ Q;  2YUQ A;  3CD6 A;  3CC4 T;  3OSS C;  4E2F B;  3QUI A;  5KE2 A;  2JS2 A;  4XTY A;  2HQX A;  3CCQ T;  1VQP T;  3CC4 Q;  4DOW A;  1I5L A;  4VUB A;  2BIV A;  3CCQ Q;  3JB9 G;  2J06 A;  1VQP Q;  1WJR A;  5J3B A;  2RK1 A;  4E7L A;  3PIP A;  4CI0 C;  1WHL A;  4HVU A;  4IUP A;  4JLI A;  3L2R A;  1VQ7 A;  4PJO A;  1PKT A;  4OP0 A;  3EGX B;  2L5Q A;  2VYT A;  2QYZ A;  2RNA A;  3G4S T;  4J8O A;  4XTX A;  1VQ6 A;  2CP5 A;  1RUW A;  3G4S Q;  2CGH A;  3P8B B;  2HCK A;  1AHJ B;  1YJW A;  4JLG A;  4PNO A;  5CO7 A;  3X24 B;  1I4K 1;  1Y71 A;  4C92 B;  1M5Q 1;  3LW5 E;  1S72 A;  1U3O A;  1QKX A;  1E7O A;  2KDS A;  4J9I A;  1X6G A;  2K57 A;  3V7R A;  4Y92 A;  3VRY A;  4M7D B;  4M78 A;  3IQL A;  2R57 A;  4F7U G;  1UHC A;  4C8Q B;  3Q1J A;  5LJ3 f;  4PJO D;  1WQW A;  3I5R A;  5GAN 4;  1JJ2 P;  3RKX A;  4RTU A;  3L2U A;  1G3T A;  1R0B G;  1SF9 A;  5D7U A;  2MOX A;  4M75 B;  1XNI A;  5DM7 R;  2CZ1 B;  4QQ6 A;  3E19 A;  3ER0 A;  2DBK A;  1N9S A;  1YHQ A;  2X4Y A;  1C6V X;  4HKE A;  4FYV B;  3OYF A;  4J7F A;  4IKF A;  3CC4 A;  2A37 A;  5J39 A;  1HSQ A;  2PVG B;  4C0F A;  3CCQ A;  1VQL T;  1QLY A;  2HSP A;  1KD1 R;  1XJW B;  4OML A;  2QGG A;  3A8L B;  3HRS A;  2W0Z A;  3CCM T;  2O4X A;  3M9Q A;  3OW2 A;  4DBH A;  3CCM Q;  3M59 A;  4PJO E;  3OSV A;  1NYG A;  1K0X A;  1GCP A;  1X6B A;  2MK5 A;  3O5Z A;  1N8R R;  1MHN A;  2DK3 A;  2E5K A;  1NBE B;  1FXX A;  3G4S A;  5FU6 C;  4OMQ A;  1TTH B;  3CQT A;  1QKW A;  1ZBJ A;  5GMK h;  4HVV A;  4A4G A;  3C0C A;  1D3B B;  5CCA A;  2XI9 A;  1T3L A;  2QAS A;  1BBZ A;  4HA8 A;  2P4R A;  2PUK B;  3OYL A;  1U06 A;  2PQW A;  1BI1 A;  4Z88 A; 
#chains in the Genus database with same CATH homology
 4ATO A;  3QII A;  3X28 B;  5CKB A;  1VQ5 A;  3OYC A;  4X9D A;  4M78 E;  1YIJ A;  3OYD A;  3A8O B;  3CCL A;  2MAM A;  2EJF A;  2RHX A;  2KK4 A;  3CME A;  3MEW A;  2P0Q A;  4OGC A;  4L5G A;  1G3Y A;  2GFU A;  4M78 F;  3V8J A;  1VQO A;  1QP3 A;  1XTD A;  3GPL A;  2HBP A;  1Y07 A;  2KQW A;  1YJ9 