4CRIA

Crystal structure of 53bp1 tandem tudor domains in complex with methylated k810 rb peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine Methylation-Dependent Binding of 53BP1 to the Prb Tumor Suppressor.
pubmed doi rcsb
molecule keywords TUMOR SUPPRESSOR P53-BINDING PROTEIN 1
molecule tags Peptide binding protein
source organism Homo sapiens
total genus 28
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4criA01
3OS2A 3CCRA 3CCSA 2XHCA 3OYIA 5LL6S 2K3XA 2BIVA 2GFAA 5CIUA 3MEAA 4E7IA 3PMTA 5FRMA 3FDRA 5D6YA 2OTJT 3CPWA 4ZTJA 3CEYA 1NZ9A 4NS5A 3J81E 3J80E 3CC4A 3LLRA 3PIOA 2JNGA 5C6SA 1JJ2A 3QBYA 3OS0A 4RG2A 3CCJA 3OQ5A 1G5VA 1Q81C 1YHQA 3MP8A 4IKFA 4BACA 2X4XA 2RJEA 1YITA 4C5GA 3CMAT 4YTLA 4PL6A 3PMIA 3L42A 3CPWS 2RHIA 1QVGA 1VQLT 4IUPA 2M16A 1OYXA 3OW2A 3OYCA 4E7HA 4QQGA 3OS1A 1X6OA 1WGSA 3CCLA 1JJ2S 3G71A 3OYGA 3OMCA 3A5ZB 3OA6A 1OZ2A 3KBGA 3ASKA 4IUTA 1KC8U 4BE1A 3META 4N4IA 5J39A 4C5HA 3PIPA 1VQ7T 4FL6A 4Z02A 1QVGS 2E6NA 4L59A 2F5KA 3MO8A 2DO3A 2DIQA 3OW2S 1MHNA 1YHQT 4A4HA 3LGLA 2QEXA 1M1GA 1XTDA 1YITT 1W2BA 2MWOA 3G6ET 1VQKT 2LDMA 1KD1C 2RHZA 2RI2A 3CMAA 3OYMA 5KH6A 5IAYA 3BDLA 3O8VA 4N4HA 3OB9A 1VQOT 4QW2A 1KQSA 3H6ZA 3CCVT 1KC8C 5D6XA 1RI0A 2LRQA 3DLLA 1N27A 3FEOA 2BUDA 2O4XA 3OYBA 1W2BS 2LVMA 4QQDA 1WJSA 4PLLA 3MP6A 1K8AU 3E9FA 1BKBA 1Q7YU 2L89A 1M90U 4A4GA 2VYTA 4ZN3A 4BDYA 3EAEA 3CXCA 3DB3A 3CC2T 3MEUA 5D6WA 1VQ7A 1N8RU 2QEXT 2DIGA 1KQSS 1K73U 2KDSA 2K3YA 1VQ6T 4EDUA 3OYFA 3HKSA 2GF7A 3LYIA 3M9QA 3OYNA 1YJWT 2QA4A 2L8DA 4FU6A 3G6EA 4A4FA 3OYEA 1VQKA 3I55A 3CXCS 3NTKA 2JTFA 2RJFA 1M1KU 3DB4A 2G3RA 1IZ6A 2YRVA 1K8AC 1VQOA 1Q7YC 1M90C 3CCVA 1Q86U 2EQUA 4A4EA 2E6ZA 5KCHA 4N4GA 4X34A 1N8RC 3L2WA 3CC7A 1K73C 1UEBA 4E7KA 1VQ5T 2GFUA 2PQWA 2E5QA 3CD6T 1K9MU 4E7JA 3CC2A 4BDZA 2EIFA 4E7LA 3LH0A 3H8ZA 2RI3A 2RHXA 5KE3A 1VQNA 3S3OA 1NJIU 4Q5WA 2QA4T 2CKKA 2LCLA 1VQ6A 3ZEHA 2QQSA 3F70A 1M1KC 2E70A 3OYJA 3GOXA 3I55T 3UWNA 4ZN1A 3KUFA 1YJWA 2RJDA 3DLMA 3TREA 5IN1A 3L2UA 1OZ3A 4C5IA 3CMET 4II1A 2OTLT 1Q86C 2HQEA 4IUQA 3E9GA 2RHYA 2FHDA 3L2VA 2WACA 1Q82U 2EQKA 3ER0A 1VQMA 5A2QE 2LCCA 2RI5A 4B9XA 5C0MA 1YJ9T 3UT1A 3CCQT 3CC7T 3ME9A 2XK0A 2L3RA 2JZ2A 3MP1A 1K9MC 2MWPA 3PNWC 1NJIC 1KHIA 1NPRA 1VQ5A 1VQNT 2EQMA 2X35A 3MEVA 2EKOA 2BKDN 2LQ8A 4OVAA 3CD6A 2R5AA 4BE0A 3C4SA 2M0OA 2JVVA 3J7AF 5KCOA 3OYDA 3G4ST 2XDPA 1YIJA 3S3NA 3FLGA 1S72T 5HY6A 1QVFA 3S6WA 4GY5A 5FRNA 4HCZA 3SD4A 3LX7A 1Q82C 3L2QA 1VQ4T 3QJ6A 2R58A 3OYLA 1YBYA 1YI2T 3OYHA 3CMEA 3OYYA 1VQ8T 1VQMT 2OTLA 2MI6A 2RJCA 3CCET 2RO0A 3OMGA 2JOYA 5J26A 4BD3A 4CRIA 2X4YA 1VQPA 3CCMT 4BE2A 2NLUA 4QQ6A 1QVFS 3I56T 1WJQA 2RHUA 5M9OA 2EFIA 3OYKA 1YJ9A 2KVQG 3CCQA 4UC4A 3CCRT 3CCST 1RL2A 1KD1U 1VQ9A 1OI1A 2P0KA 2EQJA 1YJNA 1XNIA 3CCUA 3OYAA 4C5EA 4QVZA 4TVRA 3FC3A 1YIJT 2X4WA 3OY9A 2LTOA 1WJRA 3CC4T 3CPFA 2O4XB 3S3MA 5KE2A 3G4SA 3LGFA 2OTJA 1KHCA 3P8DA 4B9WA 1S72A 5FROA 3CCJT 3PFSA 5FLXE 3JAME 1EIFA 2QQRA 4ZTFA 3Q1JA 3QKJA 2HQXA 1VQ4A 5DM7R 3P8BB 4IUVA 2B8AA 2D9TA 1VQPT 3MEWA 1YI2A 2JUFA 1VQ8A 2IG0A 4IUUA 5IT9E 1SSFA 1H3ZA 1Q81U 3CCEA 5DLQE 4LD6A 3QIIA 4IURA 1NPPA 1VQ9T 3CCMA 3CCLT 2R5MA 3NTIA 4PLIA 1YJNT 3G71T 3NTHA 5J3BA 1VQLA 3CCUT 2R57A 3I56A 3L2RA 2M1HA 2DAQA 3P8HA
chains in the Genus database with same CATH superfamily
3RR6A 1M3CA 3CCRA 3LWHA 4XTXA 2XHCA 2XICA 3OYIA 6AT1B 2ED1A 4X9DA 2BIVA 2NUPA 4M7DB 1Y96A 1PKSA 2LJ0A 3PMTA 5FRMA 5D6YA 3M57A 5GANj 4ZTJA 3CEYA 4J9GA 1Q82R 3J80E 3LLRA 1WDXA 2HAXA 2RF0A 4O6JA 2JNGA 1F1BB 4F7UE 1JJ2A 4FYVB 5CVIA 2HSEB 4X9CA 2B86A 4RG2A 1Q81C 1C0MA 4RTUA 2D6FA 3EG2A 5GAN6 4BACA 2X4XA 5CKEA 4F7UB 1AEYA 2YXYA 4JJDA 3JCMh 4XU2A 3CPWS 2RHIA 1QVGA 5LJ5d 3WXMB 2FPDA 1OYXA 1HXDA 2LZ6B 1IGUA 4E7HA 4QQGA 1X6OA 1B3QA 2CSQA 2DVJA 2PU9B 2DL5A 2PVOB 3A8HB 5GAOm 3QWYA 3OA6A 2O9VA 1OZ2A 4LUDA 2CP2A 2MIOA 3INZA 4OGEA 3EFOA 4IUTA 4BE1A 1U8RA 4N4IA 3V7SA 2FRYA 4ZGEB 3CCLQ 3JB9H 4ORZA 3JCMb 4Z02A 1M27C 2KEAA 2RK2A 1YN8A 3X24B 2F5KA 4FIBA 3JCMW 3M53A 2EYZA 2MK5A 3V8JA 3FJ5A 2P4TA 4MZPA 1R0BG 3LGLA 1LJOA 2H8HA 2X4JA 3QZ5B 1OOTA 1KD1R 1EFNA 2DE0X 1M3BA 4QKUA 1VQKT 2I2LA 4M78A 2LDMA 4JRQA 1KD1C 1GL5A 1U3OA 2RK1A 5GAMh 4XTUA 3OYMA 1X75C 1QCFA 4DBQA 5KH6A 3BDLA 4N4HA 3EGDA 2ROTA 3BW1A 2VC8A 3CCVT 3X28B 1PRMC 2EW3A 1MV3A 1FWZA 1N27A 1W2BS 3L2ZA 2QASA 2CYZB 2ZPEB 4QQDA 4OMLA 2ZZDA 4QVDA 2XU8A 3MP6A 1BB9A 3E9FA 3OBYA 3MPUB 3QYGB 2JMCA 3EAEA 3N5BB 3VS0A 3DB3A 1D3BA 2DEQA 1MNEA 2RQUA 1UG1A 2Y4XA 1WXBA 1N8RU 2QEXT 3R6NA 1KQSS 4F16A 3EGXB 5CCAA 2AKLA 3GIBA 3HKSA 2GF7A 4C0GA 4RTVA 3SEMA 4JLIA 4XQ3A 2KRNA 2RB6A 1AOJA 3GBQA 2KGTA 3CXCP 1AWXA 3OYEA 4A4FA 1QCNA 4J6YA 1VQKA 3RESA 5KYXA 1TWBA 3NTKA 2HSPA 1JEGA 2JTFA 3HTRA 2ZPBB 4RTXA 3H0FA 4RTZA 3R6OA 4OMPA 5GAOn 3V8LA 5FU7C 4MMKA 2QA4Q 5D7UA 3VUZA 1K8AC 1Q7YC 1M90C 3JRZA 1BBZA 2ZAEA 3CCVA 1M2VB 5CKDA 2DEUA 1D09B 4X34A 1MMNA 4J9DA 4J83A 3L2WA 3CC7A 2YRDA 2V8IA 2O31A 3UA6A 4E47A 1VQ5T 2GFUA 2KY9A 4FSXA 3C95A 2YUPA 4E7JA 2EIFA 4JS5A 4E7LA 1GBQA 1I07A 2RI3A 2RHXA 2WSFE 2LNVA 1VQNA 1WHGA 2YUNA 3HRTA 4OP0A 4M7AG 4PFPA 4PJOD 3E19A 2EYXA 2QQSA 2A37A 5AT1B 3JB9D 2E70A 3I55T 1SEMA 3OBWA 4GLKA 4KGZB 2YDLA 5IN1A 1VA7A 2O88A 1CKBA 1YWPA 2JM9A 3CMET 2BTTA 1AWWA 2OTLT 1Q86C 3ULRB 1CSKA 4EMGA 2EJ9A 1IXDA 1JRIA 2RHYA 2RNAA 2Z0WA 3M56A 4PJOC 2M0YA 2WACA 4PJJA 2KNBB 1VQMA 1M9SA 4Y28E 2PUOB 3SWNB 4PJOF 2WSEE 4B9XA 1YJ9T 3CCQT 3H41A 2DD4A 1KQ2A 4IIOA 1K9MC 1GBRA 1W70A 1Z9QA 2QGGA 4HVWA 1NJIC 4E2FB 2XDBA 4AMCA 5FWCA 2DZCA 1FMKA 2E10A 1WLPB 1KHIA 3SFMA 3V8KA 2L5QA 2X35A 1VQ5A 3EHRA 1SRLA 2K57A 5GAMj 1OU9A 2LQ8A 5GAN5 5FU7B 2JVVA 1JBMA 5KCOA 3HFOA 4PJNA 1YIJA 1S72T 5HY6A 3CCRQ 3CBPA 4D6WA 2VGMA 1BI1A 1ZA2B 1LNXA 3CD6Q 1WHMA 1AWJA 1YBYA 2EGEA 3CMEA 4RUGA 1VQ8T 4F17A 3RMQA 1V76A 2OTLA 2JJ9A 3UPUA 1VIFA 2L3QA 2CS7A 2RO0A 2P0QA 1QVFP 5J26A 5GANe 2X4YA 4HVVA 3BY7A 1M3AA 5LJ5f 2K5IA 1K73R 3EG9B 1D0XA 2A28A 1WJQA 2RHUA 5KYWB 3OYKA 1YJ9A 3CCQA 4UC4A 3CCST 2DL7A 2EQJA 1YJNA 3OYAA 1Y0MA 4C5EA 4QVZA 4PJOE 2HDAA 5GANd 1M30A 4AFSC 1G3YA 1QVGP 1N6AA 2HMAA 1M1KR 2M9UA 1WFWA 3I5SA 1ZHIA 4EMKA 5CKBA 2O4XB 1YCYA 4PJOB 1GFCA 2EQIA 4MMLA 3CCUQ 1ZSZC 1E7OA 3LGFA 2L2PA 1S72A 3MKDA 3NGPA 5FROA 1ARKA 3CCJT 5FLXE 2K4YA 1FMVA 2QQRA 4KBMB 4N0AA 2HQXA 4AFUC 5DM7R 2RQVA 2D9TA 2PUKB 2JUFA 4C8QG 4J6XA 3M5AA 1WNLA 1VQ8A 4IUUA 4HKEA 3REBB 3M0PA 1H641 2DILA 3M0RA 4IURA 1RUWA 3QIIA 4BUGA 2L3SA 1PSFA 2SEMA 4XAXB 1VQ9T 1I8FA 3U23A 4EPCA 3DKMA 3NTHA 4C92C 1VQLA 1PRLC 2IPOB 2M1HA 3QHSA 4C92F 3AT1B 3OS2A 3G1JA 1M8VA 3CCSA 5GMKe 4M7AA 4PK4A 1QP3A 2H3JA 1RABB 4KUIA 2KT8A 2VGNA 3TU4K 2DX1A 2LJ3A 3I56Q 1UGSB 2XMFA 1M5Q1 3PIOA 4XTZA 5KYUA 1TG0A 1OPLA 3MHXA 2JTMA 1ZQ1A 3QBYA 3CCJA 1YHQA 1BCMA 4IKFA 4J7IA 2GTJA 2F2WA 1GCQA 3CPWP 2RJEA 1YITA 3CC4Q 3I5RA 3RKWA 4F7UG 3MJXA 1UGQB 4JLGA 2LQKA 5I2SA 4OB2B 4OMQA 3VS7A 4IUPA 2M16A 1ABQA 1IRXA 3HRUA 4M78G 3OYCA 4FW2A 2HD0A 3NMZC 3OS1A 1WGSA 4DOVA 4M75D 1RAHB 4L6V5 1JJ2S 1ZSZB 3HFNA 3M59A 3OMCA 1D0YA 5LJ5g 2RM4A 4F04B 1QLYA 3ASKA 2QG9B 3META 