4CS0B

Direct visualisation of strain-induced protein post-translational modification
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 35
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cs0B00
2OH1A 1WWZA 1M4IA 2H5MA 3SHPA 4OLLA 3BLNA 1RXTA 4XPLA 2R1IA 4Y49B 5F46A 2FCKA 2ZXVA 1MJAA 1Z4EA 2PR8A 3KKWA 2VI7A 3EY5A 3DDDA 3W6SA 1IYLA 1Y9WA 4UBRA 3PZJA 2J8MA 4R3KA 2B58A 2Q4VA 4U9YA 2FS5A 4RS2A 1Q2CA 4PK3A 2X7BA 2Z11A 3GKRA 2VEZA 1NE9A 1YK3A 2REFA 3VWDA 1IICA 2R98A 3TOBA 1M44A 3TT2A 2PSWA 3NE7A 4FD5A 2FE7A 4KVXA 3VWEA 2AJ6A 4U9ZA 2PC1A 4KZTA 3LD2A 2QIRA 5KTCA 2B5GA 4AVBA 2FSRA 5KTDA 1IB1E 4KOSA 3EFAA 2CNMA 2FT0A 2Q0YA 3TO9A 5F49A 2OZGA 3OWCA 4AG9A 1VHSA 1U6MA 2A4NA 3R9FA 2IL4A 4QVTA 3TOAA 5J8FA 3TO7A 3ZZIA 4U5YA 3G3SA 2JLMA 1PUAA 1YREA 1S3ZA 5I0CA 4R3LA 3T90A 4KORA 1J4JA 4YFJA 5HH1A 3R96A 2ZPAA 2B3UA 1L0CA 2BSWA 3DR8A 4XPDB 4F6AA 4AVCA 5IX3A 2PR1A 2KCWA 4FD6A 3FXTA 5E96A 3H4QA 2ATRA 5DWMA 2D4OA 3FIXA 4Y49C 4DNCA 3C26A 1S7KA 1FY7A 3S6GA 2CY2A 2BUEA 2CNSA 4PSXA 4XNHB 3TFYA 3V8IA 4FD7A 3FRMA 3S6KA 1VKCA 1SQHA 4L8AA 1KUYA 1S5KA 3EO4A 1NMTA 5DWNA 2PDOA 4MJ8A 2Z10A 1KUXA 1QSRA 4JXRA 4E0AA 2P0WA 4L89A 4CRYB 3R95A 3FBUA 3W91A 2B3VA 1CM0A 1YX0A 1QSMA 1NSLA 2P6EA 5H84A 1Q2YA 2R8VA 1S60A 2G0BA 5JQ4A 2OZUA 5C88A 4KOUA 4R57A 4ZBGA 1Y7RA 1OZPA 2ZW6A 4NSQA 2Q4YA 3TE4A 1B6BA 4JJXA 4BMHA 1YR0A 2RC4A 2B4DB 1K4JA 3LODA 1IYKA 4E8OA 4E2AA 1LRZA 3WR7A 4CRZB 2ZW4A 3D8PA 2NMTA 2J8RA 5JPHA 1XMTA 2VQYA 4HKFA 4F0YA 1YGHA 4IF5A 3T9YA 1I21A 3DNSA 3SXNA 2VXKA 2QECA 4PV6A 4KLWA 3FYNA 2JDDA 1I1DA 1YVOA 3F0AA 4KUBA 2O28A 3R1KA 4H6UA 1V0CA 4XPDC 2C27A 4X5KA 1M4DA 4AG7A 4R87A 3PP9A 4B5PA 1M1DA 1S7NA 4JWPA 4LX9A 2D4PA 1MJ9A 2Y0MA 4M85A 2HUZA 4RI1A 1KZFA 4OAEA 2ARHA 1R57A 4B5OA 2G3AA 1XEBA 3CXPA 1S7FA 3EC4A 2I79A 3F5BA 2FXFA 3IWGA 1ON0A 2B5GB 3EXNA 3JUWA 4XPKA 3BJ7A 4CAWA 1UFHA 2P6FA 3G8WA 3CXQA 4KUAA 1I12A 3I9SA 1KUVA 3R9GA 4UWJA 4FD4A 4EVYA 3P2HA 4PK2A 4YGOA 4R9MA 4H6ZA 5F47A 5EC4A 4KOTA 5FVJA 2I00A 2OZHA 4UWIA 4B5PB 5EBVA 4KOVA 5CNPA 1BO4A 2FIAA 4PSWA 2F5IA 4KOWA 4AVAA 4CS0B 2QMLA 3D3SA 2ZW5A 4HNXB 3F8KA 3DR6A 4OADA 2BL1A 3TTHA 2K5TA 4KVME 4IUSA 4ONUA 4II9A 1P4NA 4QUSA 3MGDA 4AB7A 2Q04A 1PU9A 3FNCA 1GHEA 2EUIA 4ORFA 1XIXA 1XF8A 2WPWA 3DSBA 4MI4A 2FIWA 2P6GA 3TCVA 4NCZA 1MJBA 4MBUA 2VZYA 4QC6A 3S6FA 4MHDA 4J3GA 4JXQA 4KOXA 2J8NA 2GIVA 2CNTA 2G3TA 3BJ8A 4KOYA 3P2FA 4YRHA 2REEA 4H89A 3R9EA 1P0HA 4KLVA 3I3GA 4LUAA 3SXOA 3CXSA 4CAXA 4I49A 1QSTA 5H86A 5ISVA 2ZW7A 4CAVA 2VBQA 4MY3A 5HMNA 4QB9A 4NEXA 2VZZA 1YLEA 3GY9A 4JLYA 3S6HA 2PQ8A 4GS4A 1Y9KA 3JVNA 4K30A 2DXQA 3FB3A 2BEIA 1MK4A 3D2PA 4XNHC 2R7HA 1M4GA 5C82A 1IIDA 1TIQA 2JEVA 2PRBA 3RYOA 2GANA 2JDCA 3E0KA 2WPXA 4UA3A 3GYAA 3B8GA 5GCNA 3K9UA 2GE3A 5IB0A 1XE4A 3TO6A 2OU2A 3ZJ0A 2Q7BA 3D2MA 4KVOE 5IV0A 1QSNA 5J8CA 2HQYA 3N7ZA 4MY0A 2HV2A 1BOBA 1RO5A 1Z4RA 3QAHA 2OB0A 2FL4A 4HNYB 5F48A 3QB8A 3PGPA 3W6XA 4M3SA 2Q44A 5KTAA 4NF1A 1CJWA 2AE6A 2EVNA 3UY5A 4QBJA 1QSOA 1WK4A 2B4DA 1N71A 4NXYA 1S7LA 1Z9UA 1Q2DA 2Z0ZA 4HNWB 3IGRA 2B4BA 1B87A 4JD6A 1YVKA
chains in the Genus database with same CATH superfamily
2RFHA 1VGYA 3PB8X 2OH1A 1ZG8A 5DS0A 1WWZA 1M4IA 2H5MA 3S9LA 3SHPA 2PJCA 2AFUA 4OLLA 1XMBA 3BLNA 2PVVA 5AG7A 1RXTA 1IOFA 4XPLA 5K8MA 2R1IA 5G22A 4CAFA 3NH4A 4BBHA 4Y49B 1CBXA 2V77A 4B13A 5F46A 2FCKA 2ZXVA 4G1PA 1MJAA 4P6YA 3T8WA 1XBUA 1Z4EA 2PR8A 3KKWA 3KR4A 2VI7A 3EY5A 3DDDA 1XRYA 3FECA 5EMIA 4OC2A 1IYLA 3W6SA 3KASA 1Y9WA 2Q4ZA 4UBRA 3PZJA 4EWTA 2DEAA 4C7HA 4YWYA 2J8MA 3PB7X 3IFEA 2ZELA 2C6CA 4R3KA 2B58A 2Q4VA 4U9YA 2FS5A 1F2OA 2PVWA 3KQZA 4RS2A 5BWAB 4UIBA 3D66A 1Q2CA 2FVGA 4PK3A 4A2ZA 1DTDA 2X7BA 5LRJA 3SI1A 5AG5A 2AFWA 1RTQA 2Z11A 3B3TA 4A37A 2BOAA 3LMSA 3GKRA 2ODFA 1LFWA 2VEZA 2EK9A 2J9AA 2QVPA 4JYWA 2NSMA 1NE9A 3KQXA 4OP4A 1YK3A 2REFA 4WWVA 4BINA 3VWDA 4OIWA 5JGFA 2AFMA 1IICA 2R98A 3RZAA 3TOBA 2ZEMA 4CGNA 2IMOA 1IU8A 1M44A 4CAVA 1CPSA 3TT2A 4C2XA 3IJ3A 2PSWA 3NE7A 4FD5A 5G21A 4F9UA 4PXCA 1F2PA 2FE7A 4KVXA 3SJXA 4UIAA 3VWEA 4X8IA 