A;  1B34 B;  2ZPB B;  2VGM A;  2LCL A;  3BFM A;  3QG1 A;  2ZPE B;  2ZPH B;  3CPW A;  5HK0 A;  2QI2 A;  3CCU A;  3OYM A;  1KG1 A;  3CXC A;  1JJ2 S;  2CZ0 B;  5GAN f;  3OMG A;  3L2V A;  1K73 U;  1KD1 C;  4OF1 A;  4BB7 A;  4C0D C;  2E65 A;  4OB3 B;  4M7A C;  2IVW A;  2DTH A;  4V2S A;  3OBW A;  2RHZ A;  3S3N A;  4ELY C;  2GQV A;  2XD0 A;  2GFA A;  2WSC E;  3KUF A;  2EQM A;  3GLX A;  3QZ9 B;  1XOV A;  3FEO A;  3M56 A;  3TEE A;  3CC7 T;  4M7A G;  1UGS B;  4LDV A;  5A0G A;  3SB2 A;  3RUX A;  4M7A A;  2X4X A;  1KHC A;  3X26 B;  3G6E A;  5CKE A;  2C06 A;  5I2S A;  5LJ3 g;  2YLB A;  4XTW A;  3OYY A;  1QP2 A;  4R55 A;  3T9N A;  4C92 A;  4O6J A;  2E64 A;  2GF7 A;  1Q81 U;  1KC8 C;  2V8K A;  4PLL A;  3CBO A;  1VQL A;  4M7D C;  3HSB A;  2DZ9 A;  2M1H A;  1N8R C;  2RI2 A;  2VGN A;  2BUD A;  4BUG A;  1M9S A;  3GNG A;  5GAM j;  3QSU A;  2P0K A;  4JJN K;  4J6X A;  3MHX A;  1QVF A;  4JS5 A;  4M7D G;  2DTO A;  4KT0 E;  1M1G A;  2ZPG B;  1VQ9 A;  2L89 A;  3RER A;  2LT4 A;  1U1S A;  5FU7 C;  4M7D A;  1VQM T;  3CCM A;  2QQB A;  4C8Q A;  3SWN B;  3BDU A;  1IRE B;  1MGQ A;  4WF2 A;  3VKI A;  1ZHI A;  2LC4 A;  2QDY B;  2EQU A;  3NTH A;  1W2B A;  1V29 B;  3WVD B;  2PVD B;  3HP9 A;  2MF2 A;  4F7U A;  2DAQ A;  2EWN A;  2JNG A;  3QO3 A;  3HFO A;  4M75 A;  5FU7 B;  2RM4 A;  4IUV A;  2FL7 A;  5CK9 A;  5CKH A;  5I21 A;  1YJN A;  5GMK j;  4MDW A;  1M1K C;  5LJ5 h;  5J26 A;  1WQ7 A;  2ZPF B;  2G3R A;  3RKY A;  3I55 A;  2CZ6 B;  3QXE B;  4NL3 A;  1QVG S;  2DEQ A;  3JCM W;  4ZTF A;  4NL2 A;  4M7A D;  4EDU A;  1WJQ A;  1FWZ A;  2FVU A;  2R5M A;  4J6Y A;  3X25 B;  3FRN A;  2FYK A;  2JUF A;  4QVZ A;  2EQK A;  4XQ3 A;  3OYI A;  4PLI A;  3QZ5 B;  4MZM A;  5GAN e;  2I2L A;  4EMK B;  1BIB A;  4OB1 B;  5GAM d;  3CBP A;  5GMK m;  2DO3 A;  1K8A U;  2ZGW A;  2DXC A;  2K5L A;  3GNF B;  2QQA A;  3V8L A;  3H8Z A;  4EMH A;  5C0M A;  1VQP A;  1VQ7 T;  3A8G B;  4XTV A;  2LT1 A;  4J5Y A;  4MZP A;  3L42 A;  2VXE A;  2XK0 A;  1Q86 U;  4M7D D;  3UWN