4CRIA

Crystal structure of 53bp1 tandem tudor domains in complex with methylated k810 rb peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine Methylation-Dependent Binding of 53BP1 to the Prb Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
total genus 28
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA01
2LRQA 2JTFA 1XNIA 3NTHA 1YITA 4Z02A 1KHCA 4C5IA 1JJ2S 3E9FA 2R5AA 2RJEA 2EIFA 2YRVA 2X4XA 3PMIA 5D6WA 2RJDA 1BKBA 1EIFA 3QIIA 3MP6A 3S3MA 3OYNA 2R57A 1YIJT 1VQPA 3J81E 3CEYA 2LQ8A 1QVGA 3LH0A 1VQ7T 3CCVA 1VQ8T 2E5QA 1YJ9A 3OYFA 3NTIA 3CMEA 1M1KU 2OTJT 2LDMA 3I55A 2RHIA 1S72T 5LL6S 3OW2S 3MEWA 5FRMA 2MWOA 3CD6T 5DLQE 2M0OA 2MWPA 1VQ4T 3S3NA 4B9WA 2DIGA 5D6XA 1YI2T 3CC4A 3OYJA 1VQ9T 3OYIA 4E7LA 3CCSA 2DAQA 3META 3P8DA 3L2WA 3OS1A 4YTLA 4RG2A 2QA4A 4PLLA 2RO0A 1NPRA 1Q81U 4L59A 3G4ST 4ZN3A 3CCRA 3PIPA 3MO8A 3CCLT 3L2QA 3OYGA 1M90C 3P8BB 2GFAA 2EQKA 1VQ6T 1VQPT 3BDLA 4GY5A 3I56T 3LGLA 3OY9A 3CMET 4FL6A 3CC2A 3GOXA 3CCEA 3L2UA 1WJQA 1OZ2A 4FU6A 3CCUT 5IT9E 3OYBA 1M1KC 1XTDA 1OZ3A 2M1HA 5FLXE 5C6SA 3PNWC 4A4EA 4E7JA 1YBYA 3OS2A 1VQLT 2VYTA 1QVFS 1OYXA 4EDUA 2KVQG 5KE3A 3KUFA 2KDSA 1YJWA 3CMAT 3UWNA 1Q7YC 4C5GA 4LD6A 3I55T 3OMGA 3CCMA 2OTLT 3UT1A 3I56A 4BD3A 2R5MA 3L42A 5IAYA 1KQSA 2L8DA 1M1GA 2DIQA 5IN1A 1K73U 3OYMA 2JZ2A 1NJIU 3M9QA 3CCQA 3EAEA 1QVGS 2E6ZA 2K3YA 1VQLA 5HY6A 1VQMA 3OQ5A 3CC4T 2DO3A 1WJSA 3OYDA 1YHQA 1K8AU 5FRNA 2XK0A 2JUFA 1MHNA 1K9MC 4BE1A 3CPFA 3CCJT 2JNGA 2M16A 3NTKA 4IUQA 3CCLA 3OB9A 5KCHA 1YJ9T 3CC2T 2XHCA 3ZEHA 4TVRA 5J39A 3H6ZA 2O4XB 2GFUA 5C0MA 3SD4A 3OYKA 3PIOA 1VQ6A 2BUDA 4II1A 3FLGA 1VQOT 2EFIA 3KBGA 1SSFA 4BACA 2LCCA 1WJRA 1W2BS 1WGSA 3OYAA 3CCST 4BDYA 3MEUA 3S6WA 3P8HA 2CKKA 4PL6A 2L89A 1YHQT 3G71A 2L3RA 5DM7R 1N27A 3OMCA 1W2BA 3CXCS 4N4GA 1VQ4A 3CCQT 3LGFA 2RHUA 2LCLA 3ME9A 1KC8U 1RI0A 2K3XA 3H8ZA 4BE0A 3ASKA 4BE2A 2LTOA 2BKDN 2PQWA 2RJFA 1YJNA 1Q86C 3FC3A 3CCVT 3CCMT 2OTLA 2R58A 5KH6A 2RI5A 3JAME 2OTJA 1X6OA 4ZN1A 1Q81C 1OI1A 4PLIA 1YJNT 3OYHA 4ZTFA 2BIVA 4E7KA 1JJ2A 3E9GA 5A2QE 2QEXA 1VQNA 1NZ9A 3MEVA 1KD1C 3DLLA 3QKJA 2O4XA 1VQ9A 3L2RA 3DB3A 5J3BA 2HQEA 3DLMA 1VQOA 2RI2A 3OA6A 3G6EA 4QQGA 1UEBA 3OYEA 4IUUA 3CCET 5D6YA 2X4WA 3OS0A 1NPPA 3CCRT 3DB4A 3CC7T 1VQ8A 2MI6A 1S72A 3MP8A 2EKOA 4QW2A 1IZ6A 3LX7A 3L2VA 3OYYA 3FDRA 2RHZA 1N8RC 2IG0A 4B9XA 2QEXT 1VQNT 3MEAA 1KC8C 3QJ6A 3CPWA 3TREA 4QQ6A 3PFSA 2E70A 1YITT 2P0KA 1H3ZA 3CXCA 1VQMT 3F70A 1Q82U 2X35A 3S3OA 2HQXA 3J80E 5KCOA 1Q86U 1M90U 1QVFA 3CCUA 4ZTJA 1K73C 4N4HA 3J7AF 4A4HA 2RHXA 2EQUA 1YI2A 3MP1A 4QVZA 3QBYA 5M9OA 4IUPA 2B8AA 2RJCA 3PMTA 2FHDA 3OYCA 3OYLA 3CC7A 3O8VA 4N4IA 1VQ7A 2JVVA 3LLRA 4C5HA 2LVMA 2QQSA 2GF7A 4Q5WA 1VQ5T 1K9MU 4E7IA 1KD1U 2F5KA 1KQSS 3C4SA 1YIJA 4IKFA 3ER0A 3LYIA 3Q1JA 4CRIA 1YJWT 3CPWS 4OVAA 2QQRA 1KHIA 1Q7YU 2G3RA 4QQDA 3CD6A 3FEOA 4IUVA 2JOYA 5FROA 4NS5A 5KE2A 1RL2A 4E7HA 2RHYA 1VQKT 2D9TA 1VQ5A 2WACA 1N8RU 2NLUA 4HCZA 3G6ET 4BDZA 3HKSA 3OW2A 1VQKA 2EQJA 1G5VA 1NJIC 2QA4T 3CMAA 1Q82C 4A4FA 4A4GA 5CIUA 4IURA 4C5EA 3CCJA 4UC4A 3A5ZB 2RI3A 2XDPA 1K8AC 4X34A 2X4YA 2E6NA 4IUTA 3G4SA 5J26A 2EQMA 3G71T
chains in the Genus database with same CATH superfamily
1SEMA 3UPUA 3NTHA 1JJ2S 2EIFA 4OMOA 4M7DG 1N8RR 5LJ3g 5GAOn 4DOWA 2HZYA 4LDWA 3MP6A 3S3MA 4M75E 3UA6A 1ZA2B 2R57A 1YIJT 2ESWA 1YFNA 2DZ9A 2X9HA 4PFOA 1VQPA 1KIKA 2EQIA 1VQ7T 1VQ8T 1F1BB 2E5QA 1YJ9A 3NTIA 1UDLA 4PJJA 3VS7A 4FSXA 2K6DA 3I55A 4LDXA 4M7DF 1UTIA 3MEWA 4C8QA 1Q82R 3QJYA 1WHLA 3M58A 5CO7A 5D7UA 3TEEA 2LT4A 2MWPA 4B9WA 1VQ6Q 3CXCP 1BB9A 3EG9B 3NHNA 4MMKA 1M5Q1 4D6WA 5LJ5e 3HFOA 3OYIA 4JRPA 2KXCA 2RMOA 1WHGA 2P0QA 4M78F 1KFZA 1IGUA 4OMNA 4RG2A 1TS9A 1Q81U 1NE8A 4R0KA 2KR3A 3EG3A 4KGXB 2RQWA 2A0FB 3MO8A 3PVLA 4XQ3A 4ZGDB 1ZLMA 4LNPA 5GANe 3OYGA 1RACB 1WIEA 4J9DA 4DQ2A 1H641 1RAFB 2EGAA 3EGDB 8ATCB 2GFAA 1T0JA 1VQPT 1VQKQ 2MAMA 2P84A 5AT1B 3CQTA 5LJ5h 2VWFA 3CMAQ 3LH5A 4FM4B 3TSZA 3CC2A 1K0XA 2VGNA 2VC8A 1LOJA 2CP7A 1AZGB 2D8HA 2DBMA 1WJQA 4QT7A 1Q81R 1MUZA 3HHTB 5FLXE 3VYGA 3PNWC 3QSUA 2VYTA 1QVFS 1U06A 2QGFB 2L3PA 4R56A 2JM9A 3JCMJ 2FEIA 4LUDA 4A54A 3KUFA 5FU7B 4A4KA 3CMAT 2FG0A 5KYNA 1ZBJA 3I55T 3OMGA 5FW9A 2BZ8A 2AK5A 3CCMA 4QVDA 2R5MA 2A36A 5GMKj 1YWPA 2D6FA 2P4RA 3L42A 1KQSA 2F2VA 1M1GA 2YUNA 2DXTA 5IN1A 5GAOm 3EGXB 2YT6A 2NUTA 1M8VA 3OS5A 2NUTB 4M77C 2JZ2A 5GAMh 2HNIA 2E6ZA 2MF2A 4HVVA 1VQMA 1VQOQ 2CP6A 3OQ5A 1Q95G 3CPWP 1WJSA 3OYDA 3EGDA 2EJ9A 1YHQA 2PVGB 1K8AU 1WQ7A 3NFCA 2P0PA 1UGQB 3IQLA 4C92C 2O88A 3SWNC 2DA9A 5CR2A 3AHUA 4BE1A 1M1FA 3CPFA 2DYBA 1FYNA 3SWNA 2V8KA 3QDFA 4OP0A 4C0DC 1KQSP 3TVTA 3OB9A 5KCHA 3G7ZA 1TTHB 1K9MR 1UJ0A 2XHCA 3ZEHA 1TSFA 4ELYC 5GAMg 2O4XB 3JCMW 2E12A 1H8KA 1I4K1 3X26B 1VQ6A 3U23A 4HVWA 5I11A 3EH2A 3HRTA 3JB9G 4B6MA 4KH1B 1SSFA 2K7AA 2LCCA 3M57A 1W2BS 3OYAA 2KAFA 1Z9QA 4M77D 4L5GA 3H41A 4PL6A 1JXMA 2AHJB 1ARKA 4J6WA 5GAMj 4MDWA 3CXCS 4C92D 5KYYA 2CUBA 3LGFA 5GANj 5GANf 2RHUA 2EW3A 1RI0A 4CC7A 1EZZB 3JCMb 2RD1A 2GNCA 1M90R 3ASKA 3TQ7P 4HT8A 1K73R 4FYVB 1YJNA 5DLOA 3FC3A 3E1SA 3CCVT 3ZL7C 2RI5A 3LW5E 1Q81C 4ZN1A 4PLIA 2AKKA 4M78G 1YJNT 2GTJA 4RG8A 4ZTFA 3PTAA 3JSCA 4J5YA 2QK0A 4PFZA 3CC7Q 2DBKA 2K5LA 1FMVA 1VQNA 4X1VA 1B7TA 2DJQA 1ZSZC 5LJ3j 1XOVA 3DLLA 1HSQA 4D8KA 3A8HB 1IO6A 2ZAEA 2ZPBB 1VQ9A 3DB3A 5J3BA 2Y4YA 2CYZB 1D0YA 2ZZDA 4FT2A 4MDXA 4IUUA 3RUXA 3CCET 5D6YA 1ZSZA 2LNHB 3OS0A 5CQXA 3G71Q 3DB4A 5HK0A 3CC7T 5DY9A 4PKCC 1VQ8A 2MI6A 3MP8A 2EKOA 1OV3A 3OYYA 2ZCFB 4Y91A 3RKYA 5A0LA 1UGVA 5I2SA 3TCJA 1WHJA 3MEAA 2MCNA 1QVFP 2DX1A 4M78A 3TREA 4C8QE 1KG1A 3JCMV 3OSVA 2MK5A 3I9QA 3H0HA 1K73C 3J7AF 2J7IA 2OI3A 2MOXA 3M59A 3MP1A 3QBYA 1FMKA 3GBQA 2RJCA 3PMTA 4E2FB 1ZSZB 3O8VA 4N4IA 3CC7A 1CSKA 1PKTA 3LLRA 4PK4A 2C0OA 4Q5WA 2V1QA 2LCSA 1EFNA 1ABQA 2D0QB 2GBQA 3EHRA 1PC0A 3M0TA 4IKFA 1PRLC 3V7SA 5GAN6 1EX4A 3Q1JA 2HBWA 3MKDA 2QQRA 3RMSA 2PVOB 3REAB 3V7RA 3RDVA 5CK9A 4BI4A 4C0GA 4RTYA 5KE2A 2VB6A 2RHYA 1RAHB 1VQ5A 3BW1A 1T3SA 2O01E 2KRNA 2E3IA 4RTXA 1YWOA 1M3CA 1B34B 2K2MA 5CIUA 3CCUQ 4C8QB 2K3BA 1FXXA 4UC4A 4X34A 1QKXA 2X4YA 4M75A 2E6NA 5FWBA 2H3JA 5GAOl 3G71T 2LRQA 1YP5A 1XNIA 2G6FX 7AT1B 1KJWA 1YITA 1M1KR 1PD0A 4OB0B 1CKBA 4C5IA 1LPLA 1MMNA 4F7UE 1U1TA 2YRVA 4QVCA 1WI7A 3FJPA 1V76A 4FSSA 2FB7A 1YCSB 4BY6C 1YHQQ 1Q7YR 4PJOD 1G3YA 4N0AA 2AIRB 1BIBA 3CEYA 2ABLA 3LH0A 2Z0WA 2LJ0A 1Z9ZA 3VS3A 3RERA 1AWWA 4J6YA 2LDMA 1QQJA 4DBHA 5FRMA 5LJ3d 2MWOA 1K76A 2HDAA 2W0ZA 1E6GA 4J83A 4PJOE 2D8JA 1JBMA 2M0OA 3X20B 3S3NA 1VQ4T 3G1JA 3EFSA 4A63B 4VUBA 1WHKA 1X6GA 5CKBA 2D1XA 1OPLA 3RIRA 2QG9B 1VQ9T 1VOMA 2YUPA 2AT1B 2GGRA 3VS4A 3CCSA 4J7IA 4Y28E 1IHWA 3C12A 1IREB 1M3BA 1U8RA 2DVJA 3H9NA 4KBMB 4PLLA 5LJ3f 5GAMe 2WSFE 1NPRA 4L59A 2PVDB 1AOJA 4C0DB 3TU4K 3CCRA 1XJWB 3PIPA 2VXEA 1K9AA 4AFUC 4E7SA 3VUZA 2XIDA 3P8BB 3RNJA 3HP9A 2CZ7B 4M75G 1WLPB 1YI2Q 1LJOA 4GY5A 3GP8A 5GAMf 3CCEQ 3VV0A 3LGLA 3WVEB 3JCMh 4AFSC 2ZPIB 2VVKA 3CMET 2HSEB 2E64A 4C92G 3QDRB 4XTXA 3CCEA 3L2UA 1RABB 2LP5A 1WZOA 3RMQA 4GLMA 3QXEB 1M1KC 2ZPHB 3GPLA 