4CS0B

Direct visualisation of strain-induced protein post-translational modification
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
b'MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWEKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 35
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cs0B00
4AVBA 5IV0A 3FIXA 4PSXA 1IYLA 4M3SA 4L8AA 3I9SA 3FNCA 1UFHA 1IYKA 4ONUA 4LX9A 3FB3A 4UWIA 4AB7A 5F46A 1M44A 4GS4A 4NF1A 3ZZIA 1S7KA 2G0BA 1S7FA 4PV6A 4U9YA 2REFA 1YX0A 4R87A 3D8PA 1K4JA 3QB8A 2BEIA 4KOVA 1Z4RA 5DWNA 1YLEA 3CXSA 3D2MA 1KUYA 2B3UA 3G3SA 1I12A 3TFYA 2Q04A 2FIWA 4KUAA 2Q7BA 4MY0A 3T90A 1PU9A 2CNSA 1P4NA 1YVOA 2G3TA 4R57A 2NMTA 2ZW7A 3GYAA 3IGRA 2G3AA 3RYOA 1IICA 4EVYA 3TT2A 4I49A 4KOXA 4R3LA 3DSBA 3F8KA 2OZHA 1J4JA 1Z9UA 3E0KA 2ZXVA 2ZPAA 4F0YA 4UA3A 3ZJ0A 4E2AA 2P6GA 2VQYA 4XNHC 4H6UA 2OU2A 2WPWA 2HV2A 4OLLA 1M1DA 5IB0A 4F6AA 4QVTA 3S6FA 3S6GA 3SXNA 2PQ8A 3PP9A 4KVME 1PUAA 5KTDA 5J8CA 1IB1E 2PC1A 2OZGA 2B4BA 2VZYA 1Y9WA 3W91A 2FS5A 3R9GA 3D2PA 5F49A 4FD4A 4NXYA 4MI4A 1B87A 1NSLA 4YGOA 3EO4A 2X7BA 4XPKA 3QAHA 4YRHA 3TCVA 4MY3A 5I0CA 1RXTA 3NE7A 5E96A 2PSWA 5ISVA 2O28A 4QB9A 3R96A 4ORFA 2I79A 2GE3A 4KOWA 4ZBGA 4XPDC 1KUXA 2P0WA 2JEVA 3PZJA 2B3VA 2ZW5A 3BJ8A 5CNPA 3DR6A 2CY2A 4H6ZA 4QBJA 4CRZB 2RC4A 3S6HA 4KVOE 5FVJA 4X5KA 2ZW6A 1YREA 3SXOA 2FXFA 5H84A 1QSRA 4KLWA 2FE7A 1Y9KA 4IF5A 4CS0B 4J3GA 3I3GA 3KKWA 2VZZA 2JLMA 3DR8A 2K5TA 5HH1A 4K30A 2QMLA 4FD5A 2H5MA 3K9UA 1M4GA 2DXQA 3LD2A 4QC6A 5EBVA 4B5OA 1GHEA 3F0AA 2CNMA 4U9ZA 5HMNA 4NCZA 3IWGA 2J8MA 3D3SA 3EXNA 5GCNA 4DNCA 2ARHA 3FRMA 4KOUA 2C27A 3EC4A 3G8WA 3R9EA 3VWEA 4NSQA 2B58A 3V8IA 1S60A 1LRZA 2FIAA 4KZTA 4OAEA 2P6EA 1M4IA 1QSNA 5H86A 4E8OA 4CRYB 2PR8A 1P0HA 3FBUA 1ON0A 3B8GA 4H89A 4MJ8A 4RS2A 2F5IA 1KUVA 4L89A 3MGDA 3TTHA 3P2FA 3R1KA 2JDDA 2OH1A 2REEA 2A4NA 2HUZA 3C26A 4HKFA 5F48A 1BO4A 2B4DB 1S3ZA 1Q2CA 1QSTA 2Q4YA 1RO5A 4AVCA 2D4PA 2I00A 2B4DA 2R1IA 1XE4A 1XEBA 1Y7RA 4UWJA 2P6FA 1S7NA 3LODA 1L0CA 1I21A 2Z0ZA 4MBUA 2PRBA 4JJXA 1QSOA 4LUAA 5JPHA 4NEXA 1YGHA 1TIQA 3BLNA 2R8VA 4KLVA 2VI7A 1YR0A 4KVXA 1CM0A 4HNXB 4M85A 3TOAA 3TOBA 2ZW4A 4KORA 1I1DA 3W6XA 1YVKA 4JXRA 4U5YA 3PGPA 2FL4A 4FD6A 1NMTA 1U6MA 2D4OA 4QUSA 2QIRA 4KOSA 1VHSA 4KUBA 5IX3A 3UY5A 3GKRA 5DWMA 5J8FA 2VBQA 1S7LA 3GY9A 3VWDA 1V0CA 3P2HA 4XPLA 4MHDA 4UBRA 1KZFA 1M4DA 3DNSA 1OZPA 2JDCA 3DDDA 2IL4A 4JWPA 3R95A 3WR7A 3CXQA 4CAVA 4OADA 5F47A 1B6BA 1VKCA 2AJ6A 4YFJA 3TE4A 2OB0A 3JUWA 2FCKA 2KCWA 2PR1A 1WK4A 1SQHA 3FXTA 2BUEA 1YK3A 2J8RA 1Q2DA 1XF8A 2CNTA 3CXPA 5C82A 3EFAA 