A;  5LL6 S;  2EIF A;  2LRQ A;  1U8R A;  3LGF A;  3RIR A;  3L2W A;  3CMA T;  1JJ2 A;  3KXT A;  1XQH A;  2JTF A;  3JB9 F;  3MCA B;  4QVC A;  2MMP A;  2CS7 A;  2E70 A;  3M57 A;  3NFC A;  3N5B B;  1HXD A;  3OYK A;  2HAX A;  2D6F A;  3M55 A;  3P8D A;  3UDC A;  2QA4 T;  5FRN A;  2X4J A;  2HNI A;  3JCM g;  4YTL A;  2RB6 A;  2WAC A;  1BIA A;  1M90 C;  2QXF A;  2QQR A;  4PJO F;  3S6W A;  3G71 T;  1R8O B;  5FRO A;  4ZN3 A;  3HL8 A;  1KD1 U;  4BDZ A;  2P4T A;  3C95 A;  4E47 A;  4A54 A;  4Z02 A;  4M7A E;  2F5K A;  3CC2 T;  2R5A A;  4IUU A;  4A4K A;  1YBY A;  3OYE A;  2LVM A;  4LD9 K;  4XAX B;  3WVE B;  2D9T A;  1UB4 A;  2LCC A;  1TH7 A;  1I8F A;  2O01 E;  1D3B A;  4HCZ A;  4RG8 A;  3BW1 A;  2FHD A;  1RL2 A;  4P5N A;  3JB9 H;  3QJ6 A;  3VUZ A;  4C92 F;  1NPR A;  1G5V A;  1KC8 U;  2EKO A;  2RI3 A;  1LJO A;  3OBY A;  2XIC A;  5GAM f;  3MO8 A;  3JCM f;  1UGQ B;  3PNW C;  3ZFJ A;  1N8R U;  4M7D E;  4RKU E;  2E12 A;  3A5Z B;  5HK3 A;  3OYJ A;  4C8Q E;  3FC3 A;  3JCM J;  2Y4Y A;  1VQM A;  2CZ7 B;  2DD5 A;  3OYG A;  3CCJ T;  4O5V A;  1VIE A;  5LJ5 j;  5GAN h;  2K3Y A;  1B34 A;  4C8Q F;  5A0L A;  4OVA A;  4F7U E;  5IAY A;  4JUV A;  1VQK T;  1N6A A;  4M77 C;  4M75 E;  4II1 A;  4E7H A;  2QEX T;  2DVE A;  3EAE A;  2XHC A;  4KUL A;  4F7U F;  4FT4 A;  4XU0 A;  4M77 G;  4LDW A;  4M75 F;  3QDR B;  2K2V A;  4RCB A;  5CQY A;  1M1K U;  2RHI A;  3NTI A;  2RD1 A;  3OA6 A;  4M77 B;  4HT8 A;  4RMO A;  3CCE T;  1M1F A;  5D6W A;  4A53 A;  2OTJ A;  4C5E A;  1G3S A;  2RJF A;  2M9U A;  3PMT A;  1X75 C;  2E10 A;  2E1H A;  2X35 A;  4TVR A;  5GAN 8;  4ZGJ B;  1ZBX A;  2IG0 A;  1LOJ A;  2EJG A;  4L6V 5;  5GAN 6;  2JZ2 A;  4HT9 A;  3L1A A;  4C5H A;  2RHY A;  3F70 A;  3QYH B;  3QHS A;  2EFI A;  2RJE A;  3SWN C;  4C5G A;  4C0G A;  2KY9 A;  3QBY A;  4LDU A;  3LGL A;  5DLQ E;  5EG2 A;  2XKO C;  1P92 A;  5KCH A;  2KAF A;  2E6N A;  3OW2 S;  2A3L A;  4PJO B;  3RMS A;  4OB2 B;  3SWN A;  1VQN T;  3P8H A;  2DXB A;  3DB4 A;  3E1S A;  1HK9 A;  3MP8 