4CRIA

Crystal structure of 53bp1 tandem tudor domains in complex with methylated k810 rb peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine Methylation-Dependent Binding of 53BP1 to the Prb Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
total genus 28
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA01
3S3NA 3CMAA 2BKDN 5D6XA 1Q86U 1Q82C 3L2VA 3I56T 2MWPA 2R58A 3G71A 2QEXA 4X34A 2DAQA 3LYIA 5LL6S 2K3XA 3CC2A 2EQMA 3CMAT 4A4HA 2JVVA 1VQPT 5DLQE 3FLGA 3MEVA 4C5GA 2EQUA 4UC4A 1NZ9A 1S72T 3S3OA 3OYCA 2OTLT 3CPWA 3UWNA 3P8DA 1VQKT 3OQ5A 4L59A 4B9WA 3OYIA 3CCVT 3H6ZA 1M1GA 4ZN3A 1KC8C 3NTIA 3OA6A 1QVFS 3M9QA 2EFIA 1WJRA 3S6WA 1Q7YC 2PQWA 1K8AU 2K3YA 3HKSA 3CD6T 1W2BS 5KCOA 4EDUA 1M90U 3LGLA 5KCHA 3OYAA 4IUQA 1YITA 2LVMA 4QQDA 5C0MA 1JJ2A 3H8ZA 2RJEA 1OZ2A 4Z02A 2OTJA 1YBYA 1S72A 3OYEA 1YJNA 1VQ7A 3UT1A 3OMGA 4IUUA 2P0KA 2L8DA 1W2BA 1M1KC 3G6ET 1VQOA 1KD1U 4PL6A 1VQMA 5M9OA 3FC3A 1Q81U 3MP6A 5D6YA 5KE2A 2B8AA 3MEAA 3OW2A 1KQSS 5FROA 4OVAA 1Q81C 3I55A 4QVZA 2RI3A 4FL6A 3OYKA 3OYFA 3E9FA 1KHIA 3CCET 3CMEA 2E70A 3OW2S 3EAEA 3FDRA 1N27A 3CCST 3OYHA 2JTFA 2VYTA 5J39A 2QQSA 3ASKA 3OYMA 2HQEA 1WJQA 3F70A 1N8RU 2QA4A 2FHDA 1KQSA 2D9TA 1JJ2S 3MEWA 4QW2A 4E7IA 3CCRT 3CC7T 3TREA 3ER0A 3J7AF 3OYBA 1VQMT 1QVGS 3G4SA 4YTLA 2XDPA 3PIPA 1IZ6A 4BDYA 2KVQG 2GFUA 2DO3A 4RG2A 2IG0A 1EIFA 2GF7A 3PMIA 2R57A 2JZ2A 3KUFA 4Q5WA 3LH0A 2EQJA 3META 1K73U 1VQ9T 1VQPA 3CCSA 1VQ8T 3MO8A 1YI2A 3C4SA 2JUFA 5FLXE 2R5MA 4IUVA 3GOXA 2E5QA 3CXCA 3CCQA 2F5KA 4E7JA 1YJWT 3E9GA 2CKKA 3L2RA 2XK0A 4IURA 1VQ6A 3OS0A 1SSFA 3J81E 1RI0A 3CC4T 4A4EA 3CCLT 1VQ5T 1Q86C 1XNIA 3CCJT 3QBYA 2OTLA 1YHQT 2JNGA 2EQKA 2E6ZA 3G71T 4ZN1A 2GFAA 3A5ZB 1N8RC 4BACA 3CMET 1KHCA 2KDSA 3CCUT 2WACA 4C5HA 3J80E 3CCMA 3OYYA 2O4XA 1NPPA 1K73C 4N4HA 3SD4A 1YJNT 1VQ7T 1VQ4A 3P8BB 2M0OA 2RI2A 1VQNA 3Q1JA 3CEYA 3CCUA 3NTHA 3CC4A 4HCZA 3OYJA 2L3RA 3L42A 3OYDA 1VQ5A 4FU6A 1QVGA 1NJIU 3CCEA 5CIUA 3I56A 3CCJA 4B9XA 4LD6A 5C6SA 2M1HA 1KD1C 1Q7YU 4QQGA 1XTDA 2RHXA 3KBGA 2LDMA 3QKJA 5IT9E 4BE2A 3QIIA 4GY5A 4E7HA 4QQ6A 1H3ZA 2E6NA 2LCLA 1YIJA 4E7KA 1UEBA 3O8VA 5KE3A 2JOYA 1WGSA 5D6WA 4C5IA 3OYLA 1VQLA 3MP8A 2LTOA 4E7LA 2R5AA 1VQKA 2QQRA 3JAME 2X35A 2LCCA 1YI2T 2RI5A 5IAYA 1YIJT 2HQXA 3CCLA 4PLLA 4A4FA 2BIVA 2LRQA 1Q82U 1RL2A 3OMCA 1BKBA 2RJDA 3OS1A 1NJIC 1K9MU 3DB4A 4NS5A 2BUDA 3BDLA 1QVFA 1MHNA 4BD3A 2RHUA 1OZ3A 3OYNA 4IUPA 4N4IA 4IUTA 4C5EA 2X4YA 3CC7A 3CXCS 3LX7A 2G3RA 2OTJT 2MI6A 4A4GA 1NPRA 3G4ST 3FEOA 2XHCA 3DLMA 1YJWA 1K9MC 3ZEHA 1VQ4T 3P8HA 3CC2T 5IN1A 3CD6A 2RHZA 3OB9A 1WJSA 3CPWS 5HY6A 3G6EA 1VQOT 2EIFA 2X4WA 1OYXA 2RJFA 2RO0A 3OS2A 3DLLA 1VQ6T 3MEUA 1M1KU 4ZTJA 3LLRA 5J26A 2YRVA 4N4GA 3L2QA 3CCVA 3MP1A 3CCRA 2LQ8A 2X4XA 4IKFA 1G5VA 4CRIA 1YJ9A 2DIQA 3PMTA 3DB3A 2M16A 2RJCA 2DIGA 1VQLT 3ME9A 1M90C 1OI1A 2O4XB 1VQ8A 3I55T 2L89A 1YITT 1VQ9A 3L2WA 1YJ9T 2NLUA 4BE0A 3LGFA 1VQNT 3PIOA 1K8AC 3PNWC 3L2UA 5DM7R 3PFSA 3NTKA 2RHIA 3QJ6A 2RHYA 5J3BA 1KC8U 5A2QE 3CCQT 4BE1A 2EKOA 4ZTFA 3CCMT 3CPFA 4BDZA 1X6OA 2QA4T 3OY9A 1YHQA 5FRMA 4TVRA 4II1A 2QEXT 5FRNA 2MWOA 3S3MA 3OYGA 5KH6A 4PLIA
chains in the Genus database with same CATH superfamily
3CMAA 4IIOA 5LJ5f 2CP5A 5GAOp 1Q82C 5A0DA 5I2SA 1FMKA 1JO8A 2K57A 2EKHA 2QEXA 2RH2A 5GANh 4CC4B 1RAHB 5I22A 3QXEB 1X01A 2K3XA 1VQPT 1FX7A 1AWJA 1PHTA 1C0MA 4UC4A 1NZ9A 5CR2A 1AD5A 1YCYA 4LD9K 4XU1A 1RAIB 2CT3A 2LJ1A 3MCAB 4M7DB 5CQXA 3NFCA 4A54A 4PFZA 1M27C 3P8DA 4F7UG 2YLBA 2LCSA 2RN8A 4P5NA 2AKKA 3H6ZA 5CQYA 2O01E 1GFDA 2EFIA 2CZ7B 1WJRA 2RMOA 2PQWA 4AMCA 5GANe 1YP5A 2G6FX 2L3QA 3A8LB 1LVKA 2K3YA 1WHMA 1W2BS 1OQKA 2LQNA 1KK7A 1JEGA 3OYAA 2RQVA 2FB7A 3H0IA 4JJBA 5C0MA 5IXBA 3CCLQ 2KSSA 3C12A 2EYQA 4OMNA 1I81A 1S72A 1WHKA 2RK2A 2KYBA 2QQBA 1EZZB 4F17A 2PVDB 2VGMA 2CT4A 2XU8A 3EG9A 4MMKA 4DEXA 1SHGA 3I35A 2P0KA 1OU9A 2KYMA 1PRLC 4N0AC 2L8DA 1M1FA 5GAMh 1MMDA 1D1BA 5GAOm 1VQOA 3I9QA 3FC3A 5FW9A 4M75C 2LMJA 1YWPA 1RLQC 4LXCA 1M1KR 4QVZA 2H3EB 3OYFA 2P84A 4XTYA 4J6XA 1AWWA 2MIOA 4O5VA 2VC8A 1GRIA 2JTFA 2VV5A 4M7DG 2QQAA 1U06A 1I07A 3BFMA 3F70A 2AK5A 3TU4K 1E6GA 2FHDA 5GAN3 1KQSA 2D9TA 1X69A 4F04B 4XU0A 3C95A 2V1RA 4LNPA 2K2MA 3M5AA 2QTVA 2MK5A 3WXMB 3PIPA 1QWEA 1CKBA 2RPNA 3A8MB 3M0UA 4KH0B 1OV3A 1X2KA 2JN0A 5A0LA 4C92E 3PMIA 3RNJA 2DYBA 3LH0A 3META 2DEUA 2KR3A 3REAB 1OULA 1B34A 1NLOC 1WQWA 1VQ8T 1CKAA 2HBWA 4MZPA 2DILA 3PTAA 4L6V5 5GAOn 3JB9I 2V8JA 5IHKA 2C0TA 5GANf 2R5MA 1O9SA 1Q95G 4C8QG 4XU3A 1IGQA 2F5KA 4E7JA 2DPPB 2EW3A 3KXTA 1ZUUA 4QT7A 3E9GA 3RKYA 2HQHA 1W2BP 2K3BA 3TSWA 2ZPGB 1GCQC 2E41A 3CBPA 2M0YA 2HSEB 3J81E 3M53A 5AT1B 4EMKB 1VQ5T 1XOVA 1S72Q 3CCJT 3U23A 2O88A 2KMTA 3LW5E 3GNGA 3SWNC 5GAOl 3E1SA 5GAN2 2E6ZA 4PJOE 2DNUA 3VS7A 3A5ZB 4K11A 4BACA 1M3AA 1N8RC 2H8HA 2KDSA 1U3OA 2WACA 4AG2C 2LZ6B 3CQTA 3OYYA 2KI7A 2EWNA 1NPPA 1K73C 2DERA 1NBEB 1R0BG 2L0AA 1VQLQ 2ZPBB 4RUGA 1VQ4A 2DXUA 1TUDA 4JS5A 3CC4A 3HTRA 2D8JA 2K4YA 2KE9A 4X9CA 4AFZC 5CKHA 2JS2A 3CCEA 5CIUA 2I0NA 3CCJA 1ACMB 4LD6A 5EG2A 1NM7A 7AT1B 4M78D 1KD1C 1PD1A 4OB0B 3M0TA 3A98A 3VS6A 3GP8A 2FEIA 1UGPB 3UA7A 5I21A 3QIIA 1WQ7A 2K5LA 2LNVA 1N9SA 2PUKB 1YIJA 1K73R 2DA9A 3NHNA 1UEBA 2KRNA 3VS4A 1VIFA 3OYLA 2A36A 4E7LA 1WX6A 2O31A 2LCCA 1SRLA 1QKXA 1WA7A 2KQWA 3G6EQ 4E7SA 4J9CA 1RL2A 3OMCA 4XTVA 2CH4A 3H9NA 1K9MU 2OI3A 2EJ9A 2XIDA 1GFCA 2QAZA 3M0PA 1MHNA 4BD3A 3JB9H 4KT0E 1JQQA 4PK4A 4M77D 4BI4A 2DBKA 2CS7A 2EYZA 3CC7A 3SWNA 3CXCS 3LX7A 3NGPA 2G3RA 2V1QA 2K6DA 3RERA 4KUDK 2OTJT 1UUEA 5LJ5g 1IB8A 1PRMC 5GANg 1NPRA 1ZUKA 2OJ2A 3RR6A 2DD5A 1YJWA 3ZEHA 4F14A 3P8HA 5GMKm 3CD6A 2ESWA 2ROTA 2DJQA 2ZCFB 4HKEA 4FYWB 1GCQA 1OPLA 2ROLA 5HY6A 3M0RA 1TS9A 5KYWA 4FYVB 1KG1A 2LT4A 1M90R 3OS2A 1QKWA 5DY9A 4MDWA 3DLLA 3A8GB 2FPFA 4WTOB 1ARKA 3MEUA 1TOVA 1D1CA 1RABB 2YRVA 1AWXA 3L2QA 1UGQB 3CCVA 3MP1A 3JB9F 1VQPQ 3SEMA 2X3WD 1KQSP 2D1XA 3M4YA 2COYA 3PMTA 5GAMj 3EHRA 1BI2A 1BCMA 4C0DB 4M7DE 4M75G 5GMKj 3SFMA 2LNHB 5LJ5h 2O4XB 5IXFA 1RAFB 2QDYB 2X51A 1QVFP 3JRZA 2M51A 2JTEA 4M75E 1VQ9A 1OPKA 2LJ0A 2EJFA 2K5IA 3PIOA 2GGRA 1DJ7B 2E3HA 2AZSA 2PNIA 3FJPA 2RHIA 3VS5A 1C1AA 5J3BA 1KC8U 2HAXA 2O2OA 3RDVA 3PVLA 1RLPC 5FWCA 1OX8A 4KGXB 5FU6B 2EVRA 1OOTA 2MOXA 2XDBA 1KSWA 1TWBA 2DX1A 2OX7A 1PKTA 2JT4A 1N8RR 2YSQA 2EGEA 5GMKi 3I5RA 3VS3A 3S3MA 3KFVA 3VRZA 1VYTA 2BKDN 4WCIA 2RQUA 4FYXB 2X9HA 4C92A 4M75A 1E7OA 3I56T 3QDFA 2MWPA 2FVUA 4D8KA 1QW1A 1YJNQ 1VQ7Q 3G71A 1B3QA 2EJGA 1W1FA 1BI3A 4X34A 4OGCA 2CP2A 3N5BB 2DKGA 4N0AA 5LL6S 2JVVA 2F2WA 3FLGA 4QVCA 2EQUA 2RK1A 5KYXB 2ZPHB 4M78F 2VUBA 4HXJA 1W70A 2JJ9A 1ABQA 1WI7A 4L59A 4LDXA 5I2MA 5LJ3h 2XDDA 2QGFB 4KRTA 2AZVA 4M77F 1BK2A 2JMCA 1M1GA 1UJYA 5GAN6 4ZN3A 2EPDA 3NTIA 1KC8C 3EG9B 2HEQA 2E1HA 1QCNA 2HNIA 1Q7YC 2GTJA 1I8FA 4M78G 1WYXA 2RQWA 1ZLMA 2OAUA 5KCOA 5GAMf 4HVUA 1M90U 4X9DA 2J6FA 5KCHA 2KROA 4IUQA 1P92A 3MPUB 4XAXB 1JJ2A 2RJEA 4JPBW 4Z02A 2EAYA 1OU8A 3LWIA 1NLPC 4R0KA 2GQIA 2ENMA 3VJPA 2DM1A 3EH2A 2CREA 3C94A 3OMGA 1PCXA 4LDVA 1K76A 4BB7A 5GJWB 1W2BA 5L8RE 