5ECAA 2J6KA 1WIEA 4C5HA 1QCOA 2F69A 3VJPA 1IHVA 4FL6A 3G71Q 1QVGS 4EIKA 1SPKA 4M75C 4FSSA 3MO8A 2JXBA 3HL8A 2X51A 2DIQA 3PE0A 1HSQA 5CKHA 1SKUB 4M75F 5CK9A 4A4HA 2ZPHB 3GF5A 4C92B 1XTDA 3QDRB 2DBKA 2MWOA 3ZFJA 3G6ET 1X27A 4C0ZA 1AHJB 2NWMA 5IAYA 2QEXQ 3VV0A 3JCMe 1S1NA 1FXXA 2JS0A 2V8KA 4ZGJB 4QW2A 4M77D 1W2BP 2C0OA 1HYOA 4XK8E 1RI0A 2GNCA 2P0PA 5KYNA 3JCMQ 2LRQA 3C94A 1G2BA 3I35A 4DEXA 3CMAQ 3JCMP 2COWA 1PKTA 2RA2A 5CQXA 1I1JA 1T0JA 2KXDA 1WJSA 4FYYB 1M2OA 1BKBA 2E4HA 1KQSP 4WF2A 8AT1B 3HHTB 3CC2T 3MEUA 2K5LA 4HXJA 4M77C 1X6BA 3UF4A 5IH2A 2EYQA 1KSWA 2COYA 4M77F 3A8MB 1Q81R 4RTYA 4C8QA 2YUOA 4EDUA 4PJMA 2FG0A 2FPEA 2ENMA 4J9CA 3T9NA 1G3WA 1YJWT 3O5ZA 2J7IA 4FU6A 2EBPA 1VQ7Q 4A54A 3G6EA 1VQ5Q 1WHLA 4HT9A 1VYUA 4M75E 2X3XD 1SHGA 3DB4A 4M4ZA 1WPYA 1IZ6A 5GAMe 2PVGB 2OJ2A 2LT4A 5LJ3j 2CZ1B 3D7SB 5HKCA 2F5TX 4M75B 2JW4A 2DPPB 1BYMA 2G6FX 3I55Q 2EQUA 4FM4B 3UA7A 1WA7A 2E6ZA 1D1BA 5KCHA 4N4GA 1UB4A 3EH2A 4LD9K 1RAGB 1N8RC 4OMNA 1WZOA 3LH5A 2W10A 3TVTA 2QDYB 1OX8A 1VQOQ 2ABLA 2CREA 1BI2A 1U06A 3E2UA 4JZ3A 2E5QA 1WX6A 3CC2A 3ZBDA 2JTEA 4F7UA 2EAYA 5KE3A 3S3OA 2CKKA 2VUBA 3GLXA 3ZEHA 1NE8A 5GMKj 2CUBA 4ESRA 5GAN7 1FMWA 1M1FA 5LJ5h 2E65A 1TSFA 1YJWA 1JQQA 4M77E 1FYNA 1Y07A 1AZGB 4C5IA 3PTAA 4LDVA 4MDWA 5GJWB 1D1AA 2RN8A 2KROA 2MF2A 4IUQA 1I4K1 2LX9A 4B6MA 4ANJA 4M77B 4KULA 4Y92A 1Q82U 4ATOA 1X43A 4RG8A 2RI5A 2LNHB 2HBPA 3CC7T 2KBTA 1FX7A 2FZKB 2XK0A 3A8OB 4OB0B 1N5ZA 3PGGA 2YWWA 1JO8A 4GBQA 2SRCA 2NUTB 4OGCA 2K9GA 2PNIA 4HT8A 1PSEA 4AFQC 1WI7A 2FEIA 2C06A 2RPNA 3FIFA 1WXUA 1NPRA 5KYYB 1VQNT 3M0QA 2BKDN 2DRMA 4CC7A 2EVRA 2EYWA 4PFZA 4OVAA 2R5AA 5FW9A 1Y71A 3C4SA 2M0OA 3J7AF 3G4ST 2V8JA 1H92A 3NHNA 3S3NA 2QGFB 3WVEB 2RQRA 4GY5A 1ABOA 2CSIA 2ZCFB 2KXCA 1X2QA 5A0GA 4RKUE 1JXOA 1B34B 1VQ4T 3TSWA 3QWXX 1K8AR 5GMKl 3OYLA 1Q7YR 4ME7A 1M90R 3OYYA 1VQMT 2MI6A 1K9AA 1PD1A 4BD3A 1KJWA 4CRIA 1Q95G 1VQPA 2I0NA 2D8HA 4BE2A 3L1AA 4J9HA 1M8MA 1CKAA 3CCJQ 2CZ6B 2O2OA 2M02A 1KD1U 3KFVA 2P0KA 4MZTA 3EGXA 2Y4YA 1WHHA 2RQTA 2EPDA 3FC3A 3UATA 1LCKA 1VOMA 1VYVA 1XQHA 1YIJT 1PG5B 2DYBA 1SG5A 1VQ9Q 2A3LA 1RAAB 2W0ZA 2HNIA 1QWFA 5GANg 3VYHB 4NL2A 3G4SA 4BI4A 2OTJA 4RTWA 2KYBA 2ZPFB 1Q86R 5A0LA 4Y91A 1G3SA 4X1VA 1G83A 1GCPA 3QUIA 3VS4A 4M7AD 5L23A 2JN0A 1M2VA 2MOXA 3QKJA 1VQ4A 4IUVA 2B8AA 1K76A 2NUZA 3RNJA 5GMKi 2LQWA 4JJCA 2KSSA 1NYFA 1K9MR 1MUZA 1VIEA 3JB9F 3CCLT 4J9FA 1NJIR 1YJNT 4M7AC 1UGPB 3C0CA 2DAQA 4JDSA 2AZSA 3CBOA 1UFFA 4PNOA 3CCEQ 4JJBA 5LL6S 3JCMX 4VUBA 2EJFA 2AZVA 3CCMQ 3EG1A 2EGCA 2GFAA 4O5VA 3MEAA 1NLPC 4J5YA 2PZ1A 4E7IA 3FDRA 2COZA 2DM1A 2E3IA 2LCSA 1RLPC 1C6VX 5EG2A 1NZ9A 2BZ8A 1G3TA 1G8XA 4HA8A 2QQAA 3QDFA 1MMAA 5C6SA 2DJZA 2DRKA 4HVUA 1RAIB 3OS0A 1GCQC 3OQ5A 3SWNA 3VRYA 2QQ9A 2K2VA 2DLPA 2DMOA 2FZGB 2YHTA 1QWEA 1VQLT 1WHKA 1JJ2P 2X9HA 4L5GA 2V1QA 3OW2A 1WQWA 2OI3A 3CCLA 4LDWA 3QG1A 2LP5A 2DL8A 3RUXA 5AYFA 3OYGA 1WXTA 3G6EQ 4QT7A 3I9QA 2ESWA 4J8OA 2YLCA 4BY6C 1UECA 1JU5C 3A5ZB 5GJVB 2HBWA 3KBGA 3NPFA 1KC8U 2BE7D 3LW5E 1GFDA 2DYIA 1E6GA 1T3LA 1PD0A 5GAN3 2AK5A 2HCKA 2P84A 4L59A 3URGA 4M7AE 3VU3C 5LJ3e 1NYGA 4A53A 1QVPA 4R0KA 5HCKA 1YHQT 1JXMA 1EX4A 2DNUA 4C92G 1YITT 3H9NA 3EG9A 3FJPA 1I81A 1KFZA 5KYWA 5LJ3d 3CC2Q 2RHZA 2DVEA 2E1HA 3O8VA 3VUBA 1E6HA 3H6ZA 2GQIA 4C8QD 3CBMA 2GTOA 1PNJA 5FWBA 4J9BA 2BUDA 2O4XA 2AKKA 2BZXA 4PJOA 3RKXA 2CP5A 4IIMA 4Z88A 1VUBA 4M7DG 2LX7A 1HD3A 2JMAA 2L89A 1K1ZA 5HK0A 4A4GA 4ZN3A 4BDYA 1K0SA 3OSSC 3CXCA 4CC2A 1TUDA 2LT1A 1K73U 2KDSA 1VQ6T 2DFUA 2CP3A 2AHJB 2QXFA 1PCXA 3IQLA 3LYIA 3M9QA 3OYNA 5IXBA 2P4RA 1XJWB 2QA4A 2L8DA 1YWOA 4BY6B 2XDDA 2A7YA 2QTVA 2EJGA 3KXTA 5L8RE 1TU0B 4XU3A 1M1KU 2G3RA 2KAFA 1V29B 3QO3A 3VRZA 1MGQA 2YRVA 2O01E 1SSHA 2A08A 2DXCA 4FYXB 1VQKQ 3EGUA 3G7ZA 2DJQA 1BU1A 1NG2A 4M78D 3REAB 1LOJA 1OEBA 1OPKA 2ZGWA 2KE9A 7AT1B 2GQVA 3TCJA 4E7KA 2YSQA 4R56A 2PQWA 3CCVQ 1QQJA 3CD6T 4BDZA 2ED0A 3LH0A 2BZYA 1VYTA 1OULA 4BB7A 5IHNA 3MCAB 4WTOB 4NL3A 3QPHA 4M78C 3CC7Q 4CC4B 2LCLA 1VQ6A 1Y7XA 3F70A 4M78F 2LC4A 2XI9A 4LDYA 3UDCA 3OYJA 3GOXA 4D8KA 4ZN1A 2NUPB 3DLMA 3TREA 1Y96B 3L2UA 5I2MA 1OZ3A 1T0HA 1VQNQ 1ZBJA 2DZ9A 1X2KA 2HKNA 2HQEA 2AIRB 5DY9A 2EQKA 3VS5A 3VS1A 1LVKA 2YLBA 2CDTA 1ACMB 5A2QE 5FU6C 2E12A 5IHIA 3ME9A 2HL3A 3EG0A 2L3RA 2YT6A 1N9SA 3QSUA 5IXFA 3TSZA 3GNGA 2MWPA 3EHQA 2K5FA 3JCMd 5GAOp 2RQWA 4C92A 1VQMQ 1OX9A 2KI7A 2EKOA 3RMSA 1U5SA 3PT9A 4KT0E 3CD6A 1TUCA 2HQHA 2KK4A 2VXEA 4BE0A 1IB8A 4OB1B 3OYDA 3BE3A 3NFCA 1PWTA 3OS5A 3QXEB 1QVFA 3EFOB 5FRNA 2KRMA 5I22A 2CGHA 4HCZA 1PC0A 2K3BA 5LJ5e 3LX7A 2O9SA 1Q82C 3WVDB 4KGXB 5A0DA 5CR2A 1YI2T 1IGQA 4LNPA 1YIJQ 2D0NA 1SRMA 4M78E 3LWIA 3RDVA 1XOVA 4M7DA 1EZZB 3THKA 3AHUA 1WQ7A 3OMGA 2JOYA 3RBBB 4JRKA 1N8RR 4MZMA 2CH4A 2NLUA 4JUVA 2KR3A 3M58A 4QQ6A 3I56T 1KK7A 2GCXA 4M78B 1UTIA 1W6XA 1AWOA 1BIAA 1JB0E 4D8DA 3JB9I 3CMEQ 2KVQG 2CP6A 5GAMd 2OTLQ 1OI1A 1RL2A 2MAMA 1O75A 3GP8A 4BI8B 5GANf 3CCUA 2AT1B 3PVQA 3EGDB 2VXFA 1U1TA 2CP7A 4FCYA 3JCMV 1UJYA 1AVZC 3M0SA 1YJ9Q 3CCQQ 2X4WA 3OY9A 2VWFA 1UUEA 2FYKA 2LTOA 3OW2P 3CC4T 2OAWA 3GNFB 3EFRA 1YJNQ 1UDLA 1R8OB 5GAN4 1A0NB 3VYGA 2LQNA 3E1SA 9ATCB 1PHTA 1KHCA 3P8DA 5FU6B 3OSVA 2CZ0B 4M75A 4FT4A 1D3BB 3QJYA 2J6FA 2MMPA 1KIKA 2QDLA 3P8BB 1KG1A 3X20B 3MEWA 5LJ3f 1VQPT 1D1CA 1YI2A 2HKQB 2VB6A 2IG0A 1S72Q 1BI3A 1SSFA 1TH7A 1H3ZA 1Q81U 4E7ZA 2YRCA 1K4US 4FYWB 3VS6A 2EKHA 1UGVA 4JZ4A 4AG2C 4PLIA 3HPWA 3G71T 3JCMJ 5J3BA 4ZGDB 3FB9A 3I56A 5KYXB 3V7CA 2GGRA 1VQ8Q 4KH1B 1QW1A 2A0FB 4AFZC 1J3TA 2K79A 5HK3A 4CC3A 2K3XA 4OB3B 2MPXC 5CIUA 1VQLQ 3PVLA 3VKIA 5CAIA 2OTJT 4EMHA 3CPWA 5CKFA 1T3SA 2F2XA 3CCSQ 4NS5A 3J81E 3CC4A 3RIRA 5EC7A 3SWNC 4M77A 3A8LB 8ATCB 1UHCA 2VKNA 4NOYA 2EGAA 1G5VA 3MP8A 4LUEA 4XU1A 4C0DC 2IIMA 2OX7A 4KUDK 4C5GA 1NEGA 4PKCC 5GAOr 3CMAT 1IO6A 4YTLA 3M4GA 3M54A 2NUTA 4PL6A 2J6OA 3PMIA 1NM7A 1TUGB 3L42A 4GLMA 3SB2A 4FT2A 1YHQQ 1ZX6A 5KYYA 2FRWA 1YITQ 1R0CB 3G71A 4LXCA 3X25B 3RKYA 2JS2A 2FPFA 4EMKC 1SHFA 5J39A 4AT1B 1BCOA 1YFNA 3PIPA 1B34A 1VQ7T 4PJOG 2E6NA 4CI0C 2DL4A 3JB9G 2DO3A 1AZEA 3OW2S 1MHNA 1N9RA 1QKWA 4QVCA 4N0AC 1IHWA 4HCCA 1ZBXA 2QEXA 1M1GA 3A1PA 5IHKA 1PM3A 4LDUA 4F14A 1W2BA 1OQKA 1QMCA 3VS3A 2Y90A 4MDXA 2HEQA 2QAZA 2DTOA 2J06A 1W4SA 1YNZA 2RI2A 3CMAA 1NBEB 2FZCB 1KC8R 1ZLMA 2LMJA 4AG1C 1RADB 1VQ6Q 3OB9A 1VQOT 4KRTA 5LJ3g 1KQSA 4RCBA 1KC8C 1RAFB 5D6XA 4M7AF 2CUDA 5LJ5j 4KGVB 1MV0B 3TQ7P 3FEOA 3DLLA 3OYBA 5GMKm 2LVMA 3QZ9B 4JPBW 4PLLA 3JCMf 1K8AU 4ZNXA 4XU0A 2WSCE 1Q7YU 1M90U 1ZUKA 4A63B 2VYTA 4C0DB 1TOVA 3JB9J 4OMOA 2LJ1A 3A8GB 3H0HA 4WCIA 5D6WA 1ZUUA 1VQ7A 1RI9A 2PVDB 2DIGA 1LPLA 2VV5A 2K3YA 1ZA1B 3EG3A 1U1SA 1MMGA 2DL3A 4Z89A 1M4ZA 3OYFA 4PFOA 1BIBA 2GBQA 3JCMc 1NEBA 5GAN8 5CQYA 4LN2A 3ZL7C 1IREB 3CQTA 1V1CA 3QYHB 2DETA 3M4YA 1RACB 4RMOA 1W1FA 2MCNA 2HZYA 5GAN2 4EMKB 2DKGA 3I55A 3CXCS 2DBMA 2YUQA 2RJFA 1BK2A 1AT1B 1QKXA 3C12A 4RTTA 3VS2A 2FVUA 3M0TA 3H0IA 1AD5A 2D1XA 2DERA 1VQOA 2K6DA 4XTWA 1HJDA 1D0ZA 2K2MA 1Q86U 4A4EA 4HCKA 2E5KA 3JSCA 4XTYA 1X6GA 2XG8D 4DA4A 2FO0A 2KRSA 5GAMf 1Z9ZA 4DBHA 1TS9A 