4CRIA

Crystal structure of 53bp1 tandem tudor domains in complex with methylated k810 rb peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
publication title Lysine Methylation-Dependent Binding of 53BP1 to the Prb Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 28
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA01
4BDYA 4GY5A 3S3NA 5KCOA 1VQ9T 3CCEA 3OYLA 3G6ET 2L8DA 2RHIA 4QVZA 5J39A 3LLRA 4YTLA 1JJ2A 1YBYA 1VQ7A 1Q7YC 1VQMA 4FL6A 2MI6A 4BE2A 3L2UA 3SD4A 1XTDA 2M16A 3FEOA 3DLMA 3OA6A 2X4XA 2E70A 5KE2A 3FC3A 2LDMA 1KD1U 1KQSS 3I55A 1Q81C 5D6YA 3CXCA 5C6SA 2G3RA 1YIJA 1OI1A 4C5IA 1K9MU 4X34A 1VQKA 1YITT 4LD6A 4N4HA 3TREA 2VYTA 3MP6A 2DIGA 4A4EA 1OZ2A 3DB3A 5DM7R 3J80E 1VQ8T 2OTLA 1WJSA 4B9WA 3PNWC 2RJFA 2R57A 3PIOA 4PLIA 1YHQA 3C4SA 3H6ZA 1S72A 1K8AU 2DAQA 5C0MA 3QIIA 1YJWA 3LYIA 3UWNA 3OMGA 3CCET 2JVVA 3H8ZA 1M90C 4E7KA 5J26A 4IUUA 5CIUA 2WACA 2O4XB 5A2QE 1NZ9A 3O8VA 2RJCA 5FLXE 2HQEA 1NPPA 3OY9A 1YJ9A 4ZTFA 2RI5A 2R58A 3NTIA 2XDPA 1VQ7T 1VQMT 3ASKA 4HCZA 3OYYA 1UEBA 2BIVA 3E9GA 3UT1A 3CMEA 5D6XA 3OB9A 3L2QA 5HY6A 3CCVT 3I55T 2L3RA 3S3OA 3QBYA 3LX7A 1YIJT 2QQRA 5KE3A 1IZ6A 1VQKT 3OYAA 1MHNA 3MP1A 1Q82U 3OYIA 3E9FA 3MEAA 2BKDN 2OTLT 4E7JA 2R5AA 3P8HA 1Q86U 3OYFA 2LCCA 2LQ8A 1YHQT 1S72T 1QVGA 2LVMA 3ZEHA 1G5VA 1YJWT 1W2BS 5FROA 4C5HA 3OQ5A 3CPWS 1VQ4T 5FRNA 3KUFA 3OYMA 4IUPA 1YJ9T 1NPRA 1EIFA 1VQPA 2E6ZA 2XK0A 3OYGA 2RHZA 2EKOA 3PMTA 4RG2A 4UC4A 3S3MA 3OW2S 4IUQA 3LGFA 2PQWA 3MP8A 3DLLA 3CMET 3M9QA 2KVQG 2E5QA 4BD3A 3CD6A 2JTFA 3CC2A 3JAME 3CMAA 3L2RA 3EAEA 3A5ZB 2EFIA 3Q1JA 3CCLA 1KD1C 4II1A 3PIPA 1OZ3A 3CCRA 4PL6A 4A4FA 2QA4T 5KCHA 1WGSA 3GOXA 2K3XA 1YJNA 3S6WA 1K9MC 2RJDA 4QQ6A 1K73U 3QJ6A 1KC8C 2X35A 4B9XA 3CCSA 1QVFA 3DB4A 2RI2A 2LRQA 1JJ2S 3OS0A 3I56A 2E6NA 4FU6A 3BDLA 2D9TA 1K8AC 3OS1A 2EQJA 4A4GA 3CCUA 3QKJA 3OS2A 2GFAA 1VQPT 3OMCA 5J3BA 5KH6A 2MWOA 3NTHA 3CC4A 1VQ5A 2IG0A 1NJIU 2MWPA 3CXCS 3G4SA 1VQ6A 2LCLA 1OYXA 3OYCA 2RHXA 4E7LA 3LH0A 2K3YA 3P8DA 1RL2A 3CD6T 3CCMA 3CC2T 3CC7A 4IURA 4Q5WA 3CMAT 4E7HA 1N27A 4CRIA 5IAYA 2DO3A 1N8RU 5M9OA 4L59A 1M1GA 5FRMA 1VQOA 1M1KU 3CCRT 3CCQA 2GF7A 2FHDA 2EQMA 4BACA 1YJNT 3MO8A 4BE1A 3L2WA 1Q82C 2X4WA 1VQLA 3CCST 1KHCA 1Q86C 3MEWA 3I56T 2B8AA 4N4GA 3META 4TVRA 4OVAA 2XHCA 2P0KA 3P8BB 3FDRA 3CCUT 4IUTA 4EDUA 1Q7YU 2QQSA 2F5KA 3MEUA 3G71A 2RJEA 3CC4T 5IT9E 1VQ5T 3OYNA 2EQUA 1YI2A 3G4ST 1VQ6T 1KHIA 2OTJA 2GFUA 1WJRA 3MEVA 3CCJA 2M0OA 4ZN3A 2RHUA 4A4HA 2QEXA 5D6WA 1Q81U 3CCMT 3CC7T 2R5MA 3ER0A 2EQKA 2RO0A 1RI0A 3HKSA 3PFSA 2JZ2A 2O4XA 3OYJA 2X4YA 2RI3A 3CEYA 1QVGS 1VQOT 4IUVA 3CCVA 3CCQT 2L89A 1X6OA 3OYKA 2JUFA 1KC8U 3OYEA 1VQNA 3L42A 3J81E 1VQLT 1BKBA 2YRVA 1M90U 4QW2A 4IKFA 1K73C 3NTKA 4ZTJA 3F70A 1VQ9A 1SSFA 2EIFA 4ZN1A 2LTOA 3G6EA 3PMIA 2RHYA 2BUDA 4E7IA 2JNGA 4QQDA 3G71T 1VQ4A 4PLLA 4BE0A 4N4IA 1W2BA 4QQGA 5LL6S 1YI2T 3CPWA 2OTJT 3CCJT 1NJIC 2QEXT 1H3ZA 3OYBA 1WJQA 1XNIA 3CCLT 2HQXA 3KBGA 3ME9A 2NLUA 1QVFS 3OW2A 5IN1A 5DLQE 2JOYA 4BDZA 1YITA 1N8RC 2M1HA 2DIQA 1KQSA 4NS5A 2CKKA 1VQ8A 3OYHA 4Z02A 3L2VA 1M1KC 1VQNT 4C5EA 2QA4A 3CPFA 3FLGA 4C5GA 3LGLA 3J7AF 3OYDA 2KDSA
chains in the Genus database with same CATH superfamily
2EWNA 4GY5A 2YHTA 1O9SA 5KCOA 2K2VA 1VQ9T 1W4SA 2Z0WA 4LUEA 5L8RE 4Z88A 2I2LA 1Z9ZA 4QVZA 5J39A 2E5KA 2EJGA 3SHWA 1Y07A 1PM3A 3VYGA 2ZPGB 2K5FA 5CCAA 4M7DE 1BI2A 2P0QA 4BE2A 5IH2A 4NL2A 1RABB 1XTDA 2M16A 3A8GB 3LWHA 3DLMA 4C92G 2EQIA 2NUPB 3SEMA 2LDMA 1N8RR 4JLIA 4Y28E 2L3SA 5C6SA 1WXUA 2M0YA 1M1KR 2JTEA 4J6YA 1M4ZA 6AT1B 1CKBA 2DD4A 3REAB 3R6OA 1GRIA 1OZ2A 3DB3A 5LJ3h 4B9WA 1QKXA 2HBPA 1XJWB 5DLOA 2R57A 3M4YA 2W10A 1PC0A 2DTHA 4PLIA 1YHQA 5CKBA 1BBZA 1PRMC 1T0HA 1WIEA 1S72A 3QIIA 3R6NA 3VS6A 3NMZC 1WXTA 2L2PA 3UWNA 3OMGA 4OMOA 2V1QA 5EC7A 2OTLQ 2JVVA 5J26A 2A36A 2O4XB 3CBMA 5LJ3j 4J6WA 2YUPA 1M5Q1 3O8VA 2BE9B 5GJWB 2K7AA 1NPPA 3OY9A 4E7SA 1K1ZA 3EG0A 1VQ7T 2DTOA 5KYXA 2AHJB 2YT6A 1V76A 1HK9A 4JRIA 2YUOA 3OYYA 4LE9A 1UEBA 2AZVA 2JMCA 2CGHA 3E9GA 1QMCA 2X51A 3M59A 1Q81R 3OB9A 3FRNA 3KXTA 2VWFA 1MGQA 1WNLA 4RTXA 1LJOA 3EHRA 1YCYA 2E64A 4AFSC 4JJDA 5HY6A 2L3RA 2SRCA 3JCMd 3CC4Q 1VQ5Q 5GANd 1YIJT 4M7DC 3GP8A 5GMKh 3CMEQ 4M7DB 4XTWA 3OYAA 1MHNA 3MP1A 4JRQA 3EFOB 8AT1B 5KYYB 2AKLA 4RTTA 4E7JA 3P8HA 4M7DG 1HXDA 1JXMA 5GAOn 3CCMQ 4EMKC 2LQ8A 1M90R 2PUOB 4EMKB 4F17A 1QVGA 1D1AA 5GMKe 1YJWT 5FROA 1JU5C 5GMKj 1X6BA 3RMSA 1PCXA 3PVLA 4FW1A 1EIFA 2PZ1A 2NYSA 2DK3A 4KBMB 4AFZC 2NUZA 2JS0A 2RHZA 4RG2A 3S3MA 2ZPIB 3FIFA 4RUGA 2QASA 1MV3A 3DLLA 4ZGJB 3E19A 4DQ2A 2E5QA 3CD6A 2JTFA 2PU9B 3CC2A 1UG1A 1H92A 4PJNA 1PD1A 4C0DC 1B07A 1TUGB 2E3IA 4PFZA 1E6GA 4C0DB 3CCRA 4PJMA 4A4FA 1WYXA 4IIOA 1YJNA 3CMAQ 4QQ6A 1K73U 4J8OA 3CPWP 4LXCA 3C0CA 2X35A 2NUTB 2Y4XA 4B9XA 4WTOB 2HZYA 3CCSA 2FEIA 3DB4A 2RI2A 2LRQA 3ZBDA 1EZZB 1JJ2S 3JCMh 4CC4B 4DBQA 4M4ZA 4X9CA 4O6JA 2E41A 4FYXB 2DVJA 3M58A 2VGNA 3QKJA 3CBOA 3OS2A 3CCUA 3OW2P 2MAMA 4P5NA 5FU6C 2GFAA 4J7IA 2MIOA 5CAIA 3OMCA 5J3BA 1FXXA 5FU6B 4BI8B 3JCMe 1FMKA 5CVIA 4ANJA 1K9AA 2JT4A 3JRZA 1ZSZA 3JB9F 2LCLA 2K3BA 1XOVA 3CBPA 1AWXA 4E7LA 4VUBA 4JRPA 2K3YA 3P8DA 1RL2A 3V8JA 4OMNA 1WDXA 2IVWA 1M1GA 1RAEB 3EH2A 3EGDB 1VQOA 5GAMf 2ZGWA 4F14A 1KC8R 1YFNA 3MJXA 4M7AA 4L6V5 2JN0A 1SHGA 2FHDA 2EQMA 1EFNA 5LJ5h 1NYGA 2YSQA 3MO8A 3GF5A 1G3WA 1X43A 4BE1A 1UJ0A 3WXMB 4M7AD 1G3TA 3M4GA 4BB7A 1JEGA 2CZ7B 1I5LA 3VS3A 1D1BA 3META 2DRMA 5LJ5e 4C8QE 2HCKA 4RTUA 3EGXB 2P0KA 3I5RA 5LJ5j 3P8BB 3M0TA 4F7UA 1VQ8Q 4EDUA 1M3AA 3CXCP 2EPDA 3MEUA 3G71A 1JB0E 3CC4T 3LWIA 1VQ5T 2EQUA 2DXBA 3G4ST 2J06A 1KHIA 4KUIA 1P92A 2EYZA 1WJRA 2QYZA 4O5VA 2M0OA 2RHUA 2QEXA 2P84A 2VASA 3CCMT 2WSEE 4QVDA 3ER0A 3QSUA 2DL4A 3TCJA 3V7SA 2K9GA 3OYJA 2C0OA 1GFDA 1D1CA 2MPXC 1T3SA 1W70A 1X6GA 3M54A 3CCVA 1BI1A 1VOMA 1X6OA 2FL7A 2P4TA 2RH2A 2GQIA 4E2FB 2JW4A 4M78A 2YDLA 2D6FA 2CP5A 5KYNA 3N5BB 1VQNA 2YRCA 1SPKA 1UE9A 3A8HB 1VQLT 2DZCA 4KGVB 4QW2A 2QQ9A 2W0ZA 4XK8E 2CREA 4ZTJA 2DM1A 2FZCB 2DJZA 4KH0B 4C92F 5FU7C 3PMIA 2RHYA 2JJ9A 4DOVA 5FU7B 3JCMV 2XICA 3WVDB 4BE0A 1VQ4A 3HRUA 2DLPA 2O2OA 5CKDA 1YHQQ 3HL8A 2HSPA 2V1RA 3CPWA 1M27C 3O5ZA 2EJ9A 1X75C 1LVKA 4HCKA 1QQJA 4XU0A 1WFWA 2V8KA 1NJIC 1HD3A 1PWTA 2ROTA 1LCKA 4RTZA 4D6WA 2YUNA 1BB9A 3V8KA 1YCSB 2XG8D 1TOVA 3VU3C 1QVFS 3OW2A 5IN1A 2DJQA 1QWFA 1PG5B 1JBMA 1AWOA 5LJ3f 1YITA 4FSSA 2DIQA 1VA7A 3AT1B 2CKKA 1K73R 2QA4A 3M0RA 2DEUA 1U8RA 2IIMA 4EMHA 3M0UA 1CKAA 4NL3A 3VS2A 1ABOA 1UGPB 3M0PA 1BI0A 4BDYA 3EH1A 2KROA 3CCEA 4JUVA 3OYLA 2DILA 1KJWA 4DEXA 3SDZA 2HSEB 4PNOA 4YTLA 1VUBA 3PT9A 2CUDA 1VQMA 2RF0A 2E10A 5KYUA 5KYWB 3EFSA 2QXFA 3H41A 2CSQA 2KGTA 1BIAA 4XQ3A 3BE3A 4J9DA 3SD4A 2B86A 1OU9A 2OX7A 1QWEA 2LT4A 3CQTA 1AD5A 1N6AA 2PNIA 3I55A 2F5TX 1B7TA 1MNDA 3CXCA 4E47A 1IHVA 2G3RA 2KR3A 4C5IA 3JB9G 3UF4A 2KE9A 4X34A 1VQKA 4LD6A 2VYTA 1M3CA 1QCNA 5CKHA 2DIGA 1VQ8T 3J80E 3M55A 3JCMW 4M77A 3HRSA 4LDYA 3CD6Q 2RJFA 3CC2Q 1IGUA 2CYZB 2G6FX 4A53A 2DAQA 4EIKA 2EJFA 1KFZA 1RLQC 1U1TA 2KSSA 3CCRQ 2K5LA 1YWPA 2CP6A 5CIUA 2ED1A 