1KD1U 1T3LA 2P0QA 3M58A 5A0GA 3UATA 4OB1B 5M9OA 1Q81U 1LPLA 3INZA 2DK3A 4XTUA 5KE2A 3G1JA 4ORZA 2B8AA 4L5GA 2FO0A 1ZBJA 3OW2A 1KQSS 1BI1A 5FROA 3GNFB 4E6RA 1Q81C 3RBBB 1BIAA 3CCQQ 4FL6A 4M7AF 3OYKA 2IPOB 3E9FA 2YUOA 3QPHA 2AKLA 2E70A 1KQ2A 2LQKA 3EAEA 3OW2S 3FDRA 2VXEA 1M2VB 2V8IA 3JB9G 4FW1A 2P0PA 2QQSA 2F1LA 2D0QB 2KY9A 1Y71A 2HQEA 1WJQA 4JJNK 3FJ5A 1R8OB 1N8RU 3H0FA 4B6MA 3QZ9B 1JJ2S 3TCJA 3MEWA 4CC7A 5KYYB 4E7IA 2DYIA 2VWFA 3CC7T 4F7UE 4QVDA 1G8XA 3ZL7C 2ED1A 3J7AF 1VQMT 1FMVA 4QKUA 4JZ3A 1PC0A 1IXDA 2XKOC 2KVQG 4RG2A 1MGQA 1YWOA 1RADB 3KUFA 3JCMg 1Y7XA 4GLKA 2QA4Q 2JW4A 3QYGB 1E6HA 2V26A 1XJWB 1VQPA 4C92G 1G2BA 3MHXA 3CCVQ 3SDZA 2ZZDA 2CUBA 2BZ8A 3QDRB 5HK3A 3I55Q 5D7UA 1Y57A 4XU2A 5IHNA 4HVVA 2E5QA 2VASA 2RD1A 2E4HA 3NPFA 4XTXA 2DEQA 1QMCA 4EMKA 3T9NA 2FG0A 2CUDA 1ZSGA 1VQ6A 3SB2A 4FSSA 1RI0A 3CC4T 3M59A 1H8KA 3L1AA 4C8QE 1HK9A 2Z0WA 4PJOA 2CP6A 4XTWA 2OTLA 1YHQT 1Z9ZA 3RMSA 1JXOA 3JSCA 3TEEA 4OGEA 1ZSZA 3HP9A 2CYZB 1B07A 2JNGA 3CCJQ 2RA2A 2ZGWA 4ZN1A 5LJ5j 2QI2A 3CMET 1KHCA 1U8RA 1RAEB 4C5HA 3J80E 5KYWB 2DXBA 3LH5A 1M3BA 4R56A 3R6NA 3E19A 1M30A 2Y90A 1UHCA 1JB0E 2X3XD 2L3PA 3Q1JA 2FL7A 3NTHA 1NYFA 2L3RA 3VU3C 1G3TA 1VQ5A 2ABLA 4Y91A 4OMMA 1QVGA 1NJIU 4DQ2A 2DTHA 4C8QA 4DOWA 2QDLA 2M9UA 4M75D 4DBQA 4JJDA 1JRIA 3ULRB 1AHJB 4EMGA 5KYUA 2DL7A 2LDMA 4M7DD 4BE2A 3X28B 4QQ6A 1N9RA 2ZPFB 1KD1R 1PM3A 3O8VA 3R6OA 2YT6A 4NL3A 1JU5C 4HT9A 1IRXA 1VQLA 3MP8A 1UGSB 4RG8A 2VB6A 4DA4A 2DETA 1YI2T 2ED0A 2RI5A 5IAYA 2SRCA 3CCLA 1IHWA 4PLLA 1V76A 4E7ZA 4IIMA 3JCMQ 1BKBA 2K2VA 3C0CA 4NS5A 3DB4A 2QYZA 2BUDA 2A28A 2DMOA 4OF1A 1VQNQ 1Y0MA 4IUTA 4JLGA 4C5EA 4MDXA 1TUCA 1WLPB 2NYSA 5LJ3j 1M8MA 2EGAA 1BB9A 2HSPA 3CXCP 1PWTA 4OMLA 2EYYA 3GIBA 2FZKB 1FXXA 1K9MC 1VQ4T 2BZYA 4M78B 4KH1B 5IN1A 1SF9A 3OB9A 5GAMd 2O9SA 4J9HA 2RF0A 4AFUC 1IGUA 1VQ8Q 1MV0B 1VQOT 2EIFA 2GQVA 1WXTA 1VQMQ 4D6WA 1RI9A 2X4JA 1VOMA 1VQ6T 3G71Q 3LLRA 2RQRA 1N5ZA 3FIFA 1UGVA 2HD0A 2X4XA 1SEMA 2F2VA 1R77A 2B86A 1QCFA 2RM4A 5HKCA 4RTWA 4CC3A 2DIQA 4HVWA 2EYXA 4V2SA 2RQTA 2DIGA 1OEBA 5LJ3d 3ME9A 1MMAA 3X24B 1VA7A 2YLCA 1UE9A 3EG1A 3FRNA 4Z89A 4M78E 1IHVA 1M2OA 2JM9A 2WSEE 1VQOQ 1YJ9T 2DFUA 2KT1A 4JRIA 4BE0A 4OMPA 1K8AC 2LQWA 4LUDA 1J3TA 3L2UA 5DM7R 2MCNA 1PNJA 3G7ZA 3PFSA 3M4GA 4FT4A 4M77A 3QWYA 1JJ2P 4PFOA 2A37A 1UG1A 2AIRB 2YUPA 1UTIA 4ZTFA 1LJOA 2W10A 2LT1A 2ZPIB 1NEBA 3CCMT 2E10A 4VUBA 2NUZA 3CPFA 2J7IA 2DBMA 1X6OA 4HCKA 5FWBA 3JCMP 1W4SA 4II1A 4TVRA 2CGHA 2QEXT 5FRNA 3V7RA 3OYGA 5KH6A 2PUOB 2P4TA 4R55A 3JCMe 3IQLA 5D6XA 4E2FB 2Y4YA 4FYYB 4LDUA 3OBWA 1IREB 1UFFA 2YRDA 4MZTA 2E65A 1M2VA 1JBMA 4GLMA 3M57A 1Q86R 3CC2A 4AG1C 2EQMA 2LX7A 3CMAT 4RCCA 3M55A 3H0HA 1GL5A 1Y07A 1FMWA 2K79A 1YHQQ 3V7SA 2YWWA 3S3OA 2OTLT 4M7AA 2HZYA 3GF5A 3UWNA 3QUIA 1VQKT 5I11A 1OX9A 4ME7A 1RAAB 4B9WA 4J5YA 1GBRA 3OYIA 3UDCA 3JCMh 2FRWA 3CCUQ 4M75B 1MNDA 1SG5A 3OA6A 3M9QA 3H41A 1VYUA 5IH2A 2XMFA 2KK4A 3MJXA 1WHJA 3CCMQ 3HKSA 3TQ7P 4M78A 4M77G 1H92A 3CD6T 4EDUA 4F7UF 2XD0A 1PD0A 2J05A 2GNCA 3TVTA 2LVMA 4QQDA 2CDTA 4FM4B 2NWMA 3H8ZA 1NJIR 1OZ2A 1YBYA 2V8KA 1ZA2B 3OYEA 4C0GA 3X20B 1NEGA 1YJNA 1VQ7A 4EMHA 1YIJQ 2ZPEB 1M1KC 1FWZA 4C0ZA 2A08A 2XI9A 1VQMA 2FRYA 3MP6A 1K0SA 3CBMA 2MYSA 3V8JA 4RTTA 3MEAA 2PU9B 4A53A 3I55A 2K5FA 2RI3A 1X2QA 3SWNB 3VS1A 4M7AG 1SKUB 1QP2A 1KHIA 3FB9A 5GMKe 3CC4Q 4PJOG 1N27A 3OYHA 3VUZA 3AT1B 2VYTA 5J39A 2H3JA 2JM8A 3JCMJ 5CKDA 4LUEA 2DE0X 3HRTA 3OSVA 1KIKA 2COZA 4QW2A 4J9BA 2NUTA 2LP5A 5GJVB 3CCRT 4LDYA 4PJOD 4EPCA 1WPYA 3EGXB 4PJOF 3ER0A 3OYBA 3G4SA 3GPLA 2XDPA 5FU7B 4KULA 1I4K1 4RTVA 1EX4A 4BI8B 2GFUA 2DO3A 2FZGB 2IG0A 4J6YA 2GF7A 1H3HA 5CVIA 2EQJA 4ELYC 4X1VA 1C6VX 1K73U 1ABOA 2F2XA 1VQ9T 2JMAA 1D0ZA 5FU6C 1M5Q1 3EGDA 5GAOq 4KGZB 5CCAA 3MO8A 3C4SA 2GTOA 2JUFA 2DVEA 3OW2P 3GLXA 1Q82R 4IUVA 3CXCA 3LWHA 1JXMA 1SSHA 2BZXA 1X27A 2P4RA 4OB3B 3JV3A 2DTIA 2KGTA 1W6XA 4KUIA 2XK0A 2YRCA 4IURA 1I0CA 1BYMA 1B34B 2DL5A 5LJ3f 3X26B 1G3SA 2QEXQ 4M75F 2D6FA 3CCSQ 1QCOA 4RTZA 4A4EA 3VS0A 1WZOA 1AZGB 4C92D 2DXTA 4ZGJB 4WF2A 3VUBA 4J8OA 1X6BA 4C8QC 1N6AA 3BE3A 2EQKA 2QQ9A 2GFAA 3A8OB 3RKWA 2BE7D 3CCUT 5CO7A 3CCMA 4C92F 2O4XA 4GBQA 5KYXA 3SD4A 2QK0A 2DRMA 1UB4A 5HK0A 1FYNA 5IHIA 3P8BB 1TTHB 2M0OA 1PG5B 5GAN5 2HCKA 1VQNA 4RCBA 3CEYA 3CCUA 1K1ZA 4CI0C 3OYJA 2YXYA 3EFRA 1ZSZC 3L42A 3VYHB 3OYDA 4FU6A 1MMNA 3I56A 2MF2A 4B9XA 3RKXA 3A8HB 4PJOC 5C6SA 2M1HA 6AT1B 1XTDA 4M7DA 2RHXA 2CP0A 3KBGA 1T0JA 5IT9E 4CC2A 3RMQA 4GY5A 4E7HA 4M7DC 1H3ZA 2E6NA 1QVPA 4BI3A 1M3CA 4O6JA 3A1PA 4EMKC 2RB6A 1WGSA 2JOYA 5D6WA 4C5IA 2LTOA 3UPUA 2EBPA 2FZCB 2R5AA 1NE8A 2QG9B 2QQRA 3JCMV 2OTJQ 4OMOA 4M7AD 4J7IA 4PJMA 5GANj 2Y4XA 1YIJT 1TH7A 2HQXA 3HRUA 2DZ9A 2LRQA 3HFOA 4JRKA 1B7TA 3CPWP 4PKCC 1NJIC 3HSBA 1LNXA 1HYOA 3CD6Q 1AT1B 4KGVB 3BDLA 4OMQA 2XG8D 2RHUA 2VKNA 2ECZA 3QHSA 1OZ3A 3OYNA 4IUPA 4N4IA 1V29B 4LE9A 2M02A 1I1JA 2X4YA 1UJ0A 3RUXA 2DL4A 1R0CB 3QJYA 3SHWA 2HKNA 4A4GA 3G4ST 4RMOA 2C0IA 2QTXA 2AHJB 1V1CA 1X6GA 1YFNA 3HFNA 3RESA 3CC2T 2BE9B 2O9VA 1WJSA 4HCCA 2W0ZA 3JCMf 3JCMW 3CPWS 2GCXA 3URGA 1WDXA 2KEAA 3G6EA 1OYXA 1SHFA 2K9GA 2RO0A 1A0NB 1I5OB 2YHTA 3E2UA 3EFOB 4ZTJA 1M1KU 4J7FA 3X25B 3MKDA 3CCRA 1D0XA 2J06A 4Y28E 1LCKA 3CMAQ 3QZ5B 4IKFA 2DXCA 1PSEA 4AFSC 4PJOB 3DB3A 2M16A 1U5SA 1UECA 2EQIA 1VQLT 1M90C 3M0QA 2KBTA 2QASA 4M4ZA 1OI1A 5EC7A 1VQ8A 2CH4W 1TG0A 3I55T 3VYGA 4HT8A 1YITT 3L2WA 1VQNT 5GMKh 1HSQA 4C8QF 2L2PA 2JS0A 4MZMA 3NTKA 1D09B 1GBQA 5ECAA 5A2QE 3CCQT 5GAMg 4BE1A 2I2LA 4J6WA 4F16A 5GAOr 1KJWA 3ZBDA 3PVQA 1D0YA 1WHLA 2F69A 1MMGA 3OY9A 3OS5A 1UDLA 1MNEA 1YHQA 5FRMA 5GAN7 5GAN8 2F5TX 2MWOA 1YJ9Q 4PLIA 3QG1A 1F1BB 3S3NA 1Q86U 4ZNXA 1D3BA 1WXUA 2C0OA 3CCRQ 3L2VA 5L23A 2A3LA 4C0FA 2ATCB 2R58A 3EG2A 2DAQA 3LYIA 3QO3A 4OP0A 4RKUE 3VV0A 4A4HA 8ATCB 1KC8R 3GBQA 2CZ6B 4M7DF 5DLQE 3MEVA 4DBRA 2E64A 3EGUA 4C5GA 2PZ1A 5GANd 4JUVA 2J6KA 1WHGA 1UGRB 1S72T 2DD4A 1ZA1B 3M56A 4FT2A 3JCMd 3OYCA 1VIEA 2NUPA 3UF4A 1VQ5Q 3CPWA 4LN2A 4C92C 3I56Q 1YI2Q 2HL3A 1HXDA 1SPKA 3OQ5A 2FPDA 2YDLA 2DJZA 2LJ3A 4C8QB 3JB9D 3CCVT 4ZGDB 1QWFA 4M78C 1BIBA 2PTKA 2DL8A 2PVOB 4BUGA 1QVFS 5KYNA 3PGGA 2HKQB 4FW2A 4JLIA 9ATCB 3S6WA 1YNZA 1K8AU 1X75C 1RUWA 2YUNA 2MAMA 3LGLA 1WIEA 2YUQA 1YITA 2CSIA 2QGGA 3REBB 3QYHB 4PJNA 2OTLQ 4M7AC 1PKSA 1TUGB 2OTJA 1O75A 1QLYA 4OB2B 1Q7YR 3V8KA 3UT1A 4IUUA 1M8VA 3VKIA 2QXFA 3G6ET 1VYVA 4ELZC 5LJ5e 1VQ6Q 1ZHIA 4PL6A 3CBOA 3CMEQ 4DEYA 4JZ4A 2HMAA 2EGCA 5D6YA 3VRYA 3L2ZA 4OVAA 2VGNA 3JCMb 3OSSC 2KRSA 1GXIE 2E5KA 3CCET 3CMEA 2NUPB 5DLOA 4M77E 3CCST 4JS4A 5LJ3e 3ASKA 1M4ZA 2C06A 3OYMA 2HBPA 1ZBXA 3JCMc 2QA4A 5LJ5d 3RIRA 4LDWA 4PNOA 4M77C 3D7SB 2PVGB 3G4SQ 3TREA 3EGDB 1AVZC 4RTYA 1QVGS 4YTLA 1IZ6A 4BDYA 1MV3A 4E47A 1EIFA 1G3YA 2R57A 1PSFA 2JZ2A 4Q5WA 3BDUA 1BBZA 1BCOA 5AYFA 4ANJA 4D8DA 2DZCA 5CKFA 1XQHA 3CCSA 4PJLA 5GAN4 4XK8E 2BTTA 2AT1B 3TSZA 3HHTB 3I5SA 4J9DA 1VQ9Q 1YI2A 2DF6A 1YCSB 1YN8A 2RNAA 4MMLA 2IIMA 5FLXE 4C0DC 3GOXA 2CP7A 3CCQA 5CK9A 4ATOA 3EG0A 1YJWT 2CKKA 4NL2A 3DKMA 4F7UB 3CCEQ 1VUBA 2JTMA 