1K73C 1BI0A 1UEBA 1UE9A 2EWNA 1I0CA 2KMTA 4Z8AA 4JJNK 1K9MU 3M55A 2JM8A 4OMFB 2DXUA 1H8KA 3H8ZA 2IVWA 1UGRB 4J7FA 2F1LA 1X01A 4Q5WA 1NJIU 2EYYA 2H3EB 2QA4T 2ATCB 4M7AB 2XD0A 2E41A 2CP0A 1B07A 4E6RA 1M1KC 2FL7A 3UWNA 3KUFA 1P92A 1X69A 2RJDA 3M0UA 4DBFA 4II1A 4C92D 1WHJA 1YP5A 2XKOC 2C0IA 1WYXA 4DOWA 5KYUB 3E9GA 5GANh 2DF6A 4R55A 2VVKA 2KT1A 2FHDA 4E7SA 3L2VA 1YJWQ 3ER0A 3BFMA 1I5OB 1UJ0A 4V2SA 2LCCA 5C0MA 5CO7A 3UT1A 2QTXA 4FW1A 2JZ2A 3MP1A 2V26A 4DBRA 1MMDA 1TTHB 1C1AA 2E64A 3PNWC 4XTVA 1YI2Q 2HL5C 2X3WD 4C8QC 1OU8A 2M51A 2L3PA 2EQMA 4C8QF 2QQBA 3MEVA 5GAOq 3JCMg 2E3HA 2KQWA 4M7DD 2BE9B 4RCCA 5LJ3h 2ECZA 4DQ2A 2DA9A 2XDPA 3HP9A 3TEEA 3FLGA 4PJLA 1K0XA 2ROLA 3S6WA 3V7RA 3SD4A 1GRIA 1HK9A 4A4KA 5I21A 3SDZA 2CH4W 3L2QA 5DLOA 4OMMA 2RH2A 3QJ6A 2RD1A 2K7AA 2CT4A 2R58A 3X26B 1RAEB 3OYHA 4M7DC 1MNDA 3GPLA 2DTIA 3HRSA 2RJCA 4M7DF 4M75G 3CCET 3BDUA 2DK3A 3CCMT 4ELYC 1YCSB 2OAUA 2NYSA 1TXQA 1QVFS 5M9OA 2EFIA 1ZSGA 2PTKA 1UHFA 1QP2A 3FRNA 5GMKh 1Y57A 3CCRT 2ZPGB 1VQ9A 2DD5A 1H3HA 3RERA 4JRPA 4J9IA 1XNIA 3A98A 2L0AA 2D8JA 3HSBA 1B7TA 1VQPQ 2J05A 1I5LA 2VASA 1GXIE 4JRIA 2QYZA 1SF9A 4TVRA 2DXTA 5GAMg 2JT4A 4F7UF 4C0FA 2DTHA 2MYSA 4J9EA 2KYMA 1O9SA 2A36A 1WJRA 3CPFA 2QI2A 4C92E 3S3MA 5KE2A 1DJ7B 4P5NA 3EH1A 4LE9A 4B9WA 3JV3A 4DEYA 4C8QE 4JS4A 3PFSA 2CT3A 4HCBA 4J6WA 1ZSZA 2V1RA 4BI3A 3JAME 1R77A 5GAOl 1EIFA 4ZTFA 2RMOA 3Q1JA 2DXBA 3SHWA 2F2VA 2XIDA 4M77G 4C8QB 3G4SQ 1NLOC 2OTJQ 4K11A 4LDXA 4ELZC 2FB7A 5IT9E 1RLQC 3CCEA 5DLQE 4LD6A 2CZ7B 4OF1A 2QK0A 3EFSA 1OV3A 1NPPA 2D0QB 2R5MA 3NTIA 3CCMA 4KH0B 5I11A 1VQ4Q 1ZUYA 2R57A 2C0TA 3CCUT 3L2RA 2ZPIB 1KQ1A 4M7DE 3P8HA
chains in the Genus database with same CATH topology
3OS2A 4JDSA 1M8VA 3CBOA 3CCRA 3LWHA 5GMKe 1QW1A 4XTXA 3CCSA 4M7AA 2XHCA 1QP3A 4PNOA 2XICA 5HK3A 3OYIA 2H3JA 4KUIA 5LL6S 3JCMX 4VUBA 2EJFA 4X9DA 2K3XA 4OB3B 2VGNA 2BIVA 2GFAA 4O5VA 4M7DB 5CIUA 3MEAA 3TU4K 4J5YA 1Y96A 4E7IA 3PMTA 5FRMA 3FDRA 5D6YA 3VKIA 5CAIA 2OTJT 4EMHA 3M57A 3CPWA 5GANj 5EG2A 4ZTJA 3CEYA 5CKFA 1NZ9A 1UGSB 4NS5A 3J81E 3J80E 3CC4A 1M5Q1 3LLRA 3RIRA 3PIOA 1G3TA 4HA8A 4XTZA 2HAXA 3SWNC 2QQAA 4O6JA 2JNGA 4M77A 3MHXA 3A8LB 4F7UE 5C6SA 1JJ2A 2JTMA 1ZQ1A 2DJZA 5CVIA 3QBYA 4X9CA 3OS0A 4NOYA 4RG2A 3OQ5A 3SWNA 3CCJA 1G5VA 1Q81C 1YHQA 3MP8A 4IKFA 2D6FA 2QQ9A 4XU1A 4J7IA 4C0DC 5GAN6 4BACA 2K2VA 2X4XA 2RJEA 1YITA 4KUDK 4C5GA 4PKCC 5CKEA 3RKWA 5GAOr 4F7UB 3CMAT 4F7UG 4YTLA 1UGQB 3M4GA 3M54A 4JLGA 2YHTA 2LQKA 4PL6A 3JCMh 4XU2A 3PMIA 3L42A 5I2SA 3CPWS 2RHIA 4OB2B 3SB2A 1QVGA 4FT2A 1VQLT 5LJ5d 4IUPA 2M16A 3WXMB 4L5GA 1OYXA 3HRUA 4M78G 1HXDA 3OYCA 3OW2A 4E7HA 1WQWA 2HD0A 4QQGA 3OS1A 1X6OA 1WGSA 3CCLA 4DOVA 4LDWA 4M75D 3QG1A 4L6V5 1JJ2S 2PU9B 3HFNA 3M59A 5AYFA 3RUXA 3G71A 2PVOB 3OYGA 3OMCA 3A8HB 5LJ5g 4J8OA 3X25B 2RM4A 2YLCA 5GAOm 4BY6C 3RKYA 3A5ZB 3OA6A 1OZ2A 3KBGA 3ASKA 3INZA 4OGEA 4EMKC 4IUTA 4BE1A 1KC8U 3META 1U8RA 4N4IA 5J39A 3V7SA 3LW5E 4C5HA 4ZGEB 3PIPA 3JB9H 2F69A 1B34A 3JCMb 3VJPA 1VQ7T 4FL6A 4Z02A 1QVGS 4PJOG 2E6NA 5GAN3 2RK2A 4L59A 3URGA 4CI0C 4M75C 3VU3C 5LJ3e 3JB9G 3X24B 2F5KA 3MO8A 4M7AE 2DO3A 4FIBA 3HL8A 3JCMW 2DIQA 3M53A 3OW2S 1MHNA 1N9RA 1QVPA 5CKHA 4A53A 3V8JA 4M75F 4QVCA 5CK9A 4N0AC 2P4TA 1YHQT 4A4HA 1ZBXA 4HCCA 2ZPHB 4MZPA 3LGLA 2QEXA 1M1GA 1LJOA 3GF5A 4C92B 4C92G 1XTDA 3QDRB 1YITT 2X4JA 4LDUA 1W2BA 2MWOA 3QZ5B 3ZFJA 3G6ET 2Y90A 3FJPA 4MDXA 1VQKT 2I2LA 4M78A 1I81A 4C0ZA 2LDMA 4JRQA 1AHJB 2DTOA 5LJ3d 1KD1C 2RHZA 2RK1A 1W4SA 2RI2A 5GAMh 4XTUA 3CMAA 3OYMA 1X75C 2DVEA 5KH6A 2E1HA 3BDLA 5IAYA 3O8VA 4N4HA 3VV0A 3JCMe 3OB9A 1VQOT 1FXXA 2V8KA 4ZGJB 3BW1A 5LJ3g 4QW2A 3VUBA 4RCBA 3H6ZA 1KQSA 4M77D 2VC8A 4C8QD 3CCVT 3CBMA 4XK8E 5D6XA 1KC8C 1RI0A 3X28B 2P0PA 4M7AF 3JCMQ 5LJ5j 2LRQA 3C94A 1FWZA 1N27A 3FEOA 3DLLA 2BUDA 2O4XA 5GMKm 3OYBA 3JCMP 1W2BS 4PJOA 3L2ZA 2LVMA 2RA2A 2CYZB 5CQXA 2ZPEB 4QQDA 3RKXA 1WJSA 3QZ9B 2ZZDA 4QVDA 4PLLA 2XU8A 3JCMf 3MP6A 3E9FA 1K8AU 1BKBA 1VUBA 3OBYA 4XU0A 2WSCE 3QYGB 1Q7YU 2L89A 1M90U 4M7DG 5HK0A 4A4GA 2VYTA 4C0DB 4ZN3A 4BDYA 3EAEA 3N5BB 3OSSC 3CXCA 4WF2A 3DB3A 3HHTB 1D3BA 2DEQA 3JB9J 3MEUA 2K5LA 4M77C 3CC2T 3A8GB 5D6WA 2Y4XA 2EYQA 1VQ7A 1N8RU 2PVDB 2LT1A 2QEXT 2DIGA 3A8MB 4M77F 1KQSS 1K73U 4C8QA 2VV5A 2K3YA 2KDSA 1VQ6T 1U1SA 1M4ZA 5CCAA 4EDUA 4C92F 3OYFA 3HKSA 2GF7A 3GIBA 2AHJB 1BIBA 3JCMc 4C0GA 5GAN8 2QXFA 4JLIA 5CQYA 4XQ3A 3T9NA 2RB6A 3LYIA 3M9QA 3OYNA 1G3WA 1IREB 1YJWT 2QA4A 3QYHB 3M4YA 2L8DA 4FU6A 4A54A 3OYEA 4A4FA 4BY6B 3G6EA 2XDDA 4J6YA 4RMOA 5GAN2 1VQKA 2A7YA 3RESA 4M75E 4HT9A 4EMKB 2DKGA 3I55A 3CXCS 2EJGA 3NTKA 3KXTA 5L8RE 2JTFA 2ZPBB 2RJFA 4XU3A 1M1KU 3DB4A 1WPYA 3C12A 2G3RA 1IZ6A 2KAFA 5GAMe 1V29B 3QO3A 3R6OA 2PVGB 5GAOn 2FVUA 1MGQA 2YRVA 2LT4A 3V8LA 5LJ3j 5FU7C 2CZ1B 5HKCA 4MMKA 2O01E 2F5TX 4M75B 3VUZA 1VQOA 1K8AC 1Q7YC 1M90C 4XTWA 2DXCA 3JRZA 2DPPB 3CCVA 1BYMA 1Q86U 2EQUA 4A4EA 5CKDA 3G7ZA 3JSCA 4FM4B 2E6ZA 4LD9K 4XTYA 1UB4A 4N4GA 2XG8D 5KCHA 4DA4A 4M78D 4X34A 5GAMf 4J83A 1N8RC 3L2WA 1LOJA 3CC7A 1K73C 2V8IA 2ZGWA 2QDYB 2GQVA 3TCJA 4E47A 1BI0A 1UEBA 4E7KA 1BI2A 1VQ5T 2GFUA 4R56A 2KY9A 2PQWA 4FSXA 2E5QA 2EWNA 3C95A 3CD6T 4JJNK 2KMTA 4E7JA 1K9MU 4BDZA 2EIFA 3M55A 3ZBDA 3LH0A 4OMFB 4JS5A 2DXUA 4E7LA 3H8ZA 2IVWA 1UGRB 2RI3A 2RHXA 2WSFE 4J7FA 2LNVA 4BB7A 4F7UA 2EAYA 1X01A 5KE3A 3S3OA 3MCAB 4Q5WA 4NL3A 3HRTA 1NJIU 1VQNA 3J7AF 3QPHA 4M78C 2QA4T 2CKKA 4OP0A 4M7AB 2VUBA 3GLXA 2LCLA 4M7AG 3ZEHA 1VQ6A 2XD0A 1Y7XA 2E41A 4PJOD 3E19A 1NE8A 2QQSA 5GMKj 3F70A 4M78F 1M1KC 5GAN7 2LC4A 2E70A 2XI9A 4LDYA 2FL7A 1M1FA 3UDCA 3OYJA 3I55T 5LJ5h 3GOXA 2E65A 3OBWA 4GLKA 3UWNA 4ZN1A 3KUFA 1P92A 2RJDA 3DLMA 1YJWA 4M77E 1Y96B 5IN1A 3TREA 5I2MA 3L2UA 1OZ3A 1Y07A 4C5IA 3CMET 3PTAA 4II1A 2DZ9A 4LDVA 4C92D 2OTLT 4MDWA 1Q86C 2XKOC 4DOWA 2MF2A 2HQEA 4IUQA 1I4K1 3E9GA 5GANh 4R55A 2LX9A 4EMGA 2EJ9A 1JRIA 2RHYA 4M77B 4KULA 2FHDA 3M56A 5DY9A 3L2VA 4PJOC 2WACA 1Q82U 2EQKA 4ATOA 3ER0A 3CC2A 1VQMA 1M9SA 2YLBA 3BFMA 4Y28E 2PUOB 3SWNB 4RG8A 4PJOF 5A2QE 4V2SA 2LCCA 2RI5A 2WSEE 5FU6C 2E12A 4B9XA 5C0MA 1YJ9T 2HBPA 5CO7A 3UT1A 3CCQT 2QTXA 3CC7T 1FX7A 3ME9A 2XK0A 3A8OB 2JZ2A 2L3RA 4OB0B 1N9SA 3QSUA 3PGGA 2DD4A 1KQ2A 3MP1A 1K9MC 3GNGA 2MWPA 2K5FA 3JCMd 2E64A 3PNWC 4OGCA 4XTVA 1NJIC 5GAOp 2XDBA 4C8QC 4C92A 4HT8A 4HCBA 1PSEA 2DZCA 2E10A 1KHIA 2C06A 3SFMA 3FIFA 2L5QA 1NPRA 2EQMA 2X35A 3V8KA 4C8QF 1VQ5A 1VQNT 2QQBA 3MEVA 5GAOq 2K57A 3JCMg 2EKOA 3RMSA 2BKDN 5GAMj 2LQ8A 4OVAA 3PT9A 4KT0E 5GAN5 3OYDA 2KQWA 3CD6A 4M7DD 2R5AA 2KK4A 1Y71A 2VXEA 4RCCA 4BE0A 3C4SA 2M0OA 4OB1B 5FU7B 2JVVA 1JBMA 5LJ3h 3HFOA 4DQ2A 5KCOA 3NFCA 2XDPA 2V8JA 3HP9A 3TEEA 3G4ST 3S3NA 1YIJA 3FLGA 3OS5A 1S72T 3WVEB 5HY6A 3QXEB 3CBPA 3S6WA 1QVFA 4D6WA 4GY5A 5FRNA 2CGHA 4HCZA 2VGMA 2ZCFB 3V7RA 3SD4A 1HK9A 4A4KA 5A0GA 3SDZA 5I21A 4RKUE 1BI1A 5LJ5e 1B34B 3LX7A 1LNXA 3L2QA 5DLOA 1VQ4T 1Q82C 2RH2A 3QJ6A 3WVDB 2RD1A 2R58A 5A0DA 3X26B 1YBYA 5GMKl 5CR2A 3OYLA 3OYHA 1YI2T 4ME7A 4M7DC 3CMEA 3OYYA 1VQ8T 3RMQA 1VQMT 3GPLA 2MI6A 2DTIA 4M78E 3HRSA 3LWIA 2RJCA 2OTLA 4M7DF 3JB9D 