2AJ6A 3CZXA 4U9ZA 2G9DA 3SI0A 4UEFA 2PC1A 4KZTA 3D7FA 4CYQA 3LD2A 2QIRA 4A94A 5KTCA 2ZEDA 1R43A 2B5GA 4LQ6A 4AVBA 3KGQA 1Y0YA 2FSRA 3RBUA 5KTDA 4NJRA 1IB1E 1ZLHA 4KOSA 3EFAA 2CNMA 2O53A 2FT0A 3IU1A 4WJBA 3K9TA 4PQAA 2Q0YA 3TO9A 4B10A 5F49A 2OZGA 3PRTA 3SJFA 4CPAA 2GFQA 3OWCA 3SJEA 2WUUA 4AG9A 4JZ0A 4P4IA 1VHSA 2AFSA 1TKFA 1U6MA 2ABZA 2A4NA 2ZEPA 4FBEA 1ARMA 3R9FA 2IL4A 4QVTA 3TOAA 1H8LA 4CGOA 1BPMA 2C6GA 1HDQA 3HUVA 4BD9A 4OC3A 4Q38A 5J8FA 3TO7A 2PJ5A 3ZZIA 4U5YA 4MFZA 1TF9A 3G3SA 2GU2A 1PUAA 2JLMA 1YREA 1S3ZA 2QJ8A 3WC5A 5I0CA 4A30A 1ZLIA 1TXRA 4R3LA 2EK8A 3FF3A 4KORA 3T90A 3QNVA 1YLOA 1Z8WA 1J4JA 4YFJA 5HH1A 3R96A 2B3UA 1Z8XA 2ZPAA 1L0CA 2BSWA 2ZOGA 4CYPA 3DR8A 4XPDB 2PJAA 4F6AA 4AVCA 5IX3A 2PR1A 2KCWA 4M6GA 1AYEA 4FD6A 2PCUA 3FXTA 1YW6A 1BLLE 1VHEA 2O4HA 3KZWA 5E96A 4ONWA 1FNOA 4OC0A 3H4QA 2ATRA 5DWMA 4CYOA 4UFVA 2D4OA 3FIXA 1LAPA 4X2TA 4Y49C 4DNCA 4MFPA 4MFLA 3WABA 3C26A 1S7KA 1CP6A 5LYDA 1FY7A 3S6GA 1YW4A 1A2ZA 2BUEA 2CNSA 4PSXA 2PE3A 5IB9A 4XNHB 4W9YA 4A33A 3TFYA 2YNCC 4NGNA 5AGEA 2AFOA 1YSJA 3D68A 3V8IA 4FD7A 3FRMA 3VATA 3IWWA 3S6KA 1VKCA 1SQHA 3GUXA 4GM5A 4L8AA 1KUYA 1S5KA 4NGTA 3EO4A 1NMTA 1Z2LA 5DWNA 2PDOA 5HVFA 3LACA 1BPNA 3PB4X 3WT4A 4MJ8A 2Z10A 1KUXA 4P4DA 1NSAA 2F7VA 3QAYA 1QSRA 4C2YA 4FAIA 3D67A 5F09A 4OC1A 4IK2A 4JXRA 4FWUA 4CYNA 4E0AA 2P0WA 3PFOA 3FEEA 4HPSA 4L89A 1LCPA 4ZY0A 2PIYA 4CRYB 3R95A 1DE4C 3FBUA 3CPXA 4C2ZA 4ZGYB 1YMEA 3W91A 5K8PA 2B3VA 4R76A 1CM0A 2CF4A 3GIUA 2XEFA 1VHOA 3LWUA 1YX0A 3WC6A 2HB6A 1PCAA 1HDUA 2PJ2A 1QSMA 4YU9A 1NSLA 1Y0RA 2P6EA 1XFOA 3MN8A 4JD6A 5H84A 1Q2YA 3KHXA 5D29A 4CAEA 5I4MA 2R8VA 4PXDA 1S60A 4RN7A 2G0BA 2PJ8A 5JQ4A 5J1QA 4KSIA 2OZUA 2EO8A 2JBJA 5C88A 5JM6A 4KOUA 4R57A 4ZBGA 1Y7RA 1OZPA 1ARLA 2ZW6A 3B3VA 4B6ZA 2Q7SA 4NSQA 3NH5A 2Q4YA 3FVLA 4FUUA 3TE4A 1YQEA 3TC8A 1B6BA 4JJXA 4BMHA 2ZEEA 3I1UA 4IAVA 1YR0A 2ZEGA 2RC4A 3S9MA 2B4DB 1K4JA 4EFDA 3LODA 1XJOA 3DGVA 1IYKA 4E8OA 4P44A 5A27A 4R8FA 3KR5A 5AG6A 4E2AA 1LRZA 3WR7A 2YNDA 4CRZB 2ZW4A 1CPXA 3D8PA 3IU2A 1BAVA 4UCPA 2NMTA 4MFKA 4O23A 2J8RA 3PEIA 5JPHA 1XMTA 3H5ZA 2WZNA 2VQYA 4HKFA 4F0YA 1YGHA 4IF5A 3BI1A 3T9YA 1I21A 3DNSA 3NE8A 3SXNA 4OC4A 2ANPA 2VXKA 2QECA 4UFWA 4CGMA 4PV6A 2BCOA 4KLWA 3FYNA 2JDDA 5HXDA 3PBBA 1I1DA 1YVOA 3F0AA 4KUBA 2PJBA 2O28A 3IIBA 4M6IA 5HVGA 3R1KA 1CX8A 1V0CA 4H6UA 4XPDC 2RB7A 2C27A 4NGRA 5A28A 2C1CA 4X5KA 1M4DA 4AG7A 3BI0A 4AXVA 4R87A 1CP7A 3ISZA 4ZX8A 3PP9A 4B5PA 1M1DA 1R3NA 1S7NA 2PJ7A 4JWPA 4LX9A 2Z3LA 2IQ6A 3TX8A 2D4PA 1ZG9A 1MJ9A 2Y0MA 2YNEA 4NGQA 4P10A 3PB6X 2Z3KA 4M85A 1ZG7A 3PBEA 2OOTA 4P4BA 4A32A 2HUZA 4RI1A 1KZFA 4IHMA 4OAEA 2ARHA 1VIXA 1LAMA 1R57A 4PXBA 4B5OA 4EMEA 1KWMA 1X10A 1XEBA 2G3AA 2POKA 4MFQA 4Q36A 5K8OA 1X12A 3D4UA 3D7HA 6CPAA 4B12A 1CG2A 3B3CA 3CXPA 1S7FA 3EC4A 4OMEA 5G1ZA 2YNCA 4LQGA 2I79A 2XEJA 4KSAA 2VL1A 3F5BA 2FXFA 3IWGA 2Q43A 3D7DA 2PJ9A 1ON0A 4UCNA 2B5GB 3EXNA 3GB0A 2ZEOA 3JUWA 1F57A 8CPAA 4C7IA 4XPKA 3BJ7A 4CAWA 4ZYQA 2CXAA 1UFHA 4KSFA 2P6FA 2Z3MA 2WYRA 3G8WA 4K3NA 1AMPA 3CXQA 4OKOA 4KUAA 1I12A 3I9SA 5CPAA 3JTKA 3CPAA 3PB9X 1KUVA 2DPSA 4M6HA 3R9GA 4PPZA 2F8HA 4UWJA 4R7MA 4FD4A 2BO9A 1M4LA 4EVYA 3P2HA 4PK2A 4YGOA 4R9MA 1PYTB 4F0XA 4H6ZA 5F47A 5EC4A 4MHZA 5ELYA 4KOTA 2V8HA 5FVJA 4TWEA 4DUKA 4OC5A 3GLJA 1ZO0A 2I00A 1GYTA 2OZHA 4P4FA 4UWIA 4B5PB 4A38A 1Z8TA 5EBVA 2AFZA 3SI2A 7CPAA 4KOVA 5CNPA 1BO4A 4KS9A 4DJLA 2PJ4A 3FX6A 5K8NA 2FIAA 2AFXA 2PJ0A 2PJ3A 4PSWA 5D8NA 4P4JA 4X3RA 2YGWA 2F5IA 3IO1A 4MHYA 4ZX9A 4OIDA 3B2YA 3IC1A 2PRQA 1LOKA 4KOWA 4ZY2A 4AVAA 4CS0B 4MRIA 2QMLA 2GREA 2C6PA 3D3SA 3KHZA 2ZW5A 4HNXB 2Z3PA 3F8KA 1ELMP 3DR6A 4OADA 1QQ9A 2BL1A 3FMCA 1EE3P 1TKJA 4MXUA 4NFRA 4NGMA 3TTHA 2K5TA 4RUHA 4KVME 4P4EA 5JH9A 4IUSA 3MRUA 3FJUA 4ONUA 4II9A 3SJGA 2PIZA 1P4NA 2XEIA 4QUSA 4H2KA 3MGDA 1XOVA 4AB7A 2Q04A 1PU9A 3FNCA 3VARA 1GHEA 5THWA 2EUIA 4ORFA 1XIXA 3PFEA 1XF8A 2CTCA 2WPWA 2V8DA 3DSBA 4MI4A 2FIWA 1IGBA 4MMOA 2EBJA 4F8ZA 4MHNA 2P6GA 3TCVA 1JQGA 2IJZA 4NCZA 1MJBA 1HEEA 4MBUA 2VZYA 3N5FA 4ZY1A 4QC6A 