5GMKl 3L2RA 1HJDA 1S1NA 2KXCA 1D1AA 1NG2A 4FIBA 2XICA 3ZFJA 4Z8AA 3QWXX 3OS0A 1IO6A 1SSFA 4DBHA 3O5ZA 1CSKA 1RACB 1H641 2ZAEA 4ESRA 1VQ4Q 3QSUA 2CP3A 3EHQA 2VVKA 3CCLT 2KRMA 1Q86C 2COWA 3WVDB 1WFWA 1XNIA 1NYGA 1X43A 2E12A 3QBYA 2MPXC 2KXDA 2J6OA 3G71T 4HCBA 3EFOA 2OAWA 2A7YA 3JB9J 4Z88A 4DBFA 2WSFE 4AFQC 1ZX6A 4J9GA 3HPWA 3BY7A 5CAIA 1EFNA 4N4HA 4XTZA 1VQKQ 1YJNT 1VQ7T 4J9EA 4JDSA 2DTOA 1RAGB 2RI2A 3VS2A 2IVWA 2DRKA 4HCZA 2D8HA 1G83A 1K9MR 2CZ1B 1WHHA 1WXBA 3NMZC 5FU7C 2DVJA 3M54A 1Q7YU 4QQGA 4NOYA 4A4KA 4AT1B 1TSFA 3QKJA 1GCPA 2HL5C 4A63B 3EG3A 2LCLA 2L5QA 4HA8A 4E7KA 1T3SA 4EIKA 2EYWA 2DLPA 5KE3A 1Q81R 4Y92A 3PT9A 2JXBA 1VQKA 3JAME 2X35A 4C92B 1KQ1A 4ZGEB 4M77B 5KYUB 4A4FA 2BIVA 1Q82U 1MUZA 1YITQ 2VXFA 2RJDA 8AT1B 3OS1A 1QP3A 4OMFB 3WVEB 1QVFA 4J9FA 5CKEA 4JJCA 2LX9A 2D0NA 3EH1A 1M9SA 3UA6A 1AOJA 2MI6A 4KBMB 3PE0A 3FEOA 2XHCA 3DLMA 1ZUYA 5HCKA 3THKA 3V7CA 4XQ3A 1T0HA 1U1TA 2RHZA 1LOJA 4BY6B 4DOVA 1ZSZB 1D3BB 3M0SA 2X4WA 1KFZA 2RJFA 3CC2Q 1QVGP 1HD3A 2MMPA 5LJ3g 4M7AE 1Y96B 1AZEA 5J26A 4PJJA 4N4GA 1TU0B 2A0FB 2LQ8A 3JCMX 2KAFA 1U1SA 4FCYA 1G5VA 4CRIA 1YJ9A 1AWOA 2RJCA 4C8QD 3V8LA 4RTXA 1K9AA 1WNLA 2L3SA 2L89A 3EGXA 1I5LA 2NLUA 1BI0A 3LGFA 4J9IA 2NUTB 1UHFA 1Y96A 2FYKA 1YJWQ 1K0XA 4JRQA 1TXQA 3PNWC 4RTUA 2CSQA 4BY6C 3CC7Q 4J83A 2SEMA 3BW1A 1SRMA 4FSXA 3QJ6A 5CKBA 2RHYA 4PFPA 2HDAA 1AEYA 1Z9QA 1K8AR 2WSCE 2KNBB 3EFSA 2EKOA 5GAMe 2DL3A 2E3IA 1G3WA 2K7AA 4M7AB 4BDZA 2CZ0B 2QA4T 1BU1A 2FPEA 4JRPA 1ZQ1A 3HL8A 4F7UA 3HRSA 5KYYA 1QQJA 1K4US 3OBYA 2LC4A 2GBQA 3AHUA 2KT8A
chains in the Genus database with same CATH topology
3JCMe 3S3NA 3CMAA 2BKDN 5D6XA 2Y4YA 1Q86U 4LDUA 1D3BA 5LJ5f 5GAOp 4C92A 4M75A 3L2VA 3I56T 3OBWA 1Q82C 1IREB 5A0DA 5I2SA 2A3LA 4C0FA 2MWPA 2FVUA 1QW1A 4MZTA 2K57A 2E65A 2R58A 3G71A 2QEXA 2EJGA 2RH2A 5GANh 1JBMA 4X34A 1BI3A 4OGCA 3N5BB 3QXEB 1X01A 2DAQA 2DKGA 3LYIA 2K3XA 3M57A 3QO3A 4N0AA 5LL6S 3CC2A 2EQMA 4OP0A 4RKUE 3VV0A 4A4HA 3CMAT 2JVVA 2CZ6B 4RCCA 4M7DF 1VQPT 5DLQE 1FX7A 3FLGA 3M55A 2E64A 3MEVA 4C5GA 4QVCA 2EQUA 2RK1A 1Y07A 4UC4A 5GANd 4JUVA 1NZ9A 5CR2A 1UGRB 2ZPHB 3V7SA 1S72T 2DD4A 2VUBA 1YCYA 4FT2A 3M56A 4M78F 3S3OA 4LD9K 3JCMd 3OYCA 1VIEA 4XU1A 2OTLT 3CPWA 3MCAB 4M7AA 4M7DB 3GF5A 4C92C 5CQXA 3NFCA 3UWNA 4A54A 1HXDA 3P8DA 3QUIA 3OQ5A 4ME7A 4F7UG 2YLBA 4L59A 1VQKT 4LDXA 2DJZA 5I2MA 5LJ3h 4B9WA 4M77F 4C8QB 4J5YA 2XDDA 3JB9D 4P5NA 3OYIA 3UDCA 3JCMh 3H6ZA 4ZGDB 3CCVT 1M1GA 4M75B 5CQYA 2O01E 4M78C 5GAN6 4ZN3A 1KC8C 1BIBA 3NTIA 2PVOB 3OA6A 2E1HA 4BUGA 1QVFS 3M9QA 2EFIA 2CZ7B 3PGGA 4JLIA 1WJRA 3S6WA 2HNIA 2KK4A 2PQWA 1Q7YC 5GANe 1I8FA 4M78G 1K8AU 1X75C 3A8LB 2K3YA 3HKSA 2OAUA 4M78A 4M77G 5KCOA 1W2BS 5GAMf 4EDUA 3CD6T 1M90U 4F7UF 2MAMA 4X9DA 3LGLA 2XD0A 5KCHA 3OYAA 4IUQA 1P92A 1YITA 2FB7A 2LVMA 4QQDA 5C0MA 4FM4B 4XAXB 1JJ2A 3H8ZA 3QYHB 2KSSA 3C12A 2RJEA 2EYQA 4M7AC 1OZ2A 2EAYA 4Z02A 3LWIA 1YBYA 2OTJA 1I81A 2V8KA 1S72A 1O75A 2RK2A 2QQBA 3OYEA 4C0GA 3VJPA 4OB2B 3X20B 2PVDB 2VGMA 2XU8A 4MMKA 3V8KA 3UT1A 1YJNA 1VQ7A 4EMHA 3C94A 3OMGA 4IUUA 1M8VA 2P0KA 4LDVA 4N0AC 2L8DA 1M1FA 2ZPEB 5GAMh 4BB7A 1W2BA 1M1KC 5GAOm 5L8RE 3VKIA 2QXFA 3G6ET 1VQOA 1FWZA 2P0QA 1KD1U 3M58A 4C0ZA 4ELZC 5A0GA 5LJ5e 1ZHIA 4PL6A 3CBOA 2XI9A 4OB1B 1VQMA 5M9OA 3FC3A 1Q81U 3MP6A 3INZA 4M75C 2DK3A 4XTUA 5D6YA 3CBMA 5KE2A 3L2ZA 3V8JA 2B8AA 3MEAA 4L5GA 3OW2A 2PU9B 1KQSS 1BI1A 5FROA 3GNFB 4OVAA 4A53A 3I55A 2VGNA 3JCMb 1BIAA 1Q81C 3OSSC 2K5FA 4QVZA 2RI3A 4FL6A 3SWNB 4M7AG 4M7AF 3OYKA 1GXIE 3OYFA 3E9FA 4XTYA 1QP2A 1KHIA 3QPHA 3CMEA 2E70A 3CCET 4J6XA 2LQKA 1KQ2A 3EAEA 3OW2S 3FDRA 3FB9A 5GMKe 2VXEA 2V8IA 4O5VA 4M77E 1N27A 4PJOG 5DLOA 3OYHA 3CCST 3VUZA 2VC8A 4JS4A 2JTFA 2VV5A 5LJ3e 2P0PA 4M7DG 2VYTA 5J39A 2QQSA 2H3JA 3ASKA 1M4ZA 2D0QB 2C06A 2KY9A 1Y71A 3OYMA 2HBPA 2HQEA 1WJQA 3JCMJ 2QQAA 5CKDA 4JJNK 1ZBXA 3BFMA 1R8OB 3F70A 3JCMc 2QA4A 1N8RU 5LJ5d 3TU4K 3RIRA 4LDWA 3HRTA 3OSVA 4PNOA 2FHDA 5GAN3 1KQSA 2D9TA 3QZ9B 1JJ2S 3TCJA 3MEWA 4QW2A 4XU0A 4E7IA 4M77C 3CCRT 3CC7T 3C95A 4LDYA 4PJOD 4F7UE 2PVGB 4QVDA 3TREA 4EPCA 1WPYA 4PJOF 3ER0A 3OYBA 3J7AF 1VQMT 3M5AA 1QVGS 3G4SA 4YTLA 3WXMB 2XDPA 3PIPA 3GPLA 5FU7B 1IZ6A 3A8MB 4KULA 2XKOC 1I4K1 4BI8B 2KVQG 2GFUA 2JN0A 4E47A 2DO3A 4RG2A 5A0LA 4BDYA 2IG0A 1MGQA 1EIFA 4J6YA 1G3YA 2GF7A 3PMIA 4C92E 2R57A 1PSFA 2JZ2A 3KUFA 4Q5WA 3LH0A 5CVIA 2EQJA 3JCMg 1Y7XA 4ELYC 3META 4GLKA 3BDUA 1K73U 3QYGB 5AYFA 1VQ9T 2DZCA 5CKFA 1XQHA 1B34A 4C92G 3MHXA 3CCSA 1VQPA 5FU6C 1M5Q1 1WQWA 5GAN4 3SDZA 1VQ8T 4XK8E 2ZZDA 5GAOq 4MZPA 5CCAA 3MO8A 3HHTB 3PTAA 4L6V5 5GAOn 3JB9I 3C4SA 1YI2A 2V8JA 3QDRB 5HK3A 2JUFA 4MMLA 2DVEA 5GANf 4XU2A 2R5MA 5FLXE 3GLXA 4C0DC 1O9SA 4IUVA 2E5QA 4XU3A 4C8QG 3GOXA 3CXCA 2RD1A 3CCQA 2F5KA 4XTXA 2DPPB 3LWHA 4E7JA 2DEQA 4OB3B 3KXTA 5CK9A 2DTIA 4ATOA 1YJWT 3E9GA 2CKKA 3T9NA 4EMKA 4KUIA 3DKMA 4NL2A 4F7UB 3RKYA 1VUBA 2JTMA 5GMKl 2XK0A 3L2RA 4IURA 2ZPGB 1BYMA 1B34B 5LJ3f 2E41A 4FIBA 3X26B 3CBPA 1VQ6A 2XICA 1G3SA 3SB2A 3ZFJA 4M75F 3OS0A 2D6FA 1SSFA 3J81E 1RI0A 3CC4T 3M59A 3M53A 1H641 3L1AA 4A4EA 3QSUA 3CCLT 4EMKB 1VQ5T 1XOVA 4C8QE 1Q86C 3WVDB 4C92D 2DXTA 4ZGJB 1HK9A 1XNIA 4WF2A 3CCJT 4PJOA 2E12A 3VUBA 4XTWA 3QBYA 2OTLA 4J8OA 4C8QC 1YHQT 2KMTA 1N6AA 3LW5E 3RMSA 3GNGA 3SWNC 3JSCA 3TEEA 5GAOl 3E1SA 4OGEA 3HP9A 2CYZB 5GAN2 2JNGA 2EQKA 2E6ZA 3G71T 4PJOE 4HCBA 2RA2A 2ZGWA 2QQ9A 2GFAA 4ZN1A 5LJ5j 3A5ZB 2A7YA 2QI2A 3A8OB 3RKWA 4BACA 3CMET 3JB9J 1KHCA 1N8RC 1U8RA 2KDSA 2WACA 4C5HA 3CCUT 5CO7A 3J80E 2WSFE 3CCMA 4C92F 2O4XA 3OYYA 2EWNA 1NPPA 3HPWA 2DXBA 1K73C 3BY7A 4R56A 5CAIA 4N4HA 3SD4A 4XTZA 3E19A 1YJNT 1VQ7T 2Y90A 1UB4A 5HK0A 2ZPBB 1VQ4A 1JB0E 3P8BB 2DXUA 2M0OA 2DTOA 4JDSA 5GAN5 2RI2A 1VQNA 4JS5A 2IVWA 3Q1JA 4RCBA 2FL7A 3CEYA 3NTHA 3CCUA 4CI0C 4HCZA 3OYJA 3CC4A 3EFRA 2K4YA 2L3RA 3L42A 3VU3C 2CZ1B 1G3TA 4X9CA 3VYHB 3OYDA 1VQ5A 4FU6A 5CKHA 4Y91A 1QVGA 1NJIU 3CCEA 5CIUA 4DQ2A 2DTHA 3I56A 3CCJA 2MF2A 4C8QA 4B9XA 4DOWA 3RKXA 3A8HB 2M9UA 4LD6A 4M75D 5EG2A 4PJOC 5C6SA 2M1HA 5FU7C 3M54A 4M78D 1KD1C 4OB0B 1JRIA 1Q7YU 4QQGA 1XTDA 4M7DA 3GP8A 1AHJB 4EMGA 2RHXA 1UGPB 3KBGA 4NOYA 4A4KA 2LDMA 3QKJA 4M7DD 5IT9E 5I21A 4BE2A 3QIIA 3RMQA 4GY5A 3X28B 4QQ6A 1N9RA 4E7HA 1WQ7A 2K5LA 4M7DC 2LNVA 1H3ZA 1N9SA 2E6NA 2ZPFB 2LCLA 2PUKB 1YIJA 2L5QA 4HA8A 3JB9G 1QVPA 4E7KA 4BI3A 4O6JA 1UEBA 3O8VA 3R6OA 4NL3A 4EMKC 5KE3A 2RB6A 1WGSA 2JOYA 4HT9A 1VIFA 5D6WA 4C5IA 3OYLA 3PT9A 4E7LA 3MP8A 2LTOA 1VQLA 3UPUA 2R5AA 1UGSB 4RG8A 1NE8A 1VQKA 2QQRA 3JCMV 3JAME 2LCCA 2X35A 4DA4A 1YI2T 4M7AD 4C92B 4J7IA 1KQ1A 2RI5A 2Y4XA 4ZGEB 5IAYA 5GANj 1TH7A 2HQXA 1YIJT 3HRUA 3CCLA 4M77B 4PLLA 2DZ9A 4A4FA 2BIVA 2KQWA 2LRQA 1Q82U 3HFOA 1RL2A 4JRKA 3JCMQ 3OMCA 1BKBA 4XTVA 2VXFA 2RJDA 3OS1A 2K2VA 4PKCC 1NJIC 3HSBA 1LNXA 3DB4A 4NS5A 2EJ9A 2XIDA 1QP3A 1K9MU 4OMFB 2BUDA 3BDLA 3WVEB 2XG8D 1MHNA 4BD3A 1QVFA 3JB9H 2RHUA 4KT0E 4OF1A 3QHSA 5CKEA 4M77D 1OZ3A 4BI4A 3OYNA 4IUPA 4N4IA 1V29B 4IUTA 4JLGA 4C5EA 4MDXA 2CS7A 2X4YA 5LJ3j 3CC7A 2LX9A 3SWNA 3CXCS 3LX7A 3RUXA 2G3RA 3RERA 1M9SA 