A;  4J7I A;  5LJ3 h;  3X20 B;  5LJ5 d;  3VJP A;  1QVP A;  3GF5 A;  2LQK A;  2XID A;  2QQ9 A;  4FM4 B;  2RHU A;  4A4H A;  1IZ6 A;  5A2Q E;  1KHI A;  4FT2 A;  3WXM B;  4L59 A;  5GAM e;  3JCM e;  4R56 A;  4ELZ C;  2LTO A;  2QA4 A;  2OAU A;  1UGP B;  1WNL A;  3CD6 T;  3JSC A;  1YI2 A;  4ZGE B;  3MEU A;  3DKM A;  3ASK A;  1NPP A;  1G3W A;  4M77 D;  3J81 E;  3OS1 A;  3G71 A;  3CCS T;  4RG2 A;  5FRM A;  5CKD A;  3EFS A;  4M78 C;  1M90 U;  1OZ2 A;  4EMK C;  3HHT B;  3A8M B;  3FB9 A;  3BY7 A;  2L8D A;  4BI8 B;  3CCV T;  3RES A;  5GAO q;  3UPU A;  1YIT T;  5AYF A;  1VQ5 T;  3UT1 A;  2GCX A;  1VQ8 T;  4ZTJ A;  1YIJ T;  1VUB A;  2ZPI B;  3OS5 A;  5FLX E;  5GAO m;  2VC8 A;  3CCL T;  1PSF A;  2DXU A;  5LJ5 e;  1FX7 A;  4PKC C;  2VV5 A;  2Y90 A;  4EMK A;  1KQ1 A;  2F69 A;  1WPY A;  4OMF B;  4A4E A;  5GMK e;  4E7I A;  2E6Z A;  4M78 B;  3C12 A;  4QQD A;  4EPC A;  1Y96 B;  3FIF A;  4B9W A;  5KH6 A;  4JRK A;  3TU4 K;  4QVD A;  3CCU T;  3OS0 A;  5GAN j;  1BI2 A;  3M53 A;  4C5I A;  3GOX A;  4KUD K;  1VQ4 T;  1PSE A;  2R58 A;  4FSX A;  2XDP A;  3HKS A;  5KE3 A;  2KSS A;  2PU9 B;  5GAO p;  4N4I A;  3LYI A;  3CPW S;  3OYH A;  3CCJ A;  3FDR A;  3A8H B;  3RMQ A;  1KQS A;  4MZT A;  3TRE A;  3S3O A;  4JDS A;  5CVI A;  5LJ5 f;  3CXC S;  1VQK A;  1VQ6 T;  2EAY A;  3JCM b;  4XU2 A;  3LH0 A;  4XTU A;  2XU8 A;  2DPP B;  4KBM B;  4N0A C;  5C6S A;  2ZCF B;  3DLM A;  2QEX A;  2OTL T;  3V8K A;  3MEV A;  1YJW T;  1H64 1;  4UC4 A;  1X01 A;  3KBG A;  5GAM g;  5HKC A;  2Y4X A;  4KUI A;  4NS5 A;  5D6X A;  2EYQ A;  3VU3 C;  3GP8 A;  2DTI A;  5A0D A;  1WJS A;  3L2Q A;  1S72 T;  3CCR T;  1I81 A;  3OQ5 A;  3JAM E;  3OYN A;  4JRQ A;  3OMC A;  3MP6 A;  4ME7 A;  3JCM V;  1VQ9 T;  4D6W A;  3CC7 A;  4BE0 A;  4M78 D;  5CQX A;  2VXF A;  1X6O A;  3CEY A;  3M54 A;  5IN1 A;  3O8V A;  3JCM h;  5KCO A;  5GAM h;  4M7A F;  3V7C A;  1BI0 A;  2V8J A;  3QJY A;  4LD6 A;  5CIU A;  2O4X B;  1QVF S;  4FU6 A;  3QKJ A;  4Y91 A;  4BD3 A;  4MDX A;  5LJ3 j;  2HQE