5A2QE 1NZ9A 5GAN3 3TVTA 2HBWA 2H8HA 3RIRA 4HT8A 2HQEA 1R0BG 2RB6A 2DPPB 4ZTFA 1YJ9A 3RMQA 5CO7A 2XDPA 3ASKA 1UGQB 3UA6A 4HKEA 3A8LB 2ZPEB 4XU3A 3UT1A 2LJ3A 4OF1A 5D6XA 1V1CA 3L2QA 3QO3A 5GAOm 3I35A 1AEYA 5GAN8 1G83A 2YXYA 2P4RA 3C12A 2K79A 1TG0A 3LX7A 3QBYA 4MZTA 3L1AA 3OYIA 4OB3B 2XMFA 2R5AA 2JXBA 1M30A 4HXJA 1M3BA 2RQRA 3I5SA 1YHQT 3BW1A 1Y71A 2FPEA 2YRDA 1S72T 1PHTA 2KI7A 3GIBA 2LVMA 4LDWA 2A7YA 3RR6A 1G5VA 1W2BS 4J5YA 2OAWA 1NBEB 1YP5A 2F69A 5GMKl 1VQOQ 2DZ9A 2KRSA 2ABLA 1AT1B 1NEBA 1Y96A 1ZUKA 3NHNA 1MMDA 3OYMA 4IUPA 2GTOA 2RNAA 4M78F 4C92C 3EFRA 4RCBA 2ZZDA 1WHMA 4C92B 3T9NA 2CP2A 1SRLA 2A0FB 4UC4A 4M75F 3HFOA 4IUQA 2Y90A 2PQWA 1W1FA 4JZ3A 1ZBXA 3M0QA 3V8LA 2A3LA 3MCAB 5IXFA 2X9HA 3PTAA 5GAN6 1GCQA 3G71Q 2XDBA 1G8XA 3QUIA 2ENMA 3Q1JA 3QZ5B 3I9QA 1OOTA 4CC7A 5LJ5f 5I2MA 4LNPA 3PIPA 1H3HA 2CP0A 1K0SA 1W6XA 1VYVA 2K3XA 3JCMg 1VIFA 3TSWA 5GANg 2QEXQ 1K9MC 2RQVA 3QJ6A 4LD9K 2F1LA 2GGRA 3RUXA 3CCLQ 2QQBA 3G1JA 1FWZA 3GNFB 1M1FA 3OS0A 2LMJA 1KQ2A 2VV5A 3I56A 1Q95G 1V29B 2LNVA 2YUQA 4FYWB 4A4GA 1TUDA 5I2SA 4DOWA 3RKYA 3QJYA 3REBB 4JDSA 2JM9A 1ZSGA 3RKXA 1KQSP 1NJIU 1BIBA 4F7UE 3RERA 2DVEA 2HQHA 1WHHA 1K76A 3CD6T 3CC2T 3CC7A 2EBPA 2LZ6B 4Q5WA 2LQWA 1AOJA 3X20B 5LJ5g 3G4SQ 4CC2A 2NWMA 2FB7A 1OEBA 3FB9A 3CCRT 3CCQA 2GF7A 4GLKA 2EGCA 3A8OB 4ATOA 1LPLA 4FM4B 2QK0A 1JJ2P 2CSIA 1YJNT 2X4WA 1FX7A 1M8MA 3CCST 1KHCA 1WA7A 1X2KA 2NUPA 5GAOl 2SEMA 1UGVA 4C92D 1VYUA 4M78E 1UFFA 2XHCA 4M75E 1HYOA 1QW1A 4IUTA 3CCUT 1VQLQ 3E1SA 4C8QF 4L5GA 3C95A 1S1NA 5DY9A 1WQWA 2KYMA 3OYNA 1UGRB 2DF6A 1ZUUA 1YI2A 5GAN2 4XTXA 3CCEQ 2E3HA 4J6XA 3MEVA 1YWOA 4A4HA 4V2SA 4J83A 1IGQA 2R5MA 3VUZA 2HMAA 3HKSA 2O4XA 1WX6A 3QPHA 3RNJA 2RI3A 1VQMQ 1ZUYA 4EMGA 3V7RA 1VQOT 1QCOA 2KEAA 3VS7A 2L89A 3OYKA 3MKDA 2RM4A 3FJPA 1OPLA 4MMKA 1WZOA 4HVUA 2E1HA 2E4HA 1DJ7B 3FJ5A 5GANh 1CSKA 1NLOC 1BKBA 4F7UG 2YRVA 2D0NA 4J9CA 4PJOF 4FIBA 4IKFA 3A98A 2DX1A 2LJ0A 2YLCA 3F70A 2QTVA 1VQKQ 1SSFA 4ZN1A 2LTOA 3G6EA 2DE0X 4EPCA 4OB2B 2LT1A 2HAXA 4E7IA 4M7DA 2JNGA 1D0ZA 5GANe 3EFOA 5KYYA 3G71T 3IQLA 4PLLA 4N4IA 5GANj 4DBFA 4QQGA 3VYHB 5LL6S 4JZ4A 2AKKA 1T3LA 2J05A 4M7DD 3INZA 2DL7A 2JM8A 4EMKA 1BCOA 1ARKA 4A63B 1LNXA 3JB9J 2QEXT 4MZPA 3LH5A 1WJQA 4M75C 3CCLT 4LUDA 3ME9A 1YJ9Q 4M78G 4M75B 3VS4A 2NLUA 4KH1B 2KBTA 4X1VA 2AK5A 4AG2C 3PGGA 2JOYA 3SFMA 4M75G 1OX8A 1WHJA 2M1HA 2QI2A 3RKWA 2X3XD 1KQSA 4JLGA 4NS5A 1RI9A 4Z02A 3L2VA 3H0HA 1D3BB 4C5EA 4DA4A 2FZGB 1VQNT 4PFOA 4DBHA 4OMMA 4ESRA 3U23A 4MMLA 1I1JA 3BFMA 2X4JA 1RAGB 2JTMA 2DXUA 1WI7A 3S3NA 1FMVA 1SF9A 2L8DA 2XIDA 2VXEA 1WXBA 4B6MA 1JJ2A 2CP7A 2XKOC 1YBYA 1NJIR 1Q7YC 1AZGB 4FL6A 2NUTA 2VXFA 4R55A 1MMNA 5FWCA 4WF2A 1ZA2B 4C0ZA 4A54A 4QVCA 1QVFP 2J6FA 4JJNK 3OA6A 2X4XA 5CKFA 2E70A 2EGAA 5KE2A 3FC3A 4BI3A 4KUDK 4MZMA 1K9MU 2PVOB 1YITT 2RD1A 4E6RA 4PJOE 4HVVA 4A4EA 5DM7R 2OTLA 2ATCB 1WHLA 2BZYA 3EG9B 1QVPA 2A28A 2LQNA 2MK5A 4RCCA 3C4SA 5C0MA 3CCET 2KT1A 3H8ZA 4E7KA 1AWJA 1OX9A 3PVQA 3EGDA 4IUUA 4OB1B 2V8IA 2QGFB 2C0IA 2RA2A 4CI0C 2RJCA 5FLXE 4XTUA 4QT7A 1S72Q 2ESWA 2R58A 3NTIA 1NM7A 3WVEB 3JCMQ 1M9SA 1VQMT 1H641 2DL5A 4HCZA 1YNZA 2OAUA 3THKA 4C8QC 2WSFE 4X9DA 7AT1B 4C8QB 5GMKm 1JRIA 4F04B 3CMEA 2O9VA 1MV0B 4XTVA 2MMPA 4C8QG 5GAMd 3EGXA 1U06A 3I55T 1BU1A 2FRYA 1UTIA 1M2VB 4OMLA 2KYBA 5KE3A 1VQKT 3AHUA 1MUZA 2ZPHB 1QKWA 3MEAA 5I21A 5A0LA 1Y0MA 3SWNC 4KT0E 4J9GA 1UECA 4C0FA 3SWNB 3OYFA 2IPOB 4GBQA 4C0GA 3CC7Q 2EGEA 4RTVA 1G2BA 2A37A 4RG8A 3GLXA 3HP9A 4LDXA 4C5HA 3OQ5A 4OGEA 2L3PA 5I11A 3CCQQ 2KNBB 5FRNA 2VB6A 4PJOC 1B34B 2KQWA 2O88A 4PJOB 2KY9A 2VGMA 3HRTA 1YJ9T 2XI9A 3X26B 1VQPA 2E6ZA 4QKUA 4PJOG 4J9IA 1R77A 3OYGA 3M53A 2CH4A 2EKOA 1BI3A 3PMTA 2M02A 2BTTA 2D8HA 2LNHB 3GPLA 3LGFA 4J9EA 3TEEA 3MP8A 2F2XA 3M9QA 2KVQG 2K2MA 4LDVA 4BD3A 4FT2A 3L2ZA 3QZ9B 2DD5A 3JAME 3L2RA 3CMAA 3EAEA 1ZA1B 3JCMb 4RTYA 1AWWA 2YLBA 3UPUA 1PD0A 1YI2Q 1KD1C 2E65A 1AZEA 4N0AA 1OZ3A 1I4K1 5KCHA 1WGSA 2DEQA 2A08A 4CC3A 1W2BP 2RQTA 2RJDA 4XU1A 2RMOA 2DERA 2EVRA 2ZPBB 3QYHB 2K6DA 4HA8A 3TU4K 1QVFA 4PK4A 2DTIA 1GXIE 4PJJA 2K57A 2DYBA 3X24B 3EGUA 1YJNQ 4M7AF 3BDLA 2D9TA 3OS1A 1K8AC 2EQJA 2DL3A 1D0YA 3JB9H 4C8QD 5FW9A 3CCSQ 1I5OB 2RK2A 1BK2A 2MWOA 3NTHA 4IIMA 5GAOp 1X2QA 2IG0A 2MWPA 4HVWA 1G3SA 2O31A 2D1XA 3M57A 1VQ6A 3OYCA 3CCUQ 4PFPA 1IXDA 1NLPC 3LH0A 2PUKB 3G6EQ 3DKMA 4F7UF 5LJ3d 2KXCA 1QCFA 4CRIA 1A0NB 3RESA 5M9OA 2KRMA 5HK0A 1K9MR 2QG9B 1OU8A 1Y57A 5KYWA 3JCMf 3VS1A 1PSEA 5EG2A 5GANf 5HKCA 2DYIA 3RBBB 5KYXB 1Q82C 4KGXB 2LP5A 3OSVA 2DRKA 1Q86C 3MHXA 2LC4A 1N9SA 2DA9A 3MEWA 3I56T 4N4GA 4OMPA 3TQ7P 2BE7D 3E2UA 4OVAA 4J9HA 4TVRA 3X28B 1UB4A 1OULA 1Q7YU 2CT4A 3JB9D 1Y7XA 1ZQ1A 2O01E 5A0GA 5IT9E 2E12A 4BY6C 3VS0A 3M0SA 1MMGA 4BY6B 2RPNA 3QWXX 3UDCA 2M9UA 3JCMX 2OTJA 3VJPA 1JO8A 4Y91A 1TU0B 2GFUA 1SKUB 2GQVA 3CCJA 2EYXA 2COZA 3CC7T 2EQKA 3HSBA 2RO0A 4XTZA 1RI0A 2JZ2A 2H3EB 2QDLA 2Y4YA 1GBQA 2QQAA 1QVGS 1KK7A 2XU8A 4IUVA 2VUBA 1SG5A 3CCQT 4AMCA 2FVUA 1UJYA 4ZGDB 1SHFA 2JUFA 1ACMB 3OBWA 1KC8U 2ECZA 4M7AE 3CCVQ 2RN8A 1SEMA 1VQ9A 2EIFA 2HKQB 3V7CA 3QDRB 1VQNQ 5LJ3e 2KAFA 4QQDA 2MF2A 3ULRB 2EYQA 1W2BA 3JSCA 1YI2T 2HD0A 4XU2A 2CUBA 1VQ4Q 2HQXA 3KBGA 2AT1B 5IHKA 2M51A 3PE0A 3H0IA 1I07A 2CP3A 5DLQE 2HL5C 2COYA 4ELYC 2RQUA 1TWBA 4FT4A 2EAYA 2D0QB 3ZFJA 2DXTA 4C92A 1N8RC 1IHWA 4RTWA 5AYFA 1M1KC 2D8JA 4PJLA 3GBQA 1ZSZC 2K4YA 4C5GA 4J9BA 1X27A 3UA7A 1ZSZB 5CQYA 3J7AF 1PSFA 4JJBA 3OYDA 1WQ7A 1WHGA 5AT1B 3SB2A 1YITQ 3TSZA 2ZAEA 5A0DA 3G6ET 2FRWA 2QA4Q 2RHIA 5CR2A 4FW2A 4D8DA 2AZSA 1K0XA 4JPBW 4M77F 3LLRA 4M7AC 3HTRA 2V8JA 2YWWA 2EW3A 1R8OB 4M7AB 4D8KA 1VQ7A 1VIEA 4K11A 2K5IA 1UGSB 4GLMA 4XTYA 2MI6A 2FYKA 2HL3A 4M7AG 1C6VX 3UATA 3L2UA 1KG1A 2ED0A 2XDDA 2KMTA 3FEOA 1I8FA 2WSCE 5LJ5d 2ROLA 1KD1U 3OSSC 4OMQA 1VQPQ 1KQSS 2OI3A 5D6YA 1Q81C 1I0CA 1YIJA 1OI1A 1Z9QA 3QWYA 2RQWA 5GJVB 4HT9A 4F7UB 4N4HA 3TREA 1PKSA 3MP6A 2DBKA 3QHSA 2DNUA 2HNIA 1WJSA 5IXBA 2BZXA 4Z89A 3PNWC 3I55Q 5GAOq 2ZPFB 3BY7A 3PIOA 4J9FA 4ZGEB 4Z8AA 3H6ZA 1K8AU 1I81A 2J6OA 2DKGA 3LYIA 4E7ZA 1YJWA 2FZKB 1PKTA 4AFQC 1M90C 2EYWA 4AG1C 3LW5E 2WACA 3ZL7C 4LN2A 3OS5A 1BYMA 1PRLC 2PVGB 1Q7YR 2HKNA 1H8KA 4KRTA 2FG0A 2F2VA 2RI5A 3A8MB 3H0FA 4M78C 2VVKA 2H3JA 8ATCB 4M78B 2FPDA 1QP3A 2BIVA 3QDFA 2DETA 1SRMA 4ELZC 3QXEB 1X01A 4OGCA 1IRXA 2HEQA 4OMFB 1N9RA 2CT3A 1WPYA 4PKCC 1VYTA 2RK1A 3CCVT 2J7IA 3S3OA 2GTJA 1RACB 2QDYB 2QQRA 2L3QA 3VKIA 1IZ6A 4ORZA 1VQ6Q 1AHJB 5IHIA 1Q82U 3E9FA 5CKEA 2BKDN 2OTLT 4J7FA 3QG1A 1Q86U 5I22A 2LCCA 2MYSA 2JS2A 1G3YA 4M77E 5CQXA 3ZEHA 2FO0A 2DFUA 3CPWS 2OJ2A 2FPFA 1VQ4T 1M8VA 2CH4W 4DBRA 3KUFA 1NPRA 1GCPA 1O75A 2CZ6B 2XK0A 4BUGA 3EHQA 3OW2S 2LCSA 1NYFA 2DBMA 1IREB 3JCMJ 3CMET 2KT8A 2C06A 1D09B 1TS9A 2GCXA 1JQQA 1NE8A 3QYGB 1ZBJA 3A5ZB 2LJ1A 1K4US 3NPFA 3M56A 2EFIA 4RMOA 3CCLA 4DEYA 4II1A 2I0NA 5GAMg 2OTJQ 1ZX6A 4PL6A 1N5ZA 2QA4T 1D0XA 1JXOA 1KIKA 2DL8A 1UHCA 3GOXA 2GNCA 3CCJQ 2GBQA 3S6WA 3EG2A 1RAHB 1KC8C 4HCCA 3KFVA 3BDUA 5IHNA 1FYNA 4OP0A 2CDTA 1NEGA 5KYUB 4NOYA 3HFNA 1NG2A 2QAZA 2V26A 3URGA 