3QJYA 4KUDK 2OTJT 2MI6A 5LJ5g 4KBMB 4A4GA 5GANg 1NPRA 3G4ST 3FEOA 4RMOA 3GIBA 1FXXA 2XHCA 2DD5A 3DLMA 1YJWA 1K9MC 3ZEHA 2QTXA 1VQ4T 2AHJB 4M78B 3HFNA 3P8HA 3RESA 5IN1A 3CC2T 3V7CA 5GMKm 4XQ3A 3CD6A 1U1TA 2RHZA 3OB9A 5GAMd 1LOJA 1WJSA 2ZCFB 4HKEA 4BY6B 4DOVA 4HCCA 3JCMf 3JCMW 3CPWS 5HY6A 2GCXA 3URGA 1D3BB 3G6EA 1VQOT 2EIFA 2X4WA 1OYXA 2GQVA 1KG1A 2RJFA 2LT4A 2RO0A 3OS2A 5DY9A 4MDWA 4D6WA 3DLLA 2X4JA 3A8GB 1VQ6T 2MMPA 3MEUA 5LJ3g 4M7AE 1Y96B 2YHTA 4ZTJA 1M1KU 3LLRA 2YRVA 5J26A 3FIFA 4N4GA 4J7FA 3L2QA 1UGQB 3CCVA 3MP1A 3X25B 3JB9F 4PLIA 2LQ8A 3JCMX 3CCRA 2HD0A 2X4XA 4Y28E 2KAFA 1U1SA 3QZ5B 4IKFA 1G5VA 2DXCA 1PSEA 2RM4A 5HKCA 3M4YA 4CRIA 4PJOB 1YJ9A 2DIQA 3PMTA 3DB3A 5GAMj 1BI2A 4V2SA 2M16A 2RJCA 2DIGA 4C8QD 5LJ3d 3V8LA 4C0DB 1VQLT 3ME9A 4M7DE 3X24B 1M90C 4M75G 5GMKj 3SFMA 1OI1A 5LJ5h 2YLCA 2O4XB 1VQ8A 2QDYB 3FRNA 1WNLA 3JRZA 3I55T 4M78E 2L89A 3VYGA 4HT8A 1YITT 1I5LA 4M75E 1VQ9A 2WSEE 3L2WA 2EJFA 1YJ9T 2NLUA 4JRIA 4BE0A 1BI0A 3LGFA 2K5IA 2FYKA 1Y96A 1VQNT 5GMKh 3PIOA 1K8AC 4C8QF 4JRQA 1DJ7B 3PNWC 3L2UA 3FJPA 5DM7R 4BY6C 4J83A 3BW1A 3G7ZA 3PFSA 3M4GA 4FSXA 3NTKA 2RHIA 3QJ6A 4FT4A 4M77A 4MZMA 2RHYA 5CKBA 5J3BA 1KC8U 2HAXA 5A2QE 3CCQT 2WSCE 5GAMg 4BE1A 2I2LA 4J6WA 5GAOr 5FU6B 3EFSA 2EKOA 3ZBDA 4ZTFA 5GAMe 1LJOA 2LT1A 2ZPIB 2F69A 2XDBA 3CCMT 1G3WA 2E10A 4M7AB 4VUBA 3CPFA 4BDZA 1X6OA 2CZ0B 3OY9A 2QA4T 3OS5A 4JRPA 5GMKi 1ZQ1A 3HL8A 1YHQA 4F7UA 5FRMA 3HRSA 5GAN7 3JCMP 5GAN8 1W4SA 4II1A 2F5TX 4TVRA 2CGHA 3OBYA 2QEXT 2LC4A 5FRNA 2MWOA 3V7RA 3S3MA 3OYGA 5KH6A 3AHUA 2PUOB 2P4TA 4R55A 3QG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3N A;  3CMA A;  2BKD N;  5D6X A;  1Q86 U;  1Q82 C;  3L2V A;  3I56 T;  2MWP A;  2R58 A;  3G71 A;  2QEX A;  4X34 A;  2DAQ A;  3LYI A;  5LL6 S;  2K3X A;  3CC2 A;  2EQM A;  3CMA T;  4A4H A;  2JVV A;  1VQP T;  5DLQ E;  3FLG A;  3MEV A;  4C5G A;  2EQU A;  4UC4 A;  1NZ9 A;  1S72 T;  3S3O A;  3OYC A;  2OTL T;  3CPW A;  3UWN A;  3P8D A;  1VQK T;  3OQ5 A;  4L59 A;  4B9W A;  3OYI A;  3CCV T;  3H6Z A;  1M1G A;  4ZN3 A;  1KC8 C;  3NTI A;  3OA6 A;  1QVF S;  3M9Q A;  2EFI A;  1WJR A;  3S6W A;  1Q7Y C;  2PQW A;  1K8A U;  2K3Y A;  3HKS A;  3CD6 T;  1W2B S;  5KCO A;  4EDU A;  1M90 U;  3LGL A;  5KCH A;  3OYA A;  4IUQ A;  1YIT A;  2LVM A;  4QQD A;  5C0M A;  1JJ2 A;  3H8Z A;  2RJE A;  1OZ2 A;  4Z02 A;  2OTJ A;  1YBY A;  1S72 A;  3OYE A;  1YJN A;  1VQ7 A;  3UT1 A;  3OMG A;  4IUU A;  2P0K A;  2L8D A;  1W2B A;  1M1K C;  3G6E T;  1VQO A;  1KD1 U;  4PL6 A;  1VQM A;  5M9O A;  3FC3 A;  1Q81 U;  3MP6 A;  5D6Y A;  5KE2 A;  2B8A A;  3MEA A;  3OW2 A;  1KQS S;  5FRO A;  4OVA A;  1Q81 C;  3I55 A;  4QVZ A;  2RI3 A;  4FL6 A;  3OYK A;  3OYF A;  3E9F A;  1KHI A;  3CCE T;  3CME A;  2E70 A;  3OW2 S;  3EAE A;  3FDR A;  1N27 A;  3CCS T;  3OYH A;  2JTF A;  2VYT A;  5J39 A;  2QQS A;  3ASK A;  3OYM A;  2HQE A;  1WJQ A;  3F70 A;  1N8R U;  2QA4 A;  2FHD A;  1KQS A;  2D9T A;  1JJ2 S;  3MEW A;  4QW2 A;  4E7I A;  3CCR T;  3CC7 T;  3TRE A;  3ER0 A;  3J7A F;  3OYB A;  1VQM T;  1QVG S;  3G4S A;  4YTL A;  2XDP A;  3PIP A;  1IZ6 A;  4BDY A;  2KVQ G;  2GFU A;  2DO3 A;  4RG2 A;  2IG0 A;  1EIF A;  2GF7 A;  3PMI A;  2R57 A;  2JZ2 A;  3KUF A;  4Q5W A;  3LH0 A;  2EQJ A;  3MET A;  1K73 U;  1VQ9 T;  1VQP A;  3CCS A;  1VQ8 T;  3MO8 A;  1YI2 A;  3C4S A;  2JUF A;  5FLX E;  2R5M A;  4IUV A;  3GOX A;  2E5Q A;  3CXC A;  3CCQ A;  2F5K A;  4E7J A;  1YJW T;  3E9G A;  2CKK A;  3L2R A;  2XK0 A;  4IUR A;  1VQ6 A;  3OS0 A;  1SSF A;  3J81 E;  1RI0 A;  3CC4 T;  4A4E A;  3CCL T;  1VQ5 T;  1Q86 C;  1XNI A;  3CCJ T;  3QBY A;  2OTL A;  1YHQ T;  2JNG A;  2EQK A;  2E6Z A;  3G71 T;  4ZN1 A;  2GFA A;  3A5Z B;  1N8R C;  4BAC A;  3CME T;  1KHC A;  2KDS A;  3CCU T;  2WAC A;  4C5H A;  3J80 E;  3CCM A;  3OYY A;  2O4X A;  1NPP A;  1K73 C;  4N4H A;  3SD4 A;  1YJN T;  1VQ7 T;  1VQ4 A;  3P8B B;  2M0O A;  2RI2 A;  1VQN A;  3Q1J A;  3CEY A;  3CCU A;  3NTH A;  3CC4 A;  4HCZ A;  3OYJ A;  2L3R A;  3L42 A;  3OYD A;  1VQ5 A;  4FU6 A;  1QVG A;  1NJI U;  3CCE A;  5CIU A;  3I56 A;  3CCJ A;  4B9X A;  4LD6 A;  5C6S A;  2M1H A;  1KD1 C;  1Q7Y U;  4QQG A;  1XTD A;  2RHX A;  3KBG A;  2LDM A;  3QKJ A;  5IT9 E;  4BE2 A;  3QII A;  4GY5 A;  4E7H A;  4QQ6 A;  1H3Z A;  2E6N A;  2LCL A;  1YIJ A;  4E7K A;  1UEB A;  3O8V A;  5KE3 A;  2JOY A;  1WGS A;  5D6W A;  4C5I A;  3OYL A;  1VQL A;  3MP8 A;  2LTO A;  4E7L A;  2R5A A;  1VQK A;  2QQR A;  3JAM E;  2X35 A;  2LCC A;  1YI2 T;  2RI5 A;  5IAY A;  1YIJ T;  2HQX A;  3CCL A;  4PLL A;  4A4F A;  2BIV A;  2LRQ A;  1Q82 U;  1RL2 A;  3OMC A;  1BKB A;  2RJD A;  3OS1 A;  1NJI C;  1K9M U;  3DB4 A;  4NS5 A;  2BUD A;  3BDL A;  1QVF A;  1MHN A;  4BD3 A;  2RHU A;  1OZ3 A;  3OYN A;  4IUP A;  4N4I A;  4IUT A;  4C5E A;  2X4Y A;  3CC7 A;  3CXC S;  3LX7 A;  2G3R A;  2OTJ T;  2MI6 A;  4A4G A;  1NPR A;  3G4S T;  3FEO A;  2XHC A;  3DLM A;  1YJW A;  1K9M C;  3ZEH A;  1VQ4 T;  3P8H A;  3CC2 T;  5IN1 A;  3CD6 A;  2RHZ A;  3OB9 A;  1WJS A;  3CPW S;  5HY6 A;  3G6E A;  1VQO T;  2EIF A;  2X4W A;  1OYX A;  2RJF A;  2RO0 A;  3OS2 A;  3DLL A;  1VQ6 T;  3MEU A;  1M1K U;  4ZTJ A;  3LLR A;  5J26 A;  2YRV A;  4N4G A;  3L2Q A;  3CCV A;  3MP1 A;  3CCR A;  2LQ8 A;  2X4X A;  4IKF A;  1G5V A;  4CRI A;  1YJ9 A;  2DIQ A;  3PMT A;  3DB3 A;  2M16 A;  2RJC A;  2DIG A;  1VQL T;  3ME9 A;  1M90 C;  1OI1 A;  2O4X B;  1VQ8 A;  3I55 T;  2L89 A;  1YIT T;  1VQ9 A;  3L2W A;  1YJ9 T;  2NLU A;  4BE0 A;  3LGF A;  1VQN T;  3PIO A;  1K8A C;  3PNW C;  3L2U A;  5DM7 R;  3PFS A;  3NTK A;  2RHI A;  3QJ6 A;  2RHY A;  5J3B A;  1KC8 U;  5A2Q E;  3CCQ T;  4BE1 A;  2EKO A;  4ZTF A;  3CCM T;  3CPF A;  4BDZ A;  1X6O A;  2QA4 T;  3OY9 A;  1YHQ A;  5FRM A;  4TVR A;  4II1 A;  2QEX T;  5FRN A;  2MWO A;  3S3M A;  3OYG A;  5KH6 A;  4PLI A; 
#chains in the Genus database with same CATH topology
 3CMA A;  4IIO A;  5LJ5 f;  2CP5 A;  5GAO p;  1Q82 C;  5A0D A;  5I2S A;  1FMK A;  1JO8 A;  2K57 A;  2EKH A;  2QEX A;  2RH2 A;  5GAN h;  4CC4 B;  1RAH B;  5I22 A;  3QXE B;  1X01 A;  2K3X A;  1VQP T;  1FX7 A;  1AWJ A;  1PHT A;  1C0M A;  4UC4 A;  1NZ9 A;  5CR2 A;  1AD5 A;  1YCY A;  4LD9 K;  4XU1 A;  1RAI B;  2CT3 A;  2LJ1 A;  3MCA B;  4M7D B;  5CQX A;  3NFC A;  4A54 A;  4PFZ A;  1M27 C;  3P8D A;  4F7U G;  2YLB A;  2LCS A;  2RN8 A;  4P5N A;  2AKK A;  3H6Z A;  5CQY A;  2O01 E;  1GFD A;  2EFI A;  2CZ7 B;  1WJR A;  2RMO A;  2PQW A;  4AMC A;  5GAN e;  1YP5 A;  2G6F X;  2L3Q A;  3A8L B;  1LVK A;  2K3Y A;  1WHM A;  1W2B S;  1OQK A;  2LQN A;  1KK7 A;  1JEG A;  3OYA A;  2RQV A;  2FB7 A;  3H0I A;  4JJB A;  5C0M A;  5IXB A;  3CCL Q;  2KSS A;  3C12 A;  2EYQ A;  4OMN A;  1I81 A;  1S72 A;  1WHK A;  2RK2 A;  2KYB A;  2QQB A;  1EZZ B;  4F17 A;  2PVD B;  2VGM A;  2CT4 A;  2XU8 A;  3EG9 A;  4MMK A;  4DEX A;  1SHG A;  3I35 A;  2P0K A;  1OU9 A;  2KYM A;  1PRL C;  4N0A C;  2L8D A;  1M1F A;  5GAM h;  1MMD A;  1D1B A;  5GAO m;  1VQO A;  3I9Q A;  3FC3 A;  5FW9 