1XOVA 4M75G 1VIFA 3UPUA 3CCET 2CS7A 2RO0A 4M7DA 2P0QA 3AHUA 1WQ7A 3OMGA 2JOYA 3BDUA 2DK3A 5J26A 4BD3A 4CRIA 5GANe 2X4YA 3BY7A 4JRKA 1VQPA 3CCMT 4MZMA 5LJ5f 4ELYC 2K5IA 4BE2A 2OAUA 2NLUA 3L1AA 4JUVA 3M58A 4QQ6A 3I56T 1QVFS 2CZ6B 2GCXA 4M78B 1WJQA 2RHUA 5M9OA 2EFIA 3OYKA 1VQPT 1BIAA 1JB0E 3JB9I 1YJ9A 2KVQG 3CCQA 5GAMd 1QP2A 3FRNA 4UC4A 5GMKh 1OI1A 1RL2A 2P0KA 2ZPGB 3CCRT 3CCST 1KD1U 4MZTA 1VQ9A 2DD5A 2EQJA 1YJNA 2MAMA 1O75A 3RERA 2Y4YA 3GP8A 4JRPA 4BI8B 1XNIA 5GANf 3HSBA 3CCUA 3OYAA 4C5EA 4QVZA 2VXFA 1I5LA 4PJOE 1U1TA 5GANd 4JRIA 1GXIE 4TVRA 3JCMV 2DXTA 5GAMg 4F7UF 1G3YA 3FC3A 4C0FA 2DTHA 1N6AA 1XQHA 1YIJT 2M9UA 2X4WA 3OY9A 1ZHIA 4EMKA 2FYKA 1O9SA 2A3LA 1WJRA 2LTOA 5CKBA 3GNFB 3CPFA 3EFRA 2O4XB 3CC4T 1YCYA 2HNIA 5GANg 2QI2A 4PJOB 1R8OB 4C92E 5GAN4 4MMLA 3VYHB 4NL2A 3VYGA 3E1SA 3S3MA 5KE2A 1DJ7B 3G4SA 3LGFA 4P5NA 4BI4A 1KHCA 2OTJA 3P8DA 4B9WA 2ZPFB 1S72A 5FU6B 5FROA 4C8QE 5A0LA 3PFSA 4Y91A 3CCJT 5FLXE 4JS4A 3OSVA 2CZ0B 1G3SA 4J6WA 4M75A 4BI3A 3JAME 4FT4A 2K4YA 5GAOl 1EIFA 1D3BB 3QJYA 2QQRA 4ZTFA 4KBMB 3QUIA 4M7AD 2JN0A 3Q1JA 2DXBA 3QKJA 4N0AA 2HQXA 2MMPA 1VQ4A 5DM7R 3P8BB 1KG1A 3X20B 4IUVA 2B8AA 2D9TA 2PUKB 2XIDA 3MEWA 4M77G 2JUFA 5LJ3f 4J6XA 4C8QB 4C8QG 3M5AA 1YI2A 1WNLA 1VQ8A 2IG0A 4ELZC 2FB7A 5GMKi 4LDXA 2KSSA 4IUUA 4HKEA 5IT9E 1BI3A 1SSFA 1TH7A 1H3ZA 1Q81U 3CCEA 5DLQE 2CZ7B 3EFSA 1H641 1VIEA 3QIIA 4IURA 4LD6A 4OF1A 4BUGA 3JB9F 1PSFA 4XAXB 1NPPA 2D0QB 2R5MA 3NTIA 3CCLT 1I8FA 3CCMA 1VQ9T 4PLIA 1YJNT 4EPCA 3DKMA 3HPWA 3NTHA 4C92C 3G71T 5J3BA 3JCMJ 1VQLA 4M7AC 1UGPB 2R57A 3FB9A 4ZGDB 3I56A 3CCUT 3L2RA 2ZPIB 3V7CA 1KQ1A 2M1HA 3QHSA 4M7DE 2DAQA 3P8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS2 A;  3CCR A;  3CCS A;  2XHC A;  3OYI A;  5LL6 S;  2K3X A;  2BIV A;  2GFA A;  5CIU A;  3MEA A;  4E7I A;  3PMT A;  5FRM A;  3FDR A;  5D6Y A;  2OTJ T;  3CPW A;  4ZTJ A;  3CEY A;  1NZ9 A;  4NS5 A;  3J81 E;  3J80 E;  3CC4 A;  3LLR A;  3PIO A;  2JNG A;  5C6S A;  1JJ2 A;  3QBY A;  3OS0 A;  4RG2 A;  3CCJ A;  3OQ5 A;  1G5V A;  1Q81 C;  1YHQ A;  3MP8 A;  4IKF A;  4BAC A;  2X4X A;  2RJE A;  1YIT A;  4C5G A;  3CMA T;  4YTL A;  4PL6 A;  3PMI A;  3L42 A;  3CPW S;  2RHI A;  1QVG A;  1VQL T;  4IUP A;  2M16 A;  1OYX A;  3OW2 A;  3OYC A;  4E7H A;  4QQG A;  3OS1 A;  1X6O A;  1WGS A;  3CCL A;  1JJ2 S;  3G71 A;  3OYG A;  3OMC A;  3A5Z B;  3OA6 A;  1OZ2 A;  3KBG A;  3ASK A;  4IUT A;  1KC8 U;  4BE1 A;  3MET A;  4N4I A;  5J39 A;  4C5H A;  3PIP A;  1VQ7 T;  4FL6 A;  4Z02 A;  1QVG S;  2E6N A;  4L59 A;  2F5K A;  3MO8 A;  2DO3 A;  2DIQ A;  3OW2 S;  1MHN A;  1YHQ T;  4A4H A;  3LGL A;  2QEX A;  1M1G A;  1XTD A;  1YIT T;  1W2B A;  2MWO A;  3G6E T;  1VQK T;  2LDM A;  1KD1 C;  2RHZ A;  2RI2 A;  3CMA A;  3OYM A;  5KH6 A;  5IAY A;  3BDL A;  3O8V A;  4N4H A;  3OB9 A;  1VQO T;  4QW2 A;  1KQS A;  3H6Z A;  3CCV T;  1KC8 C;  5D6X A;  1RI0 A;  2LRQ A;  3DLL A;  1N27 A;  3FEO A;  2BUD A;  2O4X A;  3OYB A;  1W2B S;  2LVM A;  4QQD A;  1WJS A;  4PLL A;  3MP6 A;  1K8A U;  3E9F A;  1BKB A;  1Q7Y U;  2L89 A;  1M90 U;  4A4G A;  2VYT A;  4ZN3 A;  4BDY A;  3EAE A;  3CXC A;  3DB3 A;  3CC2 T;  3MEU A;  5D6W A;  1VQ7 A;  1N8R U;  2QEX T;  2DIG A;  1KQS S;  1K73 U;  2KDS A;  2K3Y A;  1VQ6 T;  4EDU A;  3OYF A;  3HKS A;  2GF7 A;  3LYI A;  3M9Q A;  3OYN A;  1YJW T;  2QA4 A;  2L8D A;  4FU6 A;  3G6E A;  4A4F A;  3OYE A;  1VQK A;  3I55 A;  3CXC S;  3NTK A;  2JTF A;  2RJF A;  1M1K U;  3DB4 A;  2G3R A;  1IZ6 A;  2YRV A;  1K8A C;  1VQO A;  1Q7Y C;  1M90 C;  3CCV A;  1Q86 U;  2EQU A;  4A4E A;  2E6Z A;  5KCH A;  4N4G A;  4X34 A;  1N8R C;  3L2W A;  3CC7 A;  1K73 C;  1UEB A;  4E7K A;  1VQ5 T;  2GFU A;  2PQW A;  2E5Q A;  3CD6 T;  1K9M U;  4E7J A;  3CC2 A;  4BDZ A;  2EIF A;  4E7L A;  3LH0 A;  3H8Z A;  2RI3 A;  2RHX A;  5KE3 A;  1VQN A;  3S3O A;  1NJI U;  4Q5W A;  2QA4 T;  2CKK A;  2LCL A;  1VQ6 A;  3ZEH A;  2QQS A;  3F70 A;  1M1K C;  2E70 A;  3OYJ A;  3GOX A;  3I55 T;  3UWN A;  4ZN1 A;  3KUF A;  1YJW A;  2RJD A;  3DLM A;  3TRE A;  5IN1 A;  3L2U A;  1OZ3 A;  4C5I A;  3CME T;  4II1 A;  2OTL T;  1Q86 C;  2HQE A;  4IUQ A;  3E9G A;  2RHY A;  2FHD A;  3L2V A;  2WAC A;  1Q82 U;  2EQK A;  3ER0 A;  1VQM A;  5A2Q E;  2LCC A;  2RI5 A;  4B9X A;  5C0M A;  1YJ9 T;  3UT1 A;  3CCQ T;  3CC7 T;  3ME9 A;  2XK0 A;  2L3R A;  2JZ2 A;  3MP1 A;  1K9M C;  2MWP A;  3PNW C;  1NJI C;  1KHI A;  1NPR A;  1VQ5 A;  1VQN T;  2EQM A;  2X35 A;  3MEV A;  2EKO A;  2BKD N;  2LQ8 A;  4OVA A;  3CD6 A;  2R5A A;  4BE0 A;  3C4S A;  2M0O A;  2JVV A;  3J7A F;  5KCO A;  3OYD A;  3G4S T;  2XDP A;  1YIJ A;  3S3N A;  3FLG A;  1S72 T;  5HY6 A;  1QVF A;  3S6W A;  4GY5 A;  5FRN A;  4HCZ A;  3SD4 A;  3LX7 A;  1Q82 C;  3L2Q A;  1VQ4 T;  3QJ6 A;  2R58 A;  3OYL A;  1YBY A;  1YI2 T;  3OYH A;  3CME A;  3OYY A;  1VQ8 T;  1VQM T;  2OTL A;  2MI6 A;  2RJC A;  3CCE T;  2RO0 A;  3OMG A;  2JOY A;  5J26 A;  4BD3 A;  4CRI A;  2X4Y A;  1VQP A;  3CCM T;  4BE2 A;  2NLU A;  4QQ6 A;  1QVF S;  3I56 T;  1WJQ A;  2RHU A;  5M9O A;  2EFI A;  3OYK A;  1YJ9 A;  2KVQ G;  3CCQ A;  4UC4 A;  3CCR T;  3CCS T;  1RL2 A;  1KD1 U;  1VQ9 A;  1OI1 A;  2P0K A;  2EQJ A;  1YJN A;  1XNI A;  3CCU A;  3OYA A;  4C5E A;  4QVZ A;  4TVR A;  3FC3 A;  1YIJ T;  2X4W A;  3OY9 A;  2LTO A;  1WJR A;  3CC4 T;  3CPF A;  2O4X B;  3S3M A;  5KE2 A;  3G4S A;  3LGF A;  2OTJ A;  1KHC A;  3P8D A;  4B9W A;  1S72 A;  5FRO A;  3CCJ T;  3PFS A;  5FLX E;  3JAM E;  1EIF A;  2QQR A;  4ZTF A;  3Q1J A;  3QKJ A;  2HQX A;  1VQ4 A;  5DM7 R;  3P8B B;  4IUV A;  2B8A A;  2D9T A;  1VQP T;  3MEW A;  1YI2 A;  2JUF A;  1VQ8 A;  2IG0 A;  4IUU A;  5IT9 E;  1SSF A;  1H3Z A;  1Q81 U;  3CCE A;  5DLQ E;  4LD6 A;  3QII A;  4IUR A;  1NPP A;  1VQ9 T;  3CCM A;  3CCL T;  2R5M A;  3NTI A;  4PLI A;  1YJN T;  3G71 T;  3NTH A;  5J3B A;  1VQL A;  3CCU T;  2R57 A;  3I56 A;  3L2R A;  2M1H A;  2DAQ A;  3P8H A; 
#chains in the Genus database with same CATH topology
 3RR6 A;  1M3C A;  3CCR A;  3LWH A;  4XTX A;  2XHC A;  2XIC A;  3OYI A;  6AT1 B;  2ED1 A;  4X9D A;  2BIV A;  2NUP A;  4M7D B;  1Y96 A;  1PKS A;  2LJ0 A;  3PMT A;  5FRM A;  5D6Y A;  3M57 A;  5GAN j;  4ZTJ A;  3CEY A;  4J9G A;  1Q82 R;  3J80 E;  3LLR A;  1WDX A;  2HAX A;  2RF0 A;  4O6J A;  2JNG A;  1F1B B;  4F7U E;  1JJ2 A;  4FYV B;  5CVI A;  2HSE B;  4X9C A;  2B86 A;  4RG2 A;  1Q81 C;  1C0M A;  4RTU A;  2D6F A;  3EG2 A;  5GAN 6;  4BAC A;  2X4X A;  5CKE A;  4F7U B;  1AEY A;  2YXY A;  4JJD A;  3JCM h;  4XU2 A;  3CPW S;  2RHI A;  1QVG A;  5LJ5 d;  3WXM B;  2FPD A;  1OYX A;  1HXD A;  2LZ6 B;  1IGU A;  4E7H A;  4QQG A;  1X6O A;  1B3Q A;  2CSQ A;  2DVJ A;  2PU9 B;  2DL5 A;  2PVO B;  3A8H B;  5GAO m;  3QWY A;  3OA6 A;  2O9V A;  1OZ2 A;  4LUD A;  2CP2 A;  2MIO A;  3INZ A;  4OGE A;  3EFO A;  4IUT A;  4BE1 A;  1U8R A;  4N4I A;  3V7S A;  2FRY A;  4ZGE B;  3CCL Q;  3JB9 H;  4ORZ A;  3JCM b;  4Z02 A;  1M27 C;  2KEA A;  2RK2 A;  1YN8 A;  3X24 B;  2F5K A;  4FIB A;  3JCM W;  3M53 A;  2EYZ A;  2MK5 