A;  5M9O A;  1VIF A;  5CR2 A;  5GAN d;  2DJZ A;  2HD0 A;  4NOY A;  3LLR A;  4JRI A;  4X34 A;  1OZ3 A;  4BI3 A;  1ZQ1 A;  1U1T A;  1W2B S;  1H3Z A;  1VQN A;  3JCM Q;  2JN0 A;  3MP1 A;  4M7D F;  1O9S A;  3VV0 A;  1JBM A;  2YHT A;  3QYG B;  2LX9 A;  5GAN 5;  1YHQ T;  5IT9 E;  4XTZ A;  1UEB A;  4PL6 A;  2PUO B;  3GIB A;  4OGE A;  4BI4 A;  3EFR A;  5GAO r;  3OB9 A;  2K3X A;  1JRI A;  3OYB A;  1QVG A;  3CD6 A;  2RI5 A;  3OSS C;  4IUR A;  3QUI A;  1O75 A;  5D6Y A;  4ZN1 A;  3JCM X;  3CC4 T;  1BKB A;  2YRV A;  5KE2 A;  3CCS A;  4XTY A;  2F5T X;  5FU6 B;  1QW1 A;  2HQX A;  2M16 A;  3CCQ T;  1VQP T;  2E5Q A;  4ZGD B;  4DOW A;  1I5L A;  4M77 A;  4J6W A;  3CCV A;  4VUB A;  5GMK l;  2BIV A;  3JB9 G;  1DJ7 B;  1EIF A;  1YIT A;  5CKF A;  2RO0 A;  3QPH A;  2DKG A;  1VQ8 A;  1WJR A;  1M8V A;  1NZ9 A;  2CKK A;  5J3B A;  2LQ8 A;  4DOV A;  3RKW A;  2RK1 A;  4E7L A;  1Q7Y C;  3PIP A;  4PJO C;  3J80 E;  4B9X A;  4CRI A;  2DZC A;  4CI0 C;  5LJ3 d;  2P0P A;  1NJI C;  4E7J A;  2KVQ G;  3E9G A;  4PJO G;  2JTM A;  4BY6 C;  3SFM A;  2K4Y A;  2LNV A;  2RH2 A;  4IUP A;  4JLI A;  3L2R A;  1VQ7 A;  4PJO A;  5GAO n;  2ZZD A;  1VQ4 A;  1RI0 A;  4OP0 A;  4X9C A;  3HFN A;  2L5Q A;  2RA2 A;  2VYT A;  4BE1 A;  3SDZ A;  1BI3 A;  3M4G A;  4C0Z A;  3PMI A;  1OYX A;  4IUQ A;  4Q5W A;  4C92 C;  3G4S T;  3CMA A;  4J8O A;  4XTX A;  1BYM A;  2WSE E;  4BY6 B;  3JCM P;  1VQ6 A;  3PT9 A;  2JVV A;  4C92 G;  1Q82 C;  2CGH A;  1N9R A;  3P8B B;  4C0D B;  2FB7 A;  3TCJ A;  2RJC A;  4JS4 A;  3R6O A;  2OTL A;  4N4G A;  4M7A B;  1AHJ B;  1YJW A;  4JLG A;  4PNO A;  3V7S A;  1K9M C;  4QW2 A;  5CO7 A;  3CPF A;  3X24 B;  1I4K 1;  1Y71 A;  3FJP A;  4C92 B;  5GAN 3;  2EJ9 A;  1UGR B;  2XG8 D;  1M5Q 1;  3LW5 E;  4C8Q C;  3CCR A;  1LNX A;  1S72 A;  3JB9 I;  2KMT A;  3I56 T;  2BKD N;  2DD4 A;  2KDS A;  2LDM A;  1JB0 E;  2XDD A;  3JB9 D;  2AHJ B;  2K57 A;  3V7R A;  3OY9 A;  4C8Q G;  5LJ5 g;  3CC2 A;  3MET A;  4M78 G;  2MWO A;  2DIQ A;  4M75 C;  4M7D B;  4J83 