A;  4M75 C;  2LMJ A;  1YWP A;  1RLQ C;  4LXC A;  1M1K R;  4QVZ A;  2H3E B;  3OYF A;  2P84 A;  4XTY A;  4J6X A;  1AWW A;  2MIO A;  4O5V A;  2VC8 A;  1GRI A;  2JTF A;  2VV5 A;  4M7D G;  2QQA A;  1U06 A;  1I07 A;  3BFM A;  3F70 A;  2AK5 A;  3TU4 K;  1E6G A;  2FHD A;  5GAN 3;  1KQS A;  2D9T A;  1X69 A;  4F04 B;  4XU0 A;  3C95 A;  2V1R A;  4LNP A;  2K2M A;  3M5A A;  2QTV A;  2MK5 A;  3WXM B;  3PIP A;  1QWE A;  1CKB A;  2RPN A;  3A8M B;  3M0U A;  4KH0 B;  1OV3 A;  1X2K A;  2JN0 A;  5A0L A;  4C92 E;  3PMI A;  3RNJ A;  2DYB A;  3LH0 A;  3MET A;  2DEU A;  2KR3 A;  3REA B;  1OUL A;  1B34 A;  1NLO C;  1WQW A;  1VQ8 T;  1CKA A;  2HBW A;  4MZP A;  2DIL A;  3PTA A;  4L6V 5;  5GAO n;  3JB9 I;  2V8J A;  5IHK A;  2C0T A;  5GAN f;  2R5M A;  1O9S A;  1Q95 G;  4C8Q G;  4XU3 A;  1IGQ A;  2F5K A;  4E7J A;  2DPP B;  2EW3 A;  3KXT A;  1ZUU A;  4QT7 A;  3E9G A;  3RKY A;  2HQH A;  1W2B P;  2K3B A;  3TSW A;  2ZPG B;  1GCQ C;  2E41 A;  3CBP A;  2M0Y A;  2HSE B;  3J81 E;  3M53 A;  5AT1 B;  4EMK B;  1VQ5 T;  1XOV A;  1S72 Q;  3CCJ T;  3U23 A;  2O88 A;  2KMT A;  3LW5 E;  3GNG A;  3SWN C;  5GAO l;  3E1S A;  5GAN 2;  2E6Z A;  4PJO E;  2DNU A;  3VS7 A;  3A5Z B;  4K11 A;  4BAC A;  1M3A A;  1N8R C;  2H8H A;  2KDS A;  1U3O A;  2WAC A;  4AG2 C;  2LZ6 B;  3CQT A;  3OYY A;  2KI7 A;  2EWN A;  1NPP A;  1K73 C;  2DER A;  1NBE B;  1R0B G;  2L0A A;  1VQL Q;  2ZPB B;  4RUG A;  1VQ4 A;  2DXU A;  1TUD A;  4JS5 A;  3CC4 A;  3HTR A;  2D8J A;  2K4Y A;  2KE9 A;  4X9C A;  4AFZ C;  5CKH A;  2JS2 A;  3CCE A;  5CIU A;  2I0N A;  3CCJ A;  1ACM B;  4LD6 A;  5EG2 A;  1NM7 A;  7AT1 B;  4M78 D;  1KD1 C;  1PD1 A;  4OB0 B;  3M0T A;  3A98 A;  3VS6 A;  3GP8 A;  2FEI A;  1UGP B;  3UA7 A;  5I21 A;  3QII A;  1WQ7 A;  2K5L A;  2LNV A;  1N9S A;  2PUK B;  1YIJ A;  1K73 R;  2DA9 A;  3NHN A;  1UEB A;  2KRN A;  3VS4 A;  1VIF A;  3OYL A;  2A36 A;  4E7L A;  1WX6 A;  2O31 A;  2LCC A;  1SRL A;  1QKX A;  1WA7 A;  2KQW A;  3G6E Q;  4E7S A;  4J9C A;  1RL2 A;  3OMC A;  4XTV A;  2CH4 A;  3H9N A;  1K9M U;  2OI3 A;  2EJ9 A;  2XID A;  1GFC A;  2QAZ A;  3M0P A;  1MHN A;  4BD3 A;  3JB9 H;  4KT0 E;  1JQQ A;  4PK4 A;  4M77 D;  4BI4 A;  2DBK A;  2CS7 A;  2EYZ A;  3CC7 A;  3SWN A;  3CXC S;  3LX7 A;  3NGP A;  2G3R A;  2V1Q A;  2K6D A;  3RER A;  4KUD K;  2OTJ T;  1UUE A;  5LJ5 g;  1IB8 A;  1PRM C;  5GAN g;  1NPR A;  1ZUK A;  2OJ2 A;  3RR6 A;  2DD5 A;  1YJW A;  3ZEH A;  4F14 A;  3P8H A;  5GMK m;  3CD6 A;  2ESW A;  2ROT A;  2DJQ A;  2ZCF B;  4HKE A;  4FYW B;  1GCQ A;  1OPL A;  2ROL A;  5HY6 A;  3M0R A;  1TS9 A;  5KYW A;  4FYV B;  1KG1 A;  2LT4 A;  1M90 R;  3OS2 A;  1QKW A;  5DY9 A;  4MDW A;  3DLL A;  3A8G B;  2FPF A;  4WTO B;  1ARK A;  3MEU A;  1TOV A;  1D1C A;  1RAB B;  2YRV A;  1AWX A;  3L2Q A;  1UGQ B;  3CCV A;  3MP1 A;  3JB9 F;  1VQP Q;  3SEM A;  2X3W D;  1KQS P;  2D1X A;  3M4Y A;  2COY A;  3PMT A;  5GAM j;  3EHR A;  1BI2 A;  1BCM A;  4C0D B;  4M7D E;  4M75 G;  5GMK j;  3SFM A;  2LNH B;  5LJ5 h;  2O4X B;  5IXF A;  1RAF B;  2QDY B;  2X51 A;  1QVF P;  3JRZ A;  2M51 A;  2JTE A;  4M75 E;  1VQ9 A;  1OPK A;  2LJ0 A;  2EJF A;  2K5I A;  3PIO A;  2GGR A;  1DJ7 B;  2E3H A;  2AZS A;  2PNI A;  3FJP A;  2RHI A;  3VS5 A;  1C1A A;  5J3B A;  1KC8 U;  2HAX A;  2O2O A;  3RDV A;  3PVL A;  1RLP C;  5FWC A;  1OX8 A;  4KGX B;  5FU6 B;  2EVR A;  1OOT A;  2MOX A;  2XDB A;  1KSW A;  1TWB A;  2DX1 A;  2OX7 A;  1PKT A;  2JT4 A;  1N8R R;  2YSQ A;  2EGE A;  5GMK i;  3I5R A;  3VS3 A;  3S3M A;  3KFV A;  3VRZ A;  1VYT A;  2BKD N;  4WCI A;  2RQU A;  4FYX B;  2X9H A;  4C92 A;  4M75 A;  1E7O A;  3I56 T;  3QDF A;  2MWP A;  2FVU A;  4D8K A;  1QW1 A;  1YJN Q;  1VQ7 Q;  3G71 A;  1B3Q A;  2EJG A;  1W1F A;  1BI3 A;  4X34 A;  4OGC A;  2CP2 A;  3N5B B;  2DKG A;  4N0A A;  5LL6 S;  2JVV A;  2F2W A;  3FLG A;  4QVC A;  2EQU A;  2RK1 A;  5KYX B;  2ZPH B;  4M78 F;  2VUB A;  4HXJ A;  1W70 A;  2JJ9 A;  1ABQ A;  1WI7 A;  4L59 A;  4LDX A;  5I2M A;  5LJ3 h;  2XDD A;  2QGF B;  4KRT A;  2AZV A;  4M77 F;  1BK2 A;  2JMC A;  1M1G A;  1UJY A;  5GAN 6;  4ZN3 A;  2EPD A;  3NTI A;  1KC8 C;  3EG9 B;  2HEQ A;  2E1H A;  1QCN A;  2HNI A;  1Q7Y C;  2GTJ A;  1I8F A;  4M78 G;  1WYX A;  2RQW A;  1ZLM A;  2OAU A;  5KCO A;  5GAM f;  4HVU A;  1M90 U;  4X9D A;  2J6F A;  5KCH A;  2KRO A;  4IUQ A;  1P92 A;  3MPU B;  4XAX B;  1JJ2 A;  2RJE A;  4JPB W;  4Z02 A;  2EAY A;  1OU8 A;  3LWI A;  1NLP C;  4R0K A;  2GQI A;  2ENM A;  3VJP A;  2DM1 A;  3EH2 A;  2CRE A;  3C94 A;  3OMG A;  1PCX A;  4LDV A;  1K76 A;  4BB7 A;  5GJW B;  1W2B A;  5L8R E;  1KD1 U;  1T3L A;  2P0Q A;  3M58 A;  5A0G A;  3UAT A;  4OB1 B;  5M9O A;  1Q81 U;  1LPL A;  3INZ A;  2DK3 A;  4XTU A;  5KE2 A;  3G1J A;  4ORZ A;  2B8A A;  4L5G A;  2FO0 A;  1ZBJ A;  3OW2 A;  1KQS S;  1BI1 A;  5FRO A;  3GNF B;  4E6R A;  1Q81 C;  3RBB B;  1BIA A;  3CCQ Q;  4FL6 A;  4M7A F;  3OYK A;  2IPO B;  3E9F A;  2YUO A;  3QPH A;  2AKL A;  2E70 A;  1KQ2 A;  2LQK A;  3EAE A;  3OW2 S;  3FDR A;  2VXE A;  1M2V B;  2V8I A;  3JB9 G;  4FW1 A;  2P0P A;  2QQS A;  2F1L A;  2D0Q B;  2KY9 A;  1Y71 A;  2HQE A;  1WJQ A;  4JJN K;  3FJ5 A;  1R8O B;  1N8R U;  3H0F A;  4B6M A;  3QZ9 B;  1JJ2 S;  3TCJ A;  3MEW A;  4CC7 A;  5KYY B;  4E7I A;  2DYI A;  2VWF A;  3CC7 T;  4F7U E;  4QVD A;  1G8X A;  3ZL7 C;  2ED1 A;  3J7A F;  1VQM T;  1FMV A;  4QKU A;  4JZ3 A;  1PC0 A;  1IXD A;  2XKO C;  2KVQ G;  4RG2 A;  1MGQ A;  1YWO A;  1RAD B;  3KUF A;  3JCM g;  1Y7X A;  4GLK A;  2QA4 Q;  2JW4 A;  3QYG B;  1E6H A;  2V26 A;  1XJW B;  1VQP A;  4C92 G;  1G2B A;  3MHX A;  3CCV Q;  3SDZ A;  2ZZD A;  2CUB A;  2BZ8 A;  3QDR B;  5HK3 A;  3I55 Q;  5D7U A;  1Y57 A;  4XU2 A;  5IHN A;  4HVV A;  2E5Q A;  2VAS A;  2RD1 A;  2E4H A;  3NPF A;  4XTX A;  2DEQ A;  1QMC A;  4EMK A;  3T9N A;  2FG0 A;  2CUD A;  1ZSG A;  1VQ6 A;  3SB2 A;  4FSS A;  1RI0 A;  3CC4 T;  3M59 A;  1H8K A;  3L1A A;  4C8Q E;  1HK9 A;  2Z0W A;  4PJO A;  2CP6 A;  4XTW A;  2OTL A;  1YHQ T;  1Z9Z A;  3RMS A;  1JXO A;  3JSC A;  3TEE A;  4OGE A;  1ZSZ A;  3HP9 A;  2CYZ B;  1B07 A;  2JNG A;  3CCJ Q;  2RA2 A;  2ZGW A;  4ZN1 A;  5LJ5 j;  2QI2 A;  3CME T;  1KHC A;  1U8R A;  1RAE B;  4C5H A;  3J80 E;  5KYW B;  2DXB A;  3LH5 A;  1M3B A;  4R56 A;  3R6N A;  3E19 A;  1M30 A;  2Y90 A;  1UHC A;  1JB0 E;  2X3X D;  2L3P A;  3Q1J A;  2FL7 A;  3NTH A;  1NYF A;  2L3R A;  3VU3 C;  1G3T A;  1VQ5 A;  2ABL A;  4Y91 A;  4OMM A;  1QVG A;  1NJI U;  4DQ2 A;  2DTH A;  4C8Q A;  4DOW A;  2QDL A;  2M9U A;  4M75 D;  4DBQ A;  4JJD A;  1JRI A;  3ULR B;  1AHJ B;  4EMG A;  5KYU A;  2DL7 A;  2LDM A;  4M7D D;  4BE2 A;  3X28 B;  4QQ6 A;  1N9R A;  2ZPF B;  1KD1 R;  1PM3 A;  3O8V A;  3R6O A;  2YT6 A;  4NL3 A;  1JU5 C;  4HT9 A;  1IRX A;  1VQL A;  3MP8 A;  1UGS B;  4RG8 A;  2VB6 A;  4DA4 A;  2DET A;  1YI2 T;  2ED0 A;  2RI5 A;  5IAY A;  2SRC A;  3CCL A;  1IHW A;  4PLL A;  1V76 A;  4E7Z A;  4IIM A;  3JCM Q;  1BKB A;  2K2V A;  3C0C A;  4NS5 A;  3DB4 A;  2QYZ A;  2BUD