A;  3V8J A;  3FJ5 A;  2P4T A;  4MZP A;  1R0B G;  3LGL A;  1LJO A;  2H8H A;  2X4J A;  3QZ5 B;  1OOT A;  1KD1 R;  1EFN A;  2DE0 X;  1M3B A;  4QKU A;  1VQK T;  2I2L A;  4M78 A;  2LDM A;  4JRQ A;  1KD1 C;  1GL5 A;  1U3O A;  2RK1 A;  5GAM h;  4XTU A;  3OYM A;  1X75 C;  1QCF A;  4DBQ A;  5KH6 A;  3BDL A;  4N4H A;  3EGD A;  2ROT A;  3BW1 A;  2VC8 A;  3CCV T;  3X28 B;  1PRM C;  2EW3 A;  1MV3 A;  1FWZ A;  1N27 A;  1W2B S;  3L2Z A;  2QAS A;  2CYZ B;  2ZPE B;  4QQD A;  4OML A;  2ZZD A;  4QVD A;  2XU8 A;  3MP6 A;  1BB9 A;  3E9F A;  3OBY A;  3MPU B;  3QYG B;  2JMC A;  3EAE A;  3N5B B;  3VS0 A;  3DB3 A;  1D3B A;  2DEQ A;  1MNE A;  2RQU A;  1UG1 A;  2Y4X A;  1WXB A;  1N8R U;  2QEX T;  3R6N A;  1KQS S;  4F16 A;  3EGX B;  5CCA A;  2AKL A;  3GIB A;  3HKS A;  2GF7 A;  4C0G A;  4RTV A;  3SEM A;  4JLI A;  4XQ3 A;  2KRN A;  2RB6 A;  1AOJ A;  3GBQ A;  2KGT A;  3CXC P;  1AWX A;  3OYE A;  4A4F A;  1QCN A;  4J6Y A;  1VQK A;  3RES A;  5KYX A;  1TWB A;  3NTK A;  2HSP A;  1JEG A;  2JTF A;  3HTR A;  2ZPB B;  4RTX A;  3H0F A;  4RTZ A;  3R6O A;  4OMP A;  5GAO n;  3V8L A;  5FU7 C;  4MMK A;  2QA4 Q;  5D7U A;  3VUZ A;  1K8A C;  1Q7Y C;  1M90 C;  3JRZ A;  1BBZ A;  2ZAE A;  3CCV A;  1M2V B;  5CKD A;  2DEU A;  1D09 B;  4X34 A;  1MMN A;  4J9D A;  4J83 A;  3L2W A;  3CC7 A;  2YRD A;  2V8I A;  2O31 A;  3UA6 A;  4E47 A;  1VQ5 T;  2GFU A;  2KY9 A;  4FSX A;  3C95 A;  2YUP A;  4E7J A;  2EIF A;  4JS5 A;  4E7L A;  1GBQ A;  1I07 A;  2RI3 A;  2RHX A;  2WSF E;  2LNV A;  1VQN A;  1WHG A;  2YUN A;  3HRT A;  4OP0 A;  4M7A G;  4PFP A;  4PJO D;  3E19 A;  2EYX A;  2QQS A;  2A37 A;  5AT1 B;  3JB9 D;  2E70 A;  3I55 T;  1SEM A;  3OBW A;  4GLK A;  4KGZ B;  2YDL A;  5IN1 A;  1VA7 A;  2O88 A;  1CKB A;  1YWP A;  2JM9 A;  3CME T;  2BTT A;  1AWW A;  2OTL T;  1Q86 C;  3ULR B;  1CSK A;  4EMG A;  2EJ9 A;  1IXD A;  1JRI A;  2RHY A;  2RNA A;  2Z0W A;  3M56 A;  4PJO C;  2M0Y A;  2WAC A;  4PJJ A;  2KNB B;  1VQM A;  1M9S A;  4Y28 E;  2PUO B;  3SWN B;  4PJO F;  2WSE E;  4B9X A;  1YJ9 T;  3CCQ T;  3H41 A;  2DD4 A;  1KQ2 A;  4IIO A;  1K9M C;  1GBR A;  1W70 A;  1Z9Q A;  2QGG A;  4HVW A;  1NJI C;  4E2F B;  2XDB A;  4AMC A;  5FWC A;  2DZC A;  1FMK A;  2E10 A;  1WLP B;  1KHI A;  3SFM A;  3V8K A;  2L5Q A;  2X35 A;  1VQ5 A;  3EHR A;  1SRL A;  2K57 A;  5GAM j;  1OU9 A;  2LQ8 A;  5GAN 5;  5FU7 B;  2JVV A;  1JBM A;  5KCO A;  3HFO A;  4PJN A;  1YIJ A;  1S72 T;  5HY6 A;  3CCR Q;  3CBP A;  4D6W A;  2VGM A;  1BI1 A;  1ZA2 B;  1LNX A;  3CD6 Q;  1WHM A;  1AWJ A;  1YBY A;  2EGE A;  3CME A;  4RUG A;  1VQ8 T;  4F17 A;  3RMQ A;  1V76 A;  2OTL A;  2JJ9 A;  3UPU A;  1VIF A;  2L3Q A;  2CS7 A;  2RO0 A;  2P0Q A;  1QVF P;  5J26 A;  5GAN e;  2X4Y A;  4HVV A;  3BY7 A;  1M3A A;  5LJ5 f;  2K5I A;  1K73 R;  3EG9 B;  1D0X A;  2A28 A;  1WJQ A;  2RHU A;  5KYW B;  3OYK A;  1YJ9 A;  3CCQ A;  4UC4 A;  3CCS T;  2DL7 A;  2EQJ A;  1YJN A;  3OYA A;  1Y0M A;  4C5E A;  4QVZ A;  4PJO E;  2HDA A;  5GAN d;  1M30 A;  4AFS C;  1G3Y A;  1QVG P;  1N6A A;  2HMA A;  1M1K R;  2M9U A;  1WFW A;  3I5S A;  1ZHI A;  4EMK A;  5CKB A;  2O4X B;  1YCY A;  4PJO B;  1GFC A;  2EQI A;  4MML A;  3CCU Q;  1ZSZ C;  1E7O A;  3LGF A;  2L2P A;  1S72 A;  3MKD A;  3NGP A;  5FRO A;  1ARK A;  3CCJ T;  5FLX E;  2K4Y A;  1FMV A;  2QQR A;  4KBM B;  4N0A A;  2HQX A;  4AFU C;  5DM7 R;  2RQV A;  2D9T A;  2PUK B;  2JUF A;  4C8Q G;  4J6X A;  3M5A A;  1WNL A;  1VQ8 A;  4IUU A;  4HKE A;  3REB B;  3M0P A;  1H64 1;  2DIL A;  3M0R A;  4IUR A;  1RUW A;  3QII A;  4BUG A;  2L3S A;  1PSF A;  2SEM A;  4XAX B;  1VQ9 T;  1I8F A;  3U23 A;  4EPC A;  3DKM A;  3NTH A;  4C92 C;  1VQL A;  1PRL C;  2IPO B;  2M1H A;  3QHS A;  4C92 F;  3AT1 B;  3OS2 A;  3G1J A;  1M8V A;  3CCS A;  5GMK e;  4M7A A;  4PK4 A;  1QP3 A;  2H3J A;  1RAB B;  4KUI A;  2KT8 A;  2VGN A;  3TU4 K;  2DX1 A;  2LJ3 A;  3I56 Q;  1UGS B;  2XMF A;  1M5Q 1;  3PIO A;  4XTZ A;  5KYU A;  1TG0 A;  1OPL A;  3MHX A;  2JTM A;  1ZQ1 A;  3QBY A;  3CCJ A;  1YHQ A;  1BCM A;  4IKF A;  4J7I A;  2GTJ A;  2F2W A;  1GCQ A;  3CPW P;  2RJE A;  1YIT A;  3CC4 Q;  3I5R A;  3RKW A;  4F7U G;  3MJX A;  1UGQ B;  4JLG A;  2LQK A;  5I2S A;  4OB2 B;  4OMQ A;  3VS7 A;  4IUP A;  2M16 A;  1ABQ A;  1IRX A;  3HRU A;  4M78 G;  3OYC A;  4FW2 A;  2HD0 A;  3NMZ C;  3OS1 A;  1WGS A;  4DOV A;  4M75 D;  1RAH B;  4L6V 5;  1JJ2 S;  1ZSZ B;  3HFN A;  3M59 A;  3OMC A;  1D0Y A;  5LJ5 g;  2RM4 A;  4F04 B;  1QLY A;  3ASK A;  2QG9 B;  3MET A;  5ECA A;  2J6K A;  1WIE A;  4C5H A;  1QCO A;  2F69 A;  3VJP A;  1IHV A;  4FL6 A;  3G71 Q;  1QVG S;  4EIK A;  1SPK A;  4M75 C;  4FSS A;  3MO8 A;  2JXB A;  3HL8 A;  2X51 A;  2DIQ A;  3PE0 A;  1HSQ A;  5CKH A;  1SKU B;  4M75 F;  5CK9 A;  4A4H A;  2ZPH B;  3GF5 A;  4C92 B;  1XTD A;  3QDR B;  2DBK A;  2MWO A;  3ZFJ A;  3G6E T;  1X27 A;  4C0Z A;  1AHJ B;  2NWM A;  5IAY A;  2QEX Q;  3VV0 A;  3JCM e;  1S1N A;  1FXX A;  2JS0 A;  2V8K A;  4ZGJ B;  4QW2 A;  4M77 D;  1W2B P;  2C0O A;  1HYO A;  4XK8 E;  1RI0 A;  2GNC A;  2P0P A;  5KYN A;  3JCM Q;  2LRQ A;  3C94 A;  1G2B A;  3I35 A;  4DEX A;  3CMA Q;  3JCM P;  2COW A;  1PKT A;  2RA2 A;  5CQX A;  1I1J A;  1T0J A;  2KXD A;  1WJS A;  4FYY B;  1M2O A;  1BKB A;  2E4H A;  1KQS P;  4WF2 A;  8AT1 B;  3HHT B;  3CC2 T;  3MEU A;  2K5L A;  4HXJ A;  4M77 C;  1X6B A;  3UF4 A;  5IH2 A;  2EYQ A;  1KSW A;  2COY A;  4M77 F;  3A8M B;  1Q81 R;  4RTY A;  4C8Q A;  2YUO A;  4EDU A;  4PJM A;  2FG0 A;  2FPE A;  2ENM A;  4J9C A;  3T9N A;  1G3W A;  1YJW T;  3O5Z A;  2J7I A;  4FU6 A;  2EBP A;  1VQ7 Q;  4A54 A;  3G6E A;  1VQ5 Q;  1WHL A;  4HT9 A;  1VYU A;  4M75 E;  2X3X D;  1SHG A;  3DB4 A;  4M4Z A;  1WPY A;  1IZ6 A;  5GAM e;  2PVG B;  2OJ2 A;  2LT4 A;  5LJ3 j;  2CZ1 B;  3D7S B;  5HKC A;  2F5T X;  4M75 B;  2JW4 A;  2DPP B;  1BYM A;  2G6F X;  3I55 Q;  2EQU A;  4FM4 B;  3UA7 A;  1WA7 A;  2E6Z A;  1D1B A;  5KCH A;  4N4G A;  1UB4 A;  3EH2 A;  4LD9 K;  1RAG B;  1N8R C;  4OMN A;  1WZO A;  3LH5 A;  2W10 A;  3TVT A;  2QDY B;  1OX8 A;  1VQO Q;  2ABL A;  2CRE A;  1BI2 A;  1U06 A;  3E2U A;  4JZ3 A;  2E5Q A;  1WX6 A;  3CC2 A;  3ZBD A;  2JTE A;  4F7U A;  2EAY A;  5KE3 A;  3S3O A;  2CKK A;  2VUB A;  3GLX A;  3ZEH A;  1NE8 A;  5GMK j;  2CUB A;  4ESR A;  5GAN 7;  1FMW A;  1M1F A;  5LJ5 h;  2E65 A;  1TSF A;  1YJW A;  1JQQ A;  4M77 E;  1FYN A;  1Y07 A;  1AZG B;  4C5I A;  3PTA A;  4LDV A;  4MDW A;  5GJW B;  1D1A A;  2RN8 A;  2KRO A;  2MF2 A;  4IUQ A;  1I4K 1;  2LX9 A;  4B6M A;  4ANJ A;  4M77 B;  4KUL A;  4Y92 A;  1Q82 U;  4ATO A;  1X43 A;  4RG8 A;  2RI5 A;  2LNH B;  2HBP A;  3CC7 T;  2KBT A;  1FX7 A;  2FZK B;  2XK0 A;  3A8O B;  4OB0 B;  1N5Z A;  3PGG A;  2YWW A;  1JO8 A;  4GBQ A;  2SRC A;  2NUT B;  4OGC A;  2K9G A;  2PNI A;  4HT8 A;  1PSE A;  4AFQ C;  1WI7 A;  2FEI A;  2C06 A;  2RPN A;  3FIF A;  1WXU A;  1NPR A;  5KYY B;  1VQN T;  3M0Q A;  2BKD N;  2DRM A;  4CC7 A;  2EVR A;  2EYW A;  4PFZ A;  4OVA A;  2R5A A;  5FW9 A;  1Y71 A;  3C4S A;  2M0O A;  