4M75A 1RLPC 2E6NA 4FU6A 2DMOA 4M78D 3NFCA 1RAIB 2VC8A 1TTHB 2JMAA 4M75D 1WLPB 1VQPT 4ME7A 5KH6A 1ZHIA 4FSXA 1TXQA 3CC4A 4WCIA 4FYVB 3I56Q 4KGZB 1D3BA 1VQ5A 1UUEA 3H9NA 4N0AC 3CXCS 3G4SA 4M77C 2LQKA 1OYXA 2RHXA 1VQ9Q 4M77B 2AIRB 4R0KA 2C0TA 4MDXA 1TSFA 3RDVA 3CCMA 2MOXA 2KK4A 4M77G 4R56A 1RUWA 4IURA 1T0JA 1KD1R 4E7HA 3CMAT 1N27A 3G7ZA 4LDUA 1OV3A 5CK9A 3GNGA 3MPUB 1E7OA 5IAYA 1MMAA 5HCKA 2DO3A 1N8RU 1HSQA 2QGGA 4L59A 2PTKA 5FRMA 1AVZC 2DXCA 1QP2A 1M1KU 1ABQA 4A4KA 1MNEA 9ATCB 4BI4A 1RAFB 4BACA 1KQ1A 1OPKA 5GAN4 1X69A 2MCNA 3VUBA 3L2WA 1EX4A 2QTXA 1VQLA 1K8AR 1OQKA 3EG3A 5HK3A 3VRZA 2B8AA 4F16A 1RAAB 4JRKA 2ZCFB 3FDRA 4AT1B 2L0AA 2QQSA 2F5KA 2RJEA 4Y92A 4OB0B 3EG9A 5GAN5 1GFCA 3OBYA 1IB8A 1VQ6T 1PNJA 5GAOr 2LX7A 1U5SA 2L5QA 4ZN3A 3JCMc 4RKUE 5D6WA 1FMWA 1HJDA 1Q81U 4M7DF 1TUCA 3PFSA 3JCMP 2BZ8A 4HCBA 1GL5A 3M5AA 2X4YA 1VQ7Q 3CEYA 2KXDA 1Y96B 2J6KA 4XAXB 5LJ3g 1Q82R 2X3WD 3JV3A 5GAMh 5D7UA 1Q86R 4C8QA 5L23A 3OYEA 3EG1A 2LX9A 5ECAA 4FCYA 3L42A 3J81E 1B3QA 1M90U 1KSWA 1YN8A 4C92E 1K73C 1RADB 2COWA 3NTKA 4JS4A 2P0PA 1TH7A 5GAN7 1YIJQ 2F2WA 5FWBA 4KULA 5GAMe 1GCQC 1M2VA 2CZ1B 4MDWA 5GAMj 4M77D 2BUDA 2EYYA 1BCMA 1C0MA 4ZNXA 2VKNA 2EKHA 3VRYA 3VV0A 4JJCA 4JS5A 3SWNA 1F1BB 1U1SA 1GBRA 3NGPA 1YJWQ 2OTJT 1J3TA 1ZLMA 1M2OA 3CCJT 1WHKA 1QVGP 1H3ZA 1LOJA 1E6HA 1UDLA 3OYBA 1XNIA 3VS5A 1R0CB 2PVDB 3HPWA 1B34A 1IO6A 4PJOA 3D7SB 2CS7A 4FYYB 3X25B 2CZ0B 3JB9I 3HHTB 5GMKi 4BDZA 1U3OA 4AFUC 2KRNA 4PJOD 1QLYA 1VQ8A 1SSHA 3A1PA 3OYHA 1UHFA 3CPFA 1C1AA 2HDAA 3FLGA 2XD0A 3LGLA 3C94A 2O9SA 2KDSA 1XQHA
chains in the Genus database with same CATH topology
2EWNA 1UGPB 4BDYA 1BI0A 4GY5A 2YHTA 3S3NA 1O9SA 5KCOA 2K2VA 1VQ9T 1W4SA 3CCEA 5L8RE 2I2LA 4JUVA 5A0DA 3OYLA 3G6ET 2XIDA 2L8DA 2RHIA 5CR2A 2VXEA 4QVZA 5J39A 2EJGA 4M77F 1Y07A 3LLRA 3SDZA 4YTLA 4PNOA 3VYGA 4M7AC 1VUBA 2ZPGB 2K5FA 2V8JA 5CCAA 1JJ2A 2XKOC 1R8OB 1YBYA 3PT9A 4M7AB 1VQ7A 4M7DE 1Q7YC 1VIEA 1BI2A 2P0QA 2K5IA 1VQMA 4FL6A 1UGSB 2E10A 4XTYA 4R55A 2VXFA 2MI6A 2FYKA 4BE2A 3EFSA 2QXFA 4M7AG 3L2UA 1KG1A 4WF2A 4C0ZA 4A54A 4NL2A 1BIAA 4XQ3A 2XDDA 2KMTA 3SD4A 1XTDA 2M16A 4QVCA 3FEOA 1I8FA 3A8GB 2WSCE 3LWHA 4JJNK 3DLMA 3OA6A 2X4XA 5CKFA 4C92G 5LJ5d 2E70A 5KE2A 3FC3A 2LDMA 1KD1U 2LT4A 3OSSC 1KQSS 4JLIA 1N6AA 3I55A 2F5TX 4BI3A 5D6YA 1Q81C 4Y28E 3CXCA 5C6SA 4KUDK 4E47A 2G3RA 1YIJA 1OI1A 4MZMA 4C5IA 3JB9G 1K9MU 4HT9A 4J6YA 4X34A 1M4ZA 4F7UB 2PVOB 4LD6A 4N4HA 2RD1A 3TREA 1YITT 1VQKA 2VYTA 2DD4A 4PJOE 5CKHA 3MP6A 3R6OA 2DIGA 4A4EA 3QHSA 1OZ2A 3DB3A 5LJ3h 2HNIA 4B9WA 5DM7R 1WJSA 3J80E 1VQ8T 2OTLA 2HBPA 3M55A 3JCMW 1QVPA 3HRSA 3PNWC 4LDYA 4M77A 2ZPFB 5GAOq 5DLOA 3BY7A 2RJFA 2R57A 3M4YA 3PIOA 4ZGEB 2CYZB 2DTHA 4PLIA 1YHQA 4RCCA 5CKBA 3C4SA 3H6ZA 4A53A 2DAQA 1I81A 5C0MA 1S72A 1K8AU 2EJFA 3QIIA 2DKGA 3LYIA 1YJWA 1U1TA 2KSSA 3UWNA 3OMGA 3CCET 2JVVA 3H8ZA 4E7KA 1M90C 5J26A 4IUUA 2K5LA 4OB1B 3LW5E 2WACA 2V8IA 5CIUA 3OS5A 2O4XB 2RA2A 3CBMA 5LJ3j 5A2QE 4CI0C 1NZ9A 4J6WA 2PVGB 5GAN3 1M5Q1 3O8VA 1BYMA 2RJCA 3RIRA 4HT8A 5FLXE 2HQEA 4XTUA 1NPPA 3OY9A 2RB6A 2DPPB 4ZTFA 1YJ9A 2RI5A 3RMQA 2R58A 3NTIA 5CO7A 3WVEB 2XDPA 1VQ7T 2DTOA 3JCMQ 1M9SA 3ASKA 1VQMT 3A8MB 2AHJB 1H641 4M78C 1UGQB 4HCZA 1HK9A 2H3JA 2OAUA 4JRIA 4HKEA 4M78B 2WSFE 4C8QC 3OYYA 3A8LB 1QP3A 1UEBA 2BIVA 4X9DA 4ELZC 3QXEB 2CGHA 1X01A 2ZPEB 3E9GA 4C8QB 4XU3A 3UT1A 4OGCA 1JRIA 5GMKm 4OF1A 3CMEA 3M59A 5D6XA 3OB9A 3FRNA 3KXTA 1MGQA 1WNLA 4OMFB 3L2QA 1N9RA 2MMPA 3QO3A 4XTVA 1LJOA 1WPYA 4C8QG 1YCYA 5GAMd 5GAOm 2E64A 4PKCC 5HY6A 5GAN8 2RK1A 3CCVT 3I55T 2L3RA 3S3OA 3JCMd 3C12A 5GANd 3QBYA 3LX7A 1YIJT 2QDYB 2QQRA 4MZTA 4M7DC 3GP8A 3VKIA 5KE3A 1IZ6A 5GMKh 1VQKT 3AHUA 4M7DB 2ZPHB 4XTWA 3OYAA 1AHJB 3L1AA 1MHNA 3MP1A 3OYIA 4JRQA 3E9FA 3MEAA 1Q82U 5CKEA 4OB3B 5I21A 2BKDN 5A0LA 3SWNC 2OTLT 4J7FA 4E7JA 4KT0E 2R5AA 3P8HA 3QG1A 4C0FA 1Q86U 3SWNB 4M7DG 1HXDA 3OYFA 2LCCA 5GAOn 4C0GA 4EMKC 2LQ8A 1YHQT 3BW1A 1Y71A 2PUOB 4EMKB 1S72T 1QVGA 1G3YA 3GIBA 2LVMA 4LDWA 2A7YA 4M77E 5CQXA 3ZEHA 4RG8A 4J5YA 5GMKe 1YJWT 5FROA 1W2BS 1G5VA 3GLXA 2F69A 5GMKl 3HP9A 5GMKj 4C5HA 4LDXA 3OQ5A 3CPWS 2DZ9A 4OGEA 3RMSA 1VQ4T 1M8VA 5FRNA 4PJOC 1Y96A 1B34B 2KQWA 4PJOB 2KY9A 2VGMA 3HRTA 3KUFA 3OYMA 4IUPA 1YJ9T 1NPRA 2XI9A 1EIFA 3X26B 1VQPA 2DK3A 2E6ZA 4M78F 4C92C 4PJOG 3EFRA 4KBMB 2ZZDA 1O75A 4RCBA 2CZ6B 2XK0A 4BUGA 3T9NA 3M53A 4C92B 2RHZA 2EKOA 3PMTA 1BI3A 4RG2A 3OYGA 4UC4A 3S3MA 4M75F 3OW2S 3HFOA 4IUQA 2Y90A 3LGFA 3GPLA 2PQWA 2ZPIB 3FIFA 1IREB 1ZBXA 3TEEA 3MP8A 3DLLA 3V8LA 3JCMJ 3CMET 4ZGJB 3E19A 4DQ2A 2A3LA 3M9QA 3MCAB 2KVQG 2E5QA 2C06A 4LDVA 4BD3A 4FT2A 3CD6A 2JTFA 2PU9B 3L2ZA 3CC2A 3PTAA 3QZ9B 5GAN6 2GCXA 2DD5A 3JAME 3L2RA 3CMAA 3EAEA 2XDBA 3JCMb 1NE8A 3QYGB 3QUIA 3A5ZB 3M56A 2EFIA 3Q1JA 4RMOA 2YLBA 3CCLA 4C0DC 3QZ5B 3UPUA 5LJ5f 4II1A 5I2MA 1KD1C 3PIPA 5GAMg 2E65A 4C0DB 4N0AA 1OZ3A 3CCRA 4PL6A 4A4FA 1I4K1 2QA4T 5KCHA 1WGSA 2DEQA 3GOXA 2K3XA 3JCMg 1VIFA 1YJNA 5GANg 3S6WA 1K9MC 2RJDA 4QQ6A 3QJ6A 4XU1A 1K73U 4J8OA 1KC8C 4HCCA 3BDUA 4LD9K 4OP0A 2ZPBB 3QYHB 3RUXA 2QQBA 4HA8A 2X35A 1FWZA 2Y4XA 3GNFB 4NOYA 4B9XA 3CCSA 3TU4K 3DB4A 1QVFA 2RI2A 1M1FA 2LRQA 3ZBDA 2DTIA 3HFNA 1JJ2S 1GXIE 3JCMh 3URGA 3OS0A 1KQ2A 2K57A 4M75A 2VV5A 3I56A 4X9CA 3X24B 4O6JA 2E6NA 4FU6A 1V29B 4M7AF 2LNVA 2E41A 2D9TA 3BDLA 3M58A 2EQJA 4M78D 3OS1A 1K8AC 3NFCA 3JB9H 4C8QD 2VGNA 2VC8A 4A4GA 3QKJA 3CBOA 3OS2A 3CCUA 2MAMA 4M75D 4P5NA 5FU6C 2GFAA 4J7IA 5I2SA 2RK2A 5CAIA 1VQPT 3OMCA 4ME7A 5J3BA 3RKYA 4DOWA 1FXXA 1ZHIA 2MWOA 4FSXA 3QJYA 3NTHA 5FU6B 4BI8B 3JCMe 4JDSA 3CC4A 1VQ5A 1D3BA 5CVIA 5GAOp 3RKXA 2IG0A 3JRZA 1NJIU 2MWPA 4N0AC 1G3SA 3CXCS 2DXUA 3G4SA 3M57A 1BIBA 4M77C 1VQ6A 3JB9F 2LCLA 4F7UE 3RERA 1XOVA 1OYXA 2LQKA 2RHXA 2DVEA 3CBPA 4M77B 3OYCA 4E7LA 4VUBA 3LH0A 2PUKB 4JRPA 3DKMA 4MDXA 2K3YA 3P8DA 4F7UF 1RL2A 3V8JA 3CD6T 3CCMA 4M77G 2KK4A 5LJ3d 4R56A 3CC7A 3CC2T 4IURA 4Q5WA 4E7HA 3CMAT 1N27A 3G7ZA 4LDUA 3X20B 5CK9A 3GNGA 4CRIA 5LJ5g 2IVWA 5IAYA 3RESA 2DO3A 1N8RU 5M9OA 4L59A 5HK0A 1M1GA 5FRMA 2DXCA 1QP2A 1VQOA 1M1KU 5GAMf 2ZGWA 2FB7A 3CCRT 3FB9A 4M7AA 4L6V5 2GF7A 4A4KA 2JN0A 4GLKA 3CCQA 2FHDA 3A8OB 2EQMA 4ATOA 4FM4B 4BI4A 5LJ5h 4BACA 1KQ1A 3JCMf 5GAN4 1YJNT 1PSEA 5EG2A 5GANf 3MO8A 3GF5A 5HKCA 1G3WA 3VUBA 4BE1A 3WXMB 3L2WA 1Q82C 2X4WA 4M7AD 1G3TA 1FX7A 2QTXA 3OSVA 3M4GA 3CCST 1VQLA 1KHCA 4BB7A 1Q86C 5HK3A 3MHXA 2LC4A 1N9SA 2CZ7B 3MEWA 5GAOl 4C92D 2B8AA 4N4GA 3I56T 1I5LA 4JRKA 4M78E 3META 5LJ5e 4OVAA 4TVRA 3X28B 4C8QE 2ZCFB 2XHCA 2P0KA 5LJ5j 3P8BB 3FDRA 5KH6A 4M75E 4IUTA 1QW1A 1UB4A 4EDUA 4F7UA 3CCUT 3E1SA 1Q7YU 2QQSA 4C8QF 2F5KA 3MEUA 3JB9D 4L5GA 3G71A 1Y7XA 2RJEA 3C95A 1ZQ1A 1JB0E 2O01E 4OB0B 5DY9A 1WQWA 5A0GA 3LWIA 3CC4T 3OYNA 5IT9E 1VQ5T 2E12A 4BY6C 1UGRB 2EQUA 5GAN5 1YI2A 4BY6B 3OBYA 2DXBA 3G4ST 3UDCA 2M9UA 1KHIA 4KUIA 5GAN2 1VQ6T 3JCMX 1P92A 4XTXA 3VJPA 2OTJA 4Y91A 2GFUA 5GAOr 1WJRA 4J6XA 2GQVA 4O5VA 3MEVA 3CCJA 2M0OA 2L5QA 2RHUA 3JCMc 4A4HA 4RKUE 5D6WA 4ZN3A 2QEXA 4V2SA 4J83A 3CCMT 1Q81U 4M7DF 2WSEE 4QVDA 2R5MA 3CC7T 3ER0A 