3S6FA 4Z65A 2GLJA 3DLJA 1FT7A 2DF5A 2ZEHA 1Z8LA 1IY7A 4MHDA 4J3GA 4JXQA 4KOXA 2J8NA 2JBKA 2GIVA 2V8GA 3BHXA 3H8FA 2CNTA 2G3TA 1IOIA 3BJ8A 2Z3NA 4KOYA 5LYIA 3P2FA 1LANA 4YRHA 2REEA 3CDXA 4H89A 3R9EA 3ISXA 5G20A 3RNZA 1P0HA 4KLVA 4NGPA 3I3GA 4LUAA 2EWBA 3SXOA 3L2NA 3CXSA 4F9VA 4CAXA 2GLFA 4I49A 2JEWA 4MHPA 4UCMA 1QSTA 2ZENA 1Q7LA 5H86A 5ISVA 1TF8A 1TKHA 1ELLP 2ZW7A 4MCPA 2CIJA 2VBQA 1JWQA 4MY3A 4TNUA 4B14A 5HMNA 4UF4A 4A95A 4QB9A 4NEXA 3JRUA 2VZZA 1YLEA 3GY9A 3S9NA 4JLYA 3S6HA 2Z3OA 2PQ8A 4A39A 4GS4A 1Y9KA 3JVNA 4K30A 3KI9A 3V38A 3A9LA 3FEDA 3V7ZA 2DXQA 3FB3A 4C68A 2BEIA 1MK4A 3D2PA 2HC9A 2R7HA 1M4GA 4XNHC 5C82A 3NFZA 1IIDA 3H8EA 3B35A 4MFJA 1TIQA 2JEVA 2PRBA 3B7IA 3RYOA 3FH4A 5LYFA 2Q51A 4UEZA 3VH9A 1Z5RA 2GANA 2WSAA 2JDCA 4MCRA 4DYOA 3E0KA 2WPXA 4UA3A 5LRKA 3GYAA 3B8GA 5GCNA 3K9UA 3NH8A 2GE3A 5IB0A 1QMUA 1Y7EA 3RO0A 3NA6A 1XE4A 4CGLA 3TO6A 2OU2A 3ZJ0A 2Q7BA 1OBRA 3D2MA 4KVOE 3IEHA 3K2KA 4CGPA 4NJQA 4UEEA 5AG4A 5IV0A 1QSNA 1AUGA 4P45A 4R6TA 4UFXA 5J8CA 2HQYA 4MCSA 3N7ZA 4MY0A 2HV2A 4B11A 1BOBA 1RO5A 3CT9A 1Z4RA 3B3WA 3QAHA 2OB0A 3IWEA 5LYLA 4GXHA 2FL4A 4HNYB 5F48A 3QB8A 3PGPA 2ZEFA 4M3SA 4NGSA 3W6XA 3H8GA 5CBMA 3D7GA 2PJ1A 2Q44A 5KTAA 4NF1A 2XEGA 1CJWA 2AE6A 2EVNA 3HLPA 3UY5A 4QBJA 1QSOA 1WK4A 2QYVA 2B4DA 2PJ6A 1N71A 4NXYA 1S7LA 1Z9UA 2NYQA 3RAMA 4A31A 5HVHA 1UWYA 4ZI6A 2OR4A 1Q2DA 2Z0ZA 3BXMA 4HNWB 3IGRA 4MCQA 2DPTA 2B4BA 2I3CA 2ZOFA 3B3SA 4Q7AA 2V8VA 1B87A 3KL9A 2CTBA 4PXEA 3WC7A 2CY2A 5LRGA 1YVKA
chains in the Genus database with same CATH topology
2OH1A 1WWZA 1M4IA 2H5MA 3SHPA 4OLLA 3BLNA 5AG7A 1RXTA 4XPLA 2R1IA 5G22A 4CAFA 4BBHA 4Y49B 4B13A 5F46A 2FCKA 2ZXVA 1MJAA 1Z4EA 2PR8A 3KKWA 2VI7A 3EY5A 3DDDA 3W6SA 1IYLA 1Y9WA 4UBRA 3PZJA 4C7HA 2J8MA 4R3KA 2B58A 2Q4VA 4U9YA 2FS5A 4RS2A 5BWAB 1Q2CA 4PK3A 4A2ZA 2X7BA 5AG5A 2Z11A 3GKRA 2VEZA 1NE9A 1YK3A 2REFA 3VWDA 1IICA 2R98A 3TOBA 4CGNA 1M44A 3TT2A 4C2XA 2PSWA 3NE7A 4FD5A 5G21A 2FE7A 4KVXA 3VWEA 2AJ6A 4U9ZA 2PC1A 4KZTA 4CYQA 3LD2A 2QIRA 5KTCA 2B5GA 4AVBA 2FSRA 5KTDA 1IB1E 4KOSA 3EFAA 2CNMA 2FT0A 3IU1A 4B10A 2Q0YA 3TO9A 5F49A 2OZGA 3OWCA 2WUUA 4AG9A 1VHSA 1U6MA 2A4NA 3R9FA 2IL4A 4QVTA 3TOAA 4CGOA 4Q38A 5J8FA 3TO7A 3ZZIA 4U5YA 4MFZA 3G3SA 2JLMA 1PUAA 1YREA 1S3ZA 5I0CA 4A30A 4R3LA 3T90A 4KORA 1J4JA 4YFJA 5HH1A 3R96A 2ZPAA 2B3UA 1L0CA 2BSWA 4CYPA 3DR8A 4XPDB 4F6AA 4AVCA 5IX3A 2PR1A 2KCWA 4FD6A 3FXTA 5E96A 3H4QA 2ATRA 5DWMA 4CYOA 4UFVA 2D4OA 3FIXA 4Y49C 4DNCA 4MFPA 4MFLA 3C26A 1S7KA 1FY7A 3S6GA 2CY2A 2BUEA 2CNSA 4PSXA 4XNHB 4A33A 3TFYA 2YNCC 5AGEA 3V8IA 4FD7A 3FRMA 3S6KA 1VKCA 1SQHA 4L8AA 1KUYA 1S5KA 3EO4A 1NMTA 5DWNA 2PDOA 4MJ8A 2Z10A 1KUXA 1QSRA 4C2YA 4JXRA 4CYNA 4E0AA 2P0WA 4L89A 4CRYB 3R95A 3FBUA 4C2ZA 4ZGYB 3W91A 2B3VA 1CM0A 1YX0A 1QSMA 1NSLA 2P6EA 5H84A 1Q2YA 4CAEA 2R8VA 1S60A 2G0BA 5JQ4A 2OZUA 5C88A 4KOUA 4R57A 4ZBGA 1Y7RA 1OZPA 2ZW6A 4NSQA 2Q4YA 3TE4A 1B6BA 4JJXA 4BMHA 1YR0A 2RC4A 2B4DB 1K4JA 3LODA 1IYKA 4E8OA 5A27A 4E2AA 5AG6A 1LRZA 3WR7A 2YNDA 4CRZB 2ZW4A 3D8PA 3IU2A 4UCPA 2NMTA 4MFKA 2J8RA 5JPHA 1XMTA 3H5ZA 2VQYA 4HKFA 4F0YA 1YGHA 4IF5A 3T9YA 1I21A 3DNSA 3SXNA 2VXKA 2QECA 4UFWA 4CGMA 4PV6A 4KLWA 3FYNA 2JDDA 1I1DA 1YVOA 3F0AA 4KUBA 2O28A 3R1KA 4H6UA 1V0CA 4XPDC 5A28A 2C27A 4X5KA 1M4DA 4AG7A 4R87A 3PP9A 4B5PA 1M1DA 1S7NA 4JWPA 4LX9A 2Z3LA 2D4PA 1MJ9A 2Y0MA 2YNEA 2Z3KA 4M85A 4A32A 2HUZA 4RI1A 1KZFA 4OAEA 2ARHA 1R57A 4B5OA 2G3AA 1XEBA 4MFQA 4Q36A 4B12A 3CXPA 1S7FA 3EC4A 5G1ZA 2YNCA 2I79A 4KSAA 3F5BA 2FXFA 3IWGA 1ON0A 4UCNA 2B5GB 3EXNA 3JUWA 4C7IA 4XPKA 3BJ7A 4CAWA 2CXAA 1UFHA 4KSFA 2P6FA 2Z3MA 3G8WA 3CXQA 4KUAA 1I12A 3I9SA 3JTKA 1KUVA 2DPSA 3R9GA 4UWJA 4FD4A 4EVYA 3P2HA 4PK2A 4YGOA 4R9MA 4F0XA 4H6ZA 5F47A 5EC4A 4KOTA 5FVJA 1ZO0A 2I00A 2OZHA 4UWIA 4B5PB 5EBVA 4KOVA 5CNPA 1BO4A 4KS9A 2FIAA 4PSWA 2YGWA 2F5IA 4KOWA 4AVAA 4CS0B 2QMLA 3D3SA 2ZW5A 4HNXB 2Z3PA 3F8KA 3DR6A 4OADA 2BL1A 3TTHA 2K5TA 4KVME 4IUSA 4ONUA 4II9A 1P4NA 4QUSA 3MGDA 4AB7A 2Q04A 1PU9A 3FNCA 1GHEA 2EUIA 4ORFA 1XIXA 1XF8A 2WPWA 3DSBA 4MI4A 