3J7A F;  3G4S T;  2V8J A;  1H92 A;  3NHN A;  3S3N A;  2QGF B;  3WVE B;  2RQR A;  4GY5 A;  1ABO A;  2CSI A;  2ZCF B;  2KXC A;  1X2Q A;  5A0G A;  4RKU E;  1JXO A;  1B34 B;  1VQ4 T;  3TSW A;  3QWX X;  1K8A R;  5GMK l;  3OYL A;  1Q7Y R;  4ME7 A;  1M90 R;  3OYY A;  1VQM T;  2MI6 A;  1K9A A;  1PD1 A;  4BD3 A;  1KJW A;  4CRI A;  1Q95 G;  1VQP A;  2I0N A;  2D8H A;  4BE2 A;  3L1A A;  4J9H A;  1M8M A;  1CKA A;  3CCJ Q;  2CZ6 B;  2O2O A;  2M02 A;  1KD1 U;  3KFV A;  2P0K A;  4MZT A;  3EGX A;  2Y4Y A;  1WHH A;  2RQT A;  2EPD A;  3FC3 A;  3UAT A;  1LCK A;  1VOM A;  1VYV A;  1XQH A;  1YIJ T;  1PG5 B;  2DYB A;  1SG5 A;  1VQ9 Q;  2A3L A;  1RAA B;  2W0Z A;  2HNI A;  1QWF A;  5GAN g;  3VYH B;  4NL2 A;  3G4S A;  4BI4 A;  2OTJ A;  4RTW A;  2KYB A;  2ZPF B;  1Q86 R;  5A0L A;  4Y91 A;  1G3S A;  4X1V A;  1G83 A;  1GCP A;  3QUI A;  3VS4 A;  4M7A D;  5L23 A;  2JN0 A;  1M2V A;  2MOX A;  3QKJ A;  1VQ4 A;  4IUV A;  2B8A A;  1K76 A;  2NUZ A;  3RNJ A;  5GMK i;  2LQW A;  4JJC A;  2KSS A;  1NYF A;  1K9M R;  1MUZ A;  1VIE A;  3JB9 F;  3CCL T;  4J9F A;  1NJI R;  1YJN T;  4M7A C;  1UGP B;  3C0C A;  2DAQ A;  4JDS A;  2AZS A;  3CBO A;  1UFF A;  4PNO A;  3CCE Q;  4JJB A;  5LL6 S;  3JCM X;  4VUB A;  2EJF A;  2AZV A;  3CCM Q;  3EG1 A;  2EGC A;  2GFA A;  4O5V A;  3MEA A;  1NLP C;  4J5Y A;  2PZ1 A;  4E7I A;  3FDR A;  2COZ A;  2DM1 A;  2E3I A;  2LCS A;  1RLP C;  1C6V X;  5EG2 A;  1NZ9 A;  2BZ8 A;  1G3T A;  1G8X A;  4HA8 A;  2QQA A;  3QDF A;  1MMA A;  5C6S A;  2DJZ A;  2DRK A;  4HVU A;  1RAI B;  3OS0 A;  1GCQ C;  3OQ5 A;  3SWN A;  3VRY A;  2QQ9 A;  2K2V A;  2DLP A;  2DMO A;  2FZG B;  2YHT A;  1QWE A;  1VQL T;  1WHK A;  1JJ2 P;  2X9H A;  4L5G A;  2V1Q A;  3OW2 A;  1WQW A;  2OI3 A;  3CCL A;  4LDW A;  3QG1 A;  2LP5 A;  2DL8 A;  3RUX A;  5AYF A;  3OYG A;  1WXT A;  3G6E Q;  4QT7 A;  3I9Q A;  2ESW A;  4J8O A;  2YLC A;  4BY6 C;  1UEC A;  1JU5 C;  3A5Z B;  5GJV B;  2HBW A;  3KBG A;  3NPF A;  1KC8 U;  2BE7 D;  3LW5 E;  1GFD A;  2DYI A;  1E6G A;  1T3L A;  1PD0 A;  5GAN 3;  2AK5 A;  2HCK A;  2P84 A;  4L59 A;  3URG A;  4M7A E;  3VU3 C;  5LJ3 e;  1NYG A;  4A53 A;  1QVP A;  4R0K A;  5HCK A;  1YHQ T;  1JXM A;  1EX4 A;  2DNU A;  4C92 G;  1YIT T;  3H9N A;  3EG9 A;  3FJP A;  1I81 A;  1KFZ A;  5KYW A;  5LJ3 d;  3CC2 Q;  2RHZ A;  2DVE A;  2E1H A;  3O8V A;  3VUB A;  1E6H A;  3H6Z A;  2GQI A;  4C8Q D;  3CBM A;  2GTO A;  1PNJ A;  5FWB A;  4J9B A;  2BUD A;  2O4X A;  2AKK A;  2BZX A;  4PJO A;  3RKX A;  2CP5 A;  4IIM A;  4Z88 A;  1VUB A;  4M7D G;  2LX7 A;  1HD3 A;  2JMA A;  2L89 A;  1K1Z A;  5HK0 A;  4A4G A;  4ZN3 A;  4BDY A;  1K0S A;  3OSS C;  3CXC A;  4CC2 A;  1TUD A;  2LT1 A;  1K73 U;  2KDS A;  1VQ6 T;  2DFU A;  2CP3 A;  2AHJ B;  2QXF A;  1PCX A;  3IQL A;  3LYI A;  3M9Q A;  3OYN A;  5IXB A;  2P4R A;  1XJW B;  2QA4 A;  2L8D A;  1YWO A;  4BY6 B;  2XDD A;  2A7Y A;  2QTV A;  2EJG A;  3KXT A;  5L8R E;  1TU0 B;  4XU3 A;  1M1K U;  2G3R A;  2KAF A;  1V29 B;  3QO3 A;  3VRZ A;  1MGQ A;  2YRV A;  2O01 E;  1SSH A;  2A08 A;  2DXC A;  4FYX B;  1VQK Q;  3EGU A;  3G7Z A;  2DJQ A;  1BU1 A;  1NG2 A;  4M78 D;  3REA B;  1LOJ A;  1OEB A;  1OPK A;  2ZGW A;  2KE9 A;  7AT1 B;  2GQV A;  3TCJ A;  4E7K A;  2YSQ A;  4R56 A;  2PQW A;  3CCV Q;  1QQJ A;  3CD6 T;  4BDZ A;  2ED0 A;  3LH0 A;  2BZY A;  1VYT A;  1OUL A;  4BB7 A;  5IHN A;  3MCA B;  4WTO B;  4NL3 A;  3QPH A;  4M78 C;  3CC7 Q;  4CC4 B;  2LCL A;  1VQ6 A;  1Y7X A;  3F70 A;  4M78 F;  2LC4 A;  2XI9 A;  4LDY A;  3UDC A;  3OYJ A;  3GOX A;  4D8K A;  4ZN1 A;  2NUP B;  3DLM A;  3TRE A;  1Y96 B;  3L2U A;  5I2M A;  1OZ3 A;  1T0H A;  1VQN Q;  1ZBJ A;  2DZ9 A;  1X2K A;  2HKN A;  2HQE A;  2AIR B;  5DY9 A;  2EQK A;  3VS5 A;  3VS1 A;  1LVK A;  2YLB A;  2CDT A;  1ACM B;  5A2Q E;  5FU6 C;  2E12 A;  5IHI A;  3ME9 A;  2HL3 A;  3EG0 A;  2L3R A;  2YT6 A;  1N9S A;  3QSU A;  5IXF A;  3TSZ A;  3GNG A;  2MWP A;  3EHQ A;  2K5F A;  3JCM d;  5GAO p;  2RQW A;  4C92 A;  1VQM Q;  1OX9 A;  2KI7 A;  2EKO A;  3RMS A;  1U5S A;  3PT9 A;  4KT0 E;  3CD6 A;  1TUC A;  2HQH A;  2KK4 A;  2VXE A;  4BE0 A;  1IB8 A;  4OB1 B;  3OYD A;  3BE3 A;  3NFC A;  1PWT A;  3OS5 A;  3QXE B;  1QVF A;  3EFO B;  5FRN A;  2KRM A;  5I22 A;  2CGH A;  4HCZ A;  1PC0 A;  2K3B A;  5LJ5 e;  3LX7 A;  2O9S A;  1Q82 C;  3WVD B;  4KGX B;  5A0D A;  5CR2 A;  1YI2 T;  1IGQ A;  4LNP A;  1YIJ Q;  2D0N A;  1SRM A;  4M78 E;  3LWI A;  3RDV A;  1XOV A;  4M7D A;  1EZZ B;  3THK A;  3AHU A;  1WQ7 A;  3OMG A;  2JOY A;  3RBB B;  4JRK A;  1N8R R;  4MZM A;  2CH4 A;  2NLU A;  4JUV A;  2KR3 A;  3M58 A;  4QQ6 A;  3I56 T;  1KK7 A;  2GCX A;  4M78 B;  1UTI A;  1W6X A;  1AWO A;  1BIA A;  1JB0 E;  4D8D A;  3JB9 I;  3CME Q;  2KVQ G;  2CP6 A;  5GAM d;  2OTL Q;  1OI1 A;  1RL2 A;  2MAM A;  1O75 A;  3GP8 A;  4BI8 B;  5GAN f;  3CCU A;  2AT1 B;  3PVQ A;  3EGD B;  2VXF A;  1U1T A;  2CP7 A;  4FCY A;  3JCM V;  1UJY A;  1AVZ C;  3M0S A;  1YJ9 Q;  3CCQ Q;  2X4W A;  3OY9 A;  2VWF A;  1UUE A;  2FYK A;  2LTO A;  3OW2 P;  3CC4 T;  2OAW A;  3GNF B;  3EFR A;  1YJN Q;  1UDL A;  1R8O B;  5GAN 4;  1A0N B;  3VYG A;  2LQN A;  3E1S A;  9ATC B;  1PHT A;  1KHC A;  3P8D A;  5FU6 B;  3OSV A;  2CZ0 B;  4M75 A;  4FT4 A;  1D3B B;  3QJY A;  2J6F A;  2MMP A;  1KIK A;  2QDL A;  3P8B B;  1KG1 A;  3X20 B;  3MEW A;  5LJ3 f;  1VQP T;  1D1C A;  1YI2 A;  2HKQ B;  2VB6 A;  2IG0 A;  1S72 Q;  1BI3 A;  1SSF A;  1TH7 A;  1H3Z A;  1Q81 U;  4E7Z A;  2YRC A;  1K4U S;  4FYW B;  3VS6 A;  2EKH A;  1UGV A;  4JZ4 A;  4AG2 C;  4PLI A;  3HPW A;  3G71 T;  3JCM J;  5J3B A;  4ZGD B;  3FB9 A;  3I56 A;  5KYX B;  3V7C A;  2GGR A;  1VQ8 Q;  4KH1 B;  1QW1 A;  2A0F B;  4AFZ C;  1J3T A;  2K79 A;  5HK3 A;  4CC3 A;  2K3X A;  4OB3 B;  2MPX C;  5CIU A;  1VQL Q;  3PVL A;  3VKI A;  5CAI A;  2OTJ T;  4EMH A;  3CPW A;  5CKF A;  1T3S A;  2F2X A;  3CCS Q;  4NS5 A;  3J81 E;  3CC4 A;  3RIR A;  5EC7 A;  3SWN C;  4M77 A;  3A8L B;  8ATC B;  1UHC A;  2VKN A;  4NOY A;  2EGA A;  1G5V A;  3MP8 A;  4LUE A;  4XU1 A;  4C0D C;  2IIM A;  2OX7 A;  4KUD K;  4C5G A;  1NEG A;  4PKC C;  5GAO r;  3CMA T;  1IO6 A;  4YTL A;  3M4G A;  3M54 A;  2NUT A;  4PL6 A;  2J6O A;  3PMI A;  1NM7 A;  1TUG B;  3L42 A;  4GLM A;  3SB2 A;  4FT2 A;  1YHQ Q;  1ZX6 A;  5KYY A;  2FRW A;  1YIT Q;  1R0C B;  3G71 A;  4LXC A;  3X25 B;  3RKY A;  2JS2 A;  2FPF A;  4EMK C;  1SHF A;  5J39 A;  4AT1 B;  1BCO A;  1YFN A;  3PIP A;  1B34 A;  1VQ7 T;  4PJO G;  2E6N A;  4CI0 C;  2DL4 A;  3JB9 G;  2DO3 A;  1AZE A;  3OW2 S;  1MHN A;  1N9R A;  1QKW A;  4QVC A;  4N0A C;  1IHW A;  4HCC A;  1ZBX A;  2QEX A;  1M1G A;  3A1P A;  5IHK A;  1PM3 A;  4LDU A;  4F14 A;  1W2B A;  1OQK A;  1QMC A;  3VS3 A;  2Y90 A;  4MDX A;  2HEQ A;  2QAZ A;  2DTO A;  2J06 A;  1W4S A;  1YNZ A;  2RI2 A;  3CMA A;  1NBE B;  2FZC B;  1KC8 R;  1ZLM A;  2LMJ A;  4AG1 C;  1RAD B;  1VQ6 Q;  3OB9 A;  1VQO T;  4KRT A;  5LJ3 g;  1KQS A;  4RCB A;  1KC8 C;  1RAF B;  5D6X A;  4M7A F;  2CUD A;  5LJ5 j;  4KGV B;  1MV0 B;  3TQ7 