A;  2A28 A;  2DMO A;  4OF1 A;  1VQN Q;  1Y0M A;  4IUT A;  4JLG A;  4C5E A;  4MDX A;  1TUC A;  1WLP B;  2NYS A;  5LJ3 j;  1M8M A;  2EGA A;  1BB9 A;  2HSP A;  3CXC P;  1PWT A;  4OML A;  2EYY A;  3GIB A;  2FZK B;  1FXX A;  1K9M C;  1VQ4 T;  2BZY A;  4M78 B;  4KH1 B;  5IN1 A;  1SF9 A;  3OB9 A;  5GAM d;  2O9S A;  4J9H A;  2RF0 A;  4AFU C;  1IGU A;  1VQ8 Q;  1MV0 B;  1VQO T;  2EIF A;  2GQV A;  1WXT A;  1VQM Q;  4D6W A;  1RI9 A;  2X4J A;  1VOM A;  1VQ6 T;  3G71 Q;  3LLR A;  2RQR A;  1N5Z A;  3FIF A;  1UGV A;  2HD0 A;  2X4X A;  1SEM A;  2F2V A;  1R77 A;  2B86 A;  1QCF A;  2RM4 A;  5HKC A;  4RTW A;  4CC3 A;  2DIQ A;  4HVW A;  2EYX A;  4V2S A;  2RQT A;  2DIG A;  1OEB A;  5LJ3 d;  3ME9 A;  1MMA A;  3X24 B;  1VA7 A;  2YLC A;  1UE9 A;  3EG1 A;  3FRN A;  4Z89 A;  4M78 E;  1IHV A;  1M2O A;  2JM9 A;  2WSE E;  1VQO Q;  1YJ9 T;  2DFU A;  2KT1 A;  4JRI A;  4BE0 A;  4OMP A;  1K8A C;  2LQW A;  4LUD A;  1J3T A;  3L2U A;  5DM7 R;  2MCN A;  1PNJ A;  3G7Z A;  3PFS A;  3M4G A;  4FT4 A;  4M77 A;  3QWY A;  1JJ2 P;  4PFO A;  2A37 A;  1UG1 A;  2AIR B;  2YUP A;  1UTI A;  4ZTF A;  1LJO A;  2W10 A;  2LT1 A;  2ZPI B;  1NEB A;  3CCM T;  2E10 A;  4VUB A;  2NUZ A;  3CPF A;  2J7I A;  2DBM A;  1X6O A;  4HCK A;  5FWB A;  3JCM P;  1W4S A;  4II1 A;  4TVR A;  2CGH A;  2QEX T;  5FRN A;  3V7R A;  3OYG A;  5KH6 A;  2PUO B;  2P4T A;  4R55 A;  3JCM e;  3IQL A;  5D6X A;  4E2F B;  2Y4Y A;  4FYY B;  4LDU A;  3OBW A;  1IRE B;  1UFF A;  2YRD A;  4MZT A;  2E65 A;  1M2V A;  1JBM A;  4GLM A;  3M57 A;  1Q86 R;  3CC2 A;  4AG1 C;  2EQM A;  2LX7 A;  3CMA T;  4RCC A;  3M55 A;  3H0H A;  1GL5 A;  1Y07 A;  1FMW A;  2K79 A;  1YHQ Q;  3V7S A;  2YWW A;  3S3O A;  2OTL T;  4M7A A;  2HZY A;  3GF5 A;  3UWN A;  3QUI A;  1VQK T;  5I11 A;  1OX9 A;  4ME7 A;  1RAA B;  4B9W A;  4J5Y A;  1GBR A;  3OYI A;  3UDC A;  3JCM h;  2FRW A;  3CCU Q;  4M75 B;  1MND A;  1SG5 A;  3OA6 A;  3M9Q A;  3H41 A;  1VYU A;  5IH2 A;  2XMF A;  2KK4 A;  3MJX A;  1WHJ A;  3CCM Q;  3HKS A;  3TQ7 P;  4M78 A;  4M77 G;  1H92 A;  3CD6 T;  4EDU A;  4F7U F;  2XD0 A;  1PD0 A;  2J05 A;  2GNC A;  3TVT A;  2LVM A;  4QQD A;  2CDT A;  4FM4 B;  2NWM A;  3H8Z A;  1NJI R;  1OZ2 A;  1YBY A;  2V8K A;  1ZA2 B;  3OYE A;  4C0G A;  3X20 B;  1NEG A;  1YJN A;  1VQ7 A;  4EMH A;  1YIJ Q;  2ZPE B;  1M1K C;  1FWZ A;  4C0Z A;  2A08 A;  2XI9 A;  1VQM A;  2FRY A;  3MP6 A;  1K0S A;  3CBM A;  2MYS A;  3V8J A;  4RTT A;  3MEA A;  2PU9 B;  4A53 A;  3I55 A;  2K5F A;  2RI3 A;  1X2Q A;  3SWN B;  3VS1 A;  4M7A G;  1SKU B;  1QP2 A;  1KHI A;  3FB9 A;  5GMK e;  3CC4 Q;  4PJO G;  1N27 A;  3OYH A;  3VUZ A;  3AT1 B;  2VYT A;  5J39 A;  2H3J A;  2JM8 A;  3JCM J;  5CKD A;  4LUE A;  2DE0 X;  3HRT A;  3OSV A;  1KIK A;  2COZ A;  4QW2 A;  4J9B A;  2NUT A;  2LP5 A;  5GJV B;  3CCR T;  4LDY A;  4PJO D;  4EPC A;  1WPY A;  3EGX B;  4PJO F;  3ER0 A;  3OYB A;  3G4S A;  3GPL A;  2XDP A;  5FU7 B;  4KUL A;  1I4K 1;  4RTV A;  1EX4 A;  4BI8 B;  2GFU A;  2DO3 A;  2FZG B;  2IG0 A;  4J6Y A;  2GF7 A;  1H3H A;  5CVI A;  2EQJ A;  4ELY C;  4X1V A;  1C6V X;  1K73 U;  1ABO A;  2F2X A;  1VQ9 T;  2JMA A;  1D0Z A;  5FU6 C;  1M5Q 1;  3EGD A;  5GAO q;  4KGZ B;  5CCA A;  3MO8 A;  3C4S A;  2GTO A;  2JUF A;  2DVE A;  3OW2 P;  3GLX A;  1Q82 R;  4IUV A;  3CXC A;  3LWH A;  1JXM A;  1SSH A;  2BZX A;  1X27 A;  2P4R A;  4OB3 B;  3JV3 A;  2DTI A;  2KGT A;  1W6X A;  4KUI A;  2XK0 A;  2YRC A;  4IUR A;  1I0C A;  1BYM A;  1B34 B;  2DL5 A;  5LJ3 f;  3X26 B;  1G3S A;  2QEX Q;  4M75 F;  2D6F A;  3CCS Q;  1QCO A;  4RTZ A;  4A4E A;  3VS0 A;  1WZO A;  1AZG B;  4C92 D;  2DXT A;  4ZGJ B;  4WF2 A;  3VUB A;  4J8O A;  1X6B A;  4C8Q C;  1N6A A;  3BE3 A;  2EQK A;  2QQ9 A;  2GFA A;  3A8O B;  3RKW A;  2BE7 D;  3CCU T;  5CO7 A;  3CCM A;  4C92 F;  2O4X A;  4GBQ A;  5KYX A;  3SD4 A;  2QK0 A;  2DRM A;  1UB4 A;  5HK0 A;  1FYN A;  5IHI A;  3P8B B;  1TTH B;  2M0O A;  1PG5 B;  5GAN 5;  2HCK A;  1VQN A;  4RCB A;  3CEY A;  3CCU A;  1K1Z A;  4CI0 C;  3OYJ A;  2YXY A;  3EFR A;  1ZSZ C;  3L42 A;  3VYH B;  3OYD A;  4FU6 A;  1MMN A;  3I56 A;  2MF2 A;  4B9X A;  3RKX A;  3A8H B;  4PJO C;  5C6S A;  2M1H A;  6AT1 B;  1XTD A;  4M7D A;  2RHX A;  2CP0 A;  3KBG A;  1T0J A;  5IT9 E;  4CC2 A;  3RMQ A;  4GY5 A;  4E7H A;  4M7D C;  1H3Z A;  2E6N A;  1QVP A;  4BI3 A;  1M3C A;  4O6J A;  3A1P A;  4EMK C;  2RB6 A;  1WGS A;  2JOY A;  5D6W A;  4C5I A;  2LTO A;  3UPU A;  2EBP A;  2FZC B;  2R5A A;  1NE8 A;  2QG9 B;  2QQR A;  3JCM V;  2OTJ Q;  4OMO A;  4M7A D;  4J7I A;  4PJM A;  5GAN j;  2Y4X A;  1YIJ T;  1TH7 A;  2HQX A;  3HRU A;  2DZ9 A;  2LRQ A;  3HFO A;  4JRK A;  1B7T A;  3CPW P;  4PKC C;  1NJI C;  3HSB A;  1LNX A;  1HYO A;  3CD6 Q;  1AT1 B;  4KGV B;  3BDL A;  4OMQ A;  2XG8 D;  2RHU A;  2VKN A;  2ECZ A;  3QHS A;  1OZ3 A;  3OYN A;  4IUP A;  4N4I A;  1V29 B;  4LE9 A;  2M02 A;  1I1J A;  2X4Y A;  1UJ0 A;  3RUX A;  2DL4 A;  1R0C B;  3QJY A;  3SHW A;  2HKN A;  4A4G A;  3G4S T;  4RMO A;  2C0I A;  2QTX A;  2AHJ B;  1V1C A;  1X6G A;  1YFN A;  3HFN A;  3RES A;  3CC2 T;  2BE9 B;  2O9V A;  1WJS A;  4HCC A;  2W0Z A;  3JCM f;  3JCM W;  3CPW S;  2GCX A;  3URG A;  1WDX A;  2KEA A;  3G6E A;  1OYX A;  1SHF A;  2K9G A;  2RO0 A;  1A0N B;  1I5O B;  2YHT A;  3E2U A;  3EFO B;  4ZTJ A;  1M1K U;  4J7F A;  3X25 B;  3MKD A;  3CCR A;  1D0X A;  2J06 A;  4Y28 E;  1LCK A;  3CMA Q;  3QZ5 B;  4IKF A;  2DXC A;  1PSE A;  4AFS C;  4PJO B;  3DB3 A;  2M16 A;  1U5S A;  1UEC A;  2EQI A;  1VQL T;  1M90 C;  3M0Q A;  2KBT A;  2QAS A;  4M4Z A;  1OI1 A;  5EC7 A;  1VQ8 A;  2CH4 W;  1TG0 A;  3I55 T;  3VYG A;  4HT8 A;  1YIT T;  3L2W A;  1VQN T;  5GMK h;  1HSQ A;  4C8Q F;  2L2P A;  2JS0 A;  4MZM A;  3NTK A;  1D09 B;  1GBQ A;  5ECA A;  5A2Q E;  3CCQ T;  5GAM g;  4BE1 A;  2I2L A;  4J6W A;  4F16 A;  5GAO r;  1KJW A;  3ZBD A;  3PVQ A;  1D0Y A;  1WHL A;  2F69 A;  1MMG A;  3OY9 A;  3OS5 A;  1UDL A;  1MNE A;  1YHQ A;  5FRM A;  5GAN 7;  5GAN 8;  2F5T X;  2MWO A;  1YJ9 Q;  4PLI A;  3QG1 A;  1F1B B;  3S3N A;  1Q86 U;  4ZNX A;  1D3B A;  1WXU A;  2C0O A;  3CCR Q;  3L2V A;  5L23 A;  2A3L A;  4C0F A;  2ATC B;  2R58 A;  3EG2 A;  2DAQ A;  3LYI A;  3QO3 A;  4OP0 A;  4RKU E;  3VV0 A;  4A4H A;  8ATC B;  1KC8 R;  3GBQ A;  2CZ6 B;  4M7D F;  5DLQ E;  3MEV A;  4DBR A;  2E64 A;  3EGU A;  4C5G A;  2PZ1 A;  5GAN d;  4JUV A;  2J6K A;  1WHG A;  1UGR B;  1S72 T;  2DD4 A;  1ZA1 B;  3M56 A;  4FT2 A;  3JCM d;  3OYC A;  1VIE A;  2NUP A;  3UF4 A;  1VQ5 Q;  3CPW A;  4LN2 A;  4C92 C;  3I56 Q;  1YI2 Q;  2HL3 A;  1HXD A;  1SPK A;  3OQ5 A;  2FPD A;  2YDL A;  2DJZ A;  2LJ3 A;  4C8Q B;  3JB9 D;  3CCV T;  4ZGD B;  1QWF A;  4M78 C;  1BIB A;  2PTK A;  2DL8 A;  2PVO B;  4BUG A;  1QVF S;  5KYN A;  3PGG A;  2HKQ B;  4FW2 A;  4JLI A;  9ATC B;  3S6W A;  1YNZ A;  1K8A U;  1X75 C;  1RUW A;  2YUN A;  2MAM A;  3LGL A;  1WIE A;  2YUQ A;  1YIT A;  2CSI A;  2QGG A;  3REB B;  3QYH B;  4PJN A;  2OTL Q;  4M7A C;  1PKS A;  1TUG B;  2OTJ A;  1O75 