2FIWA 2P6GA 3TCVA 4NCZA 1MJBA 4MBUA 2VZYA 4QC6A 3S6FA 4MHDA 4J3GA 4JXQA 4KOXA 2J8NA 2GIVA 2CNTA 2G3TA 3BJ8A 2Z3NA 4KOYA 3P2FA 4YRHA 2REEA 4H89A 3R9EA 5G20A 1P0HA 4KLVA 3I3GA 4LUAA 3SXOA 3CXSA 4CAXA 4I49A 4UCMA 1QSTA 5H86A 5ISVA 2ZW7A 4CAVA 2VBQA 4MY3A 5HMNA 4A95A 4QB9A 4NEXA 2VZZA 1YLEA 3GY9A 4JLYA 3S6HA 2Z3OA 2PQ8A 4GS4A 1Y9KA 3JVNA 4K30A 3A9LA 4C68A 2DXQA 3FB3A 2BEIA 1MK4A 3D2PA 4XNHC 2R7HA 1M4GA 5C82A 1IIDA 4MFJA 1TIQA 2JEVA 2PRBA 3RYOA 2GANA 2WSAA 2JDCA 3E0KA 2WPXA 4UA3A 3GYAA 3B8GA 5GCNA 3K9UA 2GE3A 5IB0A 1XE4A 4CGLA 3TO6A 2OU2A 3ZJ0A 2Q7BA 3D2MA 4KVOE 5AG4A 4CGPA 5IV0A 1QSNA 4UFXA 5J8CA 2HQYA 3N7ZA 4MY0A 2HV2A 4B11A 1BOBA 1RO5A 1Z4RA 3QAHA 2OB0A 3IWEA 2FL4A 4HNYB 5F48A 3QB8A 3PGPA 3W6XA 4M3SA 2Q44A 5KTAA 4NF1A 1CJWA 2AE6A 2EVNA 3UY5A 4QBJA 1QSOA 1WK4A 2B4DA 1N71A 4NXYA 1S7LA 1Z9UA 4A31A 1Q2DA 2Z0ZA 4HNWB 3IGRA 2DPTA 2B4BA 1B87A 4JD6A 4B14A 1YVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OH1 A;  1WWZ A;  1M4I A;  2H5M A;  3SHP A;  4OLL A;  3BLN A;  1RXT A;  4XPL A;  2R1I A;  4Y49 B;  5F46 A;  2FCK A;  2ZXV A;  1MJA A;  1Z4E A;  2PR8 A;  3KKW A;  2VI7 A;  3EY5 A;  3DDD A;  3W6S A;  1IYL A;  1Y9W A;  4UBR A;  3PZJ A;  2J8M A;  4R3K A;  2B58 A;  2Q4V A;  4U9Y A;  2FS5 A;  4RS2 A;  1Q2C A;  4PK3 A;  2X7B A;  2Z11 A;  3GKR A;  2VEZ A;  1NE9 A;  1YK3 A;  2REF A;  3VWD A;  1IIC A;  2R98 A;  3TOB A;  1M44 A;  3TT2 A;  2PSW A;  3NE7 A;  4FD5 A;  2FE7 A;  4KVX A;  3VWE A;  2AJ6 A;  4U9Z A;  2PC1 A;  4KZT A;  3LD2 A;  2QIR A;  5KTC A;  2B5G A;  4AVB A;  2FSR A;  5KTD A;  1IB1 E;  4KOS A;  3EFA A;  2CNM A;  2FT0 A;  2Q0Y A;  3TO9 A;  5F49 A;  2OZG A;  3OWC A;  4AG9 A;  1VHS A;  1U6M A;  2A4N A;  3R9F A;  2IL4 A;  4QVT A;  3TOA A;  5J8F A;  3TO7 A;  3ZZI A;  4U5Y A;  3G3S A;  2JLM A;  1PUA A;  1YRE A;  1S3Z A;  5I0C A;  4R3L A;  3T90 A;  4KOR A;  1J4J A;  4YFJ A;  5HH1 A;  3R96 A;  2ZPA A;  2B3U A;  1L0C A;  2BSW A;  3DR8 A;  4XPD B;  4F6A A;  4AVC A;  5IX3 A;  2PR1 A;  2KCW A;  4FD6 A;  3FXT A;  5E96 A;  3H4Q A;  2ATR A;  5DWM A;  2D4O A;  3FIX A;  4Y49 C;  4DNC A;  3C26 A;  1S7K A;  1FY7 A;  3S6G A;  2CY2 A;  2BUE A;  2CNS A;  4PSX A;  4XNH B;  3TFY A;  3V8I A;  4FD7 A;  3FRM A;  3S6K A;  1VKC A;  1SQH A;  4L8A A;  1KUY A;  1S5K A;  3EO4 A;  1NMT A;  5DWN A;  2PDO A;  4MJ8 A;  2Z10 A;  1KUX A;  1QSR A;  4JXR A;  4E0A A;  2P0W A;  4L89 A;  4CRY B;  3R95 A;  3FBU A;  3W91 A;  2B3V A;  1CM0 A;  1YX0 A;  1QSM A;  1NSL A;  2P6E A;  5H84 A;  1Q2Y A;  2R8V A;  1S60 A;  2G0B A;  5JQ4 A;  2OZU A;  5C88 A;  4KOU A;  4R57 A;  4ZBG A;  1Y7R A;  1OZP A;  2ZW6 A;  4NSQ A;  2Q4Y A;  3TE4 A;  1B6B A;  4JJX A;  4BMH A;  1YR0 A;  2RC4 A;  2B4D B;  1K4J A;  3LOD A;  1IYK A;  4E8O A;  4E2A A;  1LRZ A;  3WR7 A;  4CRZ B;  2ZW4 A;  3D8P A;  2NMT A;  2J8R A;  5JPH A;  1XMT A;  2VQY A;  4HKF A;  4F0Y A;  1YGH A;  4IF5 A;  3T9Y A;  1I21 A;  3DNS A;  3SXN A;  2VXK A;  2QEC A;  4PV6 A;  4KLW A;  3FYN A;  2JDD A;  1I1D A;  1YVO A;  3F0A A;  4KUB A;  2O28 A;  3R1K A;  4H6U A;  1V0C A;  4XPD C;  2C27 A;  4X5K A;  1M4D A;  4AG7 A;  4R87 A;  3PP9 A;  4B5P A;  1M1D A;  1S7N A;  4JWP A;  4LX9 A;  2D4P A;  1MJ9 A;  2Y0M A;  4M85 A;  2HUZ A;  4RI1 A;  1KZF A;  4OAE A;  2ARH A;  1R57 A;  4B5O A;  2G3A A;  1XEB A;  3CXP A;  1S7F A;  3EC4 A;  2I79 A;  3F5B A;  2FXF A;  3IWG A;  1ON0 A;  2B5G B;  3EXN A;  3JUW A;  4XPK A;  3BJ7 A;  4CAW A;  1UFH A;  2P6F A;  3G8W A;  3CXQ A;  4KUA A;  1I12 A;  3I9S A;  1KUV A;  3R9G A;  4UWJ A;  4FD4 A;  4EVY A;  3P2H A;  4PK2 A;  4YGO A;  4R9M A;  4H6Z A;  5F47 A;  5EC4 A;  4KOT A;  5FVJ A;  2I00 A;  2OZH A;  4UWI A;  4B5P B;  5EBV A;  4KOV A;  5CNP A;  1BO4 A;  2FIA A;  4PSW A;  2F5I A;  4KOW A;  4AVA A;  4CS0 B;  2QML A;  3D3S A;  2ZW5 A;  4HNX B;  3F8K A;  3DR6 A;  4OAD A;  2BL1 A;  3TTH A;  2K5T A;  4KVM E;  4IUS A;  4ONU A;  4II9 A;  1P4N A;  4QUS A;  3MGD A;  4AB7 A;  2Q04 A;  1PU9 A;  3FNC A;  1GHE A;  2EUI A;  4ORF A;  1XIX A;  1XF8 A;  