P;  3FEO A;  3DLL A;  3OYB A;  5GMK m;  2LVM A;  3QZ9 B;  4JPB W;  4PLL A;  3JCM f;  1K8A U;  4ZNX A;  4XU0 A;  2WSC E;  1Q7Y U;  1M90 U;  1ZUK A;  4A63 B;  2VYT A;  4C0D B;  1TOV A;  3JB9 J;  4OMO A;  2LJ1 A;  3A8G B;  3H0H A;  4WCI A;  5D6W A;  1ZUU A;  1VQ7 A;  1RI9 A;  2PVD B;  2DIG A;  1LPL A;  2VV5 A;  2K3Y A;  1ZA1 B;  3EG3 A;  1U1S A;  1MMG A;  2DL3 A;  4Z89 A;  1M4Z A;  3OYF A;  4PFO A;  1BIB A;  2GBQ A;  3JCM c;  1NEB A;  5GAN 8;  5CQY A;  4LN2 A;  3ZL7 C;  1IRE B;  3CQT A;  1V1C A;  3QYH B;  2DET A;  3M4Y A;  1RAC B;  4RMO A;  1W1F A;  2MCN A;  2HZY A;  5GAN 2;  4EMK B;  2DKG A;  3I55 A;  3CXC S;  2DBM A;  2YUQ A;  2RJF A;  1BK2 A;  1AT1 B;  1QKX A;  3C12 A;  4RTT A;  3VS2 A;  2FVU A;  3M0T A;  3H0I A;  1AD5 A;  2D1X A;  2DER A;  1VQO A;  2K6D A;  4XTW A;  1HJD A;  1D0Z A;  2K2M A;  1Q86 U;  4A4E A;  4HCK A;  2E5K A;  3JSC A;  4XTY A;  1X6G A;  2XG8 D;  4DA4 A;  2FO0 A;  2KRS A;  5GAM f;  1Z9Z A;  4DBH A;  1TS9 A;  1K73 C;  1BI0 A;  1UEB A;  1UE9 A;  2EWN A;  1I0C A;  2KMT A;  4Z8A A;  4JJN K;  1K9M U;  3M55 A;  2JM8 A;  4OMF B;  2DXU A;  1H8K A;  3H8Z A;  2IVW A;  1UGR B;  4J7F A;  2F1L A;  1X01 A;  4Q5W A;  1NJI U;  2EYY A;  2H3E B;  2QA4 T;  2ATC B;  4M7A B;  2XD0 A;  2E41 A;  2CP0 A;  1B07 A;  4E6R A;  1M1K C;  2FL7 A;  3UWN A;  3KUF A;  1P92 A;  1X69 A;  2RJD A;  3M0U A;  4DBF A;  4II1 A;  4C92 D;  1WHJ A;  1YP5 A;  2XKO C;  2C0I A;  1WYX A;  4DOW A;  5KYU B;  3E9G A;  5GAN h;  2DF6 A;  4R55 A;  2VVK A;  2KT1 A;  2FHD A;  4E7S A;  3L2V A;  1YJW Q;  3ER0 A;  3BFM A;  1I5O B;  1UJ0 A;  4V2S A;  2LCC A;  5C0M A;  5CO7 A;  3UT1 A;  2QTX A;  4FW1 A;  2JZ2 A;  3MP1 A;  2V26 A;  4DBR A;  1MMD A;  1TTH B;  1C1A A;  2E64 A;  3PNW C;  4XTV A;  1YI2 Q;  2HL5 C;  2X3W D;  4C8Q C;  1OU8 A;  2M51 A;  2L3P A;  2EQM A;  4C8Q F;  2QQB A;  3MEV A;  5GAO q;  3JCM g;  2E3H A;  2KQW A;  4M7D D;  2BE9 B;  4RCC A;  5LJ3 h;  2ECZ A;  4DQ2 A;  2DA9 A;  2XDP A;  3HP9 A;  3TEE A;  3FLG A;  4PJL A;  1K0X A;  2ROL A;  3S6W A;  3V7R A;  3SD4 A;  1GRI A;  1HK9 A;  4A4K A;  5I21 A;  3SDZ A;  2CH4 W;  3L2Q A;  5DLO A;  4OMM A;  2RH2 A;  3QJ6 A;  2RD1 A;  2K7A A;  2CT4 A;  2R58 A;  3X26 B;  1RAE B;  3OYH A;  4M7D C;  1MND A;  3GPL A;  2DTI A;  3HRS A;  2RJC A;  4M7D F;  4M75 G;  3CCE T;  3BDU A;  2DK3 A;  3CCM T;  4ELY C;  1YCS B;  2OAU A;  2NYS A;  1TXQ A;  1QVF S;  5M9O A;  2EFI A;  1ZSG A;  2PTK A;  1UHF A;  1QP2 A;  3FRN A;  5GMK h;  1Y57 A;  3CCR T;  2ZPG B;  1VQ9 A;  2DD5 A;  1H3H A;  3RER A;  4JRP A;  4J9I A;  1XNI A;  3A98 A;  2L0A A;  2D8J A;  3HSB A;  1B7T A;  1VQP Q;  2J05 A;  1I5L A;  2VAS A;  1GXI E;  4JRI A;  2QYZ A;  1SF9 A;  4TVR A;  2DXT A;  5GAM g;  2JT4 A;  4F7U F;  4C0F A;  2DTH A;  2MYS A;  4J9E A;  2KYM A;  1O9S A;  2A36 A;  1WJR A;  3CPF A;  2QI2 A;  4C92 E;  3S3M A;  5KE2 A;  1DJ7 B;  4P5N A;  3EH1 A;  4LE9 A;  4B9W A;  3JV3 A;  4DEY A;  4C8Q E;  4JS4 A;  3PFS A;  2CT3 A;  4HCB A;  4J6W A;  1ZSZ A;  2V1R A;  4BI3 A;  3JAM E;  1R77 A;  5GAO l;  1EIF A;  4ZTF A;  2RMO A;  3Q1J A;  2DXB A;  3SHW A;  2F2V A;  2XID A;  4M77 G;  4C8Q B;  3G4S Q;  1NLO C;  2OTJ Q;  4K11 A;  4LDX A;  4ELZ C;  2FB7 A;  5IT9 E;  1RLQ C;  3CCE A;  5DLQ E;  4LD6 A;  2CZ7 B;  4OF1 A;  2QK0 A;  3EFS A;  1OV3 A;  1NPP A;  2D0Q B;  2R5M A;  3NTI A;  3CCM A;  4KH0 B;  5I11 A;  1VQ4 Q;  1ZUY A;  2R57 A;  2C0T A;  3CCU T;  3L2R A;  2ZPI B;  1KQ1 A;  4M7D E;  3P8H A; 
#chains in the Genus database with same CATH homology
 3OS2 A;  4JDS A;  1M8V A;  3CBO A;  3CCR A;  3LWH A;  5GMK e;  1QW1 A;  4XTX A;  3CCS A;  4M7A A;  2XHC A;  1QP3 A;  4PNO A;  2XIC A;  5HK3 A;  3OYI A;  2H3J A;  4KUI A;  5LL6 S;  3JCM X;  4VUB A;  2EJF A;  4X9D A;  2K3X A;  4OB3 B;  2VGN A;  2BIV A;  2GFA A;  4O5V A;  4M7D B;  5CIU A;  3MEA A;  3TU4 K;  4J5Y A;  1Y96 A;  4E7I A;  3PMT A;  5FRM A;  3FDR A;  5D6Y A;  3VKI A;  5CAI A;  2OTJ T;  4EMH A;  3M57 A;  3CPW A;  5GAN j;  5EG2 A;  4ZTJ A;  3CEY A;  5CKF A;  1NZ9 A;  1UGS B;  4NS5 A;  3J81 E;  3J80 E;  3CC4 A;  1M5Q 1;  3LLR A;  3RIR A;  3PIO A;  1G3T A;  4HA8 A;  4XTZ A;  2HAX A;  3SWN C;  2QQA A;  4O6J A;  2JNG A;  4M77 A;  3MHX A;  3A8L B;  4F7U E;  5C6S A;  1JJ2 A;  2JTM A;  1ZQ1 A;  2DJZ A;  5CVI A;  3QBY A;  4X9C A;  3OS0 A;  4NOY A;  4RG2 A;  3OQ5 A;  3SWN A;  3CCJ A;  1G5V A;  1Q81 C;  1YHQ A;  3MP8 A;  4IKF A;  2D6F A;  2QQ9 A;  4XU1 A;  4J7I A;  4C0D C;  5GAN 6;  4BAC A;  2K2V A;  2X4X A;  2RJE A;  1YIT A;  4KUD K;  4C5G A;  4PKC C;  5CKE A;  3RKW A;  5GAO r;  4F7U B;  3CMA T;  4F7U G;  4YTL A;  1UGQ B;  3M4G A;  3M54 A;  4JLG A;  2YHT A;  2LQK A;  4PL6 A;  3JCM h;  4XU2 A;  3PMI A;  3L42 A;  5I2S A;  3CPW S;  2RHI A;  4OB2 B;  3SB2 A;  1QVG A;  4FT2 A;  1VQL T;  5LJ5 d;  4IUP A;  2M16 A;  3WXM B;  4L5G A;  1OYX A;  3HRU A;  4M78 G;  1HXD A;  3OYC A;  3OW2 A;  4E7H A;  1WQW A;  2HD0 A;  4QQG A;  3OS1 A;  1X6O A;  1WGS A;  3CCL A;  4DOV A;  4LDW A;  4M75 D;  3QG1 A;  4L6V 5;  1JJ2 S;  2PU9 B;  3HFN A;  3M59 A;  5AYF A;  3RUX A;  3G71 A;  2PVO B;  3OYG A;  3OMC A;  3A8H B;  5LJ5 g;  4J8O A;  3X25 B;  2RM4 A;  2YLC A;  5GAO m;  4BY6 C;  3RKY A;  3A5Z B;  3OA6 A;  1OZ2 A;  3KBG A;  3ASK A;  3INZ A;  4OGE A;  4EMK C;  4IUT A;  4BE1 A;  1KC8 U;  3MET A;  1U8R A;  4N4I A;  5J39 A;  3V7S A;  3LW5 E;  4C5H A;  4ZGE B;  3PIP A;  3JB9 H;  2F69 A;  1B34 A;  3JCM b;  3VJP A;  1VQ7 T;  4FL6 A;  4Z02 A;  1QVG S;  4PJO G;  2E6N A;  5GAN 3;  2RK2 A;  4L59 A;  3URG A;  4CI0 C;  4M75 C;  3VU3 C;  5LJ3 e;  3JB9 G;  3X24 B;  2F5K A;  3MO8 A;  4M7A E;  2DO3 A;  4FIB A;  3HL8 A;  3JCM W;  2DIQ A;  3M53 A;  3OW2 S;  1MHN A;  1N9R A;  1QVP A;  5CKH A;  4A53 A;  3V8J A;  4M75 F;  4QVC A;  5CK9 A;  4N0A C;  2P4T A;  1YHQ T;  4A4H A;  1ZBX A;  4HCC A;  2ZPH B;  4MZP A;  3LGL A;  2QEX A;  1M1G A;  1LJO A;  3GF5 A;  4C92 B;  4C92 G;  1XTD A;  3QDR B;  1YIT T;  2X4J A;  4LDU A;  1W2B A;  2MWO A;  3QZ5 B;  3ZFJ A;  3G6E T;  2Y90 A;  3FJP A;  4MDX A;  1VQK T;  2I2L A;  4M78 A;  1I81 A;  4C0Z A;  2LDM A;  4JRQ A;  1AHJ B;  2DTO A;  5LJ3 d;  1KD1 C;  2RHZ A;  2RK1 A;  1W4S A;  2RI2 A;  5GAM h;  4XTU A;  3CMA A;  3OYM A;  1X75 C;  2DVE A;  5KH6 A;  2E1H A;  3BDL A;  5IAY A;  3O8V A;  4N4H A;  3VV0 A;  3JCM e;  3OB9 A;  1VQO T;  1FXX A;  2V8K A;  4ZGJ B;  3BW1 A;  5LJ3 g;  4QW2 A;  3VUB A;  4RCB A;  3H6Z A;  1KQS A;  4M77 D;  2VC8 A;  4C8Q D;  3CCV T;  3CBM A;  4XK8 E;  5D6X A;  1KC8 C;  1RI0 A;  3X28 B;  2P0P A;  4M7A F;  3JCM Q;  5LJ5 j;  2LRQ A;  3C94 A;  1FWZ A;  1N27 A;  3FEO A;  3DLL A;  2BUD A;  2O4X A;  5GMK m;  3OYB A;  3JCM P;  1W2B S;  4PJO A;  3L2Z A;  2LVM A;  2RA2 A;  2CYZ B;  5CQX A;  2ZPE B;  4QQD A;  3RKX A;  1WJS A;  3QZ9 B;  2ZZD A;  4QVD A;  4PLL A;  2XU8 A;  3JCM f;  3MP6 A;  3E9F A;  1K8A U;  1BKB A;  1VUB A;  3OBY A;  4XU0 A;  2WSC E;  3QYG B;  1Q7Y U;  2L89 A;  1M90 U;  4M7D G;  5HK0 A;  4A4G A;  2VYT A;  4C0D B;  4ZN3 A;  