2EQKA 3VUZA 3HSBA 2RO0A 4XTZA 3QSUA 1RI0A 3TCJA 3V7SA 3HKSA 3PFSA 2JZ2A 2O4XA 3JCMP 4HCBA 3QPHA 3OYJA 2Y4YA 3M5AA 2X4YA 2QQAA 2RI3A 3CEYA 3M54A 1QVGS 4EMGA 3V7RA 1VQOT 2XU8A 4IUVA 1Y96B 2VUBA 4XAXB 3CCVA 5LJ3g 1BI1A 3CCQT 2L89A 2FVUA 1X6OA 2FL7A 2P4TA 2RH2A 3OYKA 4ZGDB 2RM4A 5GAMh 2JUFA 3FJPA 4M78A 4MMKA 3OBWA 2D6FA 1KC8U 4C8QA 3N5BB 3OYEA 4M7AE 1VQNA 2E1HA 1DJ7B 2LX9A 3A8HB 5GANh 3L42A 3J81E 1VQLT 1BKBA 2DZCA 4F7UG 2YRVA 4PJOF 1M90U 4FIBA 4QW2A 4IKFA 2QQ9A 4C92E 1K73C 3NTKA 4XK8E 4JS4A 2YLCA 4ZTJA 2P0PA 1TH7A 5GAN7 2DJZA 3F70A 1VQ9A 4KULA 1SSFA 2EIFA 5GAMe 2LTOA 3V7CA 4C92F 4ZN1A 2CZ1B 3QDRB 3G6EA 4MDWA 5FU7C 3PMIA 2RHYA 4M77D 2BUDA 4OB2B 2LT1A 4EPCA 4DOVA 5GAMj 4E7IA 2HAXA 4M7DA 2JNGA 5FU7B 5LJ3e 2KAFA 5GANe 4QQDA 2MF2A 2XICA 3JCMV 3WVDB 3VV0A 4PLLA 3G71T 3HRUA 4BE0A 1VQ4A 4N4IA 5GANj 4JS5A 5CKDA 2EYQA 3SWNA 1W2BA 4QQGA 3VYHB 5LL6S 3HL8A 3JSCA 1U1SA 1YI2T 4M7DD 3CPWA 2HD0A 2OTJT 3INZA 4XU2A 2EJ9A 1X75C 4EMKA 4XU0A 1LNXA 2V8KA 3CCJT 1NJIC 3JB9J 2QEXT 4MZPA 1H3ZA 1LOJA 3BFMA 3OYBA 1WJQA 1XNIA 4D6WA 4M75C 2HQXA 3CCLT 3KBGA 3ME9A 2PVDB 3HPWA 4M78G 1B34A 4M75B 3V8KA 4PJOA 2NLUA 2XG8D 2CS7A 3VU3C 1QVFS 3OW2A 5IN1A 5DLQE 3X25B 3PGGA 4ELYC 2CZ0B 1JBMA 2JOYA 4M75G 3SFMA 3JB9I 3HHTB 4FT4A 5LJ3f 5GMKi 2EAYA 2D0QB 3ZFJA 4BDZA 2DXTA 1YITA 4C92A 1N8RC 2M1HA 2DIQA 2QI2A 3RKWA 4PJOD 1KQSA 4JLGA 4NS5A 2CKKA 5AYFA 1VQ8A 3OYHA 4Z02A 3L2VA 1M1KC 1D3BB 4C5EA 4DA4A 2QA4A 3CPFA 1VQNT 2K4YA 3FLGA 2XD0A 4C5GA 3LGLA 1U8RA 3C94A 5CQYA 3J7AF 1PSFA 4EMHA 3OYDA 4MMLA 1WQ7A 4NL3A 2X4JA 2KDSA 3SB2A 1XQHA 2JTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDY A;  4GY5 A;  3S3N A;  5KCO A;  1VQ9 T;  3CCE A;  3OYL A;  3G6E T;  2L8D A;  2RHI A;  4QVZ A;  5J39 A;  3LLR A;  4YTL A;  1JJ2 A;  1YBY A;  1VQ7 A;  1Q7Y C;  1VQM A;  4FL6 A;  2MI6 A;  4BE2 A;  3L2U A;  3SD4 A;  1XTD A;  2M16 A;  3FEO A;  3DLM A;  3OA6 A;  2X4X A;  2E70 A;  5KE2 A;  3FC3 A;  2LDM A;  1KD1 U;  1KQS S;  3I55 A;  1Q81 C;  5D6Y A;  3CXC A;  5C6S A;  2G3R A;  1YIJ A;  1OI1 A;  4C5I A;  1K9M U;  4X34 A;  1VQK A;  1YIT T;  4LD6 A;  4N4H A;  3TRE A;  2VYT A;  3MP6 A;  2DIG A;  4A4E A;  1OZ2 A;  3DB3 A;  5DM7 R;  3J80 E;  1VQ8 T;  2OTL A;  1WJS A;  4B9W A;  3PNW C;  2RJF A;  2R57 A;  3PIO A;  4PLI A;  1YHQ A;  3C4S A;  3H6Z A;  1S72 A;  1K8A U;  2DAQ A;  5C0M A;  3QII A;  1YJW A;  3LYI A;  3UWN A;  3OMG A;  3CCE T;  2JVV A;  3H8Z A;  1M90 C;  4E7K A;  5J26 A;  4IUU A;  5CIU A;  2WAC A;  2O4X B;  5A2Q E;  1NZ9 A;  3O8V A;  2RJC A;  5FLX E;  2HQE A;  1NPP A;  3OY9 A;  1YJ9 A;  4ZTF A;  2RI5 A;  2R58 A;  3NTI A;  2XDP A;  1VQ7 T;  1VQM T;  3ASK A;  4HCZ A;  3OYY A;  1UEB A;  2BIV A;  3E9G A;  3UT1 A;  3CME A;  5D6X A;  3OB9 A;  3L2Q A;  5HY6 A;  3CCV T;  3I55 T;  2L3R A;  3S3O A;  3QBY A;  3LX7 A;  1YIJ T;  2QQR A;  5KE3 A;  1IZ6 A;  1VQK T;  3OYA A;  1MHN A;  3MP1 A;  1Q82 U;  3OYI A;  3E9F A;  3MEA A;  2BKD N;  2OTL T;  4E7J A;  2R5A A;  3P8H A;  1Q86 U;  3OYF A;  2LCC A;  2LQ8 A;  1YHQ T;  1S72 T;  1QVG A;  2LVM A;  3ZEH A;  1G5V A;  1YJW T;  1W2B S;  5FRO A;  4C5H A;  3OQ5 A;  3CPW S;  1VQ4 T;  5FRN A;  3KUF A;  3OYM A;  4IUP A;  1YJ9 T;  1NPR A;  1EIF A;  1VQP A;  2E6Z A;  2XK0 A;  3OYG A;  2RHZ A;  2EKO A;  3PMT A;  4RG2 A;  4UC4 A;  3S3M A;  3OW2 S;  4IUQ A;  3LGF A;  2PQW A;  3MP8 A;  3DLL A;  3CME T;  3M9Q A;  2KVQ G;  2E5Q A;  4BD3 A;  3CD6 A;  2JTF A;  3CC2 A;  3JAM E;  3CMA A;  3L2R A;  3EAE A;  3A5Z B;  2EFI A;  3Q1J A;  3CCL A;  1KD1 C;  4II1 A;  3PIP A;  1OZ3 A;  3CCR A;  4PL6 A;  4A4F A;  2QA4 T;  5KCH A;  1WGS A;  3GOX A;  2K3X A;  1YJN A;  3S6W A;  1K9M C;  2RJD A;  4QQ6 A;  1K73 U;  3QJ6 A;  1KC8 C;  2X35 A;  4B9X A;  3CCS A;  1QVF A;  3DB4 A;  2RI2 A;  2LRQ A;  1JJ2 S;  3OS0 A;  3I56 A;  2E6N A;  4FU6 A;  3BDL A;  2D9T A;  1K8A C;  3OS1 A;  2EQJ A;  4A4G A;  3CCU A;  3QKJ A;  3OS2 A;  2GFA A;  1VQP T;  3OMC A;  5J3B A;  5KH6 A;  2MWO A;  3NTH A;  3CC4 A;  1VQ5 A;  2IG0 A;  1NJI U;  2MWP A;  3CXC S;  3G4S A;  1VQ6 A;  2LCL A;  1OYX A;  3OYC A;  2RHX A;  4E7L A;  3LH0 A;  2K3Y A;  3P8D A;  1RL2 A;  3CD6 T;  3CCM A;  3CC2 T;  3CC7 A;  4IUR A;  4Q5W A;  3CMA T;  4E7H A;  1N27 A;  4CRI A;  5IAY A;  2DO3 A;  1N8R U;  5M9O A;  4L59 A;  1M1G A;  5FRM A;  1VQO A;  1M1K U;  3CCR T;  3CCQ A;  2GF7 A;  2FHD A;  2EQM A;  4BAC A;  1YJN T;  3MO8 A;  4BE1 A;  3L2W A;  1Q82 C;  2X4W A;  1VQL A;  3CCS T;  1KHC A;  1Q86 C;  3MEW A;  3I56 T;  2B8A A;  4N4G A;  3MET A;  4TVR A;  4OVA A;  2XHC A;  2P0K A;  3P8B B;  3FDR A;  3CCU T;  4IUT A;  4EDU A;  1Q7Y U;  2QQS A;  2F5K A;  3MEU A;  3G71 A;  2RJE A;  3CC4 T;  5IT9 E;  1VQ5 T;  3OYN A;  2EQU A;  1YI2 A;  3G4S T;  1VQ6 T;  1KHI A;  2OTJ A;  2GFU A;  1WJR A;  3MEV A;  3CCJ A;  2M0O A;  4ZN3 A;  2RHU A;  4A4H A;  2QEX A;  5D6W A;  1Q81 U;  3CCM T;  3CC7 T;  2R5M A;  3ER0 A;  2EQK A;  2RO0 A;  1RI0 A;  3HKS A;  3PFS A;  2JZ2 A;  2O4X A;  3OYJ A;  2X4Y A;  2RI3 A;  3CEY A;  1QVG S;  1VQO T;  4IUV A;  3CCV A;  3CCQ T;  2L89 A;  1X6O A;  3OYK A;  2JUF A;  1KC8 U;  3OYE A;  1VQN A;  3L42 A;  3J81 E;  1VQL T;  1BKB A;  2YRV A;  1M90 U;  4QW2 A;  4IKF A;  1K73 C;  3NTK A;  4ZTJ A;  3F70 A;  1VQ9 A;  1SSF A;  2EIF A;  4ZN1 A;  2LTO A;  3G6E A;  3PMI A;  2RHY A;  2BUD A;  4E7I A;  2JNG A;  4QQD A;  3G71 T;  1VQ4 A;  4PLL A;  4BE0 A;  4N4I A;  1W2B A;  4QQG A;  5LL6 S;  1YI2 T;  3CPW A;  2OTJ T;  3CCJ T;  1NJI C;  2QEX T;  1H3Z A;  3OYB A;  1WJQ A;  1XNI A;  3CCL T;  2HQX A;  3KBG A;  3ME9 A;  2NLU A;  1QVF S;  3OW2 A;  5IN1 A;  5DLQ E;  2JOY A;  4BDZ A;  1YIT A;  1N8R C;  2M1H A;  2DIQ A;  1KQS A;  4NS5 A;  2CKK A;  1VQ8 A;  3OYH A;  4Z02 A;  3L2V A;  1M1K C;  1VQN T;  4C5E A;  2QA4 A;  3CPF A;  3FLG A;  4C5G A;  3LGL A;  3J7A F;  3OYD A;  2KDS A; 
#chains in the Genus database with same CATH topology
 2EWN A;  4GY5 A;  2YHT A;  1O9S A;  5KCO A;  2K2V A;  1VQ9 T;  1W4S A;  2Z0W A;  4LUE A;  5L8R E;  4Z88 A;  2I2L A;  1Z9Z A;  4QVZ A;  5J39 A;  2E5K A;  2EJG A;  3SHW A;  1Y07 A;  1PM3 A;  3VYG A;  2ZPG B;  2K5F A;  5CCA A;  4M7D E;  1BI2 A;  2P0Q A;  4BE2 A;  5IH2 A;  4NL2 A;  1RAB B;  1XTD A;  2M16 A;  3A8G B;  3LWH A;  3DLM A;  4C92 G;  2EQI A;  2NUP B;  3SEM A;  2LDM A;  1N8R R;  4JLI A;  4Y28 E;  2L3S A;  5C6S A;  1WXU A;  2M0Y A;  1M1K R;  2JTE A;  4J6Y A;  1M4Z A;  6AT1 B;  1CKB A;  2DD4 A;  3REA B;  3R6O A;  1GRI A;  1OZ2 A;  3DB3 A;  5LJ3 h;  4B9W A;  1QKX A;  2HBP A;  1XJW B;  5DLO A;  2R57 A;  3M4Y A;  2W10 A;  1PC0 A;  2DTH A;  4PLI A;  1YHQ A;  5CKB A;  1BBZ A;  1PRM C;  1T0H A;  1WIE A;  1S72 A;  3QII A;  3R6N A;  3VS6 A;  3NMZ C;  1WXT A;  2L2P A;  3UWN A;  3OMG A;  4OMO A;  2V1Q A;  5EC7 A;  2OTL Q;  2JVV A;  5J26 A;  2A36 A;  2O4X B;  3CBM A;  5LJ3 j;  4J6W A;  2YUP A;  1M5Q 1;  3O8V A;  2BE9 B;  5GJW B;  2K7A A;  1NPP A;  3OY9 A;  4E7S A;  1K1Z A;  3EG0 A;  1VQ7 T;  2DTO A;  5KYX A;  2AHJ B;  2YT6 A;  1V76 A;  