2WPW A;  3DSB A;  4MI4 A;  2FIW A;  2P6G A;  3TCV A;  4NCZ A;  1MJB A;  4MBU A;  2VZY A;  4QC6 A;  3S6F A;  4MHD A;  4J3G A;  4JXQ A;  4KOX A;  2J8N A;  2GIV A;  2CNT A;  2G3T A;  3BJ8 A;  4KOY A;  3P2F A;  4YRH A;  2REE A;  4H89 A;  3R9E A;  1P0H A;  4KLV A;  3I3G A;  4LUA A;  3SXO A;  3CXS A;  4CAX A;  4I49 A;  1QST A;  5H86 A;  5ISV A;  2ZW7 A;  4CAV A;  2VBQ A;  4MY3 A;  5HMN A;  4QB9 A;  4NEX A;  2VZZ A;  1YLE A;  3GY9 A;  4JLY A;  3S6H A;  2PQ8 A;  4GS4 A;  1Y9K A;  3JVN A;  4K30 A;  2DXQ A;  3FB3 A;  2BEI A;  1MK4 A;  3D2P A;  4XNH C;  2R7H A;  1M4G A;  5C82 A;  1IID A;  1TIQ A;  2JEV A;  2PRB A;  3RYO A;  2GAN A;  2JDC A;  3E0K A;  2WPX A;  4UA3 A;  3GYA A;  3B8G A;  5GCN A;  3K9U A;  2GE3 A;  5IB0 A;  1XE4 A;  3TO6 A;  2OU2 A;  3ZJ0 A;  2Q7B A;  3D2M A;  4KVO E;  5IV0 A;  1QSN A;  5J8C A;  2HQY A;  3N7Z A;  4MY0 A;  2HV2 A;  1BOB A;  1RO5 A;  1Z4R A;  3QAH A;  2OB0 A;  2FL4 A;  4HNY B;  5F48 A;  3QB8 A;  3PGP A;  3W6X A;  4M3S A;  2Q44 A;  5KTA A;  4NF1 A;  1CJW A;  2AE6 A;  2EVN A;  3UY5 A;  4QBJ A;  1QSO A;  1WK4 A;  2B4D A;  1N71 A;  4NXY A;  1S7L A;  1Z9U A;  1Q2D A;  2Z0Z A;  4HNW B;  3IGR A;  2B4B A;  1B87 A;  4JD6 A;  1YVK A; 
#chains in the Genus database with same CATH topology
 2RFH A;  1VGY A;  3PB8 X;  2OH1 A;  1ZG8 A;  5DS0 A;  1WWZ A;  1M4I A;  2H5M A;  3S9L A;  3SHP A;  2PJC A;  2AFU A;  4OLL A;  1XMB A;  3BLN A;  2PVV A;  5AG7 A;  1RXT A;  1IOF A;  4XPL A;  5K8M A;  2R1I A;  5G22 A;  4CAF A;  3NH4 A;  4BBH A;  4Y49 B;  1CBX A;  2V77 A;  4B13 A;  5F46 A;  2FCK A;  2ZXV A;  4G1P A;  1MJA A;  4P6Y A;  3T8W A;  1XBU A;  1Z4E A;  2PR8 A;  3KKW A;  3KR4 A;  2VI7 A;  3EY5 A;  3DDD A;  1XRY A;  3FEC A;  5EMI A;  4OC2 A;  1IYL A;  3W6S A;  3KAS A;  1Y9W A;  2Q4Z A;  4UBR A;  3PZJ A;  4EWT A;  2DEA A;  4C7H A;  4YWY A;  2J8M A;  3PB7 X;  3IFE A;  2ZEL A;  2C6C A;  4R3K A;  2B58 A;  2Q4V A;  4U9Y A;  2FS5 A;  1F2O A;  2PVW A;  3KQZ A;  4RS2 A;  5BWA B;  4UIB A;  3D66 A;  1Q2C A;  2FVG A;  4PK3 A;  4A2Z A;  1DTD A;  2X7B A;  5LRJ A;  3SI1 A;  5AG5 A;  2AFW A;  1RTQ A;  2Z11 A;  3B3T A;  4A37 A;  2BOA A;  3LMS A;  3GKR A;  2ODF A;  1LFW A;  2VEZ A;  2EK9 A;  2J9A A;  2QVP A;  4JYW A;  2NSM A;  1NE9 A;  3KQX A;  4OP4 A;  1YK3 A;  2REF A;  4WWV A;  4BIN A;  3VWD A;  4OIW A;  5JGF A;  2AFM A;  1IIC A;  2R98 A;  3RZA A;  3TOB A;  2ZEM A;  4CGN A;  2IMO A;  1IU8 A;  1M44 A;  4CAV A;  1CPS A;  3TT2 A;  4C2X A;  3IJ3 A;  2PSW A;  3NE7 A;  4FD5 A;  5G21 A;  4F9U A;  4PXC A;  1F2P A;  2FE7 A;  4KVX A;  3SJX A;  4UIA A;  3VWE A;  4X8I A;  2AJ6 A;  3CZX A;  4U9Z A;  2G9D A;  3SI0 A;  4UEF A;  2PC1 A;  4KZT A;  3D7F A;  4CYQ A;  3LD2 A;  2QIR A;  4A94 A;  5KTC A;  2ZED A;  1R43 A;  2B5G A;  4LQ6 A;  4AVB A;  3KGQ A;  1Y0Y A;  2FSR A;  3RBU A;  5KTD A;  4NJR A;  1IB1 E;  1ZLH A;  4KOS A;  3EFA A;  2CNM A;  2O53 A;  2FT0 A;  3IU1 A;  4WJB A;  3K9T A;  4PQA A;  2Q0Y A;  3TO9 A;  4B10 A;  5F49 A;  2OZG A;  3PRT A;  3SJF A;  4CPA A;  2GFQ A;  3OWC A;  3SJE A;  2WUU A;  4AG9 A;  4JZ0 A;  4P4I A;  1VHS A;  2AFS A;  1TKF A;  1U6M A;  2ABZ A;  2A4N A;  2ZEP A;  4FBE A;  1ARM A;  3R9F A;  2IL4 A;  4QVT A;  3TOA A;  1H8L A;  4CGO A;  1BPM A;  2C6G A;  1HDQ A;  3HUV A;  4BD9 A;  4OC3 A;  4Q38 A;  5J8F A;  3TO7 A;  2PJ5 A;  3ZZI A;  4U5Y A;  4MFZ A;  1TF9 A;  3G3S A;  2GU2 A;  1PUA A;  2JLM A;  1YRE A;  1S3Z A;  2QJ8 A;  3WC5 A;  5I0C A;  4A30 A;  1ZLI A;  1TXR A;  4R3L A;  2EK8 A;  3FF3 A;  4KOR A;  3T90 A;  3QNV A;  1YLO A;  1Z8W A;  1J4J A;  4YFJ A;  5HH1 A;  3R96 A;  2B3U A;  1Z8X A;  2ZPA A;  1L0C A;  2BSW A;  2ZOG A;  4CYP A;  3DR8 A;  4XPD B;  2PJA A;  4F6A A;  4AVC A;  5IX3 A;  2PR1 A;  2KCW A;  4M6G A;  1AYE A;  4FD6 A;  2PCU A;  3FXT A;  1YW6 A;  1BLL E;  1VHE A;  2O4H A;  3KZW A;  5E96 A;  4ONW A;  1FNO A;  4OC0 A;  3H4Q A;  2ATR A;  5DWM A;  4CYO A;  4UFV A;  2D4O A;  3FIX A;  1LAP A;  4X2T A;  4Y49 C;  4DNC A;  4MFP A;  4MFL A;  3WAB A;  