2M1HA 4EMKC 4OB2B 2PZ1A 4FYWB 1BI1A 4E7JA 2XDBA 1YBYA 3OS2A 2V8JA 5HCKA 1VQLT 4PJOA 4DOVA 1UGPB 1BCMA 2YHTA 1OYXA 1U1SA 2YRCA 2EJGA 1T3LA 3JB9D 4Z89A 4LDYA 4AG2C 5KE3A 3V8JA 4Y92A 1YJWA 2HEQA 4JJDA 4J8OA 2PTKA 4C5GA 2ECZA 2OTLT 4PFPA 5I22A 4BD3A 4OMQA 2HKQB 2CUDA 1OU8A 4M78C 3QO3A 1YJ9Q 3MHXA 2RK1A 4Z8AA 1JU5C 3LWHA 1WHMA 2KYBA 3OYMA 3EGXA 1BI3A 4MZPA 1VYTA 3CCQA 2KRSA 4HCKA 3OSSC 5HY6A 1R77A 2DTHA 2ATCB 4M7AB 4FCYA 5FRNA 2XK0A 1TH7A 2VKNA 1MHNA 2EJFA 2XDDA 1SHGA 3VUBA 3M5AA 4OB1B 2JNGA 3A98A 2M16A 2QA4Q 4OF1A 2JMAA 1GFCA 3VU3C 2MMPA 3RR6A 2OAUA 4QKUA 1OQKA 4BI8B 1MMDA 1W1FA 2DLPA 3H6ZA 1PRMC 3OYKA 1O75A 2L5QA 1WPYA 4EMKA 3QYHB 4EMKB 2H3EB 3JRZA 2QAZA 3FIFA 2V8IA 3QPHA 2E3HA 4BACA 3CC4Q 2K5FA 1WJRA 1WGSA 2EYQA 1N5ZA 4BDYA 2AKLA 3MEUA 2QQBA 2YRDA 3OBYA 3S6WA 3P8HA 4LD9K 2L89A 3X25B 1K1ZA 4A53A 1KQ2A 5CCAA 2KROA 2JJ9A 1V1CA 2L3QA 2MPXC 2DL8A 1TOVA 3E19A 3O5ZA 5AYFA 1VA7A 3VS5A 3M0PA 4CI0C 4M7AE 2F2WA 3MJXA 2RQUA 2K3XA 2E1HA 5GAOr 2LTOA 2K5IA 4FIBA 3H0FA 3QWXX 4KUDK 2KE9A 2PQWA 2XG8D 4M7AA 2RK2A 2CH4A 3R6OA 1MMGA 3SB2A 2DVEA 2J6FA 3JAME 1N9RA 1QCOA 2M02A 3M0UA 1NBEB 1Y07A 1JJ2A 3E9GA 1MV0B 2OX7A 4JZ3A 5KYUA 1KD1R 4JLGA 3KXTA 4M77B 1I5OB 2QEXA 3MEVA 2E65A 2BE9B 1YN8A 3QKJA 2KMTA 4XTVA 3ZFJA 2O4XA 4C92B 3L2RA 1D3BA 1OOTA 2M9UA 2YUQA 4OGEA 1WXTA 1AWXA 2YUOA 4F7UG 1TWBA 2CSQA 4J9GA 3I56Q 4FYYB 3TSWA 5GMKi 2LMJA 5GAOq 2YXYA 4X9DA 1W6XA 4X9CA 4QW2A 2CT4A 1W4SA 2DETA 2QQ9A 3HTRA 4J9BA 4AG1C 3A8GB 5IH2A 1QWEA 3CPWA 4PJMA 4XU2A 4QQ6A 1ZUUA 2P0KA 2BTTA 3CXCA 1VQMT 3F70A 5A0GA 9ATCB 4DEXA 2RQVA 4V2SA 3D7SB 1M90U 1JEGA 1QVFA 3CCUA 2X3XD 2OTJQ 3RBBB 1UFFA 4N4HA 1ZUKA 3QHSA 2JW4A 1PD1A 4JZ4A 4QVZA 5M9OA 1UUEA 1M4ZA 2GQVA 3PGGA 1VQ7A 2JVVA 2KT8A 4RUGA 4M7AF 2LVMA 2ZPEB 2GF7A 3M4YA 4IIOA 4E7IA 3RKWA 2KBTA 2KGTA 1E7OA 2DMOA 2Y4XA 1KQSS 3DKMA 3C4SA 1OULA 3FB9A 5KYWA 2PUOB 4AMCA 3LYIA 4O5VA 5LJ5j 3CCVQ 2RQRA 2M51A 5L8RE 2LQKA 2DL5A 1KHIA 1BI0A 1Q7YU 2G3RA 1AHJB 3CD6A 1ZA1B 3HSBA 4IUVA 2NUZA 4JS4A 1NEGA 4NS5A 4ORZA 1RL2A 2SEMA 4N0AC 2CDTA 5GJWB 2I2LA 4FW1A 4CC2A 2CP5A 4HCZA 2QTXA 2VGMA 1VQKA 2EQJA 1U5SA 1NJIC 2QA4T 2V26A 3CMAA 2CZ1B 4A4GA 1M8MA 4IURA 4HVUA 5FU7C 5IHNA 3A5ZB 6AT1B 2RI3A 1M27C 2MIOA 4CC3A 1OPKA 2DERA 2EQMA 2V1RA 2JTFA 1WYXA 5GAOp 3C0CA 1ZUYA 1KHCA 2RA2A 2QASA 3E9FA 3HPWA 2R5AA 4GBQA 1RAAB 2CP3A 5IXBA 4JJBA 2X4XA 3PMIA 1M2VA 2CZ0B 4LXCA 5D6WA 4HCBA 4XU0A 1BKBA 5KYYB 1EIFA 3G6EQ 3OYNA 3JCMc 2EVRA 1PNJA 2LQ8A 5EC7A 2EPDA 2HCKA 4J9FA 1SHFA 1M1KU 4NL2A 3KFVA 2COYA 3OW2S 2EYZA 1NYGA 2DJZA 1AD5A 1G3SA 3H0IA 2MYSA 3INZA 3JB9I 2EBPA 3PVQA 5DLQE 4RCBA 4LDVA 2KK4A 3NMZC 1RAEB 1OX8A 5D6XA 4PJOF 4M77A 1YI2T 1SRLA 3CC4A 2DD4A 4HXJA 4F16A 1I8FA 2C0TA 2DAQA 2ZGWA 3META 1ZX6A 3M0QA 3P8DA 1BI2A 3L2WA 4C92A 1D3BB 2QA4A 4PJOB 2KT1A 1NYFA 1GBRA 2RO0A 5EG2A 1SPKA 4DEYA 2I0NA 4ZN3A 3UF4A 3L2QA 3T9NA 3HRUA 5CAIA 2O9VA 1G8XA 2EQKA 1Y7XA 1FMWA 5HK3A 3I56T 4JRKA 1V29B 1SKUB 2DEQA 2DZCA 3JCMd 5FU6B 4JRQA 4FL6A 5KYUB 4JLIA 3JCMQ 3GOXA 2FVUA 1ZHIA 4FU6A 3CCQQ 3CCUT 1YCYA 1R0CB 4M7AG 3G4SQ 1OZ3A 1QWFA 1WNLA 5C6SA 2JXBA 2COZA 3CBOA 3X28B 1G3TA 1QP2A 1PM3A 2LJ3A 5GAN3 2K2VA 3M4GA 4JJCA 3M54A 1PKSA 1X69A 2FZGB 2EWNA 4Z88A 1NJIR 1N9SA 3ZBDA 1Q7YC 4LD6A 2KEAA 3QUIA 4MMLA 3JB9J 2E41A 2A3LA 2CP0A 4J9EA 3CBPA 3CCJQ 1AT1B 1D09B 1LVKA 2L8DA 1TUGB 5GANh 2DIQA 3EFOA 1S1NA 2LX7A 1U3OA 4FYXB 4WTOB 1NJIU 3M9QA 3EAEA 1FX7A 1OX9A 2HBPA 2K3YA 4HA8A 2DRKA 5KYXA 1D1BA 1WXUA 2DK3A 2XD0A 1CKAA 1PSEA 1N6AA 1IGQA 1B07A 2W10A 3UA7A 1UB4A 1WX6A 1SRMA 4C92E 1K9MC 1DJ7B 1VUBA 3VS6A 1KSWA 1QCNA 3EHQA 2DE0X 2DYIA 4M75F 3CCJT 2XICA 2H8HA 4M77G 4PJOG 3NTKA 2KYMA 3MPUB 4KUIA 2CREA 2K4YA 3SEMA 3CC2T 1QVPA 1PWTA 4LN2A 2CP2A 5J39A 1OU9A 2DM1A 2GFUA 5C0MA 1AWOA 3I35A 3PIOA 3C94A 2BUDA 5KYWB 4CC4B 4RMOA 1X01A 3PE0A 5FU6C 3VS0A 2FPDA 2LQNA 5GMKh 4O6JA 2CKKA 3REBB 2FRWA 3L2ZA 2EGCA 3G71A 2VV5A 2QDYB 1WHHA 3N5BB 3QZ9B 5DM7R 1M2OA 1N27A 3OMCA 1VQ7Q 2RN8A 4N4GA 1GCPA 4KGZB 3UATA 1PSFA 5CQYA 3EH1A 4NOYA 4BE0A 2DXCA 3QYGB 1JB0E 1JQQA 1JO8A 4BE2A 1KQ1A 1UG1A 2GTOA 1GBQA 2RJFA 4EPCA 1BYMA 2OTLA 2R58A 1YJWQ 1OI1A 2OTJA 1X6OA 4M75B 1UECA 2CSIA 3OBWA 3ULRB 3JB9H 2BIVA 4E7KA 3I5RA 2C06A 2HQHA 4FT4A 3SWNB 1VIEA 1UJYA 1RLQC 2QTVA 3M56A 2HSPA 2AZSA 3BFMA 5GAN5 4M7DB 2WSCE 1KD1C 1BIAA 1PCXA 1RADB 1G3WA 2A28A 1JJ2P 3M55A 1X43A 3EGUA 4RTVA 2BZXA 1W70A 2QEXQ 2JMCA 1LNXA 4E47A 5ECAA 3HL8A 4LUEA 2HQEA 2ZPFB 1VQOA 2RI2A 4AT1B 3G6EA 2F2XA 4QQGA 4J9IA 4XTWA 3VRYA 1UEBA 3RKXA 2J6OA 3OYEA 1K4US 4P5NA 2L0AA 2X4WA 3JV3A 2IVWA 3JCMP 4XK8E 1ZQ1A 1NPPA 3CCRT 5GMKl 4XTYA 1S72A 1SF9A 1MNDA 1IZ6A 3LX7A 2M0YA 3L2VA 2RHZA 4B9XA 1UHCA 5A0DA 4C92F 2QEXT 2CH4W 2EYXA 1T0HA 2KXDA 3PFSA 1WXBA 1X2KA 2E70A 1YITT 2RPNA 2QQAA 1H92A 1X27A 4F7UA 1ABOA 2CT3A 2DD5A 2EGEA 4M4ZA 2X35A 3S3OA 2HQXA 2JTMA 4C0FA 2E4HA 4M77F 2O2OA 1X2QA 1K8AR 2RHXA 2EQUA 1YI2A 1G2BA 4K11A 3M0SA 4BY6B 5LJ5g 3V8KA 3A1PA 2FHDA 1VQLQ 1AVZC 1K0SA 2QQSA 4BI3A 1VQ5T 1K9MU 4DBFA 1KD1U 4M78E 3CBMA 3VS2A 4M7DE 1BK2A 4BUGA 1YIJA 4FW2A 3BE3A 2DTOA 4M75C 1TUDA 3ER0A 4OB3B 3V7CA 1O9SA 4CRIA 1YJWT 2DILA 2LC4A 2FZCB 4M7DC 2ZPGB 5GMKm 2HL5C 5FWCA 5LJ3e 4QQDA 3FEOA 4E6RA 4WCIA 5GJVB 2WACA 3EG1A 2JTEA 5CKEA 1SG5A 4XAXB 5GAN8 1G5VA 4AFQC 4A4FA 1Q82C 3NPFA 4AFZC 1D1AA 4ZGEB 1PG5B 2EYWA 3CCJA 2XDPA 1K8AC 2COWA 1UGSB 3C95A 5I21A 1QMCA 2CGHA 5GMKe 1S72Q 3VRZA 5LJ3h 3CCRQ 1YNZA 2DL7A 2WSEE 1NLOC 1MGQA 4Z02A 4M7AC 4BB7A 2RJEA 2HD0A 4EIKA 3WXMB 1M2VB 2RJDA 2XI9A 1VYUA 1HD3A 3QIIA 2LZ6B 1QKWA 1AZEA 2Y90A 3LWIA 1VQMQ 4LDUA 4M78B 3J81E 1QVGA 3CCVA 1M9SA 3THKA 1NM7A 2BE7D 3OYFA 1BCOA 2CZ6B 5L23A 3CMEA 2OTJT 1HJDA 4RCCA 2RHIA 1S72T 2ROLA 4MZMA 5LL6S 1GXIE 2KRMA 2PUKB 1WDXA 5GAN7 2JT4A 3A8LB 4DA4A 3QZ5B 2KSSA 1G83A 2FO0A 3CCLQ 3CD6T 2JS2A 4EMHA 3FRNA 1MV3A 2DIGA 3GIBA 1RAGB 4PJNA 3GNGA 2DF6A 3OYJA 2GQIA 4XTUA 4HKEA 3JCMe 4J7FA 4F7UF 4E7LA 1QP3A 1VQ8Q 2KQWA 2DL3A 4D8DA 3OS1A 1WQWA 4YTLA 3MCAB 2DXUA 5CKHA 3BDUA 2LJ1A 2YWWA 1UHFA 4M78D 3SHWA 3G4ST 5GAN2 1RI9A 2NWMA 4KH0B 3CCLT 3CD6Q 1H3HA 2K79A 1M90C 1VQ4Q 4HT9A 3R6NA 1VQ6T 3BDLA 2QGGA 4LE9A 1XQHA 1E6HA 2YSQA 4JRIA 2OTLQ 3OY9A 1KK7A 1GCQC 1IXDA 2NUPB 2YDLA 3VJPA 4NL3A 3EG9A 1VQ9Q 1I0CA 1WA7A 1RLPC 1IHVA 2A08A 1OZ2A 5IT9E 1JRIA 3OYBA 4JDSA 2QYZA 1B3QA 1XTDA 2E10A 2FYKA 4A4EA 2J05A 1YITQ 3GLXA 8AT1B 4EDUA 2RB6A 2KVQG 4PJLA 1TUCA 2FL7A 3CCMQ 1LCKA 1M3AA 2K57A 1W2BP 2KDSA 3V8LA 4GLKA 3UWNA 1YJNQ 2QDLA 2XMFA 4C8QF 2K9GA 3A8MB 1BBZA 4M7DA 3UT1A 3I56A 3CMEQ 4KGVB 1GRIA 5IAYA 1HXDA 2D0NA 1VQ5Q 4C0ZA 2EYYA 1K73U 2C0IA 2FRYA 4IIMA 1QVGS 4KULA 1FWZA 4ME7A 1TXQA 1VQLA 3AT1B 2SRCA 2RNAA 4XTZA 3CC4T 2DO3A 2JS0A 3L1AA 3HRSA 1X6BA 2AZVA 2JUFA 1I5LA 4MZTA 2J6KA 3CCSQ 2A7YA 2PNIA 3URGA 5HKCA 4ZNXA 2KY9A 1C6VX 3OW2P 3FJ5A 2NUPA 4IUQA 3CCLA 3SDZA 4RTTA 2KI7A 1YJ9T 2XKOC 1OEBA 2VASA 2RQTA 2VXFA 4TVRA 3HFNA 1Q86R 3A8OB 1PHTA 4WF2A 3SD4A 4PNOA 1WFWA 4M75D 4II1A 3FLGA 3GNFB 1VQOT 4HCCA 1MNEA 2EFIA 3KBGA 1Y96A 4ANJA 1P92A 2FZKB 3CCST 4JS5A 4J9HA 4M7DD 1R0BG 