1HK9 A;  4JRI A;  2YUO A;  3OYY A;  4LE9 A;  1UEB A;  2AZV A;  2JMC A;  2CGH A;  3E9G A;  1QMC A;  2X51 A;  3M59 A;  1Q81 R;  3OB9 A;  3FRN A;  3KXT A;  2VWF A;  1MGQ A;  1WNL A;  4RTX A;  1LJO A;  3EHR A;  1YCY A;  2E64 A;  4AFS C;  4JJD A;  5HY6 A;  2L3R A;  2SRC A;  3JCM d;  3CC4 Q;  1VQ5 Q;  5GAN d;  1YIJ T;  4M7D C;  3GP8 A;  5GMK h;  3CME Q;  4M7D B;  4XTW A;  3OYA A;  1MHN A;  3MP1 A;  4JRQ A;  3EFO B;  8AT1 B;  5KYY B;  2AKL A;  4RTT A;  4E7J A;  3P8H A;  4M7D G;  1HXD A;  1JXM A;  5GAO n;  3CCM Q;  4EMK C;  2LQ8 A;  1M90 R;  2PUO B;  4EMK B;  4F17 A;  1QVG A;  1D1A A;  5GMK e;  1YJW T;  5FRO A;  1JU5 C;  5GMK j;  1X6B A;  3RMS A;  1PCX A;  3PVL A;  4FW1 A;  1EIF A;  2PZ1 A;  2NYS A;  2DK3 A;  4KBM B;  4AFZ C;  2NUZ A;  2JS0 A;  2RHZ A;  4RG2 A;  3S3M A;  2ZPI B;  3FIF A;  4RUG A;  2QAS A;  1MV3 A;  3DLL A;  4ZGJ B;  3E19 A;  4DQ2 A;  2E5Q A;  3CD6 A;  2JTF A;  2PU9 B;  3CC2 A;  1UG1 A;  1H92 A;  4PJN A;  1PD1 A;  4C0D C;  1B07 A;  1TUG B;  2E3I A;  4PFZ A;  1E6G A;  4C0D B;  3CCR A;  4PJM A;  4A4F A;  1WYX A;  4IIO A;  1YJN A;  3CMA Q;  4QQ6 A;  1K73 U;  4J8O A;  3CPW P;  4LXC A;  3C0C A;  2X35 A;  2NUT B;  2Y4X A;  4B9X A;  4WTO B;  2HZY A;  3CCS A;  2FEI A;  3DB4 A;  2RI2 A;  2LRQ A;  3ZBD A;  1EZZ B;  1JJ2 S;  3JCM h;  4CC4 B;  4DBQ A;  4M4Z A;  4X9C A;  4O6J A;  2E41 A;  4FYX B;  2DVJ A;  3M58 A;  2VGN A;  3QKJ A;  3CBO A;  3OS2 A;  3CCU A;  3OW2 P;  2MAM A;  4P5N A;  5FU6 C;  2GFA A;  4J7I A;  2MIO A;  5CAI A;  3OMC A;  5J3B A;  1FXX A;  5FU6 B;  4BI8 B;  3JCM e;  1FMK A;  5CVI A;  4ANJ A;  1K9A A;  2JT4 A;  3JRZ A;  1ZSZ A;  3JB9 F;  2LCL A;  2K3B A;  1XOV A;  3CBP A;  1AWX A;  4E7L A;  4VUB A;  4JRP A;  2K3Y A;  3P8D A;  1RL2 A;  3V8J A;  4OMN A;  1WDX A;  2IVW A;  1M1G A;  1RAE B;  3EH2 A;  3EGD B;  1VQO A;  5GAM f;  2ZGW A;  4F14 A;  1KC8 R;  1YFN A;  3MJX A;  4M7A A;  4L6V 5;  2JN0 A;  1SHG A;  2FHD A;  2EQM A;  1EFN A;  5LJ5 h;  1NYG A;  2YSQ A;  3MO8 A;  3GF5 A;  1G3W A;  1X43 A;  4BE1 A;  1UJ0 A;  3WXM B;  4M7A D;  1G3T A;  3M4G A;  4BB7 A;  1JEG A;  2CZ7 B;  1I5L A;  3VS3 A;  1D1B A;  3MET A;  2DRM A;  5LJ5 e;  4C8Q E;  2HCK A;  4RTU A;  3EGX B;  2P0K A;  3I5R A;  5LJ5 j;  3P8B B;  3M0T A;  4F7U A;  1VQ8 Q;  4EDU A;  1M3A A;  3CXC P;  2EPD A;  3MEU A;  3G71 A;  1JB0 E;  3CC4 T;  3LWI A;  1VQ5 T;  2EQU A;  2DXB A;  3G4S T;  2J06 A;  1KHI A;  4KUI A;  1P92 A;  2EYZ A;  1WJR A;  2QYZ A;  4O5V A;  2M0O A;  2RHU A;  2QEX A;  2P84 A;  2VAS A;  3CCM T;  2WSE E;  4QVD A;  3ER0 A;  3QSU A;  2DL4 A;  3TCJ A;  3V7S A;  2K9G A;  3OYJ A;  2C0O A;  1GFD A;  1D1C A;  2MPX C;  1T3S A;  1W70 A;  1X6G A;  3M54 A;  3CCV A;  1BI1 A;  1VOM A;  1X6O A;  2FL7 A;  2P4T A;  2RH2 A;  2GQI A;  4E2F B;  2JW4 A;  4M78 A;  2YDL A;  2D6F A;  2CP5 A;  5KYN A;  3N5B B;  1VQN A;  2YRC A;  1SPK A;  1UE9 A;  3A8H B;  1VQL T;  2DZC A;  4KGV B;  4QW2 A;  2QQ9 A;  2W0Z A;  4XK8 E;  2CRE A;  4ZTJ A;  2DM1 A;  2FZC B;  2DJZ A;  4KH0 B;  4C92 F;  5FU7 C;  3PMI A;  2RHY A;  2JJ9 A;  4DOV A;  5FU7 B;  3JCM V;  2XIC A;  3WVD B;  4BE0 A;  1VQ4 A;  3HRU A;  2DLP A;  2O2O A;  5CKD A;  1YHQ Q;  3HL8 A;  2HSP A;  2V1R A;  3CPW A;  1M27 C;  3O5Z A;  2EJ9 A;  1X75 C;  1LVK A;  4HCK A;  1QQJ A;  4XU0 A;  1WFW A;  2V8K A;  1NJI C;  1HD3 A;  1PWT A;  2ROT A;  1LCK A;  4RTZ A;  4D6W A;  2YUN A;  1BB9 A;  3V8K A;  1YCS B;  2XG8 D;  1TOV A;  3VU3 C;  1QVF S;  3OW2 A;  5IN1 A;  2DJQ A;  1QWF A;  1PG5 B;  1JBM A;  1AWO A;  5LJ3 f;  1YIT A;  4FSS A;  2DIQ A;  1VA7 A;  3AT1 B;  2CKK A;  1K73 R;  2QA4 A;  3M0R A;  2DEU A;  1U8R A;  2IIM A;  4EMH A;  3M0U A;  1CKA A;  4NL3 A;  3VS2 A;  1ABO A;  1UGP B;  3M0P A;  1BI0 A;  4BDY A;  3EH1 A;  2KRO A;  3CCE A;  4JUV A;  3OYL A;  2DIL A;  1KJW A;  4DEX A;  3SDZ A;  2HSE B;  4PNO A;  4YTL A;  1VUB A;  3PT9 A;  2CUD A;  1VQM A;  2RF0 A;  2E10 A;  5KYU A;  5KYW B;  3EFS A;  2QXF A;  3H41 A;  2CSQ A;  2KGT A;  1BIA A;  4XQ3 A;  3BE3 A;  4J9D A;  3SD4 A;  2B86 A;  1OU9 A;  2OX7 A;  1QWE A;  2LT4 A;  3CQT A;  1AD5 A;  1N6A A;  2PNI A;  3I55 A;  2F5T X;  1B7T A;  1MND A;  3CXC A;  4E47 A;  1IHV A;  2G3R A;  2KR3 A;  4C5I A;  3JB9 G;  3UF4 A;  2KE9 A;  4X34 A;  1VQK A;  4LD6 A;  2VYT A;  1M3C A;  1QCN A;  5CKH A;  2DIG A;  1VQ8 T;  3J80 E;  3M55 A;  3JCM W;  4M77 A;  3HRS A;  4LDY A;  3CD6 Q;  2RJF A;  3CC2 Q;  1IGU A;  2CYZ B;  2G6F X;  4A53 A;  2DAQ A;  4EIK A;  2EJF A;  1KFZ A;  1RLQ C;  1U1T A;  2KSS A;  3CCR Q;  2K5L A;  1YWP A;  2CP6 A;  5CIU A;  2ED1 A;  5A2Q E;  1NZ9 A;  5GAN 3;  3TVT A;  2HBW A;  2H8H A;  3RIR A;  4HT8 A;  2HQE A;  1R0B G;  2RB6 A;  2DPP B;  4ZTF A;  1YJ9 A;  3RMQ A;  5CO7 A;  2XDP A;  3ASK A;  1UGQ B;  3UA6 A;  4HKE A;  3A8L B;  2ZPE B;  4XU3 A;  3UT1 A;  2LJ3 A;  4OF1 A;  5D6X A;  1V1C A;  3L2Q A;  3QO3 A;  5GAO m;  3I35 A;  1AEY A;  5GAN 8;  1G83 A;  2YXY A;  2P4R A;  3C12 A;  2K79 A;  1TG0 A;  3LX7 A;  3QBY A;  4MZT A;  3L1A A;  3OYI A;  4OB3 B;  2XMF A;  2R5A A;  2JXB A;  1M30 A;  4HXJ A;  1M3B A;  2RQR A;  3I5S A;  1YHQ T;  3BW1 A;  1Y71 A;  2FPE A;  2YRD A;  1S72 T;  1PHT A;  2KI7 A;  3GIB A;  2LVM A;  4LDW A;  2A7Y A;  3RR6 A;  1G5V A;  1W2B S;  4J5Y A;  2OAW A;  1NBE B;  1YP5 A;  2F69 A;  5GMK l;  1VQO Q;  2DZ9 A;  2KRS A;  2ABL A;  1AT1 B;  1NEB A;  1Y96 A;  1ZUK A;  3NHN A;  1MMD A;  3OYM A;  4IUP A;  2GTO A;  2RNA A;  4M78 F;  4C92 C;  3EFR A;  4RCB A;  2ZZD A;  1WHM A;  4C92 B;  3T9N A;  2CP2 A;  1SRL A;  2A0F B;  4UC4 A;  4M75 F;  3HFO A;  4IUQ A;  2Y90 A;  2PQW A;  1W1F A;  4JZ3 A;  1ZBX A;  3M0Q A;  3V8L A;  2A3L A;  3MCA B;  5IXF A;  2X9H A;  3PTA A;  5GAN 6;  1GCQ A;  3G71 Q;  2XDB A;  1G8X A;  3QUI A;  2ENM A;  3Q1J A;  3QZ5 B;  3I9Q A;  1OOT A;  4CC7 A;  5LJ5 f;  5I2M A;  4LNP A;  3PIP A;  1H3H A;  2CP0 A;  1K0S A;  1W6X A;  1VYV A;  2K3X A;  3JCM g;  1VIF A;  3TSW A;  5GAN g;  2QEX Q;  1K9M C;  2RQV A;  3QJ6 A;  4LD9 K;  2F1L A;  2GGR A;  3RUX A;  3CCL Q;  2QQB A;  3G1J A;  1FWZ A;  3GNF B;  1M1F A;  3OS0 A;  2LMJ A;  1KQ2 A;  2VV5 A;  3I56 A;  1Q95 G;  1V29 B;  2LNV A;  2YUQ A;  4FYW B;  4A4G A;  1TUD A;  5I2S A;  4DOW A;  3RKY A;  3QJY A;  3REB B;  4JDS A;  2JM9 A;  1ZSG A;  3RKX A;  1KQS P;  1NJI U;  1BIB A;  4F7U E;  3RER A;  2DVE A;  2HQH A;  1WHH A;  1K76 A;  3CD6 T;  3CC2 T;  3CC7 A;  2EBP A;  2LZ6 B;  4Q5W A;  2LQW A;  1AOJ A;  3X20 B;  5LJ5 g;  3G4S Q;  4CC2 A;  2NWM A;  2FB7 A;  1OEB A;  3FB9 A;  3CCR T;  3CCQ A;  2GF7 A;  4GLK A;  2EGC A;  3A8O B;  4ATO A;  1LPL A;  4FM4 B;  2QK0 A;  1JJ2 P;  2CSI A;  1YJN T;  2X4W A;  1FX7 A;  1M8M A;  3CCS T;  1KHC A;  1WA7 A;  1X2K A;  2NUP A;  5GAO l;  2SEM A;  1UGV A;  4C92 D;  1VYU A;  4M78 E;  1UFF A;  2XHC A;  4M75 E;  1HYO A;  1QW1 A;  4IUT A;  3CCU T;  1VQL Q;  3E1S A;  4C8Q F;  4L5G A;  3C95 A;  1S1N A;  5DY9 A;  1WQW A;  2KYM A;  3OYN A;  1UGR B;  2DF6 A;  1ZUU A;  1YI2 A;  5GAN 2;  4XTX A;  3CCE Q;  2E3H