A;  4M78 A;  2V8I A;  3CME T;  3DLL A;  1Y96 A;  2R57 A;  4F7U G;  4BDY A;  4C8Q B;  4BAC A;  1VQO T;  3S3M A;  3Q1J A;  4M75 G;  5LJ3 f;  4EMG A;  1YJ9 T;  2A7Y A;  2K5I A;  4PJO D;  1WQW A;  3JRZ A;  5GAN 4;  3VYH B;  1K73 C;  3RKX A;  4HCB A;  4F7U B;  3L2U A;  1G3T A;  3PTA A;  4M75 B;  5HY6 A;  1XNI A;  3G7Z A;  5DM7 R;  1SSF A;  2CZ1 B;  4QQ6 A;  4Y28 E;  4DA4 A;  4BE2 A;  4FL6 A;  3E9F A;  2WSF E;  2E41 A;  2VUB A;  3E19 A;  3ER0 A;  1KQ2 A;  1N9S A;  3PFS A;  1YHQ A;  2X4Y A;  2OTJ T;  5L8R E;  4FIB A;  3SD4 A;  3HRU A;  3VUB A;  4C92 D;  4XU3 A;  5DLO A;  1Q81 C;  1OI1 A;  4HKE A;  4OB0 B;  3OYF A;  2MWP A;  4J7F A;  3G6E T;  5GMK i;  4IKF A;  3JB9 J;  3CC4 A;  3M58 A;  1NE8 A;  3JCM d;  2B8A A;  5J39 A;  2K5F A;  2PVG B;  4M77 E;  4C0F A;  3LWI A;  3FLG A;  3CCQ A;  4QQG A;  1VQL T;  4HCC A;  2L3R A;  3HPW A;  4N0A A;  3L2Z A;  3M4Y A;  4M77 F;  2PVO B;  1Y7X A;  4RCC A;  3CCE A;  3HRT A;  4C8Q D;  4MMK A;  3A8L B;  3HRS A;  3OYA A;  3URG A;  3C4S A;  4XK8 E;  3CCM T;  1N27 A;  2O4X A;  3OS2 A;  4GLK A;  3VYG A;  3M9Q A;  4MML A;  2XDB A;  3LX7 A;  4LDY A;  3OW2 A;  1Q7Y U;  3CBM A;  3M59 A;  4M75 D;  3LWH A;  4PJO E;  1NJI U;  3OSV A;  1YI2 T;  2RJD A;  1KQS S;  4E7K A;  1M4Z A;  2JOY A;  4A4F A;  3BDL A;  3INZ A;  5GAN 7;  1W4S A;  3ME9 A;  3PGG A;  3J7A F;  2EQJ A;  1YJN T;  1MHN A;  2DK3 A;  4LDX A;  3MEA A;  2X4W A;  3ZEH A;  3I55 T;  1FXX A;  3NTK A;  2YLC A;  2RK2 A;  2H3J A;  4GY5 A;  3G4S A;  4IUT A;  4XU1 A;  5FU6 C;  1YCY A;  2DIG A;  3M5A A;  5LJ3 e;  1WGS A;  3AHU A;  4C92 E;  5GMK h;  2M0O A;  4A4G A;  3ZBD A;  2DXT A;  3JCM c;  1GXI E;  2CYZ B;  2QQS A;  3DB3 A;  5GAO l;  3H6Z A;  1Q82 U;  1K8A C;  1D3B B;  5GAN 2;  5GAN g;  5CCA A;  3PIO A;  2XI9 A;  2NLU A;  1K9M U;  4HA8 A;  2PUK B;  3C94 A;  5DY9 A;  1Q86 C;  2D0Q B;  3OYL A;  4JRP A;  3I56 A;  2MI6 A;  5I2M A;  4DQ2 A;  4N4H A;  2PQW A;  1BI1 A;  2QTX A;  5CAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...