1YHQT 4M7AD 1GCQA 1YIJQ 1SSHA 2DTIA 4OGCA 3QWYA 2L3RA 5CKDA 1AEYA 5IXFA 1W2BA 2DL4A 3EG2A 1NG2A 3CCQT 5GAN4 1VQ4A 2LCLA 1I07A 3ME9A 1D1CA 4ELZC 1KC8U 3H8ZA 4RKUE 3M0RA 3E2UA 5I2MA 4F7UB 1AWJA 2DRMA 2IIMA 2L3SA 2BKDN 4EMGA 5KYXB 2RH2A 4OMPA 1Q86C 2QI2A 1ZSGA 3CCMT 2F1LA 5KH6A 5IHIA 1IRXA 2ROTA 3VYHB 1Y96B 2OJ2A 2ED1A 2ENMA 4M77E 3JB9F 1BU1A 3OYHA 3VKIA 2X4JA 2EKHA 1KC8R 2CS7A 5A2QE 3UDCA 3RESA 1JXOA 2RF0A 4C8QG 3X24B 1NZ9A 2DFUA 2B86A 4F17A 2IPOB 2HMAA 4XU1A 1IB8A 2DKGA 3BY7A 1VIFA 3EFRA 4JJNK 1QVGP 1VQNQ 5IHKA 2QXFA 3DLMA 2DEUA 4E7ZA 1J3TA 4F14A 3OA6A 4OMFB 2FPEA 2P4TA 5CVIA 4ATOA 2XU8A 2DXBA 1HK9A 2ED0A 2O9SA 1MMAA 5GAMd 2O31A 2X3WD 4JUVA 2DNUA 2BZYA 3EG0A 1ZBXA 1GFDA 2KNBB 3NGPA 4DBQA 4ESRA 3FDRA 1X75C 3WVDB 1N8RC 2F69A 2IG0A 4RTUA 1VQNT 1KC8C 3QJ6A 1C1AA 2YLCA 1D0ZA 1QCFA 4C8QC 1B34A 1H3ZA 2YLBA 1A0NB 4J6XA 1I1JA 1Q82U 3VS1A 1NEBA 2FPFA 3J80E 5KCOA 2X51A 1NLPC 1Q86U 2E5KA 4ZTJA 2PU9B 4PJOC 4A4HA 2DPPB 2GCXA 3PT9A 3JCMg 3I55Q 4JPBW 4IUPA 4KRTA 2B8AA 2HL3A 1TU0B 3OYCA 4F04B 3OYLA 2EAYA 2JN0A 1Y0MA 1UE9A 4C5HA 4ZGJB 2RM4A 2F5KA 1C0MA 4C8QD 2HKNA 4XU3A 1Y71A 1I81A 2A37A 4L6V5 4OMMA 3I5SA 5LJ5d 2OAWA 3M53A 1RAIB 4KT0E 2VUBA 5GANd 1TG0A 2LNVA 3CPWS 1D0XA 2LQWA 4OVAA 2HAXA 2JM8A 4J9CA 1QLYA 1ACMB 4DBRA 3JCMX 4R55A 1VYVA 1QW1A 2J06A 3QG1A 2NYSA 2F5TX 2LX9A 4RTZA 1HYOA 2JOYA 5FROA 1RUWA 4E7HA 1VQPQ 2D9TA 1VQKT 3JCMf 2NLUA 1N8RU 5GANg 1M30A 3G6ET 5LJ5f 4BDZA 5CKFA 3SFMA 3HKSA 3OW2A 2L2PA 1Y57A 1GL5A 1UGRB 2LT1A 4OMLA 4C5EA 4RTWA 3CC2Q 3EFOB 1R8OB 4IUTA 3G4SA 3GF5A 5J26A
chains in the Genus database with same CATH topology
2LRQA 2JTFA 5LJ3h 1XNIA 3UPUA 3NTHA 2WSEE 1YITA 1MGQA 4OB0B 4Z02A 5GAOp 4M7AC 1KHCA 2RA2A 4C5IA 3E9FA 1JJ2S 4BB7A 3HPWA 4F7UE 1U1TA 2R5AA 2HD0A 2RJEA 2EIFA 2YRVA 4QVCA 4M7DG 2X4XA 3PMIA 3FJPA 5LJ3g 5GAOn 3WXMB 2CZ0B 4DOWA 5D6WA 4HCBA 4XU0A 2RJDA 2XI9A 1BKBA 2FB7A 1EIFA 3QIIA 4LDWA 3MP6A 4BY6C 3S3MA 4M75E 4PJOD 1G3YA 4N0AA 3OYNA 2R57A 1YIJT 3JCMc 2DZ9A 2Y90A 1VQPA 1BIBA 3LWIA 4LDUA 3CEYA 2LQ8A 4M78B 3J81E 1QVGA 3LH0A 1VQ7T 3CCVA 1VQ8T 1M9SA 2E5QA 3OYFA 1YJ9A 3NTIA 3CMEA 2CZ6B 5GMKe 1M1KU 2OTJT 3RERA 4NL2A 4J6YA 4FSXA 2LDMA 4RCCA 3I55A 2RHIA 1S72T 4LDXA 4MZMA 5LL6S 3OW2S 4M7DF 3MEWA 1GXIE 2PUKB 4C8QA 5FRMA 3QJYA 5LJ3d 2MWOA 2DJZA 5GAN7 3A8LB 4DA4A 3QZ5B 1G3SA 3M58A 2KSSA 3INZA 4J83A 4PJOE 3JB9I 5CO7A 3CD6T 1N8RC 1JBMA 5DLQE 2M0OA 3TEEA 2LT4A 2MWPA 4RCBA 3X20B 3FRNA 4EMHA 3EFSA 3S3NA 4LDVA 4VUBA 1VQ4T 2KK4A 4B9WA 2DIGA 5CKBA 5D6XA 4MMKA 4PJOF 4M77A 1M5Q1 4D6WA 1YI2T 3RIRA 3GIBA 5LJ5e 3CC4A 3HFOA 3GNGA 3OYJA 1VQ9T 2DD4A 4XTUA 4HKEA 1I8FA 3JCMe 3OYIA 4J7FA 4F7UF 4E7LA 4JRPA 3CCSA 2DAQA 4J7IA 1QP3A 2ZGWA 2KQWA 3META 4Y28E 2P0QA 3C12A 4M78F 3P8DA 1BI2A 3L2WA 3OS1A 1IREB 1WQWA 4YTLA 4C92A 1U8RA 1D3BB 4RG2A 2QA4A 4PJOB 3MCAB 2RO0A 2DXUA 4KBMB 4PLLA 5EG2A 2WSFE 3BDUA 5CKHA 5LJ3f 5GAMe 1NPRA 1NE8A 1Q81U 4L59A 4M78D 3G4ST 2PVDB 5GAN2 4C0DB 4ZN3A 3TU4K 3CCRA 3PIPA 3MO8A 4XQ3A 4ZGDB 3CCLT 2VXEA 5GANe 3L2QA 3T9NA 3HRUA 3OYGA 4DQ2A 1M90C 1H641 3VUZA 5CAIA 2XIDA 3P8BB 2GFAA 3HP9A 2EQKA 2CZ7B 4HT9A 1Y7XA 4M75G 1VQ6T 5HK3A 1VQPT 1LJOA 3BDLA 2MAMA 4GY5A 3GP8A 5GAMf 3I56T 4JRKA 5LJ5h 3VV0A 1XQHA 3LGLA 1V29B 4JRIA 3OY9A 2DEQA 2DZCA 3JCMh 3WVEB 3JCMd 5FU6B 2ZPIB 4FM4B 3VJPA 4NL3A 3CMET 4JRQA 4FL6A 2E64A 4JLIA 3CC2A 4C92G 3QDRB 2VGNA 2VC8A 3JCMQ 3GOXA 4XTXA 3CCEA 3L2UA 1LOJA 2FVUA 1WJQA 3RMQA 1OZ2A 1ZHIA 4FU6A 3CCUT 1JRIA 3OYBA 1YCYA 5IT9E 4JDSA 3QXEB 1M1KC 2ZPHB 3HHTB 3GPLA 4M7AG 1OZ3A 1XTDA 2M1HA 4EMKC 2E10A 1WNLA 3VYGA 3PNWC 4OB2B 5FLXE 5C6SA 2FYKA 1BI1A 4A4EA 4E7JA 2XDBA 3QSUA 1YBYA 3OS2A 3CBOA 2V8JA 1VQLT 4PJOA 3GLXA 4DOVA 1UGPB 3X28B 1VQ6A 2YHTA 2VYTA 1G3TA 1OYXA 1U1SA 1QP2A 4EDUA 1QVFS 2RB6A 2EJGA 5GAN3 2KVQG 2K2VA 3M4GA 3JB9D 4LDYA 4R56A 2FL7A 3JCMJ 3M54A 5KE3A 2K57A 3V8JA 4A54A 3KUFA 5FU7B 2EWNA 2KDSA 3V8LA 4A4KA 1YJWA 4J8OA 4GLKA 3CMAT 1N9SA 3UWNA 3ZBDA 1Q7YC 4C5GA 4LD6A 3I55T 3OMGA 4C8QF 3QUIA 3A8MB 4MMLA 2E41A 3CCMA 3JB9J 2A3LA 3UT1A 2OTLT 4QVDA 4M7DA 3CBPA 3I56A 4BD3A 2R5MA 4M78C 3QO3A 5GMKj 2D6FA 3L42A 5J26A 2L8DA 5IAYA 1KQSA 1HXDA 3MHXA 2RK1A 5GANh 1M1GA 3LWHA 4C0ZA 2DXTA 2DIQA 5IN1A 5GAOm 1K73U 3OYMA 1M8VA 1BI3A 3OS5A 4M77C 2JZ2A 4MZPA 5GAMh 3M9QA 3CCQA 3EAEA 1NJIU 2HNIA 1QVGS 1FX7A 4KULA 1FWZA 2HBPA 3OSSC 2E6ZA 2K3YA 2MF2A 4HA8A 4ME7A 5HY6A 1VQLA 1VQMA 2DK3A 2DTHA 2XD0A 4M7AB 4XTZA 3OQ5A 1PSEA 3CC4T 2DO3A 1WJSA 1N6AA 3OYDA 3L1AA 2EJ9A 3HRSA 2PVGB 1YHQA 2XK0A 1WQ7A 1K8AU 1TH7A 2JUFA 1MHNA 3NFCA 2P0PA 1UGQB 4C92C 1UB4A 2EJFA 2XDDA 1I5LA 4MZTA 3SWNC 4C92E 3VUBA 5CR2A 1K9MC 1DJ7B 1VUBA 2A7YA 3URGA 3M5AA 5HKCA 1M1FA 4BE1A 4OB1B 3AHUA 2KY9A 3CPFA 4M75F 3CCJT 2XICA 2JNGA 4M77G 2M16A 4PJOG 3NTKA 4IUQA 3SWNA 4OF1A 3CCLA 2V8KA 3SDZA 4KUIA 4OP0A 4C0DC 3VU3C 2MMPA 2K4YA 3OB9A 5KCHA 1YJ9T 3G7ZA 2XKOC 2OAUA 3CC2T 1QVPA 2XHCA 4BI8B 3ZEHA 2VXFA 4TVRA 4ELYC 3HFNA 5GAMg 5J39A 3H6ZA 2O4XB 2GFUA 3A8OB 4WF2A 5C0MA 3SD4A 3OYKA 3JCMW 2E12A 1O75A 2L5QA 4PNOA 1I4K1 3X26B 3C94A 3PIOA 4M75D 1WPYA 2BUDA 4II1A 3FLGA 3GNFB 3QYHB 4EMKA 1VQOT 4EMKB 3JRZA 4HCCA 4RMOA 3HRTA 3JB9G 2EFIA 3FIFA 3KBGA 2V8IA 1X01A 3QPHA 5FU6C 1SSFA 1Y96A 4BACA 2LCCA 2K5FA 3M57A 1P92A 1WJRA 1W2BS 1WGSA 5GMKh 2EYQA 3OYAA 2KAFA 3CCST 4O6JA 4M77D 4BDYA 3MEUA 2QQBA 3OBYA 4L5GA 3S6WA 4JS5A 3P8HA 2CKKA 4PL6A 4LD9K 2L89A 4M7DD 2AHJB 3X25B 4A53A 4M7AD 1YHQT 3L2ZA 1KQ2A 3G71A 2VV5A 2QDYB 5CCAA 2DTIA 4J6WA 4OGCA 3N5BB 5GAMj 3QZ9B 2L3RA 5DM7R 5CKDA 1N27A 3OMCA 4MDWA 1W2BA 3CXCS 4N4GA 3E19A 4C92D 1VQ4A 3CCQT 5GAN4 5AYFA 3LGFA 5GANj 5GANf 2RHUA 2LCLA 4CI0C 4M7AE 3ME9A 4ELZC 1KC8U 1PSFA 1RI0A 5CQYA 2K3XA 3JCMb 2E1HA 3H8ZA 2RD1A 4NOYA 4BE0A 2DXCA 3QYGB 4RKUE 5GAOr 1JB0E 3ASKA 5I2MA 4F7UB 1KQ1A 2LTOA 4BE2A 2K5IA 4HT8A 4FIBA 2BKDN 4EMGA 4KUDK 2PQWA 2RH2A 2RJFA 4EPCA 1YJNA 2XG8D 2QI2A 2RK2A 5DLOA 3FC3A 3E1SA 3CCMT 2R58A 3R6OA 5KH6A 3CCVT 2OTLA 1BYMA 3SB2A 2RI5A 2DVEA 1OI1A 3LW5E 1N9RA 1X6OA 3VYHB 4ZN1A 3JAME 1Q81C 2OTJA 4M75B 4M77E 4PLIA 4M78G 3JB9F 3OYHA 3VKIA 3OBWA 1YJNT 2X4JA 4ZTFA 4RG8A 3JB9H 2BIVA 1Y07A 3PTAA 4E7KA 3JSCA 3E9GA 2CS7A 1JJ2A 2C06A 4FT4A 5A2QE 4J5YA 3SWNB 3UDCA 1VIEA 4JLGA 3RESA 3KXTA 3M56A 4M77B 2K5LA 4C8QG 3X24B 2QEXA 1VQNA 1NZ9A 3MEVA 3BFMA 5GAN5 4M7DB 2WSCE 2E65A 1KD1C 1BIAA 1G3WA 5LJ3j 1XOVA 3M55A 3DLLA 4XU1A 3A8HB 3QKJA 2KMTA 2DKGA 3BY7A 3EFRA 1VIFA 4XTVA 4JJNK 1LNXA 3ZFJA 4E47A 2O4XA 2ZPBB 1VQ9A 4C92B 3HL8A 3L2RA 1D3BA 3DB3A 2HQEA 5J3BA 2QXFA 2ZPFB 3DLMA 1VQOA 2M9UA 2RI2A 4OGEA 3OA6A 4OMFB 2Y4YA 2CYZB 3G6EA 2ZZDA 4F7UG 4FT2A 4QQGA 1Q86C 4XTWA 2P4TA 1UEBA 3RKXA 3OYEA 4MDXA 4IUUA 4P5NA 5CVIA 2XU8A 5D6YA 3RUXA 3CCET 2DXBA 4ATOA 1HK9A 2X4WA 3OS0A 5GAMd 2IVWA 3JCMP 5CQXA 4XK8E 5GMKi 4JUVA 1ZQ1A 1NPPA 3CCRT 3DB4A 5HK0A 5GAOq 3CC7T 5GMKl 4XTYA 5DY9A 4PKCC 1ZBXA 1VQ8A 2MI6A 3MP8A 4X9DA 1S72A 4X9CA 2EKOA 4QW2A 1IZ6A 3LX7A 3L2VA 1W4SA 2QQ9A 3OYYA 3FDRA 1X75C 2ZCFB 4Y91A 3RKYA 5A0LA 3A8GB 2RHZA 5I2SA 3TCJA 3WVDB 2IG0A 2F69A 4B9XA 4C92F 5A0DA 3MEAA 2QEXT 