A;  1QLY A;  4OB2 B;  1Q7Y R;  3V8K A;  3UT1 A;  4IUU A;  1M8V A;  3VKI A;  2QXF A;  3G6E T;  1VYV A;  4ELZ C;  5LJ5 e;  1VQ6 Q;  1ZHI A;  4PL6 A;  3CBO A;  3CME Q;  4DEY A;  4JZ4 A;  2HMA A;  2EGC A;  5D6Y A;  3VRY A;  3L2Z A;  4OVA A;  2VGN A;  3JCM b;  3OSS C;  2KRS A;  1GXI E;  2E5K A;  3CCE T;  3CME A;  2NUP B;  5DLO A;  4M77 E;  3CCS T;  4JS4 A;  5LJ3 e;  3ASK A;  1M4Z A;  2C06 A;  3OYM A;  2HBP A;  1ZBX A;  3JCM c;  2QA4 A;  5LJ5 d;  3RIR A;  4LDW A;  4PNO A;  4M77 C;  3D7S B;  2PVG B;  3G4S Q;  3TRE A;  3EGD B;  1AVZ C;  4RTY A;  1QVG S;  4YTL A;  1IZ6 A;  4BDY A;  1MV3 A;  4E47 A;  1EIF A;  1G3Y A;  2R57 A;  1PSF A;  2JZ2 A;  4Q5W A;  3BDU A;  1BBZ A;  1BCO A;  5AYF A;  4ANJ A;  4D8D A;  2DZC A;  5CKF A;  1XQH A;  3CCS A;  4PJL A;  5GAN 4;  4XK8 E;  2BTT A;  2AT1 B;  3TSZ A;  3HHT B;  3I5S A;  4J9D A;  1VQ9 Q;  1YI2 A;  2DF6 A;  1YCS B;  1YN8 A;  2RNA A;  4MML A;  2IIM A;  5FLX E;  4C0D C;  3GOX A;  2CP7 A;  3CCQ A;  5CK9 A;  4ATO A;  3EG0 A;  1YJW T;  2CKK A;  4NL2 A;  3DKM A;  4F7U B;  3CCE Q;  1VUB A;  2JTM A;  5GMK l;  3L2R A;  1HJD A;  1S1N A;  2KXC A;  1D1A A;  1NG2 A;  4FIB A;  2XIC A;  3ZFJ A;  4Z8A A;  3QWX X;  3OS0 A;  1IO6 A;  1SSF A;  4DBH A;  3O5Z A;  1CSK A;  1RAC B;  1H64 1;  2ZAE A;  4ESR A;  1VQ4 Q;  3QSU A;  2CP3 A;  3EHQ A;  2VVK A;  3CCL T;  2KRM A;  1Q86 C;  2COW A;  3WVD B;  1WFW A;  1XNI A;  1NYG A;  1X43 A;  2E12 A;  3QBY A;  2MPX C;  2KXD A;  2J6O A;  3G71 T;  4HCB A;  3EFO A;  2OAW A;  2A7Y A;  3JB9 J;  4Z88 A;  4DBF A;  2WSF E;  4AFQ C;  1ZX6 A;  4J9G A;  3HPW A;  3BY7 A;  5CAI A;  1EFN A;  4N4H A;  4XTZ A;  1VQK Q;  1YJN T;  1VQ7 T;  4J9E A;  4JDS A;  2DTO A;  1RAG B;  2RI2 A;  3VS2 A;  2IVW A;  2DRK A;  4HCZ A;  2D8H A;  1G83 A;  1K9M R;  2CZ1 B;  1WHH A;  1WXB A;  3NMZ C;  5FU7 C;  2DVJ A;  3M54 A;  1Q7Y U;  4QQG A;  4NOY A;  4A4K A;  4AT1 B;  1TSF A;  3QKJ A;  1GCP A;  2HL5 C;  4A63 B;  3EG3 A;  2LCL A;  2L5Q A;  4HA8 A;  4E7K A;  1T3S A;  4EIK A;  2EYW A;  2DLP A;  5KE3 A;  1Q81 R;  4Y92 A;  3PT9 A;  2JXB A;  1VQK A;  3JAM E;  2X35 A;  4C92 B;  1KQ1 A;  4ZGE B;  4M77 B;  5KYU B;  4A4F A;  2BIV A;  1Q82 U;  1MUZ A;  1YIT Q;  2VXF A;  2RJD A;  8AT1 B;  3OS1 A;  1QP3 A;  4OMF B;  3WVE B;  1QVF A;  4J9F A;  5CKE A;  4JJC A;  2LX9 A;  2D0N A;  3EH1 A;  1M9S A;  3UA6 A;  1AOJ A;  2MI6 A;  4KBM B;  3PE0 A;  3FEO A;  2XHC A;  3DLM A;  1ZUY A;  5HCK A;  3THK A;  3V7C A;  4XQ3 A;  1T0H A;  1U1T A;  2RHZ A;  1LOJ A;  4BY6 B;  4DOV A;  1ZSZ B;  1D3B B;  3M0S A;  2X4W A;  1KFZ A;  2RJF A;  3CC2 Q;  1QVG P;  1HD3 A;  2MMP A;  5LJ3 g;  4M7A E;  1Y96 B;  1AZE A;  5J26 A;  4PJJ A;  4N4G A;  1TU0 B;  2A0F B;  2LQ8 A;  3JCM X;  2KAF A;  1U1S A;  4FCY A;  1G5V A;  4CRI A;  1YJ9 A;  1AWO A;  2RJC A;  4C8Q D;  3V8L A;  4RTX A;  1K9A A;  1WNL A;  2L3S A;  2L89 A;  3EGX A;  1I5L A;  2NLU A;  1BI0 A;  3LGF A;  4J9I A;  2NUT B;  1UHF A;  1Y96 A;  2FYK A;  1YJW Q;  1K0X A;  4JRQ A;  1TXQ A;  3PNW C;  4RTU A;  2CSQ A;  4BY6 C;  3CC7 Q;  4J83 A;  2SEM A;  3BW1 A;  1SRM A;  4FSX A;  3QJ6 A;  5CKB A;  2RHY A;  4PFP A;  2HDA A;  1AEY A;  1Z9Q A;  1K8A R;  2WSC E;  2KNB B;  3EFS A;  2EKO A;  5GAM e;  2DL3 A;  2E3I A;  1G3W A;  2K7A A;  4M7A B;  4BDZ A;  2CZ0 B;  2QA4 T;  1BU1 A;  2FPE A;  4JRP A;  1ZQ1 A;  3HL8 A;  4F7U A;  3HRS A;  5KYY A;  1QQJ A;  1K4U S;  3OBY A;  2LC4 A;  2GBQ A;  3AHU A;  2KT8 A; 
#chains in the Genus database with same CATH homology
 3JCM e;  3S3N A;  3CMA A;  2BKD N;  5D6X A;  2Y4Y A;  1Q86 U;  4LDU A;  1D3B A;  5LJ5 f;  5GAO p;  4C92 A;  4M75 A;  3L2V A;  3I56 T;  3OBW A;  1Q82 C;  1IRE B;  5A0D A;  5I2S A;  2A3L A;  4C0F A;  2MWP A;  2FVU A;  1QW1 A;  4MZT A;  2K57 A;  2E65 A;  2R58 A;  3G71 A;  2QEX A;  2EJG A;  2RH2 A;  5GAN h;  1JBM A;  4X34 A;  1BI3 A;  4OGC A;  3N5B B;  3QXE B;  1X01 A;  2DAQ A;  2DKG A;  3LYI A;  2K3X A;  3M57 A;  3QO3 A;  4N0A A;  5LL6 S;  3CC2 A;  2EQM A;  4OP0 A;  4RKU E;  3VV0 A;  4A4H A;  3CMA T;  2JVV A;  2CZ6 B;  4RCC A;  4M7D F;  1VQP T;  5DLQ E;  1FX7 A;  3FLG A;  3M55 A;  2E64 A;  3MEV A;  4C5G A;  4QVC A;  2EQU A;  2RK1 A;  1Y07 A;  4UC4 A;  5GAN d;  4JUV A;  1NZ9 A;  5CR2 A;  1UGR B;  2ZPH B;  3V7S A;  1S72 T;  2DD4 A;  2VUB A;  1YCY A;  4FT2 A;  3M56 A;  4M78 F;  3S3O A;  4LD9 K;  3JCM d;  3OYC A;  1VIE A;  4XU1 A;  2OTL T;  3CPW A;  3MCA B;  4M7A A;  4M7D B;  3GF5 A;  4C92 C;  5CQX A;  3NFC A;  3UWN A;  4A54 A;  1HXD A;  3P8D A;  3QUI A;  3OQ5 A;  4ME7 A;  4F7U G;  2YLB A;  4L59 A;  1VQK T;  4LDX A;  2DJZ A;  5I2M A;  5LJ3 h;  4B9W A;  4M77 F;  4C8Q B;  4J5Y A;  2XDD A;  3JB9 D;  4P5N A;  3OYI A;  3UDC A;  3JCM h;  3H6Z A;  4ZGD B;  3CCV T;  1M1G A;  4M75 B;  5CQY A;  2O01 E;  4M78 C;  5GAN 6;  4ZN3 A;  1KC8 C;  1BIB A;  3NTI A;  2PVO B;  3OA6 A;  2E1H A;  4BUG A;  1QVF S;  3M9Q A;  2EFI A;  2CZ7 B;  3PGG A;  4JLI A;  1WJR A;  3S6W A;  2HNI A;  2KK4 A;  2PQW A;  1Q7Y C;  5GAN e;  1I8F A;  4M78 G;  1K8A U;  1X75 C;  3A8L B;  2K3Y A;  3HKS A;  2OAU A;  4M78 A;  4M77 G;  5KCO A;  1W2B S;  5GAM f;  4EDU A;  3CD6 T;  1M90 U;  4F7U F;  2MAM A;  4X9D A;  3LGL A;  2XD0 A;  5KCH A;  3OYA A;  4IUQ A;  1P92 A;  1YIT A;  2FB7 A;  2LVM A;  4QQD A;  5C0M A;  4FM4 B;  4XAX B;  1JJ2 A;  3H8Z A;  3QYH B;  2KSS A;  3C12 A;  2RJE A;  2EYQ A;  4M7A C;  1OZ2 A;  2EAY A;  4Z02 A;  3LWI A;  1YBY A;  2OTJ A;  1I81 A;  2V8K A;  1S72 A;  1O75 A;  2RK2 A;  2QQB A;  3OYE A;  4C0G A;  3VJP A;  4OB2 B;  3X20 B;  2PVD B;  2VGM A;  2XU8 A;  4MMK A;  3V8K A;  3UT1 A;  1YJN A;  1VQ7 A;  4EMH A;  3C94 A;  3OMG A;  4IUU A;  1M8V A;  2P0K A;  4LDV A;  4N0A C;  2L8D A;  1M1F A;  2ZPE B;  5GAM h;  4BB7 A;  1W2B A;  1M1K C;  5GAO m;  5L8R E;  3VKI A;  2QXF A;  3G6E T;  1VQO A;  1FWZ A;  2P0Q A;  1KD1 U;  3M58 A;  4C0Z A;  4ELZ C;  5A0G A;  5LJ5 e;  1ZHI A;  4PL6 A;  3CBO A;  2XI9 A;  4OB1 B;  1VQM A;  5M9O A;  3FC3 A;  1Q81 U;  3MP6 A;  3INZ A;  4M75 C;  2DK3 A;  4XTU A;  5D6Y A;  3CBM A;  5KE2 A;  3L2Z A;  3V8J A;  2B8A A;  3MEA A;  4L5G A;  3OW2 A;  2PU9 B;  1KQS S;  1BI1 A;  5FRO A;  3GNF B;  4OVA A;  4A53 A;  3I55 A;  2VGN A;  3JCM b;  1BIA A;  1Q81 C;  3OSS C;  2K5F A;  4QVZ A;  2RI3 A;  4FL6 A;  3SWN B;  4M7A G;  4M7A F;  3OYK A;  1GXI E;  3OYF A;  3E9F A;  4XTY A;  1QP2 A;  1KHI A;  3QPH A;  3CME A;  2E70 A;  3CCE T;  4J6X A;  2LQK A;  1KQ2 A;  3EAE A;  3OW2 S;  3FDR A;  3FB9 A;  5GMK e;  2VXE A;  2V8I A;  4O5V A;  4M77 E;  1N27 A;  4PJO G;  5DLO A;  3OYH A;  3CCS T;  3VUZ A;  2VC8 A;  4JS4 A;  2JTF A;  2VV5 A;  5LJ3 e;  2P0P A;  4M7D G;  2VYT A;  5J39 A;  2QQS A;  2H3J A;  3ASK A;  1M4Z A;  2D0Q B;  2C06 A;  2KY9 A;  1Y71 A;  3OYM A;  2HBP A;  2HQE A;  1WJQ A;  3JCM J;  2QQA A;  5CKD A;  4JJN K;  1ZBX A;  3BFM A;  1R8O B;  3F70 A;  3JCM c;  2QA4 A;  1N8R U;  5LJ5 d;  3TU4 K;  3RIR A;  4LDW A;  3HRT A;  3OSV A;  4PNO A;  2FHD A;  5GAN 3;  1KQS A;  2D9T A;  3QZ9 