A;  4J6X A;  3MEV A;  1YWO A;  4A4H A;  4V2S A;  4J83 A;  1IGQ A;  2R5M A;  3VUZ A;  2HMA A;  3HKS A;  2O4X A;  1WX6 A;  3QPH A;  3RNJ A;  2RI3 A;  1VQM Q;  1ZUY A;  4EMG A;  3V7R A;  1VQO T;  1QCO A;  2KEA A;  3VS7 A;  2L89 A;  3OYK A;  3MKD A;  2RM4 A;  3FJP A;  1OPL A;  4MMK A;  1WZO A;  4HVU A;  2E1H A;  2E4H A;  1DJ7 B;  3FJ5 A;  5GAN h;  1CSK A;  1NLO C;  1BKB A;  4F7U G;  2YRV A;  2D0N A;  4J9C A;  4PJO F;  4FIB A;  4IKF A;  3A98 A;  2DX1 A;  2LJ0 A;  2YLC A;  3F70 A;  2QTV A;  1VQK Q;  1SSF A;  4ZN1 A;  2LTO A;  3G6E A;  2DE0 X;  4EPC A;  4OB2 B;  2LT1 A;  2HAX A;  4E7I A;  4M7D A;  2JNG A;  1D0Z A;  5GAN e;  3EFO A;  5KYY A;  3G71 T;  3IQL A;  4PLL A;  4N4I A;  5GAN j;  4DBF A;  4QQG A;  3VYH B;  5LL6 S;  4JZ4 A;  2AKK A;  1T3L A;  2J05 A;  4M7D D;  3INZ A;  2DL7 A;  2JM8 A;  4EMK A;  1BCO A;  1ARK A;  4A63 B;  1LNX A;  3JB9 J;  2QEX T;  4MZP A;  3LH5 A;  1WJQ A;  4M75 C;  3CCL T;  4LUD A;  3ME9 A;  1YJ9 Q;  4M78 G;  4M75 B;  3VS4 A;  2NLU A;  4KH1 B;  2KBT A;  4X1V A;  2AK5 A;  4AG2 C;  3PGG A;  2JOY A;  3SFM A;  4M75 G;  1OX8 A;  1WHJ A;  2M1H A;  2QI2 A;  3RKW A;  2X3X D;  1KQS A;  4JLG A;  4NS5 A;  1RI9 A;  4Z02 A;  3L2V A;  3H0H A;  1D3B B;  4C5E A;  4DA4 A;  2FZG B;  1VQN T;  4PFO A;  4DBH A;  4OMM A;  4ESR A;  3U23 A;  4MML A;  1I1J A;  3BFM A;  2X4J A;  1RAG B;  2JTM A;  2DXU A;  1WI7 A;  3S3N A;  1FMV A;  1SF9 A;  2L8D A;  2XID A;  2VXE A;  1WXB A;  4B6M A;  1JJ2 A;  2CP7 A;  2XKO C;  1YBY A;  1NJI R;  1Q7Y C;  1AZG B;  4FL6 A;  2NUT A;  2VXF A;  4R55 A;  1MMN A;  5FWC A;  4WF2 A;  1ZA2 B;  4C0Z A;  4A54 A;  4QVC A;  1QVF P;  2J6F A;  4JJN K;  3OA6 A;  2X4X A;  5CKF A;  2E70 A;  2EGA A;  5KE2 A;  3FC3 A;  4BI3 A;  4KUD K;  4MZM A;  1K9M U;  2PVO B;  1YIT T;  2RD1 A;  4E6R A;  4PJO E;  4HVV A;  4A4E A;  5DM7 R;  2OTL A;  2ATC B;  1WHL A;  2BZY A;  3EG9 B;  1QVP A;  2A28 A;  2LQN A;  2MK5 A;  4RCC A;  3C4S A;  5C0M A;  3CCE T;  2KT1 A;  3H8Z A;  4E7K A;  1AWJ A;  1OX9 A;  3PVQ A;  3EGD A;  4IUU A;  4OB1 B;  2V8I A;  2QGF B;  2C0I A;  2RA2 A;  4CI0 C;  2RJC A;  5FLX E;  4XTU A;  4QT7 A;  1S72 Q;  2ESW A;  2R58 A;  3NTI A;  1NM7 A;  3WVE B;  3JCM Q;  1M9S A;  1VQM T;  1H64 1;  2DL5 A;  4HCZ A;  1YNZ A;  2OAU A;  3THK A;  4C8Q C;  2WSF E;  4X9D A;  7AT1 B;  4C8Q B;  5GMK m;  1JRI A;  4F04 B;  3CME A;  2O9V A;  1MV0 B;  4XTV A;  2MMP A;  4C8Q G;  5GAM d;  3EGX A;  1U06 A;  3I55 T;  1BU1 A;  2FRY A;  1UTI A;  1M2V B;  4OML A;  2KYB A;  5KE3 A;  1VQK T;  3AHU A;  1MUZ A;  2ZPH B;  1QKW A;  3MEA A;  5I21 A;  5A0L A;  1Y0M A;  3SWN C;  4KT0 E;  4J9G A;  1UEC A;  4C0F A;  3SWN B;  3OYF A;  2IPO B;  4GBQ A;  4C0G A;  3CC7 Q;  2EGE A;  4RTV A;  1G2B A;  2A37 A;  4RG8 A;  3GLX A;  3HP9 A;  4LDX A;  4C5H A;  3OQ5 A;  4OGE A;  2L3P A;  5I11 A;  3CCQ Q;  2KNB B;  5FRN A;  2VB6 A;  4PJO C;  1B34 B;  2KQW A;  2O88 A;  4PJO B;  2KY9 A;  2VGM A;  3HRT A;  1YJ9 T;  2XI9 A;  3X26 B;  1VQP A;  2E6Z A;  4QKU A;  4PJO G;  4J9I A;  1R77 A;  3OYG A;  3M53 A;  2CH4 A;  2EKO A;  1BI3 A;  3PMT A;  2M02 A;  2BTT A;  2D8H A;  2LNH B;  3GPL A;  3LGF A;  4J9E A;  3TEE A;  3MP8 A;  2F2X A;  3M9Q A;  2KVQ G;  2K2M A;  4LDV A;  4BD3 A;  4FT2 A;  3L2Z A;  3QZ9 B;  2DD5 A;  3JAM E;  3L2R A;  3CMA A;  3EAE A;  1ZA1 B;  3JCM b;  4RTY A;  1AWW A;  2YLB A;  3UPU A;  1PD0 A;  1YI2 Q;  1KD1 C;  2E65 A;  1AZE A;  4N0A A;  1OZ3 A;  1I4K 1;  5KCH A;  1WGS A;  2DEQ A;  2A08 A;  4CC3 A;  1W2B P;  2RQT A;  2RJD A;  4XU1 A;  2RMO A;  2DER A;  2EVR A;  2ZPB B;  3QYH B;  2K6D A;  4HA8 A;  3TU4 K;  1QVF A;  4PK4 A;  2DTI A;  1GXI E;  4PJJ A;  2K57 A;  2DYB A;  3X24 B;  3EGU A;  1YJN Q;  4M7A F;  3BDL A;  2D9T A;  3OS1 A;  1K8A C;  2EQJ A;  2DL3 A;  1D0Y A;  3JB9 H;  4C8Q D;  5FW9 A;  3CCS Q;  1I5O B;  2RK2 A;  1BK2 A;  2MWO A;  3NTH A;  4IIM A;  5GAO p;  1X2Q A;  2IG0 A;  2MWP A;  4HVW A;  1G3S A;  2O31 A;  2D1X A;  3M57 A;  1VQ6 A;  3OYC A;  3CCU Q;  4PFP A;  1IXD A;  1NLP C;  3LH0 A;  2PUK B;  3G6E Q;  3DKM A;  4F7U F;  5LJ3 d;  2KXC A;  1QCF A;  4CRI A;  1A0N B;  3RES A;  5M9O A;  2KRM A;  5HK0 A;  1K9M R;  2QG9 B;  1OU8 A;  1Y57 A;  5KYW A;  3JCM f;  3VS1 A;  1PSE A;  5EG2 A;  5GAN f;  5HKC A;  2DYI A;  3RBB B;  5KYX B;  1Q82 C;  4KGX B;  2LP5 A;  3OSV A;  2DRK A;  1Q86 C;  3MHX A;  2LC4 A;  1N9S A;  2DA9 A;  3MEW A;  3I56 T;  4N4G A;  4OMP A;  3TQ7 P;  2BE7 D;  3E2U A;  4OVA A;  4J9H A;  4TVR A;  3X28 B;  1UB4 A;  1OUL A;  1Q7Y U;  2CT4 A;  3JB9 D;  1Y7X A;  1ZQ1 A;  2O01 E;  5A0G A;  5IT9 E;  2E12 A;  4BY6 C;  3VS0 A;  3M0S A;  1MMG A;  4BY6 B;  2RPN A;  3QWX X;  3UDC A;  2M9U A;  3JCM X;  2OTJ A;  3VJP A;  1JO8 A;  4Y91 A;  1TU0 B;  2GFU A;  1SKU B;  2GQV A;  3CCJ A;  2EYX A;  2COZ A;  3CC7 T;  2EQK A;  3HSB A;  2RO0 A;  4XTZ A;  1RI0 A;  2JZ2 A;  2H3E B;  2QDL A;  2Y4Y A;  1GBQ A;  2QQA A;  1QVG S;  1KK7 A;  2XU8 A;  4IUV A;  2VUB A;  1SG5 A;  3CCQ T;  4AMC A;  2FVU A;  1UJY A;  4ZGD B;  1SHF A;  2JUF A;  1ACM B;  3OBW A;  1KC8 U;  2ECZ A;  4M7A E;  3CCV Q;  2RN8 A;  1SEM A;  1VQ9 A;  2EIF A;  2HKQ B;  3V7C A;  3QDR B;  1VQN Q;  5LJ3 e;  2KAF A;  4QQD A;  2MF2 A;  3ULR B;  2EYQ A;  1W2B A;  3JSC A;  1YI2 T;  2HD0 A;  4XU2 A;  2CUB A;  1VQ4 Q;  2HQX A;  3KBG A;  2AT1 B;  5IHK A;  2M51 A;  3PE0 A;  3H0I A;  1I07 A;  2CP3 A;  5DLQ E;  2HL5 C;  2COY A;  4ELY C;  2RQU A;  1TWB A;  4FT4 A;  2EAY A;  2D0Q B;  3ZFJ A;  2DXT A;  4C92 A;  1N8R C;  1IHW A;  4RTW A;  5AYF A;  1M1K C;  2D8J A;  4PJL A;  3GBQ A;  1ZSZ C;  2K4Y A;  4C5G A;  4J9B A;  1X27 A;  3UA7 A;  1ZSZ B;  5CQY A;  3J7A F;  1PSF A;  4JJB A;  3OYD A;  1WQ7 A;  1WHG A;  5AT1 B;  3SB2 A;  1YIT Q;  3TSZ A;  2ZAE A;  5A0D A;  3G6E T;  2FRW A;  2QA4 Q;  2RHI A;  5CR2 A;  4FW2 A;  4D8D A;  2AZS A;  1K0X A;  4JPB W;  4M77 F;  3LLR A;  4M7A C;  3HTR A;  2V8J A;  2YWW A;  2EW3 A;  1R8O B;  4M7A B;  4D8K A;  1VQ7 A;  1VIE A;  4K11 A;  2K5I A;  1UGS B;  4GLM A;  4XTY A;  2MI6 A;  2FYK A;  2HL3 A;  4M7A G;  1C6V X;  3UAT A;  3L2U A;  1KG1 A;  2ED0 A;  2XDD A;  2KMT A;  3FEO A;  1I8F A;  2WSC E;  5LJ5 d;  2ROL A;  1KD1 U;  3OSS C;  4OMQ A;  1VQP Q;  1KQS S;  2OI3 A;  5D6Y A;  1Q81 C;  1I0C A;  1YIJ A;  1OI1 A;  1Z9Q A;  3QWY A;  2RQW A;  5GJV B;  4HT9 A;  4F7U B;  4N4H A;  3TRE A;  1PKS A;  3MP6 A;  2DBK A;  3QHS A;  2DNU A;  2HNI A;  1WJS A;  5IXB A;  2BZX A;  4Z89 A;  3PNW C;  3I55 Q;  5GAO q;  2ZPF B;  3BY7 A;  3PIO A;  4J9F A;  4ZGE B;  4Z8A A;  3H6Z A;  1K8A U;  1I81 A;  2J6O A;  2DKG A;  3LYI A;  4E7Z A;  1YJW A;  2FZK B;  1PKT A;  4AFQ C;  1M90 C;  2EYW A;  4AG1 C;  3LW5 E;  2WAC A;  3ZL7 C;  4LN2 A;  3OS5 A;  1BYM A;  1PRL C;  2PVG B;  1Q7Y R;  2HKN A;  1H8K A;  4KRT A;  2FG0 A;  2F2V A;  2RI5 A;  3A8M B;  3H0F A;  4M78 C;  2VVK A;  2H3J A;  8ATC B;  4M78 B;  2FPD A;  1QP3 A;  2BIV A;  3QDF A;  2DET A;  1SRM A;  4ELZ C;  3QXE B;  1X01 A;  4OGC A;  1IRX A;  2HEQ A;  4OMF B;  1N9R