1KC8C 1VQNT 3QJ6A 4M78A 3CPWA 3TREA 2YLCA 4XU2A 4C8QE 4QQ6A 1KG1A 3PFSA 3JCMV 2E70A 4C8QC 1YITT 1B34A 2P0KA 2QQAA 1H3ZA 2YLBA 3OSVA 4F7UA 3CXCA 4J6XA 1VQMT 3F70A 2DD5A 5A0GA 3G71T 1Q82U 2X35A 3S3OA 2HQXA 3J80E 5KCOA 4V2SA 2JTMA 1Q86U 4C0FA 1M90U 1QVFA 3CCUA 4M77F 4ZTJA 1K73C 2PU9B 4N4HA 3J7AF 4A4HA 2RHXA 4PJOC 2DPPB 2EQUA 2GCXA 1YI2A 3QHSA 3PT9A 3JCMg 3M59A 3MP1A 4QVZA 3QBYA 5M9OA 4BY6B 5LJ5g 3V8KA 4IUPA 2B8AA 2RJCA 3PMTA 1M4ZA 2FHDA 3OYCA 2GQVA 3PGGA 3OYLA 2EAYA 2JN0A 3O8VA 4N4IA 2JVVA 3CC7A 1VQ7A 3LLRA 4M7AF 4C5HA 2LVMA 2ZPEB 2QQSA 4ZGJB 2GF7A 4BI3A 4Q5WA 2RM4A 3M4YA 1VQ5T 1K9MU 4E7IA 3RKWA 1KD1U 4M78E 2Y4XA 2F5KA 1KQSS 3DKMA 3CBMA 3C4SA 4C8QD 2D0QB 4XU3A 4M7DE 4BUGA 1Y71A 1YIJA 1I81A 2DTOA 4M75C 4L6V5 3FB9A 4IKFA 2PUOB 5LJ5d 3V7SA 3ER0A 4OB3B 5GAN6 3LYIA 3V7CA 3M53A 3Q1JA 4KT0E 4O5VA 5LJ5j 2VUBA 1O9SA 5GANd 4M7AA 4CRIA 1YJWT 2LNVA 3CPWS 2HAXA 4OVAA 5L8RE 2QQRA 3RMSA 2LC4A 2LQKA 2PVOB 1KHIA 3V7RA 4M7DC 1BI0A 2ZPGB 1Q7YU 5GMKm 2G3RA 3JCMX 4R55A 1AHJB 5LJ3e 1QW1A 4QQDA 3CD6A 3FEOA 3QG1A 5CK9A 4BI4A 3HSBA 2F5TX 4IUVA 2LX9A 2JOYA 5FROA 4C0GA 4JS4A 4NS5A 5KE2A 1RL2A 4E7HA 2RHYA 1VQKT 2D9TA 4N0AC 2WACA 1VQ5A 3BW1A 5CKEA 2I2LA 3JCMf 2NLUA 1N8RU 4HCZA 2O01E 5GANg 3G6ET 5LJ5f 4BDZA 2QTXA 5CKFA 3SFMA 2VGMA 5FRNA 3HKSA 4XAXB 3OW2A 1VQKA 2EQJA 5GAN8 1G5VA 1NJIC 1B34B 2QA4T 1UGRB 2LT1A 3CMAA 4A4FA 1Q82C 2CZ1B 4A4GA 5CIUA 4IURA 4C5EA 4C8QB 1FXXA 5FU7C 4ZGEB 4UC4A 3CCJA 1R8OB 3A5ZB 2RI3A 2XDPA 1K8AC 4X34A 2X4YA 1UGSB 3C95A 4M75A 2E6NA 4IUTA 5I21A 3G4SA 2CGHA 3GF5A 1Y96B 2H3JA 2EQMA 5GAOl
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRQ A;  2JTF A;  1XNI A;  3NTH A;  1YIT A;  4Z02 A;  1KHC A;  4C5I A;  1JJ2 S;  3E9F A;  2R5A A;  2RJE A;  2EIF A;  2YRV A;  2X4X A;  3PMI A;  5D6W A;  2RJD A;  1BKB A;  1EIF A;  3QII A;  3MP6 A;  3S3M A;  3OYN A;  2R57 A;  1YIJ T;  1VQP A;  3J81 E;  3CEY A;  2LQ8 A;  1QVG A;  3LH0 A;  1VQ7 T;  3CCV A;  1VQ8 T;  2E5Q A;  1YJ9 A;  3OYF A;  3NTI A;  3CME A;  1M1K U;  2OTJ T;  2LDM A;  3I55 A;  2RHI A;  1S72 T;  5LL6 S;  3OW2 S;  3MEW A;  5FRM A;  2MWO A;  3CD6 T;  5DLQ E;  2M0O A;  2MWP A;  1VQ4 T;  3S3N A;  4B9W A;  2DIG A;  5D6X A;  1YI2 T;  3CC4 A;  3OYJ A;  1VQ9 T;  3OYI A;  4E7L A;  3CCS A;  2DAQ A;  3MET A;  3P8D A;  3L2W A;  3OS1 A;  4YTL A;  4RG2 A;  2QA4 A;  4PLL A;  2RO0 A;  1NPR A;  1Q81 U;  4L59 A;  3G4S T;  4ZN3 A;  3CCR A;  3PIP A;  3MO8 A;  3CCL T;  3L2Q A;  3OYG A;  1M90 C;  3P8B B;  2GFA A;  2EQK A;  1VQ6 T;  1VQP T;  3BDL A;  4GY5 A;  3I56 T;  3LGL A;  3OY9 A;  3CME T;  4FL6 A;  3CC2 A;  3GOX A;  3CCE A;  3L2U A;  1WJQ A;  1OZ2 A;  4FU6 A;  3CCU T;  5IT9 E;  3OYB A;  1M1K C;  1XTD A;  1OZ3 A;  2M1H A;  5FLX E;  5C6S A;  3PNW C;  4A4E A;  4E7J A;  1YBY A;  3OS2 A;  1VQL T;  2VYT A;  1QVF S;  1OYX A;  4EDU A;  2KVQ G;  5KE3 A;  3KUF A;  2KDS A;  1YJW A;  3CMA T;  3UWN A;  1Q7Y C;  4C5G A;  4LD6 A;  3I55 T;  3OMG A;  3CCM A;  2OTL T;  3UT1 A;  3I56 A;  4BD3 A;  2R5M A;  3L42 A;  5IAY A;  1KQS A;  2L8D A;  1M1G A;  2DIQ A;  5IN1 A;  1K73 U;  3OYM A;  2JZ2 A;  1NJI U;  3M9Q A;  3CCQ A;  3EAE A;  1QVG S;  2E6Z A;  2K3Y A;  1VQL A;  5HY6 A;  1VQM A;  3OQ5 A;  3CC4 T;  2DO3 A;  1WJS A;  3OYD A;  1YHQ A;  1K8A U;  5FRN A;  2XK0 A;  2JUF A;  1MHN A;  1K9M C;  4BE1 A;  3CPF A;  3CCJ T;  2JNG A;  2M16 A;  3NTK A;  4IUQ A;  3CCL A;  3OB9 A;  5KCH A;  1YJ9 T;  3CC2 T;  2XHC A;  3ZEH A;  4TVR A;  5J39 A;  3H6Z A;  2O4X B;  2GFU A;  5C0M A;  3SD4 A;  3OYK A;  3PIO A;  1VQ6 A;  2BUD A;  4II1 A;  3FLG A;  1VQO T;  2EFI A;  3KBG A;  1SSF A;  4BAC A;  2LCC A;  1WJR A;  1W2B S;  1WGS A;  3OYA A;  3CCS T;  4BDY A;  3MEU A;  3S6W A;  3P8H A;  2CKK A;  4PL6 A;  2L89 A;  1YHQ T;  3G71 A;  2L3R A;  5DM7 R;  1N27 A;  3OMC A;  1W2B A;  3CXC S;  4N4G A;  1VQ4 A;  3CCQ T;  3LGF A;  2RHU A;  2LCL A;  3ME9 A;  1KC8 U;  1RI0 A;  2K3X A;  3H8Z A;  4BE0 A;  3ASK A;  4BE2 A;  2LTO A;  2BKD N;  2PQW A;  2RJF A;  1YJN A;  1Q86 C;  3FC3 A;  3CCV T;  3CCM T;  2OTL A;  2R58 A;  5KH6 A;  2RI5 A;  3JAM E;  2OTJ A;  1X6O A;  4ZN1 A;  1Q81 C;  1OI1 A;  4PLI A;  1YJN T;  3OYH A;  4ZTF A;  2BIV A;  4E7K A;  1JJ2 A;  3E9G A;  5A2Q E;  2QEX A;  1VQN A;  1NZ9 A;  3MEV A;  1KD1 C;  3DLL A;  3QKJ A;  2O4X A;  1VQ9 A;  3L2R A;  3DB3 A;  5J3B A;  2HQE A;  3DLM A;  1VQO A;  2RI2 A;  3OA6 A;  3G6E A;  4QQG A;  1UEB A;  3OYE A;  4IUU A;  3CCE T;  5D6Y A;  2X4W A;  3OS0 A;  1NPP A;  3CCR T;  3DB4 A;  3CC7 T;  1VQ8 A;  2MI6 A;  1S72 A;  3MP8 A;  2EKO A;  4QW2 A;  1IZ6 A;  3LX7 A;  3L2V A;  3OYY A;  3FDR A;  2RHZ A;  1N8R C;  2IG0 A;  4B9X A;  2QEX T;  1VQN T;  3MEA A;  1KC8 C;  3QJ6 A;  3CPW A;  3TRE A;  4QQ6 A;  3PFS A;  2E70 A;  1YIT T;  2P0K A;  1H3Z A;  3CXC A;  1VQM T;  3F70 A;  1Q82 U;  2X35 A;  3S3O A;  2HQX A;  3J80 E;  5KCO A;  1Q86 U;  1M90 U;  1QVF A;  3CCU A;  4ZTJ A;  1K73 C;  4N4H A;  3J7A F;  4A4H A;  2RHX A;  2EQU A;  1YI2 A;  3MP1 A;  4QVZ A;  3QBY A;  5M9O A;  4IUP A;  2B8A A;  2RJC A;  3PMT A;  2FHD A;  3OYC A;  3OYL A;  3CC7 A;  3O8V A;  4N4I A;  1VQ7 A;  2JVV A;  3LLR A;  4C5H A;  2LVM A;  2QQS A;  2GF7 A;  4Q5W A;  1VQ5 T;  1K9M U;  4E7I A;  1KD1 U;  2F5K A;  1KQS S;  3C4S A;  1YIJ A;  4IKF A;  3ER0 A;  3LYI A;  3Q1J A;  4CRI A;  1YJW T;  3CPW S;  4OVA A;  2QQR A;  1KHI A;  1Q7Y U;  2G3R A;  4QQD A;  3CD6 A;  3FEO A;  4IUV A;  2JOY A;  5FRO A;  4NS5 A;  5KE2 A;  1RL2 A;  4E7H A;  2RHY A;  1VQK T;  2D9T A;  1VQ5 A;  2WAC A;  1N8R U;  2NLU A;  4HCZ A;  3G6E T;  4BDZ A;  3HKS A;  3OW2 A;  1VQK A;  2EQJ A;  1G5V A;  1NJI C;  2QA4 T;  3CMA A;  1Q82 C;  4A4F A;  4A4G A;  5CIU A;  4IUR A;  4C5E A;  3CCJ A;  4UC4 A;  3A5Z B;  2RI3 A;  2XDP A;  1K8A C;  4X34 A;  2X4Y A;  2E6N A;  4IUT A;  3G4S A;  5J26 A;  2EQM A;  3G71 T; 
#chains in the Genus database with same CATH topology
 1SEM A;  3UPU A;  3NTH A;  1JJ2 S;  2EIF A;  4OMO A;  4M7D G;  1N8R R;  5LJ3 g;  5GAO n;  4DOW A;  2HZY A;  4LDW A;  3MP6 A;  3S3M A;  4M75 E;  3UA6 A;  1ZA2 B;  2R57 A;  1YIJ T;  2ESW A;  1YFN A;  2DZ9 A;  2X9H A;  4PFO A;  1VQP A;  1KIK A;  2EQI A;  1VQ7 T;  1VQ8 T;  1F1B B;  2E5Q A;  1YJ9 A;  3NTI A;  1UDL A;  4PJJ A;  3VS7 A;  4FSX A;  2K6D A;  3I55 A;  4LDX A;  4M7D F;  1UTI A;  3MEW A;  4C8Q A;  1Q82 R;  3QJY A;  1WHL A;  3M58 A;  5CO7 A;  5D7U A;  3TEE A;  2LT4 A;  2MWP A;  4B9W A;  1VQ6 Q;  3CXC P;  1BB9 A;  3EG9 B;  3NHN A;  4MMK A;  1M5Q 1;  4D6W A;  5LJ5 e;  3HFO A;  3OYI A;  4JRP A;  2KXC A;  2RMO A;  1WHG A;  2P0Q A;  4M78 F;  1KFZ A;  1IGU A;  4OMN A;  4RG2 A;  1TS9 A;  1Q81 U;  1NE8 A;  4R0K A;  2KR3 A;  3EG3 A;  4KGX B;  2RQW A;  2A0F B;  3MO8 A;  3PVL A;  4XQ3 A;  4ZGD B;  1ZLM A;  4LNP A;  5GAN e;  3OYG A;  1RAC B;  1WIE A;  4J9D A;  4DQ2 A;  1H64 1;  1RAF B;  2EGA A;  3EGD B;  8ATC B;  2GFA A;  1T0J A;  1VQP T;  1VQK Q;  2MAM A;  2P84 A;  5AT1 B;  3CQT A;  5LJ5 h;  2VWF A;  3CMA Q;  3LH5 A;  4FM4 B;  3TSZ A;  3CC2 