B;  1JJ2 S;  3TCJ A;  3MEW A;  4QW2 A;  4XU0 A;  4E7I A;  4M77 C;  3CCR T;  3CC7 T;  3C95 A;  4LDY A;  4PJO D;  4F7U E;  2PVG B;  4QVD A;  3TRE A;  4EPC A;  1WPY A;  4PJO F;  3ER0 A;  3OYB A;  3J7A F;  1VQM T;  3M5A A;  1QVG S;  3G4S A;  4YTL A;  3WXM B;  2XDP A;  3PIP A;  3GPL A;  5FU7 B;  1IZ6 A;  3A8M B;  4KUL A;  2XKO C;  1I4K 1;  4BI8 B;  2KVQ G;  2GFU A;  2JN0 A;  4E47 A;  2DO3 A;  4RG2 A;  5A0L A;  4BDY A;  2IG0 A;  1MGQ A;  1EIF A;  4J6Y A;  1G3Y A;  2GF7 A;  3PMI A;  4C92 E;  2R57 A;  1PSF A;  2JZ2 A;  3KUF A;  4Q5W A;  3LH0 A;  5CVI A;  2EQJ A;  3JCM g;  1Y7X A;  4ELY C;  3MET A;  4GLK A;  3BDU A;  1K73 U;  3QYG B;  5AYF A;  1VQ9 T;  2DZC A;  5CKF A;  1XQH A;  1B34 A;  4C92 G;  3MHX A;  3CCS A;  1VQP A;  5FU6 C;  1M5Q 1;  1WQW A;  5GAN 4;  3SDZ A;  1VQ8 T;  4XK8 E;  2ZZD A;  5GAO q;  4MZP A;  5CCA A;  3MO8 A;  3HHT B;  3PTA A;  4L6V 5;  5GAO n;  3JB9 I;  3C4S A;  1YI2 A;  2V8J A;  3QDR B;  5HK3 A;  2JUF A;  4MML A;  2DVE A;  5GAN f;  4XU2 A;  2R5M A;  5FLX E;  3GLX A;  4C0D C;  1O9S A;  4IUV A;  2E5Q A;  4XU3 A;  4C8Q G;  3GOX A;  3CXC A;  2RD1 A;  3CCQ A;  2F5K A;  4XTX A;  2DPP B;  3LWH A;  4E7J A;  2DEQ A;  4OB3 B;  3KXT A;  5CK9 A;  2DTI A;  4ATO A;  1YJW T;  3E9G A;  2CKK A;  3T9N A;  4EMK A;  4KUI A;  3DKM A;  4NL2 A;  4F7U B;  3RKY A;  1VUB A;  2JTM A;  5GMK l;  2XK0 A;  3L2R A;  4IUR A;  2ZPG B;  1BYM A;  1B34 B;  5LJ3 f;  2E41 A;  4FIB A;  3X26 B;  3CBP A;  1VQ6 A;  2XIC A;  1G3S A;  3SB2 A;  3ZFJ A;  4M75 F;  3OS0 A;  2D6F A;  1SSF A;  3J81 E;  1RI0 A;  3CC4 T;  3M59 A;  3M53 A;  1H64 1;  3L1A A;  4A4E A;  3QSU A;  3CCL T;  4EMK B;  1VQ5 T;  1XOV A;  4C8Q E;  1Q86 C;  3WVD B;  4C92 D;  2DXT A;  4ZGJ B;  1HK9 A;  1XNI A;  4WF2 A;  3CCJ T;  4PJO A;  2E12 A;  3VUB A;  4XTW A;  3QBY A;  2OTL A;  4J8O A;  4C8Q C;  1YHQ T;  2KMT A;  1N6A A;  3LW5 E;  3RMS A;  3GNG A;  3SWN C;  3JSC A;  3TEE A;  5GAO l;  3E1S A;  4OGE A;  3HP9 A;  2CYZ B;  5GAN 2;  2JNG A;  2EQK A;  2E6Z A;  3G71 T;  4PJO E;  4HCB A;  2RA2 A;  2ZGW A;  2QQ9 A;  2GFA A;  4ZN1 A;  5LJ5 j;  3A5Z B;  2A7Y A;  2QI2 A;  3A8O B;  3RKW A;  4BAC A;  3CME T;  3JB9 J;  1KHC A;  1N8R C;  1U8R A;  2KDS A;  2WAC A;  4C5H A;  3CCU T;  5CO7 A;  3J80 E;  2WSF E;  3CCM A;  4C92 F;  2O4X A;  3OYY A;  2EWN A;  1NPP A;  3HPW A;  2DXB A;  1K73 C;  3BY7 A;  4R56 A;  5CAI A;  4N4H A;  3SD4 A;  4XTZ A;  3E19 A;  1YJN T;  1VQ7 T;  2Y90 A;  1UB4 A;  5HK0 A;  2ZPB B;  1VQ4 A;  1JB0 E;  3P8B B;  2DXU A;  2M0O A;  2DTO A;  4JDS A;  5GAN 5;  2RI2 A;  1VQN A;  4JS5 A;  2IVW A;  3Q1J A;  4RCB A;  2FL7 A;  3CEY A;  3NTH A;  3CCU A;  4CI0 C;  4HCZ A;  3OYJ A;  3CC4 A;  3EFR A;  2K4Y A;  2L3R A;  3L42 A;  3VU3 C;  2CZ1 B;  1G3T A;  4X9C A;  3VYH B;  3OYD A;  1VQ5 A;  4FU6 A;  5CKH A;  4Y91 A;  1QVG A;  1NJI U;  3CCE A;  5CIU A;  4DQ2 A;  2DTH A;  3I56 A;  3CCJ A;  2MF2 A;  4C8Q A;  4B9X A;  4DOW A;  3RKX A;  3A8H B;  2M9U A;  4LD6 A;  4M75 D;  5EG2 A;  4PJO C;  5C6S A;  2M1H A;  5FU7 C;  3M54 A;  4M78 D;  1KD1 C;  4OB0 B;  1JRI A;  1Q7Y U;  4QQG A;  1XTD A;  4M7D A;  3GP8 A;  1AHJ B;  4EMG A;  2RHX A;  1UGP B;  3KBG A;  4NOY A;  4A4K A;  2LDM A;  3QKJ A;  4M7D D;  5IT9 E;  5I21 A;  4BE2 A;  3QII A;  3RMQ A;  4GY5 A;  3X28 B;  4QQ6 A;  1N9R A;  4E7H A;  1WQ7 A;  2K5L A;  4M7D C;  2LNV A;  1H3Z A;  1N9S A;  2E6N A;  2ZPF B;  2LCL A;  2PUK B;  1YIJ A;  2L5Q A;  4HA8 A;  3JB9 G;  1QVP A;  4E7K A;  4BI3 A;  4O6J A;  1UEB A;  3O8V A;  3R6O A;  4NL3 A;  4EMK C;  5KE3 A;  2RB6 A;  1WGS A;  2JOY A;  4HT9 A;  1VIF A;  5D6W A;  4C5I A;  3OYL A;  3PT9 A;  4E7L A;  3MP8 A;  2LTO A;  1VQL A;  3UPU A;  2R5A A;  1UGS B;  4RG8 A;  1NE8 A;  1VQK A;  2QQR A;  3JCM V;  3JAM E;  2LCC A;  2X35 A;  4DA4 A;  1YI2 T;  4M7A D;  4C92 B;  4J7I A;  1KQ1 A;  2RI5 A;  2Y4X A;  4ZGE B;  5IAY A;  5GAN j;  1TH7 A;  2HQX A;  1YIJ T;  3HRU A;  3CCL A;  4M77 B;  4PLL A;  2DZ9 A;  4A4F A;  2BIV A;  2KQW A;  2LRQ A;  1Q82 U;  3HFO A;  1RL2 A;  4JRK A;  3JCM Q;  3OMC A;  1BKB A;  4XTV A;  2VXF A;  2RJD A;  3OS1 A;  2K2V A;  4PKC C;  1NJI C;  3HSB A;  1LNX A;  3DB4 A;  4NS5 A;  2EJ9 A;  2XID A;  1QP3 A;  1K9M U;  4OMF B;  2BUD A;  3BDL A;  3WVE B;  2XG8 D;  1MHN A;  4BD3 A;  1QVF A;  3JB9 H;  2RHU A;  4KT0 E;  4OF1 A;  3QHS A;  5CKE A;  4M77 D;  1OZ3 A;  4BI4 A;  3OYN A;  4IUP A;  4N4I A;  1V29 B;  4IUT A;  4JLG A;  4C5E A;  4MDX A;  2CS7 A;  2X4Y A;  5LJ3 j;  3CC7 A;  2LX9 A;  3SWN A;  3CXC S;  3LX7 A;  3RUX A;  2G3R A;  3RER A;  1M9S A;  3QJY A;  4KUD K;  2OTJ T;  2MI6 A;  5LJ5 g;  4KBM B;  4A4G A;  5GAN g;  1NPR A;  3G4S T;  3FEO A;  4RMO A;  3GIB A;  1FXX A;  2XHC A;  2DD5 A;  3DLM A;  1YJW A;  1K9M C;  3ZEH A;  2QTX A;  1VQ4 T;  2AHJ B;  4M78 B;  3HFN A;  3P8H A;  3RES A;  5IN1 A;  3CC2 T;  3V7C A;  5GMK m;  4XQ3 A;  3CD6 A;  1U1T A;  2RHZ A;  3OB9 A;  5GAM d;  1LOJ A;  1WJS A;  2ZCF B;  4HKE A;  4BY6 B;  4DOV A;  4HCC A;  3JCM f;  3JCM W;  3CPW S;  5HY6 A;  2GCX A;  3URG A;  1D3B B;  3G6E A;  1VQO T;  2EIF A;  2X4W A;  1OYX A;  2GQV A;  1KG1 A;  2RJF A;  2LT4 A;  2RO0 A;  3OS2 A;  5DY9 A;  4MDW A;  4D6W A;  3DLL A;  2X4J A;  3A8G B;  1VQ6 T;  2MMP A;  3MEU A;  5LJ3 g;  4M7A E;  1Y96 B;  2YHT A;  4ZTJ A;  1M1K U;  3LLR A;  2YRV A;  5J26 A;  3FIF A;  4N4G A;  4J7F A;  3L2Q A;  1UGQ B;  3CCV A;  3MP1 A;  3X25 B;  3JB9 F;  4PLI A;  2LQ8 A;  3JCM X;  3CCR A;  2HD0 A;  2X4X A;  4Y28 E;  2KAF A;  1U1S A;  3QZ5 B;  4IKF A;  1G5V A;  2DXC A;  1PSE A;  2RM4 A;  5HKC A;  3M4Y A;  4CRI A;  4PJO B;  1YJ9 A;  2DIQ A;  3PMT A;  3DB3 A;  5GAM j;  1BI2 A;  4V2S A;  2M16 A;  2RJC A;  2DIG A;  4C8Q D;  5LJ3 d;  3V8L A;  4C0D B;  1VQL T;  3ME9 A;  4M7D E;  3X24 B;  1M90 C;  4M75 G;  5GMK j;  3SFM A;  1OI1 A;  5LJ5 h;  2YLC A;  2O4X B;  1VQ8 A;  2QDY B;  3FRN A;  1WNL A;  3JRZ A;  3I55 T;  4M78 E;  2L89 A;  3VYG A;  4HT8 A;  1YIT T;  1I5L A;  4M75 E;  1VQ9 A;  2WSE E;  3L2W A;  2EJF A;  1YJ9 T;  2NLU A;  4JRI A;  4BE0 A;  1BI0 A;  3LGF A;  2K5I A;  2FYK A;  1Y96 A;  1VQN T;  5GMK h;  3PIO A;  1K8A C;  4C8Q F;  4JRQ A;  1DJ7 B;  3PNW C;  3L2U A;  3FJP A;  5DM7 R;  4BY6 C;  4J83 A;  3BW1 A;  3G7Z A;  3PFS A;  3M4G A;  4FSX A;  3NTK A;  2RHI A;  3QJ6 A;  4FT4 A;  4M77 A;  4MZM A;  2RHY A;  5CKB A;  5J3B A;  1KC8 U;  2HAX A;  5A2Q E;  3CCQ T;  2WSC E;  5GAM g;  4BE1 A;  2I2L A;  4J6W A;  5GAO r;  5FU6 B;  3EFS A;  2EKO A;  3ZBD A;  4ZTF A;  5GAM e;  1LJO A;  2LT1 A;  2ZPI B;  2F69 A;  2XDB A;  3CCM T;  1G3W A;  2E10 A;  4M7A B;  4VUB A;  3CPF A;  4BDZ A;  1X6O A;  2CZ0 B;  3OY9 A;  2QA4 T;  3OS5 A;  4JRP A;  5GMK i;  1ZQ1 A;  3HL8 A;  1YHQ A;  4F7U A;  5FRM A;  3HRS A;  5GAN 7;  3JCM P;  5GAN 8;  1W4S A;  4II1 A;  2F5T X;  4TVR A;  2CGH A;  3OBY A;  2QEX T;  2LC4 A;  5FRN A;  2MWO A;  3V7R A;  3S3M A;  3OYG A;  5KH6 A;  3AHU A;  2PUO B;  2P4T A;  4R55 A;  3QG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...