4BDY A;  3EAE A;  3N5B B;  3OSS C;  3CXC A;  4WF2 A;  3DB3 A;  3HHT B;  1D3B A;  2DEQ A;  3JB9 J;  3MEU A;  2K5L A;  4M77 C;  3CC2 T;  3A8G B;  5D6W A;  2Y4X A;  2EYQ A;  1VQ7 A;  1N8R U;  2PVD B;  2LT1 A;  2QEX T;  2DIG A;  3A8M B;  4M77 F;  1KQS S;  1K73 U;  4C8Q A;  2VV5 A;  2K3Y A;  2KDS A;  1VQ6 T;  1U1S A;  1M4Z A;  5CCA A;  4EDU A;  4C92 F;  3OYF A;  3HKS A;  2GF7 A;  3GIB A;  2AHJ B;  1BIB A;  3JCM c;  4C0G A;  5GAN 8;  2QXF A;  4JLI A;  5CQY A;  4XQ3 A;  3T9N A;  2RB6 A;  3LYI A;  3M9Q A;  3OYN A;  1G3W A;  1IRE B;  1YJW T;  2QA4 A;  3QYH B;  3M4Y A;  2L8D A;  4FU6 A;  4A54 A;  3OYE A;  4A4F A;  4BY6 B;  3G6E A;  2XDD A;  4J6Y A;  4RMO A;  5GAN 2;  1VQK A;  2A7Y A;  3RES A;  4M75 E;  4HT9 A;  4EMK B;  2DKG A;  3I55 A;  3CXC S;  2EJG A;  3NTK A;  3KXT A;  5L8R E;  2JTF A;  2ZPB B;  2RJF A;  4XU3 A;  1M1K U;  3DB4 A;  1WPY A;  3C12 A;  2G3R A;  1IZ6 A;  2KAF A;  5GAM e;  1V29 B;  3QO3 A;  3R6O A;  2PVG B;  5GAO n;  2FVU A;  1MGQ A;  2YRV A;  2LT4 A;  3V8L A;  5LJ3 j;  5FU7 C;  2CZ1 B;  5HKC A;  4MMK A;  2O01 E;  2F5T X;  4M75 B;  3VUZ A;  1VQO A;  1K8A C;  1Q7Y C;  1M90 C;  4XTW A;  2DXC A;  3JRZ A;  2DPP B;  3CCV A;  1BYM A;  1Q86 U;  2EQU A;  4A4E A;  5CKD A;  3G7Z A;  3JSC A;  4FM4 B;  2E6Z A;  4LD9 K;  4XTY A;  1UB4 A;  4N4G A;  2XG8 D;  5KCH A;  4DA4 A;  4M78 D;  4X34 A;  5GAM f;  4J83 A;  1N8R C;  3L2W A;  1LOJ A;  3CC7 A;  1K73 C;  2V8I A;  2ZGW A;  2QDY B;  2GQV A;  3TCJ A;  4E47 A;  1BI0 A;  1UEB A;  4E7K A;  1BI2 A;  1VQ5 T;  2GFU A;  4R56 A;  2KY9 A;  2PQW A;  4FSX A;  2E5Q A;  2EWN A;  3C95 A;  3CD6 T;  4JJN K;  2KMT A;  4E7J A;  1K9M U;  4BDZ A;  2EIF A;  3M55 A;  3ZBD A;  3LH0 A;  4OMF B;  4JS5 A;  2DXU A;  4E7L A;  3H8Z A;  2IVW A;  1UGR B;  2RI3 A;  2RHX A;  2WSF E;  4J7F A;  2LNV A;  4BB7 A;  4F7U A;  2EAY A;  1X01 A;  5KE3 A;  3S3O A;  3MCA B;  4Q5W A;  4NL3 A;  3HRT A;  1NJI U;  1VQN A;  3J7A F;  3QPH A;  4M78 C;  2QA4 T;  2CKK A;  4OP0 A;  4M7A B;  2VUB A;  3GLX A;  2LCL A;  4M7A G;  3ZEH A;  1VQ6 A;  2XD0 A;  1Y7X A;  2E41 A;  4PJO D;  3E19 A;  1NE8 A;  2QQS A;  5GMK j;  3F70 A;  4M78 F;  1M1K C;  5GAN 7;  2LC4 A;  2E70 A;  2XI9 A;  4LDY A;  2FL7 A;  1M1F A;  3UDC A;  3OYJ A;  3I55 T;  5LJ5 h;  3GOX A;  2E65 A;  3OBW A;  4GLK A;  3UWN A;  4ZN1 A;  3KUF A;  1P92 A;  2RJD A;  3DLM A;  1YJW A;  4M77 E;  1Y96 B;  5IN1 A;  3TRE A;  5I2M A;  3L2U A;  1OZ3 A;  1Y07 A;  4C5I A;  3CME T;  3PTA A;  4II1 A;  2DZ9 A;  4LDV A;  4C92 D;  2OTL T;  4MDW A;  1Q86 C;  2XKO C;  4DOW A;  2MF2 A;  2HQE A;  4IUQ A;  1I4K 1;  3E9G A;  5GAN h;  4R55 A;  2LX9 A;  4EMG A;  2EJ9 A;  1JRI A;  2RHY A;  4M77 B;  4KUL A;  2FHD A;  3M56 A;  5DY9 A;  3L2V A;  4PJO C;  2WAC A;  1Q82 U;  2EQK A;  4ATO A;  3ER0 A;  3CC2 A;  1VQM A;  1M9S A;  2YLB A;  3BFM A;  4Y28 E;  2PUO B;  3SWN B;  4RG8 A;  4PJO F;  5A2Q E;  4V2S A;  2LCC A;  2RI5 A;  2WSE E;  5FU6 C;  2E12 A;  4B9X A;  5C0M A;  1YJ9 T;  2HBP A;  5CO7 A;  3UT1 A;  3CCQ T;  2QTX A;  3CC7 T;  1FX7 A;  3ME9 A;  2XK0 A;  3A8O B;  2JZ2 A;  2L3R A;  4OB0 B;  1N9S A;  3QSU A;  3PGG A;  2DD4 A;  1KQ2 A;  3MP1 A;  1K9M C;  3GNG A;  2MWP A;  2K5F A;  3JCM d;  2E64 A;  3PNW C;  4OGC A;  4XTV A;  1NJI C;  5GAO p;  2XDB A;  4C8Q C;  4C92 A;  4HT8 A;  4HCB A;  1PSE A;  2DZC A;  2E10 A;  1KHI A;  2C06 A;  3SFM A;  3FIF A;  2L5Q A;  1NPR A;  2EQM A;  2X35 A;  3V8K A;  4C8Q F;  1VQ5 A;  1VQN T;  2QQB A;  3MEV A;  5GAO q;  2K57 A;  3JCM g;  2EKO A;  3RMS A;  2BKD N;  5GAM j;  2LQ8 A;  4OVA A;  3PT9 A;  4KT0 E;  5GAN 5;  3OYD A;  2KQW A;  3CD6 A;  4M7D D;  2R5A A;  2KK4 A;  1Y71 A;  2VXE A;  4RCC A;  4BE0 A;  3C4S A;  2M0O A;  4OB1 B;  5FU7 B;  2JVV A;  1JBM A;  5LJ3 h;  3HFO A;  4DQ2 A;  5KCO A;  3NFC A;  2XDP A;  2V8J A;  3HP9 A;  3TEE A;  3G4S T;  3S3N A;  1YIJ A;  3FLG A;  3OS5 A;  1S72 T;  3WVE B;  5HY6 A;  3QXE B;  3CBP A;  3S6W A;  1QVF A;  4D6W A;  4GY5 A;  5FRN A;  2CGH A;  4HCZ A;  2VGM A;  2ZCF B;  3V7R A;  3SD4 A;  1HK9 A;  4A4K A;  5A0G A;  3SDZ A;  5I21 A;  4RKU E;  1BI1 A;  5LJ5 e;  1B34 B;  3LX7 A;  1LNX A;  3L2Q A;  5DLO A;  1VQ4 T;  1Q82 C;  2RH2 A;  3QJ6 A;  3WVD B;  2RD1 A;  2R58 A;  5A0D A;  3X26 B;  1YBY A;  5GMK l;  5CR2 A;  3OYL A;  3OYH A;  1YI2 T;  4ME7 A;  4M7D C;  3CME A;  3OYY A;  1VQ8 T;  3RMQ A;  1VQM T;  3GPL A;  2MI6 A;  2DTI A;  4M78 E;  3HRS A;  3LWI A;  2RJC A;  2OTL A;  4M7D F;  3JB9 D;  1XOV A;  4M75 G;  1VIF A;  3UPU A;  3CCE T;  2CS7 A;  2RO0 A;  4M7D A;  2P0Q A;  3AHU A;  1WQ7 A;  3OMG A;  2JOY A;  3BDU A;  2DK3 A;  5J26 A;  4BD3 A;  4CRI A;  5GAN e;  2X4Y A;  3BY7 A;  4JRK A;  1VQP A;  3CCM T;  4MZM A;  5LJ5 f;  4ELY C;  2K5I A;  4BE2 A;  2OAU A;  2NLU A;  3L1A A;  4JUV A;  3M58 A;  4QQ6 A;  3I56 T;  1QVF S;  2CZ6 B;  2GCX A;  4M78 B;  1WJQ A;  2RHU A;  5M9O A;  2EFI A;  3OYK A;  1VQP T;  1BIA A;  1JB0 E;  3JB9 I;  1YJ9 A;  2KVQ G;  3CCQ A;  5GAM d;  1QP2 A;  3FRN A;  4UC4 A;  5GMK h;  1OI1 A;  1RL2 A;  2P0K A;  2ZPG B;  3CCR T;  3CCS T;  1KD1 U;  4MZT A;  1VQ9 A;  2DD5 A;  2EQJ A;  1YJN A;  2MAM A;  1O75 A;  3RER A;  2Y4Y A;  3GP8 A;  4JRP A;  4BI8 B;  1XNI A;  5GAN f;  3HSB A;  3CCU A;  3OYA A;  4C5E A;  4QVZ A;  2VXF A;  1I5L A;  4PJO E;  1U1T A;  5GAN d;  4JRI A;  1GXI E;  4TVR A;  3JCM V;  2DXT A;  5GAM g;  4F7U F;  1G3Y A;  3FC3 A;  4C0F A;  2DTH A;  1N6A A;  1XQH A;  1YIJ T;  2M9U A;  2X4W A;  3OY9 A;  1ZHI A;  4EMK A;  2FYK A;  1O9S A;  2A3L A;  1WJR A;  2LTO A;  5CKB A;  3GNF B;  3CPF A;  3EFR A;  2O4X B;  3CC4 T;  1YCY A;  2HNI A;  5GAN g;  2QI2 A;  4PJO B;  1R8O B;  4C92 E;  5GAN 4;  4MML A;  3VYH B;  4NL2 A;  3VYG A;  3E1S A;  3S3M A;  5KE2 A;  1DJ7 B;  3G4S A;  3LGF A;  4P5N A;  4BI4 A;  1KHC A;  2OTJ A;  3P8D A;  4B9W A;  2ZPF B;  1S72 A;  5FU6 B;  5FRO A;  4C8Q E;  5A0L A;  3PFS A;  4Y91 A;  3CCJ T;  5FLX E;  4JS4 A;  3OSV A;  2CZ0 B;  1G3S A;  4J6W A;  4M75 A;  4BI3 A;  3JAM E;  4FT4 A;  2K4Y A;  5GAO l;  1EIF A;  1D3B B;  3QJY A;  2QQR A;  4ZTF A;  4KBM B;  3QUI A;  4M7A D;  2JN0 A;  3Q1J A;  2DXB A;  3QKJ A;  4N0A A;  2HQX A;  2MMP A;  1VQ4 A;  5DM7 R;  3P8B B;  1KG1 A;  3X20 B;  4IUV A;  2B8A A;  2D9T A;  2PUK B;  2XID A;  3MEW A;  4M77 G;  2JUF A;  5LJ3 f;  4J6X A;  4C8Q B;  4C8Q G;  3M5A A;  1YI2 A;  1WNL A;  1VQ8 A;  2IG0 A;  4ELZ C;  2FB7 A;  5GMK i;  4LDX A;  2KSS A;  4IUU A;  4HKE A;  5IT9 E;  1BI3 A;  1SSF A;  1TH7 A;  1H3Z A;  1Q81 U;  3CCE A;  5DLQ E;  2CZ7 B;  3EFS A;  1H64 1;  1VIE A;  3QII A;  4IUR A;  4LD6 A;  4OF1 A;  4BUG A;  3JB9 F;  1PSF A;  4XAX B;  1NPP A;  2D0Q B;  2R5M A;  3NTI A;  3CCL T;  1I8F A;  3CCM A;  1VQ9 T;  4PLI A;  1YJN T;  4EPC A;  3DKM A;  3HPW A;  3NTH A;  4C92 C;  3G71 T;  5J3B A;  3JCM J;  1VQL A;  4M7A C;  1UGP B;  2R57 A;  3FB9 A;  4ZGD B;  3I56 A;  3CCU T;  3L2R A;  2ZPI B;  3V7C A;  1KQ1 A;  2M1H A;  3QHS A;  4M7D E;  2DAQ A;  3P8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...