A;  1K0X A;  2VGN A;  2VC8 A;  1LOJ A;  2CP7 A;  1AZG B;  2D8H A;  2DBM A;  1WJQ A;  4QT7 A;  1Q81 R;  1MUZ A;  3HHT B;  5FLX E;  3VYG A;  3PNW C;  3QSU A;  2VYT A;  1QVF S;  1U06 A;  2QGF B;  2L3P A;  4R56 A;  2JM9 A;  3JCM J;  2FEI A;  4LUD A;  4A54 A;  3KUF A;  5FU7 B;  4A4K A;  3CMA T;  2FG0 A;  5KYN A;  1ZBJ A;  3I55 T;  3OMG A;  5FW9 A;  2BZ8 A;  2AK5 A;  3CCM A;  4QVD A;  2R5M A;  2A36 A;  5GMK j;  1YWP A;  2D6F A;  2P4R A;  3L42 A;  1KQS A;  2F2V A;  1M1G A;  2YUN A;  2DXT A;  5IN1 A;  5GAO m;  3EGX B;  2YT6 A;  2NUT A;  1M8V A;  3OS5 A;  2NUT B;  4M77 C;  2JZ2 A;  5GAM h;  2HNI A;  2E6Z A;  2MF2 A;  4HVV A;  1VQM A;  1VQO Q;  2CP6 A;  3OQ5 A;  1Q95 G;  3CPW P;  1WJS A;  3OYD A;  3EGD A;  2EJ9 A;  1YHQ A;  2PVG B;  1K8A U;  1WQ7 A;  3NFC A;  2P0P A;  1UGQ B;  3IQL A;  4C92 C;  2O88 A;  3SWN C;  2DA9 A;  5CR2 A;  3AHU A;  4BE1 A;  1M1F A;  3CPF A;  2DYB A;  1FYN A;  3SWN A;  2V8K A;  3QDF A;  4OP0 A;  4C0D C;  1KQS P;  3TVT A;  3OB9 A;  5KCH A;  3G7Z A;  1TTH B;  1K9M R;  1UJ0 A;  2XHC A;  3ZEH A;  1TSF A;  4ELY C;  5GAM g;  2O4X B;  3JCM W;  2E12 A;  1H8K A;  1I4K 1;  3X26 B;  1VQ6 A;  3U23 A;  4HVW A;  5I11 A;  3EH2 A;  3HRT A;  3JB9 G;  4B6M A;  4KH1 B;  1SSF A;  2K7A A;  2LCC A;  3M57 A;  1W2B S;  3OYA A;  2KAF A;  1Z9Q A;  4M77 D;  4L5G A;  3H41 A;  4PL6 A;  1JXM A;  2AHJ B;  1ARK A;  4J6W A;  5GAM j;  4MDW A;  3CXC S;  4C92 D;  5KYY A;  2CUB A;  3LGF A;  5GAN j;  5GAN f;  2RHU A;  2EW3 A;  1RI0 A;  4CC7 A;  1EZZ B;  3JCM b;  2RD1 A;  2GNC A;  1M90 R;  3ASK A;  3TQ7 P;  4HT8 A;  1K73 R;  4FYV B;  1YJN A;  5DLO A;  3FC3 A;  3E1S A;  3CCV T;  3ZL7 C;  2RI5 A;  3LW5 E;  1Q81 C;  4ZN1 A;  4PLI A;  2AKK A;  4M78 G;  1YJN T;  2GTJ A;  4RG8 A;  4ZTF A;  3PTA A;  3JSC A;  4J5Y A;  2QK0 A;  4PFZ A;  3CC7 Q;  2DBK A;  2K5L A;  1FMV A;  1VQN A;  4X1V A;  1B7T A;  2DJQ A;  1ZSZ C;  5LJ3 j;  1XOV A;  3DLL A;  1HSQ A;  4D8K A;  3A8H B;  1IO6 A;  2ZAE A;  2ZPB B;  1VQ9 A;  3DB3 A;  5J3B A;  2Y4Y A;  2CYZ B;  1D0Y A;  2ZZD A;  4FT2 A;  4MDX A;  4IUU A;  3RUX A;  3CCE T;  5D6Y A;  1ZSZ A;  2LNH B;  3OS0 A;  5CQX A;  3G71 Q;  3DB4 A;  5HK0 A;  3CC7 T;  5DY9 A;  4PKC C;  1VQ8 A;  2MI6 A;  3MP8 A;  2EKO A;  1OV3 A;  3OYY A;  2ZCF B;  4Y91 A;  3RKY A;  5A0L A;  1UGV A;  5I2S A;  3TCJ A;  1WHJ A;  3MEA A;  2MCN A;  1QVF P;  2DX1 A;  4M78 A;  3TRE A;  4C8Q E;  1KG1 A;  3JCM V;  3OSV A;  2MK5 A;  3I9Q A;  3H0H A;  1K73 C;  3J7A F;  2J7I A;  2OI3 A;  2MOX A;  3M59 A;  3MP1 A;  3QBY A;  1FMK A;  3GBQ A;  2RJC A;  3PMT A;  4E2F B;  1ZSZ B;  3O8V A;  4N4I A;  3CC7 A;  1CSK A;  1PKT A;  3LLR A;  4PK4 A;  2C0O A;  4Q5W A;  2V1Q A;  2LCS A;  1EFN A;  1ABQ A;  2D0Q B;  2GBQ A;  3EHR A;  1PC0 A;  3M0T A;  4IKF A;  1PRL C;  3V7S A;  5GAN 6;  1EX4 A;  3Q1J A;  2HBW A;  3MKD A;  2QQR A;  3RMS A;  2PVO B;  3REA B;  3V7R A;  3RDV A;  5CK9 A;  4BI4 A;  4C0G A;  4RTY A;  5KE2 A;  2VB6 A;  2RHY A;  1RAH B;  1VQ5 A;  3BW1 A;  1T3S A;  2O01 E;  2KRN A;  2E3I A;  4RTX A;  1YWO A;  1M3C A;  1B34 B;  2K2M A;  5CIU A;  3CCU Q;  4C8Q B;  2K3B A;  1FXX A;  4UC4 A;  4X34 A;  1QKX A;  2X4Y A;  4M75 A;  2E6N A;  5FWB A;  2H3J A;  5GAO l;  3G71 T;  2LRQ A;  1YP5 A;  1XNI A;  2G6F X;  7AT1 B;  1KJW A;  1YIT A;  1M1K R;  1PD0 A;  4OB0 B;  1CKB A;  4C5I A;  1LPL A;  1MMN A;  4F7U E;  1U1T A;  2YRV A;  4QVC A;  1WI7 A;  3FJP A;  1V76 A;  4FSS A;  2FB7 A;  1YCS B;  4BY6 C;  1YHQ Q;  1Q7Y R;  4PJO D;  1G3Y A;  4N0A A;  2AIR B;  1BIB A;  3CEY A;  2ABL A;  3LH0 A;  2Z0W A;  2LJ0 A;  1Z9Z A;  3VS3 A;  3RER A;  1AWW A;  4J6Y A;  2LDM A;  1QQJ A;  4DBH A;  5FRM A;  5LJ3 d;  2MWO A;  1K76 A;  2HDA A;  2W0Z A;  1E6G A;  4J83 A;  4PJO E;  2D8J A;  1JBM A;  2M0O A;  3X20 B;  3S3N A;  1VQ4 T;  3G1J A;  3EFS A;  4A63 B;  4VUB A;  1WHK A;  1X6G A;  5CKB A;  2D1X A;  1OPL A;  3RIR A;  2QG9 B;  1VQ9 T;  1VOM A;  2YUP A;  2AT1 B;  2GGR A;  3VS4 A;  3CCS A;  4J7I A;  4Y28 E;  1IHW A;  3C12 A;  1IRE B;  1M3B A;  1U8R A;  2DVJ A;  3H9N A;  4KBM B;  4PLL A;  5LJ3 f;  5GAM e;  2WSF E;  1NPR A;  4L59 A;  2PVD B;  1AOJ A;  4C0D B;  3TU4 K;  3CCR A;  1XJW B;  3PIP A;  2VXE A;  1K9A A;  4AFU C;  4E7S A;  3VUZ A;  2XID A;  3P8B B;  3RNJ A;  3HP9 A;  2CZ7 B;  4M75 G;  1WLP B;  1YI2 Q;  1LJO A;  4GY5 A;  3GP8 A;  5GAM f;  3CCE Q;  3VV0 A;  3LGL A;  3WVE B;  3JCM h;  4AFS C;  2ZPI B;  2VVK A;  3CME T;  2HSE B;  2E64 A;  4C92 G;  3QDR B;  4XTX A;  3CCE A;  3L2U A;  1RAB B;  2LP5 A;  1WZO A;  3RMQ A;  4GLM A;  3QXE B;  1M1K C;  2ZPH B;  3GPL A;  2M1H A;  4EMK C;  4OB2 B;  2PZ1 A;  4FYW B;  1BI1 A;  4E7J A;  2XDB A;  1YBY A;  3OS2 A;  2V8J A;  5HCK A;  1VQL T;  4PJO A;  4DOV A;  1UGP B;  1BCM A;  2YHT A;  1OYX A;  1U1S A;  2YRC A;  2EJG A;  1T3L A;  3JB9 D;  4Z89 A;  4LDY A;  4AG2 C;  5KE3 A;  3V8J A;  4Y92 A;  1YJW A;  2HEQ A;  4JJD A;  4J8O A;  2PTK A;  4C5G A;  2ECZ A;  2OTL T;  4PFP A;  5I22 A;  4BD3 A;  4OMQ A;  2HKQ B;  2CUD A;  1OU8 A;  4M78 C;  3QO3 A;  1YJ9 Q;  3MHX A;  2RK1 A;  4Z8A A;  1JU5 C;  3LWH A;  1WHM A;  2KYB A;  3OYM A;  3EGX A;  1BI3 A;  4MZP A;  1VYT A;  3CCQ A;  2KRS A;  4HCK A;  3OSS C;  5HY6 A;  1R77 A;  2DTH A;  2ATC B;  4M7A B;  4FCY A;  5FRN A;  2XK0 A;  1TH7 A;  2VKN A;  1MHN A;  2EJF A;  2XDD A;  1SHG A;  3VUB A;  3M5A A;  4OB1 B;  2JNG A;  3A98 A;  2M16 A;  2QA4 Q;  4OF1 A;  2JMA A;  1GFC A;  3VU3 C;  2MMP A;  3RR6 A;  2OAU A;  4QKU A;  1OQK A;  4BI8 B;  1MMD A;  1W1F A;  2DLP A;  3H6Z A;  1PRM C;  3OYK A;  1O75 A;  2L5Q A;  1WPY A;  4EMK A;  3QYH B;  4EMK B;  2H3E B;  3JRZ A;  2QAZ A;  3FIF A;  2V8I A;  3QPH A;  2E3H A;  4BAC A;  3CC4 Q;  2K5F A;  1WJR A;  1WGS A;  2EYQ A;  1N5Z A;  4BDY A;  2AKL A;  3MEU A;  2QQB A;  2YRD A;  3OBY A;  3S6W A;  3P8H A;  4LD9 K;  2L89 A;  3X25 B;  1K1Z A;  4A53 A;  1KQ2 A;  5CCA A;  2KRO A;  2JJ9 A;  1V1C A;  2L3Q A;  2MPX C;  2DL8 A;  1TOV A;  3E19 A;  3O5Z A;  5AYF A;  1VA7 A;  3VS5 A;  3M0P A;  4CI0 C;  4M7A E;  2F2W A;  3MJX A;  2RQU A;  2K3X A;  2E1H A;  5GAO r;  2LTO A;  2K5I A;  4FIB A;  3H0F A;  3QWX X;  4KUD K;  2KE9 A;  2PQW A;  2XG8 D;  4M7A A;  2RK2 A;  2CH4 A;  3R6O A;  1MMG A;  3SB2 A;  2DVE A;  2J6F A;  3JAM E;  1N9R A;  1QCO A;  2M02 A;  3M0U A;  1NBE B;  1Y07 A;  1JJ2 A;  3E9G A;  1MV0 B;  2OX7 A;  4JZ3 A;  5KYU A;  1KD1 R;  4JLG A;  3KXT A;  4M77 B;  1I5O B;  2QEX A;  3MEV A;  2E65 A;  2BE9 B;  1YN8 A;  3QKJ A;  2KMT A;  4XTV A;  3ZFJ A;  2O4X A;  4C92 B;  3L2R A;  1D3B A;  1OOT A;  2M9U A;  2YUQ A;  4OGE A;  1WXT A;  1AWX A;  2YUO A;  4F7U G;  1TWB A;  2CSQ A;  4J9G A;  3I56 Q;  4FYY B;  3TSW A;  5GMK i;  2LMJ A;  5GAO q;  2YXY A;  4X9D A;  1W6X A;  4X9C A;  4QW2 A;  2CT4 A;  1W4S A;  2DET A;  2QQ9 A;  3HTR A;  4J9B A;  4AG1 C;  3A8G B;  5IH2 A;  1QWE A;  3CPW A;  4PJM A;  4XU2 A;  4QQ6 A;  1ZUU A;  2P0K A;  2BTT A;  3CXC A;  1VQM T;  3F70 A;  5A0G A;  9ATC B;  4DEX A;  2RQV A;  4V2S A;  3D7S B;  