A;  2CT3 A;  1WPY A;  4PKC C;  1VYT A;  2RK1 A;  3CCV T;  2J7I A;  3S3O A;  2GTJ A;  1RAC B;  2QDY B;  2QQR A;  2L3Q A;  3VKI A;  1IZ6 A;  4ORZ A;  1VQ6 Q;  1AHJ B;  5IHI A;  1Q82 U;  3E9F A;  5CKE A;  2BKD N;  2OTL T;  4J7F A;  3QG1 A;  1Q86 U;  5I22 A;  2LCC A;  2MYS A;  2JS2 A;  1G3Y A;  4M77 E;  5CQX A;  3ZEH A;  2FO0 A;  2DFU A;  3CPW S;  2OJ2 A;  2FPF A;  1VQ4 T;  1M8V A;  2CH4 W;  4DBR A;  3KUF A;  1NPR A;  1GCP A;  1O75 A;  2CZ6 B;  2XK0 A;  4BUG A;  3EHQ A;  3OW2 S;  2LCS A;  1NYF A;  2DBM A;  1IRE B;  3JCM J;  3CME T;  2KT8 A;  2C06 A;  1D09 B;  1TS9 A;  2GCX A;  1JQQ A;  1NE8 A;  3QYG B;  1ZBJ A;  3A5Z B;  2LJ1 A;  1K4U S;  3NPF A;  3M56 A;  2EFI A;  4RMO A;  3CCL A;  4DEY A;  4II1 A;  2I0N A;  5GAM g;  2OTJ Q;  1ZX6 A;  4PL6 A;  1N5Z A;  2QA4 T;  1D0X A;  1JXO A;  1KIK A;  2DL8 A;  1UHC A;  3GOX A;  2GNC A;  3CCJ Q;  2GBQ A;  3S6W A;  3EG2 A;  1RAH B;  1KC8 C;  4HCC A;  3KFV A;  3BDU A;  5IHN A;  1FYN A;  4OP0 A;  2CDT A;  1NEG A;  5KYU B;  4NOY A;  3HFN A;  1NG2 A;  2QAZ A;  2V26 A;  3URG A;  4M75 A;  1RLP C;  2E6N A;  4FU6 A;  2DMO A;  4M78 D;  3NFC A;  1RAI B;  2VC8 A;  1TTH B;  2JMA A;  4M75 D;  1WLP B;  1VQP T;  4ME7 A;  5KH6 A;  1ZHI A;  4FSX A;  1TXQ A;  3CC4 A;  4WCI A;  4FYV B;  3I56 Q;  4KGZ B;  1D3B A;  1VQ5 A;  1UUE A;  3H9N A;  4N0A C;  3CXC S;  3G4S A;  4M77 C;  2LQK A;  1OYX A;  2RHX A;  1VQ9 Q;  4M77 B;  2AIR B;  4R0K A;  2C0T A;  4MDX A;  1TSF A;  3RDV A;  3CCM A;  2MOX A;  2KK4 A;  4M77 G;  4R56 A;  1RUW A;  4IUR A;  1T0J A;  1KD1 R;  4E7H A;  3CMA T;  1N27 A;  3G7Z A;  4LDU A;  1OV3 A;  5CK9 A;  3GNG A;  3MPU B;  1E7O A;  5IAY A;  1MMA A;  5HCK A;  2DO3 A;  1N8R U;  1HSQ A;  2QGG A;  4L59 A;  2PTK A;  5FRM A;  1AVZ C;  2DXC A;  1QP2 A;  1M1K U;  1ABQ A;  4A4K A;  1MNE A;  9ATC B;  4BI4 A;  1RAF B;  4BAC A;  1KQ1 A;  1OPK A;  5GAN 4;  1X69 A;  2MCN A;  3VUB A;  3L2W A;  1EX4 A;  2QTX A;  1VQL A;  1K8A R;  1OQK A;  3EG3 A;  5HK3 A;  3VRZ A;  2B8A A;  4F16 A;  1RAA B;  4JRK A;  2ZCF B;  3FDR A;  4AT1 B;  2L0A A;  2QQS A;  2F5K A;  2RJE A;  4Y92 A;  4OB0 B;  3EG9 A;  5GAN 5;  1GFC A;  3OBY A;  1IB8 A;  1VQ6 T;  1PNJ A;  5GAO r;  2LX7 A;  1U5S A;  2L5Q A;  4ZN3 A;  3JCM c;  4RKU E;  5D6W A;  1FMW A;  1HJD A;  1Q81 U;  4M7D F;  1TUC A;  3PFS A;  3JCM P;  2BZ8 A;  4HCB A;  1GL5 A;  3M5A A;  2X4Y A;  1VQ7 Q;  3CEY A;  2KXD A;  1Y96 B;  2J6K A;  4XAX B;  5LJ3 g;  1Q82 R;  2X3W D;  3JV3 A;  5GAM h;  5D7U A;  1Q86 R;  4C8Q A;  5L23 A;  3OYE A;  3EG1 A;  2LX9 A;  5ECA A;  4FCY A;  3L42 A;  3J81 E;  1B3Q A;  1M90 U;  1KSW A;  1YN8 A;  4C92 E;  1K73 C;  1RAD B;  2COW A;  3NTK A;  4JS4 A;  2P0P A;  1TH7 A;  5GAN 7;  1YIJ Q;  2F2W A;  5FWB A;  4KUL A;  5GAM e;  1GCQ C;  1M2V A;  2CZ1 B;  4MDW A;  5GAM j;  4M77 D;  2BUD A;  2EYY A;  1BCM A;  1C0M A;  4ZNX A;  2VKN A;  2EKH A;  3VRY A;  3VV0 A;  4JJC A;  4JS5 A;  3SWN A;  1F1B B;  1U1S A;  1GBR A;  3NGP A;  1YJW Q;  2OTJ T;  1J3T A;  1ZLM A;  1M2O A;  3CCJ T;  1WHK A;  1QVG P;  1H3Z A;  1LOJ A;  1E6H A;  1UDL A;  3OYB A;  1XNI A;  3VS5 A;  1R0C B;  2PVD B;  3HPW A;  1B34 A;  1IO6 A;  4PJO A;  3D7S B;  2CS7 A;  4FYY B;  3X25 B;  2CZ0 B;  3JB9 I;  3HHT B;  5GMK i;  4BDZ A;  1U3O A;  4AFU C;  2KRN A;  4PJO D;  1QLY A;  1VQ8 A;  1SSH A;  3A1P A;  3OYH A;  1UHF A;  3CPF A;  1C1A A;  2HDA A;  3FLG A;  2XD0 A;  3LGL A;  3C94 A;  2O9S A;  2KDS A;  1XQH A; 
#chains in the Genus database with same CATH homology
 2EWN A;  1UGP B;  4BDY A;  1BI0 A;  4GY5 A;  2YHT A;  3S3N A;  1O9S A;  5KCO A;  2K2V A;  1VQ9 T;  1W4S A;  3CCE A;  5L8R E;  2I2L A;  4JUV A;  5A0D A;  3OYL A;  3G6E T;  2XID A;  2L8D A;  2RHI A;  5CR2 A;  2VXE A;  4QVZ A;  5J39 A;  2EJG A;  4M77 F;  1Y07 A;  3LLR A;  3SDZ A;  4YTL A;  4PNO A;  3VYG A;  4M7A C;  1VUB A;  2ZPG B;  2K5F A;  2V8J A;  5CCA A;  1JJ2 A;  2XKO C;  1R8O B;  1YBY A;  3PT9 A;  4M7A B;  1VQ7 A;  4M7D E;  1Q7Y C;  1VIE A;  1BI2 A;  2P0Q A;  2K5I A;  1VQM A;  4FL6 A;  1UGS B;  2E10 A;  4XTY A;  4R55 A;  2VXF A;  2MI6 A;  2FYK A;  4BE2 A;  3EFS A;  2QXF A;  4M7A G;  3L2U A;  1KG1 A;  4WF2 A;  4C0Z A;  4A54 A;  4NL2 A;  1BIA A;  4XQ3 A;  2XDD A;  2KMT A;  3SD4 A;  1XTD A;  2M16 A;  4QVC A;  3FEO A;  1I8F A;  3A8G B;  2WSC E;  3LWH A;  4JJN K;  3DLM A;  3OA6 A;  2X4X A;  5CKF A;  4C92 G;  5LJ5 d;  2E70 A;  5KE2 A;  3FC3 A;  2LDM A;  1KD1 U;  2LT4 A;  3OSS C;  1KQS S;  4JLI A;  1N6A A;  3I55 A;  2F5T X;  4BI3 A;  5D6Y A;  1Q81 C;  4Y28 E;  3CXC A;  5C6S A;  4KUD K;  4E47 A;  2G3R A;  1YIJ A;  1OI1 A;  4MZM A;  4C5I A;  3JB9 G;  1K9M U;  4HT9 A;  4J6Y A;  4X34 A;  1M4Z A;  4F7U B;  2PVO B;  4LD6 A;  4N4H A;  2RD1 A;  3TRE A;  1YIT T;  1VQK A;  2VYT A;  2DD4 A;  4PJO E;  5CKH A;  3MP6 A;  3R6O A;  2DIG A;  4A4E A;  3QHS A;  1OZ2 A;  3DB3 A;  5LJ3 h;  2HNI A;  4B9W A;  5DM7 R;  1WJS A;  3J80 E;  1VQ8 T;  2OTL A;  2HBP A;  3M55 A;  3JCM W;  1QVP A;  3HRS A;  3PNW C;  4LDY A;  4M77 A;  2ZPF B;  5GAO q;  5DLO A;  3BY7 A;  2RJF A;  2R57 A;  3M4Y A;  3PIO A;  4ZGE B;  2CYZ B;  2DTH A;  4PLI A;  1YHQ A;  4RCC A;  5CKB A;  3C4S A;  3H6Z A;  4A53 A;  2DAQ A;  1I81 A;  5C0M A;  1S72 A;  1K8A U;  2EJF A;  3QII A;  2DKG A;  3LYI A;  1YJW A;  1U1T A;  2KSS A;  3UWN A;  3OMG A;  3CCE T;  2JVV A;  3H8Z A;  4E7K A;  1M90 C;  5J26 A;  4IUU A;  2K5L A;  4OB1 B;  3LW5 E;  2WAC A;  2V8I A;  5CIU A;  3OS5 A;  2O4X B;  2RA2 A;  3CBM A;  5LJ3 j;  5A2Q E;  4CI0 C;  1NZ9 A;  4J6W A;  2PVG B;  5GAN 3;  1M5Q 1;  3O8V A;  1BYM A;  2RJC A;  3RIR A;  4HT8 A;  5FLX E;  2HQE A;  4XTU A;  1NPP A;  3OY9 A;  2RB6 A;  2DPP B;  4ZTF A;  1YJ9 A;  2RI5 A;  3RMQ A;  2R58 A;  3NTI A;  5CO7 A;  3WVE B;  2XDP A;  1VQ7 T;  2DTO A;  3JCM Q;  1M9S A;  3ASK A;  1VQM T;  3A8M B;  2AHJ B;  1H64 1;  4M78 C;  1UGQ B;  4HCZ A;  1HK9 A;  2H3J A;  2OAU A;  4JRI A;  4HKE A;  4M78 B;  2WSF E;  4C8Q C;  3OYY A;  3A8L B;  1QP3 A;  1UEB A;  2BIV A;  4X9D A;  4ELZ C;  3QXE B;  2CGH A;  1X01 A;  2ZPE B;  3E9G A;  4C8Q B;  4XU3 A;  3UT1 A;  4OGC A;  1JRI A;  5GMK m;  4OF1 A;  3CME A;  3M59 A;  5D6X A;  3OB9 A;  3FRN A;  3KXT A;  1MGQ A;  1WNL A;  4OMF B;  3L2Q A;  1N9R A;  2MMP A;  3QO3 A;  4XTV A;  1LJO A;  1WPY A;  4C8Q G;  1YCY A;  5GAM d;  5GAO m;  2E64 A;  4PKC C;  5HY6 A;  5GAN 8;  2RK1 A;  3CCV T;  3I55 T;  2L3R A;  3S3O A;  3JCM d;  3C12 A;  5GAN d;  3QBY A;  3LX7 A;  1YIJ T;  2QDY B;  2QQR A;  4MZT A;  4M7D C;  3GP8 A;  3VKI A;  5KE3 A;  1IZ6 A;  5GMK h;  1VQK T;  3AHU A;  4M7D B;  2ZPH B;  4XTW A;  3OYA A;  1AHJ B;  3L1A A;  1MHN A;  3MP1 A;  3OYI A;  4JRQ A;  3E9F A;  3MEA A;  1Q82 U;  5CKE A;  4OB3 B;  5I21 A;  2BKD N;  5A0L A;  3SWN C;  2OTL T;  4J7F A;  4E7J A;  4KT0 E;  2R5A A;  3P8H A;  3QG1 A;  4C0F A;  1Q86 U;  3SWN B;  4M7D G;  1HXD A;  3OYF A;  2LCC A;  5GAO n;  4C0G A;  4EMK C;  2LQ8 A;  1YHQ T;  3BW1 A;  1Y71 A;  2PUO B;  4EMK B;  1S72 T;  1QVG A;  1G3Y A;  3GIB