3C26 A;  1S7K A;  1CP6 A;  5LYD A;  1FY7 A;  3S6G A;  1YW4 A;  1A2Z A;  2BUE A;  2CNS A;  4PSX A;  2PE3 A;  5IB9 A;  4XNH B;  4W9Y A;  4A33 A;  3TFY A;  2YNC C;  4NGN A;  5AGE A;  2AFO A;  1YSJ A;  3D68 A;  3V8I A;  4FD7 A;  3FRM A;  3VAT A;  3IWW A;  3S6K A;  1VKC A;  1SQH A;  3GUX A;  4GM5 A;  4L8A A;  1KUY A;  1S5K A;  4NGT A;  3EO4 A;  1NMT A;  1Z2L A;  5DWN A;  2PDO A;  5HVF A;  3LAC A;  1BPN A;  3PB4 X;  3WT4 A;  4MJ8 A;  2Z10 A;  1KUX A;  4P4D A;  1NSA A;  2F7V A;  3QAY A;  1QSR A;  4C2Y A;  4FAI A;  3D67 A;  5F09 A;  4OC1 A;  4IK2 A;  4JXR A;  4FWU A;  4CYN A;  4E0A A;  2P0W A;  3PFO A;  3FEE A;  4HPS A;  4L89 A;  1LCP A;  4ZY0 A;  2PIY A;  4CRY B;  3R95 A;  1DE4 C;  3FBU A;  3CPX A;  4C2Z A;  4ZGY B;  1YME A;  3W91 A;  5K8P A;  2B3V A;  4R76 A;  1CM0 A;  2CF4 A;  3GIU A;  2XEF A;  1VHO A;  3LWU A;  1YX0 A;  3WC6 A;  2HB6 A;  1PCA A;  1HDU A;  2PJ2 A;  1QSM A;  4YU9 A;  1NSL A;  1Y0R A;  2P6E A;  1XFO A;  3MN8 A;  4JD6 A;  5H84 A;  1Q2Y A;  3KHX A;  5D29 A;  4CAE A;  5I4M A;  2R8V A;  4PXD A;  1S60 A;  4RN7 A;  2G0B A;  2PJ8 A;  5JQ4 A;  5J1Q A;  4KSI A;  2OZU A;  2EO8 A;  2JBJ A;  5C88 A;  5JM6 A;  4KOU A;  4R57 A;  4ZBG A;  1Y7R A;  1OZP A;  1ARL A;  2ZW6 A;  3B3V A;  4B6Z A;  2Q7S A;  4NSQ A;  3NH5 A;  2Q4Y A;  3FVL A;  4FUU A;  3TE4 A;  1YQE A;  3TC8 A;  1B6B A;  4JJX A;  4BMH A;  2ZEE A;  3I1U A;  4IAV A;  1YR0 A;  2ZEG A;  2RC4 A;  3S9M A;  2B4D B;  1K4J A;  4EFD A;  3LOD A;  1XJO A;  3DGV A;  1IYK A;  4E8O A;  4P44 A;  5A27 A;  4R8F A;  3KR5 A;  5AG6 A;  4E2A A;  1LRZ A;  3WR7 A;  2YND A;  4CRZ B;  2ZW4 A;  1CPX A;  3D8P A;  3IU2 A;  1BAV A;  4UCP A;  2NMT A;  4MFK A;  4O23 A;  2J8R A;  3PEI A;  5JPH A;  1XMT A;  3H5Z A;  2WZN A;  2VQY A;  4HKF A;  4F0Y A;  1YGH A;  4IF5 A;  3BI1 A;  3T9Y A;  1I21 A;  3DNS A;  3NE8 A;  3SXN A;  4OC4 A;  2ANP A;  2VXK A;  2QEC A;  4UFW A;  4CGM A;  4PV6 A;  2BCO A;  4KLW A;  3FYN A;  2JDD A;  5HXD A;  3PBB A;  1I1D A;  1YVO A;  3F0A A;  4KUB A;  2PJB A;  2O28 A;  3IIB A;  4M6I A;  5HVG A;  3R1K A;  1CX8 A;  1V0C A;  4H6U A;  4XPD C;  2RB7 A;  2C27 A;  4NGR A;  5A28 A;  2C1C A;  4X5K A;  1M4D A;  4AG7 A;  3BI0 A;  4AXV A;  4R87 A;  1CP7 A;  3ISZ A;  4ZX8 A;  3PP9 A;  4B5P A;  1M1D A;  1R3N A;  1S7N A;  2PJ7 A;  4JWP A;  4LX9 A;  2Z3L A;  2IQ6 A;  3TX8 A;  2D4P A;  1ZG9 A;  1MJ9 A;  2Y0M A;  2YNE A;  4NGQ A;  4P10 A;  3PB6 X;  2Z3K A;  4M85 A;  1ZG7 A;  3PBE A;  2OOT A;  4P4B A;  4A32 A;  2HUZ A;  4RI1 A;  1KZF A;  4IHM A;  4OAE A;  2ARH A;  1VIX A;  1LAM A;  1R57 A;  4PXB A;  4B5O A;  4EME A;  1KWM A;  1X10 A;  1XEB A;  2G3A A;  2POK A;  4MFQ A;  4Q36 A;  5K8O A;  1X12 A;  3D4U A;  3D7H A;  6CPA A;  4B12 A;  1CG2 A;  3B3C A;  3CXP A;  1S7F A;  3EC4 A;  4OME A;  5G1Z A;  2YNC A;  4LQG A;  2I79 A;  2XEJ A;  4KSA A;  2VL1 A;  3F5B A;  2FXF A;  3IWG A;  2Q43 A;  3D7D A;  2PJ9 A;  1ON0 A;  4UCN A;  2B5G B;  3EXN A;  3GB0 A;  2ZEO A;  3JUW A;  1F57 A;  8CPA A;  4C7I A;  4XPK A;  3BJ7 A;  4CAW A;  4ZYQ A;  2CXA A;  1UFH A;  4KSF A;  2P6F A;  2Z3M A;  2WYR A;  3G8W A;  4K3N A;  1AMP A;  3CXQ A;  4OKO A;  4KUA A;  1I12 A;  3I9S A;  5CPA A;  3JTK A;  3CPA A;  3PB9 X;  1KUV A;  2DPS A;  4M6H A;  3R9G A;  4PPZ A;  2F8H A;  4UWJ A;  4R7M A;  4FD4 A;  2BO9 A;  1M4L A;  4EVY A;  3P2H A;  4PK2 A;  4YGO A;  4R9M A;  1PYT B;  4F0X A;  4H6Z A;  5F47 A;  5EC4 A;  4MHZ A;  5ELY A;  4KOT A;  2V8H A;  5FVJ A;  4TWE A;  4DUK A;  4OC5 A;  3GLJ A;  1ZO0 A;  2I00 A;  1GYT A;  2OZH A;  4P4F A;  4UWI A;  4B5P B;  4A38 A;  1Z8T A;  5EBV A;  2AFZ A;  3SI2 A;  7CPA A;  4KOV A;  5CNP A;  1BO4 A;  4KS9 A;  4DJL A;  2PJ4 A;  3FX6 A;  5K8N A;  2FIA A;  2AFX A;  2PJ0 A;  2PJ3 A;  4PSW A;  5D8N A;  4P4J A;  4X3R A;  2YGW A;  2F5I A;  3IO1 A;  4MHY A;  4ZX9 A;  4OID A;  3B2Y A;  3IC1 A;  2PRQ A;  1LOK A;  4KOW A;  4ZY2 A;  4AVA A;  4CS0 B;  4MRI A;  2QML A;  2GRE A;  2C6P A;  3D3S A;  3KHZ A;  2ZW5 A;  4HNX B;  2Z3P A;  3F8K A;  1ELM