1M90 U;  1JEG A;  1QVF A;  3CCU A;  2X3X D;  2OTJ Q;  3RBB B;  1UFF A;  4N4H A;  1ZUK A;  3QHS A;  2JW4 A;  1PD1 A;  4JZ4 A;  4QVZ A;  5M9O A;  1UUE A;  1M4Z A;  2GQV A;  3PGG A;  1VQ7 A;  2JVV A;  2KT8 A;  4RUG A;  4M7A F;  2LVM A;  2ZPE B;  2GF7 A;  3M4Y A;  4IIO A;  4E7I A;  3RKW A;  2KBT A;  2KGT A;  1E7O A;  2DMO A;  2Y4X A;  1KQS S;  3DKM A;  3C4S A;  1OUL A;  3FB9 A;  5KYW A;  2PUO B;  4AMC A;  3LYI A;  4O5V A;  5LJ5 j;  3CCV Q;  2RQR A;  2M51 A;  5L8R E;  2LQK A;  2DL5 A;  1KHI A;  1BI0 A;  1Q7Y U;  2G3R A;  1AHJ B;  3CD6 A;  1ZA1 B;  3HSB A;  4IUV A;  2NUZ A;  4JS4 A;  1NEG A;  4NS5 A;  4ORZ A;  1RL2 A;  2SEM A;  4N0A C;  2CDT A;  5GJW B;  2I2L A;  4FW1 A;  4CC2 A;  2CP5 A;  4HCZ A;  2QTX A;  2VGM A;  1VQK A;  2EQJ A;  1U5S A;  1NJI C;  2QA4 T;  2V26 A;  3CMA A;  2CZ1 B;  4A4G A;  1M8M A;  4IUR A;  4HVU A;  5FU7 C;  5IHN A;  3A5Z B;  6AT1 B;  2RI3 A;  1M27 C;  2MIO A;  4CC3 A;  1OPK A;  2DER A;  2EQM A;  2V1R A;  2JTF A;  1WYX A;  5GAO p;  3C0C A;  1ZUY A;  1KHC A;  2RA2 A;  2QAS A;  3E9F A;  3HPW A;  2R5A A;  4GBQ A;  1RAA B;  2CP3 A;  5IXB A;  4JJB A;  2X4X A;  3PMI A;  1M2V A;  2CZ0 B;  4LXC A;  5D6W A;  4HCB A;  4XU0 A;  1BKB A;  5KYY B;  1EIF A;  3G6E Q;  3OYN A;  3JCM c;  2EVR A;  1PNJ A;  2LQ8 A;  5EC7 A;  2EPD A;  2HCK A;  4J9F A;  1SHF A;  1M1K U;  4NL2 A;  3KFV A;  2COY A;  3OW2 S;  2EYZ A;  1NYG A;  2DJZ A;  1AD5 A;  1G3S A;  3H0I A;  2MYS A;  3INZ A;  3JB9 I;  2EBP A;  3PVQ A;  5DLQ E;  4RCB A;  4LDV A;  2KK4 A;  3NMZ C;  1RAE B;  1OX8 A;  5D6X A;  4PJO F;  4M77 A;  1YI2 T;  1SRL A;  3CC4 A;  2DD4 A;  4HXJ A;  4F16 A;  1I8F A;  2C0T A;  2DAQ A;  2ZGW A;  3MET A;  1ZX6 A;  3M0Q A;  3P8D A;  1BI2 A;  3L2W A;  4C92 A;  1D3B B;  2QA4 A;  4PJO B;  2KT1 A;  1NYF A;  1GBR A;  2RO0 A;  5EG2 A;  1SPK A;  4DEY A;  2I0N A;  4ZN3 A;  3UF4 A;  3L2Q A;  3T9N A;  3HRU A;  5CAI A;  2O9V A;  1G8X A;  2EQK A;  1Y7X A;  1FMW A;  5HK3 A;  3I56 T;  4JRK A;  1V29 B;  1SKU B;  2DEQ A;  2DZC A;  3JCM d;  5FU6 B;  4JRQ A;  4FL6 A;  5KYU B;  4JLI A;  3JCM Q;  3GOX A;  2FVU A;  1ZHI A;  4FU6 A;  3CCQ Q;  3CCU T;  1YCY A;  1R0C B;  4M7A G;  3G4S Q;  1OZ3 A;  1QWF A;  1WNL A;  5C6S A;  2JXB A;  2COZ A;  3CBO A;  3X28 B;  1G3T A;  1QP2 A;  1PM3 A;  2LJ3 A;  5GAN 3;  2K2V A;  3M4G A;  4JJC A;  3M54 A;  1PKS A;  1X69 A;  2FZG B;  2EWN A;  4Z88 A;  1NJI R;  1N9S A;  3ZBD A;  1Q7Y C;  4LD6 A;  2KEA A;  3QUI A;  4MML A;  3JB9 J;  2E41 A;  2A3L A;  2CP0 A;  4J9E A;  3CBP A;  3CCJ Q;  1AT1 B;  1D09 B;  1LVK A;  2L8D A;  1TUG B;  5GAN h;  2DIQ A;  3EFO A;  1S1N A;  2LX7 A;  1U3O A;  4FYX B;  4WTO B;  1NJI U;  3M9Q A;  3EAE A;  1FX7 A;  1OX9 A;  2HBP A;  2K3Y A;  4HA8 A;  2DRK A;  5KYX A;  1D1B A;  1WXU A;  2DK3 A;  2XD0 A;  1CKA A;  1PSE A;  1N6A A;  1IGQ A;  1B07 A;  2W10 A;  3UA7 A;  1UB4 A;  1WX6 A;  1SRM A;  4C92 E;  1K9M C;  1DJ7 B;  1VUB A;  3VS6 A;  1KSW A;  1QCN A;  3EHQ A;  2DE0 X;  2DYI A;  4M75 F;  3CCJ T;  2XIC A;  2H8H A;  4M77 G;  4PJO G;  3NTK A;  2KYM A;  3MPU B;  4KUI A;  2CRE A;  2K4Y A;  3SEM A;  3CC2 T;  1QVP A;  1PWT A;  4LN2 A;  2CP2 A;  5J39 A;  1OU9 A;  2DM1 A;  2GFU A;  5C0M A;  1AWO A;  3I35 A;  3PIO A;  3C94 A;  2BUD A;  5KYW B;  4CC4 B;  4RMO A;  1X01 A;  3PE0 A;  5FU6 C;  3VS0 A;  2FPD A;  2LQN A;  5GMK h;  4O6J A;  2CKK A;  3REB B;  2FRW A;  3L2Z A;  2EGC A;  3G71 A;  2VV5 A;  2QDY B;  1WHH A;  3N5B B;  3QZ9 B;  5DM7 R;  1M2O A;  1N27 A;  3OMC A;  1VQ7 Q;  2RN8 A;  4N4G A;  1GCP A;  4KGZ B;  3UAT A;  1PSF A;  5CQY A;  3EH1 A;  4NOY A;  4BE0 A;  2DXC A;  3QYG B;  1JB0 E;  1JQQ A;  1JO8 A;  4BE2 A;  1KQ1 A;  1UG1 A;  2GTO A;  1GBQ A;  2RJF A;  4EPC A;  1BYM A;  2OTL A;  2R58 A;  1YJW Q;  1OI1 A;  2OTJ A;  1X6O A;  4M75 B;  1UEC A;  2CSI A;  3OBW A;  3ULR B;  3JB9 H;  2BIV A;  4E7K A;  3I5R A;  2C06 A;  2HQH A;  4FT4 A;  3SWN B;  1VIE A;  1UJY A;  1RLQ C;  2QTV A;  3M56 A;  2HSP A;  2AZS A;  3BFM A;  5GAN 5;  4M7D B;  2WSC E;  1KD1 C;  1BIA A;  1PCX A;  1RAD B;  1G3W A;  2A28 A;  1JJ2 P;  3M55 A;  1X43 A;  3EGU A;  4RTV A;  2BZX A;  1W70 A;  2QEX Q;  2JMC A;  1LNX A;  4E47 A;  5ECA A;  3HL8 A;  4LUE A;  2HQE A;  2ZPF B;  1VQO A;  2RI2 A;  4AT1 B;  3G6E A;  2F2X A;  4QQG A;  4J9I A;  4XTW A;  3VRY A;  1UEB A;  3RKX A;  2J6O A;  3OYE A;  1K4U S;  4P5N A;  2L0A A;  2X4W A;  3JV3 A;  2IVW A;  3JCM P;  4XK8 E;  1ZQ1 A;  1NPP A;  3CCR T;  5GMK l;  4XTY A;  1S72 A;  1SF9 A;  1MND A;  1IZ6 A;  3LX7 A;  2M0Y A;  3L2V A;  2RHZ A;  4B9X A;  1UHC A;  5A0D A;  4C92 F;  2QEX T;  2CH4 W;  2EYX A;  1T0H A;  2KXD A;  3PFS A;  1WXB A;  1X2K A;  2E70 A;  1YIT T;  2RPN A;  2QQA A;  1H92 A;  1X27 A;  4F7U A;  1ABO A;  2CT3 A;  2DD5 A;  2EGE A;  4M4Z A;  2X35 A;  3S3O A;  2HQX A;  2JTM A;  4C0F A;  2E4H A;  4M77 F;  2O2O A;  1X2Q A;  1K8A R;  2RHX A;  2EQU A;  1YI2 A;  1G2B A;  4K11 A;  3M0S A;  4BY6 B;  5LJ5 g;  3V8K A;  3A1P A;  2FHD A;  1VQL Q;  1AVZ C;  1K0S A;  2QQS A;  4BI3 A;  1VQ5 T;  1K9M U;  4DBF A;  1KD1 U;  4M78 E;  3CBM A;  3VS2 A;  4M7D E;  1BK2 A;  4BUG A;  1YIJ A;  4FW2 A;  3BE3 A;  2DTO A;  4M75 C;  1TUD A;  3ER0 A;  4OB3 B;  3V7C A;  1O9S A;  4CRI A;  1YJW T;  2DIL A;  2LC4 A;  2FZC B;  4M7D C;  2ZPG B;  5GMK m;  2HL5 C;  5FWC A;  5LJ3 e;  4QQD A;  3FEO A;  4E6R A;  4WCI A;  5GJV B;  2WAC A;  3EG1 A;  2JTE A;  5CKE A;  1SG5 A;  4XAX B;  5GAN 8;  1G5V A;  4AFQ C;  4A4F A;  1Q82 C;  3NPF A;  4AFZ C;  1D1A A;  4ZGE B;  1PG5 B;  2EYW A;  3CCJ A;  2XDP A;  1K8A C;  2COW A;  1UGS B;  3C95 A;  5I21 A;  1QMC A;  2CGH A;  5GMK e;  1S72 Q;  3VRZ A;  5LJ3 h;  3CCR Q;  1YNZ A;  2DL7 A;  2WSE E;  1NLO C;  1MGQ A;  4Z02 A;  4M7A C;  4BB7 A;  2RJE A;  2HD0 A;  4EIK A;  3WXM B;  1M2V B;  2RJD A;  2XI9 A;  1VYU A;  1HD3 A;  3QII A;  2LZ6 B;  1QKW A;  1AZE A;  2Y90 A;  3LWI A;  1VQM Q;  4LDU A;  4M78 B;  3J81 E;  1QVG A;  3CCV A;  1M9S A;  3THK A;  1NM7 A;  2BE7 D;  3OYF A;  1BCO A;  2CZ6 B;  5L23 A;  3CME A;  2OTJ T;  1HJD A;  4RCC A;  2RHI A;  1S72 T;  2ROL A;  4MZM A;  5LL6 S;  1GXI E;  2KRM A;  2PUK B;  1WDX A;  5GAN 7;  2JT4 A;  3A8L B;  4DA4 A;  3QZ5 B;  2KSS A;  1G83 A;  2FO0 A;  3CCL Q;  3CD6 T;  2JS2 A;  4EMH A;  3FRN A;  1MV3 A;  2DIG A;  3GIB A;  1RAG B;  4PJN A;  3GNG A;  2DF6 A;  3OYJ A;  2GQI A;  4XTU A;  4HKE A;  3JCM e;  4J7F A;  4F7U F;  4E7L A;  1QP3 A;  1VQ8 Q;  2KQW A;  2DL3 A;  4D8D A;  3OS1 A;  1WQW A;  4YTL A;  3MCA B;  2DXU A;  5CKH A;  3BDU A;  2LJ1 A;  2YWW A;  1UHF A;  4M78 D;  3SHW A;  3G4S T;  5GAN 2;  1RI9 A;  2NWM A;  4KH0 B;  3CCL T;  3CD6 Q;  1H3H A;  2K79 A;  1M90 C;  1VQ4 Q;  4HT9 A;  3R6N A;  1VQ6 T;  3BDL A;  2QGG A;  4LE9 A;  1XQH A;  1E6H A;  2YSQ A;  4JRI A;  2OTL Q;  3OY9 A;  1KK7 A;  1GCQ C;  1IXD A;  2NUP B;  2YDL A;  3VJP A;  4NL3 A;  3EG9 A;  1VQ9 Q;  1I0C A;  1WA7 A;  1RLP C;  1IHV A;  2A08 A;  1OZ2 A;  5IT9 E;  1JRI A;  3OYB A;  4JDS A;  2QYZ A;  1B3Q A;  1XTD A;  