A;  2LVM A;  4LDW A;  2A7Y A;  4M77 E;  5CQX A;  3ZEH A;  4RG8 A;  4J5Y A;  5GMK e;  1YJW T;  5FRO A;  1W2B S;  1G5V A;  3GLX A;  2F69 A;  5GMK l;  3HP9 A;  5GMK j;  4C5H A;  4LDX A;  3OQ5 A;  3CPW S;  2DZ9 A;  4OGE A;  3RMS A;  1VQ4 T;  1M8V A;  5FRN A;  4PJO C;  1Y96 A;  1B34 B;  2KQW A;  4PJO B;  2KY9 A;  2VGM A;  3HRT A;  3KUF A;  3OYM A;  4IUP A;  1YJ9 T;  1NPR A;  2XI9 A;  1EIF A;  3X26 B;  1VQP A;  2DK3 A;  2E6Z A;  4M78 F;  4C92 C;  4PJO G;  3EFR A;  4KBM B;  2ZZD A;  1O75 A;  4RCB A;  2CZ6 B;  2XK0 A;  4BUG A;  3T9N A;  3M53 A;  4C92 B;  2RHZ A;  2EKO A;  3PMT A;  1BI3 A;  4RG2 A;  3OYG A;  4UC4 A;  3S3M A;  4M75 F;  3OW2 S;  3HFO A;  4IUQ A;  2Y90 A;  3LGF A;  3GPL A;  2PQW A;  2ZPI B;  3FIF A;  1IRE B;  1ZBX A;  3TEE A;  3MP8 A;  3DLL A;  3V8L A;  3JCM J;  3CME T;  4ZGJ B;  3E19 A;  4DQ2 A;  2A3L A;  3M9Q A;  3MCA B;  2KVQ G;  2E5Q A;  2C06 A;  4LDV A;  4BD3 A;  4FT2 A;  3CD6 A;  2JTF A;  2PU9 B;  3L2Z A;  3CC2 A;  3PTA A;  3QZ9 B;  5GAN 6;  2GCX A;  2DD5 A;  3JAM E;  3L2R A;  3CMA A;  3EAE A;  2XDB A;  3JCM b;  1NE8 A;  3QYG B;  3QUI A;  3A5Z B;  3M56 A;  2EFI A;  3Q1J A;  4RMO A;  2YLB A;  3CCL A;  4C0D C;  3QZ5 B;  3UPU A;  5LJ5 f;  4II1 A;  5I2M A;  1KD1 C;  3PIP A;  5GAM g;  2E65 A;  4C0D B;  4N0A A;  1OZ3 A;  3CCR A;  4PL6 A;  4A4F A;  1I4K 1;  2QA4 T;  5KCH A;  1WGS A;  2DEQ A;  3GOX A;  2K3X A;  3JCM g;  1VIF A;  1YJN A;  5GAN g;  3S6W A;  1K9M C;  2RJD A;  4QQ6 A;  3QJ6 A;  4XU1 A;  1K73 U;  4J8O A;  1KC8 C;  4HCC A;  3BDU A;  4LD9 K;  4OP0 A;  2ZPB B;  3QYH B;  3RUX A;  2QQB A;  4HA8 A;  2X35 A;  1FWZ A;  2Y4X A;  3GNF B;  4NOY A;  4B9X A;  3CCS A;  3TU4 K;  3DB4 A;  1QVF A;  2RI2 A;  1M1F A;  2LRQ A;  3ZBD A;  2DTI A;  3HFN A;  1JJ2 S;  1GXI E;  3JCM h;  3URG A;  3OS0 A;  1KQ2 A;  2K57 A;  4M75 A;  2VV5 A;  3I56 A;  4X9C A;  3X24 B;  4O6J A;  2E6N A;  4FU6 A;  1V29 B;  4M7A F;  2LNV A;  2E41 A;  2D9T A;  3BDL A;  3M58 A;  2EQJ A;  4M78 D;  3OS1 A;  1K8A C;  3NFC A;  3JB9 H;  4C8Q D;  2VGN A;  2VC8 A;  4A4G A;  3QKJ A;  3CBO A;  3OS2 A;  3CCU A;  2MAM A;  4M75 D;  4P5N A;  5FU6 C;  2GFA A;  4J7I A;  5I2S A;  2RK2 A;  5CAI A;  1VQP T;  3OMC A;  4ME7 A;  5J3B A;  3RKY A;  4DOW A;  1FXX A;  1ZHI A;  2MWO A;  4FSX A;  3QJY A;  3NTH A;  5FU6 B;  4BI8 B;  3JCM e;  4JDS A;  3CC4 A;  1VQ5 A;  1D3B A;  5CVI A;  5GAO p;  3RKX A;  2IG0 A;  3JRZ A;  1NJI U;  2MWP A;  4N0A C;  1G3S A;  3CXC S;  2DXU A;  3G4S A;  3M57 A;  1BIB A;  4M77 C;  1VQ6 A;  3JB9 F;  2LCL A;  4F7U E;  3RER A;  1XOV A;  1OYX A;  2LQK A;  2RHX A;  2DVE A;  3CBP A;  4M77 B;  3OYC A;  4E7L A;  4VUB A;  3LH0 A;  2PUK B;  4JRP A;  3DKM A;  4MDX A;  2K3Y A;  3P8D A;  4F7U F;  1RL2 A;  3V8J A;  3CD6 T;  3CCM A;  4M77 G;  2KK4 A;  5LJ3 d;  4R56 A;  3CC7 A;  3CC2 T;  4IUR A;  4Q5W A;  4E7H A;  3CMA T;  1N27 A;  3G7Z A;  4LDU A;  3X20 B;  5CK9 A;  3GNG A;  4CRI A;  5LJ5 g;  2IVW A;  5IAY A;  3RES A;  2DO3 A;  1N8R U;  5M9O A;  4L59 A;  5HK0 A;  1M1G A;  5FRM A;  2DXC A;  1QP2 A;  1VQO A;  1M1K U;  5GAM f;  2ZGW A;  2FB7 A;  3CCR T;  3FB9 A;  4M7A A;  4L6V 5;  2GF7 A;  4A4K A;  2JN0 A;  4GLK A;  3CCQ A;  2FHD A;  3A8O B;  2EQM A;  4ATO A;  4FM4 B;  4BI4 A;  5LJ5 h;  4BAC A;  1KQ1 A;  3JCM f;  5GAN 4;  1YJN T;  1PSE A;  5EG2 A;  5GAN f;  3MO8 A;  3GF5 A;  5HKC A;  1G3W A;  3VUB A;  4BE1 A;  3WXM B;  3L2W A;  1Q82 C;  2X4W A;  4M7A D;  1G3T A;  1FX7 A;  2QTX A;  3OSV A;  3M4G A;  3CCS T;  1VQL A;  1KHC A;  4BB7 A;  1Q86 C;  5HK3 A;  3MHX A;  2LC4 A;  1N9S A;  2CZ7 B;  3MEW A;  5GAO l;  4C92 D;  2B8A A;  4N4G A;  3I56 T;  1I5L A;  4JRK A;  4M78 E;  3MET A;  5LJ5 e;  4OVA A;  4TVR A;  3X28 B;  4C8Q E;  2ZCF B;  2XHC A;  2P0K A;  5LJ5 j;  3P8B B;  3FDR A;  5KH6 A;  4M75 E;  4IUT A;  1QW1 A;  1UB4 A;  4EDU A;  4F7U A;  3CCU T;  3E1S A;  1Q7Y U;  2QQS A;  4C8Q F;  2F5K A;  3MEU A;  3JB9 D;  4L5G A;  3G71 A;  1Y7X A;  2RJE A;  3C95 A;  1ZQ1 A;  1JB0 E;  2O01 E;  4OB0 B;  5DY9 A;  1WQW A;  5A0G A;  3LWI A;  3CC4 T;  3OYN A;  5IT9 E;  1VQ5 T;  2E12 A;  4BY6 C;  1UGR B;  2EQU A;  5GAN 5;  1YI2 A;  4BY6 B;  3OBY A;  2DXB A;  3G4S T;  3UDC A;  2M9U A;  1KHI A;  4KUI A;  5GAN 2;  1VQ6 T;  3JCM X;  1P92 A;  4XTX A;  3VJP A;  2OTJ A;  4Y91 A;  2GFU A;  5GAO r;  1WJR A;  4J6X A;  2GQV A;  4O5V A;  3MEV A;  3CCJ A;  2M0O A;  2L5Q A;  2RHU A;  3JCM c;  4A4H A;  4RKU E;  5D6W A;  4ZN3 A;  2QEX A;  4V2S A;  4J83 A;  3CCM T;  1Q81 U;  4M7D F;  2WSE E;  4QVD A;  2R5M A;  3CC7 T;  3ER0 A;  2EQK A;  3VUZ A;  3HSB A;  2RO0 A;  4XTZ A;  3QSU A;  1RI0 A;  3TCJ A;  3V7S A;  3HKS A;  3PFS A;  2JZ2 A;  2O4X A;  3JCM P;  4HCB A;  3QPH A;  3OYJ A;  2Y4Y A;  3M5A A;  2X4Y A;  2QQA A;  2RI3 A;  3CEY A;  3M54 A;  1QVG S;  4EMG A;  3V7R A;  1VQO T;  2XU8 A;  4IUV A;  1Y96 B;  2VUB A;  4XAX B;  3CCV A;  5LJ3 g;  1BI1 A;  3CCQ T;  2L89 A;  2FVU A;  1X6O A;  2FL7 A;  2P4T A;  2RH2 A;  3OYK A;  4ZGD B;  2RM4 A;  5GAM h;  2JUF A;  3FJP A;  4M78 A;  4MMK A;  3OBW A;  2D6F A;  1KC8 U;  4C8Q A;  3N5B B;  3OYE A;  4M7A E;  1VQN A;  2E1H A;  1DJ7 B;  2LX9 A;  3A8H B;  5GAN h;  3L42 A;  3J81 E;  1VQL T;  1BKB A;  2DZC A;  4F7U G;  2YRV A;  4PJO F;  1M90 U;  4FIB A;  4QW2 A;  4IKF A;  2QQ9 A;  4C92 E;  1K73 C;  3NTK A;  4XK8 E;  4JS4 A;  2YLC A;  4ZTJ A;  2P0P A;  1TH7 A;  5GAN 7;  2DJZ A;  3F70 A;  1VQ9 A;  4KUL A;  1SSF A;  2EIF A;  5GAM e;  2LTO A;  3V7C A;  4C92 F;  4ZN1 A;  2CZ1 B;  3QDR B;  3G6E A;  4MDW A;  5FU7 C;  3PMI A;  2RHY A;  4M77 D;  2BUD A;  4OB2 B;  2LT1 A;  4EPC A;  4DOV A;  5GAM j;  4E7I A;  2HAX A;  4M7D A;  2JNG A;  5FU7 B;  5LJ3 e;  2KAF A;  5GAN e;  4QQD A;  2MF2 A;  2XIC A;  3JCM V;  3WVD B;  3VV0 A;  4PLL A;  3G71 T;  3HRU A;  4BE0 A;  1VQ4 A;  4N4I A;  5GAN j;  4JS5 A;  5CKD A;  2EYQ A;  3SWN A;  1W2B A;  4QQG A;  3VYH B;  5LL6 S;  3HL8 A;  3JSC A;  1U1S A;  1YI2 T;  4M7D D;  3CPW A;  2HD0 A;  2OTJ T;  3INZ A;  4XU2 A;  2EJ9 A;  1X75 C;  4EMK A;  4XU0 A;  1LNX A;  2V8K A;  3CCJ T;  1NJI C;  3JB9 J;  2QEX T;  4MZP A;  1H3Z A;  1LOJ A;  3BFM A;  3OYB A;  1WJQ A;  1XNI A;  4D6W A;  4M75 C;  2HQX A;  3CCL T;  3KBG A;  3ME9 A;  2PVD B;  3HPW A;  4M78 G;  1B34 A;  4M75 B;  3V8K A;  4PJO A;  2NLU A;  2XG8 D;  2CS7 A;  3VU3 C;  1QVF S;  3OW2 A;  5IN1 A;  5DLQ E;  3X25 B;  3PGG A;  4ELY C;  2CZ0 B;  1JBM A;  2JOY A;  4M75 G;  3SFM A;  3JB9 I;  3HHT B;  4FT4 A;  5LJ3 f;  5GMK i;  2EAY A;  2D0Q B;  3ZFJ A;  4BDZ A;  2DXT A;  1YIT A;  4C92 A;  1N8R C;  2M1H A;  2DIQ A;  2QI2 A;  3RKW A;  4PJO D;  1KQS A;  4JLG A;  4NS5 A;  2CKK A;  5AYF A;  1VQ8 A;  3OYH A;  4Z02 A;  3L2V A;  1M1K C;  1D3B B;  4C5E A;  4DA4 A;  2QA4 A;  3CPF A;  1VQN T;  2K4Y A;  3FLG A;  2XD0 A;  4C5G A;  3LGL A;  1U8R A;  3C94 A;  5CQY A;  3J7A F;  1PSF A;  4EMH A;  3OYD A;  4MML A;  1WQ7 A;  4NL3 A;  2X4J A;  2KDS A;  3SB2 A;  1XQH A;  2JTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...