P;  3DR6 A;  4OAD A;  1QQ9 A;  2BL1 A;  3FMC A;  1EE3 P;  1TKJ A;  4MXU A;  4NFR A;  4NGM A;  3TTH A;  2K5T A;  4RUH A;  4KVM E;  4P4E A;  5JH9 A;  4IUS A;  3MRU A;  3FJU A;  4ONU A;  4II9 A;  3SJG A;  2PIZ A;  1P4N A;  2XEI A;  4QUS A;  4H2K A;  3MGD A;  1XOV A;  4AB7 A;  2Q04 A;  1PU9 A;  3FNC A;  3VAR A;  1GHE A;  5THW A;  2EUI A;  4ORF A;  1XIX A;  3PFE A;  1XF8 A;  2CTC A;  2WPW A;  2V8D A;  3DSB A;  4MI4 A;  2FIW A;  1IGB A;  4MMO A;  2EBJ A;  4F8Z A;  4MHN A;  2P6G A;  3TCV A;  1JQG A;  2IJZ A;  4NCZ A;  1MJB A;  1HEE A;  4MBU A;  2VZY A;  3N5F A;  4ZY1 A;  4QC6 A;  3S6F A;  4Z65 A;  2GLJ A;  3DLJ A;  1FT7 A;  2DF5 A;  2ZEH A;  1Z8L A;  1IY7 A;  4MHD A;  4J3G A;  4JXQ A;  4KOX A;  2J8N A;  2JBK A;  2GIV A;  2V8G A;  3BHX A;  3H8F A;  2CNT A;  2G3T A;  1IOI A;  3BJ8 A;  2Z3N A;  4KOY A;  5LYI A;  3P2F A;  1LAN A;  4YRH A;  2REE A;  3CDX A;  4H89 A;  3R9E A;  3ISX A;  5G20 A;  3RNZ A;  1P0H A;  4KLV A;  4NGP A;  3I3G A;  4LUA A;  2EWB A;  3SXO A;  3L2N A;  3CXS A;  4F9V A;  4CAX A;  2GLF A;  4I49 A;  2JEW A;  4MHP A;  4UCM A;  1QST A;  2ZEN A;  1Q7L A;  5H86 A;  5ISV A;  1TF8 A;  1TKH A;  1ELL P;  2ZW7 A;  4MCP A;  2CIJ A;  2VBQ A;  1JWQ A;  4MY3 A;  4TNU A;  4B14 A;  5HMN A;  4UF4 A;  4A95 A;  4QB9 A;  4NEX A;  3JRU A;  2VZZ A;  1YLE A;  3GY9 A;  3S9N A;  4JLY A;  3S6H A;  2Z3O A;  2PQ8 A;  4A39 A;  4GS4 A;  1Y9K A;  3JVN A;  4K30 A;  3KI9 A;  3V38 A;  3A9L A;  3FED A;  3V7Z A;  2DXQ A;  3FB3 A;  4C68 A;  2BEI A;  1MK4 A;  3D2P A;  2HC9 A;  2R7H A;  1M4G A;  4XNH C;  5C82 A;  3NFZ A;  1IID A;  3H8E A;  3B35 A;  4MFJ A;  1TIQ A;  2JEV A;  2PRB A;  3B7I A;  3RYO A;  3FH4 A;  5LYF A;  2Q51 A;  4UEZ A;  3VH9 A;  1Z5R A;  2GAN A;  2WSA A;  2JDC A;  4MCR A;  4DYO A;  3E0K A;  2WPX A;  4UA3 A;  5LRK A;  3GYA A;  3B8G A;  5GCN A;  3K9U A;  3NH8 A;  2GE3 A;  5IB0 A;  1QMU A;  1Y7E A;  3RO0 A;  3NA6 A;  1XE4 A;  4CGL A;  3TO6 A;  2OU2 A;  3ZJ0 A;  2Q7B A;  1OBR A;  3D2M A;  4KVO E;  3IEH A;  3K2K A;  4CGP A;  4NJQ A;  4UEE A;  5AG4 A;  5IV0 A;  1QSN A;  1AUG A;  4P45 A;  4R6T A;  4UFX A;  5J8C A;  2HQY A;  4MCS A;  3N7Z A;  4MY0 A;  2HV2 A;  4B11 A;  1BOB A;  1RO5 A;  3CT9 A;  1Z4R A;  3B3W A;  3QAH A;  2OB0 A;  3IWE A;  5LYL A;  4GXH A;  2FL4 A;  4HNY B;  5F48 A;  3QB8 A;  3PGP A;  2ZEF A;  4M3S A;  4NGS A;  3W6X A;  3H8G A;  5CBM A;  3D7G A;  2PJ1 A;  2Q44 A;  5KTA A;  4NF1 A;  2XEG A;  1CJW A;  2AE6 A;  2EVN A;  3HLP A;  3UY5 A;  4QBJ A;  1QSO A;  1WK4 A;  2QYV A;  2B4D A;  2PJ6 A;  1N71 A;  4NXY A;  1S7L A;  1Z9U A;  2NYQ A;  3RAM A;  4A31 A;  5HVH A;  1UWY A;  4ZI6 A;  2OR4 A;  1Q2D A;  2Z0Z A;  3BXM A;  4HNW B;  3IGR A;  4MCQ A;  2DPT A;  2B4B A;  2I3C A;  2ZOF A;  3B3S A;  4Q7A A;  2V8V A;  1B87 A;  3KL9 A;  2CTB A;  4PXE A;  3WC7 A;  2CY2 A;  5LRG A;  1YVK A; 
#chains in the Genus database with same CATH homology
 2OH1 A;  1WWZ A;  1M4I A;  2H5M A;  3SHP A;  4OLL A;  3BLN A;  5AG7 A;  1RXT A;  4XPL A;  2R1I A;  5G22 A;  4CAF A;  4BBH A;  4Y49 B;  4B13 A;  5F46 A;  2FCK A;  2ZXV A;  1MJA A;  1Z4E A;  2PR8 A;  3KKW A;  2VI7 A;  3EY5 A;  3DDD A;  3W6S A;  1IYL A;  1Y9W A;  4UBR A;  3PZJ A;  4C7H A;  2J8M A;  4R3K A;  2B58 A;  2Q4V A;  4U9Y A;  2FS5 A;  4RS2 A;  5BWA B;  1Q2C A;  4PK3 A;  4A2Z A;  2X7B A;  5AG5 A;  2Z11 A;  3GKR A;  2VEZ A;  1NE9 A;  1YK3 A;  2REF A;  3VWD A;  1IIC A;  2R98 A;  3TOB A;  4CGN A;  1M44 A;  3TT2 A;  4C2X A;  2PSW A;  3NE7 A;  4FD5 A;  5G21 A;  2FE7 A;  4KVX A;  3VWE A;  2AJ6 A;  4U9Z A;  2PC1 A;  4KZT A;  4CYQ A;  3LD2 A;  2QIR A;  5KTC A;  2B5G A;  4AVB A;  2FSR A;  5KTD A;  1IB1 E;  4KOS A;  3EFA A;  2CNM A;  2FT0 A;  3IU1 A;  4B10 A;  2Q0Y A;  3TO9 A;  5F49 A;  2OZG A;  3OWC A;  2WUU A;  4AG9 A;  1VHS A;  1U6M A;  2A4N A;  3R9F A;  2IL4 A;  4QVT A;  3TOA A;  4CGO A;  4Q38 A;  5J8F A;  3TO7 A;  3ZZI A;  4U5Y A;  4MFZ A;  3G3S A;  2JLM A;  1PUA A;  1YRE A;  1S3Z A;  5I0C A;  4A30 A;  4R3L A;  3T90 A;  4KOR A;  