2E10 A;  2FYK A;  4A4E A;  2J05 A;  1YIT Q;  3GLX A;  8AT1 B;  4EDU A;  2RB6 A;  2KVQ G;  4PJL A;  1TUC A;  2FL7 A;  3CCM Q;  1LCK A;  1M3A A;  2K57 A;  1W2B P;  2KDS A;  3V8L A;  4GLK A;  3UWN A;  1YJN Q;  2QDL A;  2XMF A;  4C8Q F;  2K9G A;  3A8M B;  1BBZ A;  4M7D A;  3UT1 A;  3I56 A;  3CME Q;  4KGV B;  1GRI A;  5IAY A;  1HXD A;  2D0N A;  1VQ5 Q;  4C0Z A;  2EYY A;  1K73 U;  2C0I A;  2FRY A;  4IIM A;  1QVG S;  4KUL A;  1FWZ A;  4ME7 A;  1TXQ A;  1VQL A;  3AT1 B;  2SRC A;  2RNA A;  4XTZ A;  3CC4 T;  2DO3 A;  2JS0 A;  3L1A A;  3HRS A;  1X6B A;  2AZV A;  2JUF A;  1I5L A;  4MZT A;  2J6K A;  3CCS Q;  2A7Y A;  2PNI A;  3URG A;  5HKC A;  4ZNX A;  2KY9 A;  1C6V X;  3OW2 P;  3FJ5 A;  2NUP A;  4IUQ A;  3CCL A;  3SDZ A;  4RTT A;  2KI7 A;  1YJ9 T;  2XKO C;  1OEB A;  2VAS A;  2RQT A;  2VXF A;  4TVR A;  3HFN A;  1Q86 R;  3A8O B;  1PHT A;  4WF2 A;  3SD4 A;  4PNO A;  1WFW A;  4M75 D;  4II1 A;  3FLG A;  3GNF B;  1VQO T;  4HCC A;  1MNE A;  2EFI A;  3KBG A;  1Y96 A;  4ANJ A;  1P92 A;  2FZK B;  3CCS T;  4JS5 A;  4J9H A;  4M7D D;  1R0B G;  1YHQ T;  4M7A D;  1GCQ A;  1YIJ Q;  1SSH A;  2DTI A;  4OGC A;  3QWY A;  2L3R A;  5CKD A;  1AEY A;  5IXF A;  1W2B A;  2DL4 A;  3EG2 A;  1NG2 A;  3CCQ T;  5GAN 4;  1VQ4 A;  2LCL A;  1I07 A;  3ME9 A;  1D1C A;  4ELZ C;  1KC8 U;  3H8Z A;  4RKU E;  3M0R A;  3E2U A;  5I2M A;  4F7U B;  1AWJ A;  2DRM A;  2IIM A;  2L3S A;  2BKD N;  4EMG A;  5KYX B;  2RH2 A;  4OMP A;  1Q86 C;  2QI2 A;  1ZSG A;  3CCM T;  2F1L A;  5KH6 A;  5IHI A;  1IRX A;  2ROT A;  3VYH B;  1Y96 B;  2OJ2 A;  2ED1 A;  2ENM A;  4M77 E;  3JB9 F;  1BU1 A;  3OYH A;  3VKI A;  2X4J A;  2EKH A;  1KC8 R;  2CS7 A;  5A2Q E;  3UDC A;  3RES A;  1JXO A;  2RF0 A;  4C8Q G;  3X24 B;  1NZ9 A;  2DFU A;  2B86 A;  4F17 A;  2IPO B;  2HMA A;  4XU1 A;  1IB8 A;  2DKG A;  3BY7 A;  1VIF A;  3EFR A;  4JJN K;  1QVG P;  1VQN Q;  5IHK A;  2QXF A;  3DLM A;  2DEU A;  4E7Z A;  1J3T A;  4F14 A;  3OA6 A;  4OMF B;  2FPE A;  2P4T A;  5CVI A;  4ATO A;  2XU8 A;  2DXB A;  1HK9 A;  2ED0 A;  2O9S A;  1MMA A;  5GAM d;  2O31 A;  2X3W D;  4JUV A;  2DNU A;  2BZY A;  3EG0 A;  1ZBX A;  1GFD A;  2KNB B;  3NGP A;  4DBQ A;  4ESR A;  3FDR A;  1X75 C;  3WVD B;  1N8R C;  2F69 A;  2IG0 A;  4RTU A;  1VQN T;  1KC8 C;  3QJ6 A;  1C1A A;  2YLC A;  1D0Z A;  1QCF A;  4C8Q C;  1B34 A;  1H3Z A;  2YLB A;  1A0N B;  4J6X A;  1I1J A;  1Q82 U;  3VS1 A;  1NEB A;  2FPF A;  3J80 E;  5KCO A;  2X51 A;  1NLP C;  1Q86 U;  2E5K A;  4ZTJ A;  2PU9 B;  4PJO C;  4A4H A;  2DPP B;  2GCX A;  3PT9 A;  3JCM g;  3I55 Q;  4JPB W;  4IUP A;  4KRT A;  2B8A A;  2HL3 A;  1TU0 B;  3OYC A;  4F04 B;  3OYL A;  2EAY A;  2JN0 A;  1Y0M A;  1UE9 A;  4C5H A;  4ZGJ B;  2RM4 A;  2F5K A;  1C0M A;  4C8Q D;  2HKN A;  4XU3 A;  1Y71 A;  1I81 A;  2A37 A;  4L6V 5;  4OMM A;  3I5S A;  5LJ5 d;  2OAW A;  3M53 A;  1RAI B;  4KT0 E;  2VUB A;  5GAN d;  1TG0 A;  2LNV A;  3CPW S;  1D0X A;  2LQW A;  4OVA A;  2HAX A;  2JM8 A;  4J9C A;  1QLY A;  1ACM B;  4DBR A;  3JCM X;  4R55 A;  1VYV A;  1QW1 A;  2J06 A;  3QG1 A;  2NYS A;  2F5T X;  2LX9 A;  4RTZ A;  1HYO A;  2JOY A;  5FRO A;  1RUW A;  4E7H A;  1VQP Q;  2D9T A;  1VQK T;  3JCM f;  2NLU A;  1N8R U;  5GAN g;  1M30 A;  3G6E T;  5LJ5 f;  4BDZ A;  5CKF A;  3SFM A;  3HKS A;  3OW2 A;  2L2P A;  1Y57 A;  1GL5 A;  1UGR B;  2LT1 A;  4OML A;  4C5E A;  4RTW A;  3CC2 Q;  3EFO B;  1R8O B;  4IUT A;  3G4S A;  3GF5 A;  5J26 A; 
#chains in the Genus database with same CATH homology
 2LRQ A;  2JTF A;  5LJ3 h;  1XNI A;  3UPU A;  3NTH A;  2WSE E;  1YIT A;  1MGQ A;  4OB0 B;  4Z02 A;  5GAO p;  4M7A C;  1KHC A;  2RA2 A;  4C5I A;  3E9F A;  1JJ2 S;  4BB7 A;  3HPW A;  4F7U E;  1U1T A;  2R5A A;  2HD0 A;  2RJE A;  2EIF A;  2YRV A;  4QVC A;  4M7D G;  2X4X A;  3PMI A;  3FJP A;  5LJ3 g;  5GAO n;  3WXM B;  2CZ0 B;  4DOW A;  5D6W A;  4HCB A;  4XU0 A;  2RJD A;  2XI9 A;  1BKB A;  2FB7 A;  1EIF A;  3QII A;  4LDW A;  3MP6 A;  4BY6 C;  3S3M A;  4M75 E;  4PJO D;  1G3Y A;  4N0A A;  3OYN A;  2R57 A;  1YIJ T;  3JCM c;  2DZ9 A;  2Y90 A;  1VQP A;  1BIB A;  3LWI A;  4LDU A;  3CEY A;  2LQ8 A;  4M78 B;  3J81 E;  1QVG A;  3LH0 A;  1VQ7 T;  3CCV A;  1VQ8 T;  1M9S A;  2E5Q A;  3OYF A;  1YJ9 A;  3NTI A;  3CME A;  2CZ6 B;  5GMK e;  1M1K U;  2OTJ T;  3RER A;  4NL2 A;  4J6Y A;  4FSX A;  2LDM A;  4RCC A;  3I55 A;  2RHI A;  1S72 T;  4LDX A;  4MZM A;  5LL6 S;  3OW2 S;  4M7D F;  3MEW A;  1GXI E;  2PUK B;  4C8Q A;  5FRM A;  3QJY A;  5LJ3 d;  2MWO A;  2DJZ A;  5GAN 7;  3A8L B;  4DA4 A;  3QZ5 B;  1G3S A;  3M58 A;  2KSS A;  3INZ A;  4J83 A;  4PJO E;  3JB9 I;  5CO7 A;  3CD6 T;  1N8R C;  1JBM A;  5DLQ E;  2M0O A;  3TEE A;  2LT4 A;  2MWP A;  4RCB A;  3X20 B;  3FRN A;  4EMH A;  3EFS A;  3S3N A;  4LDV A;  4VUB A;  1VQ4 T;  2KK4 A;  4B9W A;  2DIG A;  5CKB A;  5D6X A;  4MMK A;  4PJO F;  4M77 A;  1M5Q 1;  4D6W A;  1YI2 T;  3RIR A;  3GIB A;  5LJ5 e;  3CC4 A;  3HFO A;  3GNG A;  3OYJ A;  1VQ9 T;  2DD4 A;  4XTU A;  4HKE A;  1I8F A;  3JCM e;  3OYI A;  4J7F A;  4F7U F;  4E7L A;  4JRP A;  3CCS A;  2DAQ A;  4J7I A;  1QP3 A;  2ZGW A;  2KQW A;  3MET A;  4Y28 E;  2P0Q A;  3C12 A;  4M78 F;  3P8D A;  1BI2 A;  3L2W A;  3OS1 A;  1IRE B;  1WQW A;  4YTL A;  4C92 A;  1U8R A;  1D3B B;  4RG2 A;  2QA4 A;  4PJO B;  3MCA B;  2RO0 A;  2DXU A;  4KBM B;  4PLL A;  5EG2 A;  2WSF E;  3BDU A;  5CKH A;  5LJ3 f;  5GAM e;  1NPR A;  1NE8 A;  1Q81 U;  4L59 A;  4M78 D;  3G4S T;  2PVD B;  5GAN 2;  4C0D B;  4ZN3 A;  3TU4 K;  3CCR A;  3PIP A;  3MO8 A;  4XQ3 A;  4ZGD B;  3CCL T;  2VXE A;  5GAN e;  3L2Q A;  3T9N A;  3HRU A;  3OYG A;  4DQ2 A;  1M90 C;  1H64 1;  3VUZ A;  5CAI A;  2XID A;  3P8B B;  2GFA A;  3HP9 A;  2EQK A;  2CZ7 B;  4HT9 A;  1Y7X A;  4M75 G;  1VQ6 T;  5HK3 A;  1VQP T;  1LJO A;  3BDL A;  2MAM A;  4GY5 A;  3GP8 A;  5GAM f;  3I56 T;  4JRK A;  5LJ5 h;  3VV0 A;  1XQH A;  3LGL A;  1V29 B;  4JRI A;  3OY9 A;  2DEQ A;  2DZC A;  3JCM h;  3WVE B;  3JCM d;  5FU6 B;  2ZPI B;  4FM4 B;  3VJP A;  4NL3 A;  3CME T;  4JRQ A;  4FL6 A;  2E64 A;  4JLI A;  3CC2 A;  4C92 G;  3QDR B;  2VGN A;  2VC8 A;  3JCM Q;  3GOX A;  4XTX A;  3CCE A;  3L2U A;  1LOJ A;  2FVU A;  1WJQ A;  3RMQ A;  1OZ2 A;  1ZHI A;  4FU6 A;  3CCU T;  1JRI A;  3OYB A;  1YCY A;  5IT9 E;  4JDS A;  3QXE B;  1M1K C;  2ZPH B;  3HHT B;  3GPL A;  4M7A G;  1OZ3 A;  1XTD A;  2M1H A;  4EMK C;  2E10 A;  1WNL A;  3VYG A;  3PNW C;  4OB2 B;  5FLX E;  5C6S A;  2FYK A;  1BI1 A;  4A4E A;  4E7J A;  2XDB A;  3QSU A;  1YBY A;  3OS2 A;  3CBO A;  2V8J A;  1VQL T;  4PJO A;  3GLX A;  4DOV A;  1UGP B;  3X28 B;  1VQ6 A;  2YHT A;  2VYT A;  1G3T A;  1OYX A;  1U1S A;  1QP2 A;  4EDU A;  1QVF S;  2RB6 A;  2EJG A;  5GAN 3;  2KVQ G;  2K2V A;  3M4G A;  3JB9 D;  4LDY A;  4R56 A;  2FL7 A;  3JCM J;  3M54 A;  5KE3 A;  2K57 A;  3V8J A;  4A54 A;  3KUF A;  5FU7 B;  2EWN A;  2KDS A;  3V8L A;  4A4K A;  1YJW A;  4J8O A;  4GLK A;  3CMA T;  1N9S A;  3UWN A;  3ZBD A;  1Q7Y C;  4C5G A;  4LD6 A;  3I55 T;  