1J4J A;  4YFJ A;  5HH1 A;  3R96 A;  2ZPA A;  2B3U A;  1L0C A;  2BSW A;  4CYP A;  3DR8 A;  4XPD B;  4F6A A;  4AVC A;  5IX3 A;  2PR1 A;  2KCW A;  4FD6 A;  3FXT A;  5E96 A;  3H4Q A;  2ATR A;  5DWM A;  4CYO A;  4UFV A;  2D4O A;  3FIX A;  4Y49 C;  4DNC A;  4MFP A;  4MFL A;  3C26 A;  1S7K A;  1FY7 A;  3S6G A;  2CY2 A;  2BUE A;  2CNS A;  4PSX A;  4XNH B;  4A33 A;  3TFY A;  2YNC C;  5AGE A;  3V8I A;  4FD7 A;  3FRM A;  3S6K A;  1VKC A;  1SQH A;  4L8A A;  1KUY A;  1S5K A;  3EO4 A;  1NMT A;  5DWN A;  2PDO A;  4MJ8 A;  2Z10 A;  1KUX A;  1QSR A;  4C2Y A;  4JXR A;  4CYN A;  4E0A A;  2P0W A;  4L89 A;  4CRY B;  3R95 A;  3FBU A;  4C2Z A;  4ZGY B;  3W91 A;  2B3V A;  1CM0 A;  1YX0 A;  1QSM A;  1NSL A;  2P6E A;  5H84 A;  1Q2Y A;  4CAE A;  2R8V A;  1S60 A;  2G0B A;  5JQ4 A;  2OZU A;  5C88 A;  4KOU A;  4R57 A;  4ZBG A;  1Y7R A;  1OZP A;  2ZW6 A;  4NSQ A;  2Q4Y A;  3TE4 A;  1B6B A;  4JJX A;  4BMH A;  1YR0 A;  2RC4 A;  2B4D B;  1K4J A;  3LOD A;  1IYK A;  4E8O A;  5A27 A;  4E2A A;  5AG6 A;  1LRZ A;  3WR7 A;  2YND A;  4CRZ B;  2ZW4 A;  3D8P A;  3IU2 A;  4UCP A;  2NMT A;  4MFK A;  2J8R A;  5JPH A;  1XMT A;  3H5Z A;  2VQY A;  4HKF A;  4F0Y A;  1YGH A;  4IF5 A;  3T9Y A;  1I21 A;  3DNS A;  3SXN A;  2VXK A;  2QEC A;  4UFW A;  4CGM A;  4PV6 A;  4KLW A;  3FYN A;  2JDD A;  1I1D A;  1YVO A;  3F0A A;  4KUB A;  2O28 A;  3R1K A;  4H6U A;  1V0C A;  4XPD C;  5A28 A;  2C27 A;  4X5K A;  1M4D A;  4AG7 A;  4R87 A;  3PP9 A;  4B5P A;  1M1D A;  1S7N A;  4JWP A;  4LX9 A;  2Z3L A;  2D4P A;  1MJ9 A;  2Y0M A;  2YNE A;  2Z3K A;  4M85 A;  4A32 A;  2HUZ A;  4RI1 A;  1KZF A;  4OAE A;  2ARH A;  1R57 A;  4B5O A;  2G3A A;  1XEB A;  4MFQ A;  4Q36 A;  4B12 A;  3CXP A;  1S7F A;  3EC4 A;  5G1Z A;  2YNC A;  2I79 A;  4KSA A;  3F5B A;  2FXF A;  3IWG A;  1ON0 A;  4UCN A;  2B5G B;  3EXN A;  3JUW A;  4C7I A;  4XPK A;  3BJ7 A;  4CAW A;  2CXA A;  1UFH A;  4KSF A;  2P6F A;  2Z3M A;  3G8W A;  3CXQ A;  4KUA A;  1I12 A;  3I9S A;  3JTK A;  1KUV A;  2DPS A;  3R9G A;  4UWJ A;  4FD4 A;  4EVY A;  3P2H A;  4PK2 A;  4YGO A;  4R9M A;  4F0X A;  4H6Z A;  5F47 A;  5EC4 A;  4KOT A;  5FVJ A;  1ZO0 A;  2I00 A;  2OZH A;  4UWI A;  4B5P B;  5EBV A;  4KOV A;  5CNP A;  1BO4 A;  4KS9 A;  2FIA A;  4PSW A;  2YGW A;  2F5I A;  4KOW A;  4AVA A;  4CS0 B;  2QML A;  3D3S A;  2ZW5 A;  4HNX B;  2Z3P A;  3F8K A;  3DR6 A;  4OAD A;  2BL1 A;  3TTH A;  2K5T A;  4KVM E;  4IUS A;  4ONU A;  4II9 A;  1P4N A;  4QUS A;  3MGD A;  4AB7 A;  2Q04 A;  1PU9 A;  3FNC A;  1GHE A;  2EUI A;  4ORF A;  1XIX A;  1XF8 A;  2WPW A;  3DSB A;  4MI4 A;  2FIW A;  2P6G A;  3TCV A;  4NCZ A;  1MJB A;  4MBU A;  2VZY A;  4QC6 A;  3S6F A;  4MHD A;  4J3G A;  4JXQ A;  4KOX A;  2J8N A;  2GIV A;  2CNT A;  2G3T A;  3BJ8 A;  2Z3N A;  4KOY A;  3P2F A;  4YRH A;  2REE A;  4H89 A;  3R9E A;  5G20 A;  1P0H A;  4KLV A;  3I3G A;  4LUA A;  3SXO A;  3CXS A;  4CAX A;  4I49 A;  4UCM A;  1QST A;  5H86 A;  5ISV A;  2ZW7 A;  4CAV A;  2VBQ A;  4MY3 A;  5HMN A;  4A95 A;  4QB9 A;  4NEX A;  2VZZ A;  1YLE A;  3GY9 A;  4JLY A;  3S6H A;  2Z3O A;  2PQ8 A;  4GS4 A;  1Y9K A;  3JVN A;  4K30 A;  3A9L A;  4C68 A;  2DXQ A;  3FB3 A;  2BEI A;  1MK4 A;  3D2P A;  4XNH C;  2R7H A;  1M4G A;  5C82 A;  1IID A;  4MFJ A;  1TIQ A;  2JEV A;  2PRB A;  3RYO A;  2GAN A;  2WSA A;  2JDC A;  3E0K A;  2WPX A;  4UA3 A;  3GYA A;  3B8G A;  5GCN A;  3K9U A;  2GE3 A;  5IB0 A;  1XE4 A;  4CGL A;  3TO6 A;  2OU2 A;  3ZJ0 A;  2Q7B A;  3D2M A;  4KVO E;  5AG4 A;  4CGP A;  5IV0 A;  1QSN A;  4UFX A;  5J8C A;  2HQY A;  3N7Z A;  4MY0 A;  2HV2 A;  4B11 A;  1BOB A;  1RO5 A;  1Z4R A;  3QAH A;  2OB0 A;  3IWE A;  2FL4 A;  4HNY B;  5F48 A;  3QB8 A;  3PGP A;  3W6X A;  4M3S A;  2Q44 A;  5KTA A;  4NF1 A;  1CJW A;  2AE6 A;  2EVN A;  3UY5 A;  4QBJ A;  1QSO A;  1WK4 A;  2B4D A;  1N71 A;  4NXY A;  1S7L A;  1Z9U A;  4A31 A;  1Q2D A;  2Z0Z A;  4HNW B;  3IGR A;  2DPT A;  2B4B A;  1B87 A;  4JD6 A;  4B14 A;  1YVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...