3OMG A;  4C8Q F;  3QUI A;  3A8M B;  4MML A;  2E41 A;  3CCM A;  3JB9 J;  2A3L A;  3UT1 A;  2OTL T;  4QVD A;  4M7D A;  3CBP A;  3I56 A;  4BD3 A;  2R5M A;  4M78 C;  3QO3 A;  5GMK j;  2D6F A;  3L42 A;  5J26 A;  2L8D A;  5IAY A;  1KQS A;  1HXD A;  3MHX A;  2RK1 A;  5GAN h;  1M1G A;  3LWH A;  4C0Z A;  2DXT A;  2DIQ A;  5IN1 A;  5GAO m;  1K73 U;  3OYM A;  1M8V A;  1BI3 A;  3OS5 A;  4M77 C;  2JZ2 A;  4MZP A;  5GAM h;  3M9Q A;  3CCQ A;  3EAE A;  1NJI U;  2HNI A;  1QVG S;  1FX7 A;  4KUL A;  1FWZ A;  2HBP A;  3OSS C;  2E6Z A;  2K3Y A;  2MF2 A;  4HA8 A;  4ME7 A;  5HY6 A;  1VQL A;  1VQM A;  2DK3 A;  2DTH A;  2XD0 A;  4M7A B;  4XTZ A;  3OQ5 A;  1PSE A;  3CC4 T;  2DO3 A;  1WJS A;  1N6A A;  3OYD A;  3L1A A;  2EJ9 A;  3HRS A;  2PVG B;  1YHQ A;  2XK0 A;  1WQ7 A;  1K8A U;  1TH7 A;  2JUF A;  1MHN A;  3NFC A;  2P0P A;  1UGQ B;  4C92 C;  1UB4 A;  2EJF A;  2XDD A;  1I5L A;  4MZT A;  3SWN C;  4C92 E;  3VUB A;  5CR2 A;  1K9M C;  1DJ7 B;  1VUB A;  2A7Y A;  3URG A;  3M5A A;  5HKC A;  1M1F A;  4BE1 A;  4OB1 B;  3AHU A;  2KY9 A;  3CPF A;  4M75 F;  3CCJ T;  2XIC A;  2JNG A;  4M77 G;  2M16 A;  4PJO G;  3NTK A;  4IUQ A;  3SWN A;  4OF1 A;  3CCL A;  2V8K A;  3SDZ A;  4KUI A;  4OP0 A;  4C0D C;  3VU3 C;  2MMP A;  2K4Y A;  3OB9 A;  5KCH A;  1YJ9 T;  3G7Z A;  2XKO C;  2OAU A;  3CC2 T;  1QVP A;  2XHC A;  4BI8 B;  3ZEH A;  2VXF A;  4TVR A;  4ELY C;  3HFN A;  5GAM g;  5J39 A;  3H6Z A;  2O4X B;  2GFU A;  3A8O B;  4WF2 A;  5C0M A;  3SD4 A;  3OYK A;  3JCM W;  2E12 A;  1O75 A;  2L5Q A;  4PNO A;  1I4K 1;  3X26 B;  3C94 A;  3PIO A;  4M75 D;  1WPY A;  2BUD A;  4II1 A;  3FLG A;  3GNF B;  3QYH B;  4EMK A;  1VQO T;  4EMK B;  3JRZ A;  4HCC A;  4RMO A;  3HRT A;  3JB9 G;  2EFI A;  3FIF A;  3KBG A;  2V8I A;  1X01 A;  3QPH A;  5FU6 C;  1SSF A;  1Y96 A;  4BAC A;  2LCC A;  2K5F A;  3M57 A;  1P92 A;  1WJR A;  1W2B S;  1WGS A;  5GMK h;  2EYQ A;  3OYA A;  2KAF A;  3CCS T;  4O6J A;  4M77 D;  4BDY A;  3MEU A;  2QQB A;  3OBY A;  4L5G A;  3S6W A;  4JS5 A;  3P8H A;  2CKK A;  4PL6 A;  4LD9 K;  2L89 A;  4M7D D;  2AHJ B;  3X25 B;  4A53 A;  4M7A D;  1YHQ T;  3L2Z A;  1KQ2 A;  3G71 A;  2VV5 A;  2QDY B;  5CCA A;  2DTI A;  4J6W A;  4OGC A;  3N5B B;  5GAM j;  3QZ9 B;  2L3R A;  5DM7 R;  5CKD A;  1N27 A;  3OMC A;  4MDW A;  1W2B A;  3CXC S;  4N4G A;  3E19 A;  4C92 D;  1VQ4 A;  3CCQ T;  5GAN 4;  5AYF A;  3LGF A;  5GAN j;  5GAN f;  2RHU A;  2LCL A;  4CI0 C;  4M7A E;  3ME9 A;  4ELZ C;  1KC8 U;  1PSF A;  1RI0 A;  5CQY A;  2K3X A;  3JCM b;  2E1H A;  3H8Z A;  2RD1 A;  4NOY A;  4BE0 A;  2DXC A;  3QYG B;  4RKU E;  5GAO r;  1JB0 E;  3ASK A;  5I2M A;  4F7U B;  1KQ1 A;  2LTO A;  4BE2 A;  2K5I A;  4HT8 A;  4FIB A;  2BKD N;  4EMG A;  4KUD K;  2PQW A;  2RH2 A;  2RJF A;  4EPC A;  1YJN A;  2XG8 D;  2QI2 A;  2RK2 A;  5DLO A;  3FC3 A;  3E1S A;  3CCM T;  2R58 A;  3R6O A;  5KH6 A;  3CCV T;  2OTL A;  1BYM A;  3SB2 A;  2RI5 A;  2DVE A;  1OI1 A;  3LW5 E;  1N9R A;  1X6O A;  3VYH B;  4ZN1 A;  3JAM E;  1Q81 C;  2OTJ A;  4M75 B;  4M77 E;  4PLI A;  4M78 G;  3JB9 F;  3OYH A;  3VKI A;  3OBW A;  1YJN T;  2X4J A;  4ZTF A;  4RG8 A;  3JB9 H;  2BIV A;  1Y07 A;  3PTA A;  4E7K A;  3JSC A;  3E9G A;  2CS7 A;  1JJ2 A;  2C06 A;  4FT4 A;  5A2Q E;  4J5Y A;  3SWN B;  3UDC A;  1VIE A;  4JLG A;  3RES A;  3KXT A;  3M56 A;  4M77 B;  2K5L A;  4C8Q G;  3X24 B;  2QEX A;  1VQN A;  1NZ9 A;  3MEV A;  3BFM A;  5GAN 5;  4M7D B;  2WSC E;  2E65 A;  1KD1 C;  1BIA A;  1G3W A;  5LJ3 j;  1XOV A;  3M55 A;  3DLL A;  4XU1 A;  3A8H B;  3QKJ A;  2KMT A;  2DKG A;  3BY7 A;  3EFR A;  1VIF A;  4XTV A;  4JJN K;  1LNX A;  3ZFJ A;  4E47 A;  2O4X A;  2ZPB B;  1VQ9 A;  4C92 B;  3HL8 A;  3L2R A;  1D3B A;  3DB3 A;  2HQE A;  5J3B A;  2QXF A;  2ZPF B;  3DLM A;  1VQO A;  2M9U A;  2RI2 A;  4OGE A;  3OA6 A;  4OMF B;  2Y4Y A;  2CYZ B;  3G6E A;  2ZZD A;  4F7U G;  4FT2 A;  4QQG A;  1Q86 C;  4XTW A;  2P4T A;  1UEB A;  3RKX A;  3OYE A;  4MDX A;  4IUU A;  4P5N A;  5CVI A;  2XU8 A;  5D6Y A;  3RUX A;  3CCE T;  2DXB A;  4ATO A;  1HK9 A;  2X4W A;  3OS0 A;  5GAM d;  2IVW A;  3JCM P;  5CQX A;  4XK8 E;  5GMK i;  4JUV A;  1ZQ1 A;  1NPP A;  3CCR T;  3DB4 A;  5HK0 A;  5GAO q;  3CC7 T;  5GMK l;  4XTY A;  5DY9 A;  4PKC C;  1ZBX A;  1VQ8 A;  2MI6 A;  3MP8 A;  4X9D A;  1S72 A;  4X9C A;  2EKO A;  4QW2 A;  1IZ6 A;  3LX7 A;  3L2V A;  1W4S A;  2QQ9 A;  3OYY A;  3FDR A;  1X75 C;  2ZCF B;  4Y91 A;  3RKY A;  5A0L A;  3A8G B;  2RHZ A;  5I2S A;  3TCJ A;  3WVD B;  2IG0 A;  2F69 A;  4B9X A;  4C92 F;  5A0D A;  3MEA A;  2QEX T;  1KC8 C;  1VQN T;  3QJ6 A;  4M78 A;  3CPW A;  3TRE A;  2YLC A;  4XU2 A;  4C8Q E;  4QQ6 A;  1KG1 A;  3PFS A;  3JCM V;  2E70 A;  4C8Q C;  1YIT T;  1B34 A;  2P0K A;  2QQA A;  1H3Z A;  2YLB A;  3OSV A;  4F7U A;  3CXC A;  4J6X A;  1VQM T;  3F70 A;  2DD5 A;  5A0G A;  3G71 T;  1Q82 U;  2X35 A;  3S3O A;  2HQX A;  3J80 E;  5KCO A;  4V2S A;  2JTM A;  1Q86 U;  4C0F A;  1M90 U;  1QVF A;  3CCU A;  4M77 F;  4ZTJ A;  1K73 C;  2PU9 B;  4N4H A;  3J7A F;  4A4H A;  2RHX A;  4PJO C;  2DPP B;  2EQU A;  2GCX A;  1YI2 A;  3QHS A;  3PT9 A;  3JCM g;  3M59 A;  3MP1 A;  4QVZ A;  3QBY A;  5M9O A;  4BY6 B;  5LJ5 g;  3V8K A;  4IUP A;  2B8A A;  2RJC A;  3PMT A;  1M4Z A;  2FHD A;  3OYC A;  2GQV A;  3PGG A;  3OYL A;  2EAY A;  2JN0 A;  3O8V A;  4N4I A;  2JVV A;  3CC7 A;  1VQ7 A;  3LLR A;  4M7A F;  4C5H A;  2LVM A;  2ZPE B;  2QQS A;  4ZGJ B;  2GF7 A;  4BI3 A;  4Q5W A;  2RM4 A;  3M4Y A;  1VQ5 T;  1K9M U;  4E7I A;  3RKW A;  1KD1 U;  4M78 E;  2Y4X A;  2F5K A;  1KQS S;  3DKM A;  3CBM A;  3C4S A;  4C8Q D;  2D0Q B;  4XU3 A;  4M7D E;  4BUG A;  1Y71 A;  1YIJ A;  1I81 A;  2DTO A;  4M75 C;  4L6V 5;  3FB9 A;  4IKF A;  2PUO B;  5LJ5 d;  3V7S A;  3ER0 A;  4OB3 B;  5GAN 6;  3LYI A;  3V7C A;  3M53 A;  3Q1J A;  4KT0 E;  4O5V A;  5LJ5 j;  2VUB A;  1O9S A;  5GAN d;  4M7A A;  4CRI A;  1YJW T;  2LNV A;  3CPW S;  2HAX A;  4OVA A;  5L8R E;  2QQR A;  3RMS A;  2LC4 A;  2LQK A;  2PVO B;  1KHI A;  3V7R A;  4M7D C;  1BI0 A;  2ZPG B;  1Q7Y U;  5GMK m;  2G3R A;  3JCM X;  4R55 A;  1AHJ B;  5LJ3 e;  1QW1 A;  4QQD A;  3CD6 A;  3FEO A;  3QG1 A;  5CK9 A;  4BI4 A;  3HSB A;  2F5T X;  4IUV A;  2LX9 A;  2JOY A;  5FRO A;  4C0G A;  4JS4 A;  4NS5 A;  5KE2 A;  1RL2 A;  4E7H A;  2RHY A;  1VQK T;  2D9T A;  4N0A C;  2WAC A;  1VQ5 A;  3BW1 A;  5CKE A;  2I2L A;  3JCM f;  2NLU A;  1N8R U;  4HCZ A;  2O01 E;  5GAN g;  3G6E T;  5LJ5 f;  4BDZ A;  2QTX A;  5CKF A;  3SFM A;  2VGM A;  5FRN A;  3HKS A;  4XAX B;  3OW2 A;  1VQK A;  2EQJ A;  5GAN 8;  1G5V A;  1NJI C;  1B34 B;  2QA4 T;  1UGR B;  2LT1 A;  3CMA A;  4A4F A;  1Q82 C;  2CZ1 B;  4A4G A;  5CIU A;  4IUR A;  4C5E A;  4C8Q B;  1FXX A;  5FU7 C;  4ZGE B;  4UC4 A;  3CCJ A;  1R8O B;  3A5Z B;  2RI3 A;  2XDP A;  1K8A C;  4X34 A;  2X4Y A;  1UGS B;  3C95 A;  4M75 A;  2E6N A;  4IUT A;  5I21 A;  3G4S A;  2CGH A;  3GF5 A;  1Y96 B;  2H3J A;  2EQM A;  5GAO l; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...