4CAWA 2WPXA 1WWZA 4PK2A 2B5GB 4R9MA 5KTAA 3OWCA 2Q44A 1MK4A 2Q4VA 2R98A 4XNHB 2R7HA 4KOYA 1QSMA 4IUSA 3F5BA 2B5GA 5JQ4A 4R3KA 3TO9A 1BOBA 1N71A 4PK3A 3TO6A 4B5PB 2J8NA 2ATRA 3TO7A 1IIDA 1FY7A 1XMTA 1R57A 2GANA 4B5PA 4II9A 5KTCA 4JXQA 2Z10A 4HNWB 2Y0MA 2EVNA 1Q2YA 1CJWA 2EUIA 1Z4EA 2HQYA 4Y49B 5C88A 4JD6A 2BL1A 4AVAA 2PDOA 4JLYA 2VXKA 4RI1A 1XIXA 4BMHA 4FD7A 2FSRA 2OZUA 3BJ7A 4Y49C 2VEZA 3S6KA 4AG9A 5EC4A 3N7ZA 4AG7A 2Z11A 2GIVA 3R9FA 2AE6A 1MJBA 1MJAA 3FYNA 4HNYB 3SHPA 1NE9A 2Q0YA 3EY5A 4CAXA 1S5KA 3H4QA 3T9YA 2QECA 3JVNA 4E0AA 1MJ9A 2FT0A 2BSWA 4KOTA 4XPDB 3W6SA 4PSWA
chains in the Genus database with same CATH superfamily
4AVBA 4UFVA 5IV0A 2CF4A 1ZG9A 3FF3A 2J9AA 3FIXA 4M6IA 1IYLA 1JWQA 4PSXA 4F9VA 2JEWA 4M3SA 4L8AA 3NE8A 2PJ9A 3I9SA 2QYVA 3FNCA 1UFHA 5K8OA 3KGQA 5ELYA 4MFQA 1IYKA 4ONUA 4LX9A 1Q7LA 3NH5A 3FB3A 4UWIA 5AGEA 4OC4A 5CPAA 4AB7A 5F46A 4MHPA 1M44A 3PB8X 4OKOA 4GS4A 4NF1A 3ZZIA 1S7KA 1YLOA 2G0BA 3PFEA 3IU1A 1S7FA 4PV6A 4U9YA 4UIBA 2EK8A 2REFA 4CGLA 1AYEA 1YX0A 4B6ZA 1R43A 2PJBA 4TWEA 4R87A 3D8PA 1K4JA 1LANA 1LOKA 3QB8A 4MXUA 2BEIA 3HLPA 3SJXA 2ANPA 2EWBA 1CBXA 4KOVA 1Z4RA 3IWWA 1YLEA 3CXSA 1ZLHA 3D2MA 5DWNA 4P44A 4CYPA 2ZEFA 1KUYA 2B3UA 3G3SA 1I12A 2AFZA 3TFYA 2Q04A 2FIWA 2ZEPA 4KUAA 4A95A 2Q7BA 4MY0A 4KSIA 5EMIA 3JRUA 3T90A 1PU9A 2CNSA 4LQ6A 4UEEA 3WT4A 2BOAA 1Z2LA 1P4NA 2YNEA 1YVOA 3ISZA 4OP4A 2G3TA 3K2KA 4R57A 4UCNA 4W9YA 2NMTA 2ZW7A 3D67A 3GYAA 4NJRA 2ZENA 3IGRA 1CG2A 2G3AA 3VARA 4C2ZA 3B3TA 3PB9X 3D7FA 3RYOA 1IICA 4EVYA 5K8PA 2WSAA 3TT2A 2Q51A 4BBHA 4I49A 4KOXA 4R3LA 2YGWA 3DSBA 3F8KA 2OZHA 4A32A 1YQEA 1J4JA 4OC0A 5G1ZA 1Z9UA 3E0KA 2ZXVA 4CGNA 2ZPAA 2AFOA 4F0YA 2ZOFA 4UA3A 1XMBA 1Y0RA 4B11A 4A30A 3ZJ0A 4E2AA 2P6GA 1ELLP 2VQYA 4MHNA 2QVPA 3WC7A 1LAMA 4C7HA 3IJ3A 3B3CA 4XNHC 4H6UA 2C6CA 2OU2A 1GYTA 4B14A 1IY7A 4A38A 2WPWA 5JH9A 3WC5A 4UF4A 2HV2A 2XEJA 2V8DA 3NFZA 4OLLA 4RUHA 4OMEA 1M1DA 3FVLA 3RAMA 4AXVA 5IB0A 4F6AA 2PCUA 1ZG7A 3SI2A 4PXCA 4QVTA 3S6FA 3S6GA 3SXNA 3VATA 3B2YA 1F57A 4UIAA 2PQ8A 3PP9A 4KVME 1PUAA 3ISXA 5THWA 5KTDA 1TXRA 2ZOGA 2CTCA 5LYLA 4UFXA 3L2NA 4MMOA 5J8CA 2ABZA 4CYQA 1ELMP 1IB1E 1M4LA 5A27A 2Z3NA 2PC1A 2OZGA 2B4BA 2VZYA 1Y9WA 4CAFA 4Q36A 1BPMA 2FS5A 3R9GA 3W91A 2PE3A 3D2PA 3PBEA 4CPAA 4KSFA 2YNCC 5F49A 4FD4A 4NXYA 3KR5A 1QQ9A 4MI4A 1B87A 1NSLA 4YGOA 3EO4A 1XOVA 3SJEA 2XEFA 2X7BA 3IEHA 4XPKA 4RN7A 4TNUA 4ZX9A 3QAHA 4YRHA 3CDXA 3TCVA 4CGOA 4MY3A 5I0CA 2POKA 1RXTA 1HDUA 3PB4X 1BPNA 3NE7A 1X12A 4NGPA 1NSAA 2AFMA 4PXDA 5E96A 2PSWA 4C2YA 5ISVA 2O28A 1Y7EA 4QB9A 2Q4ZA 4NGMA 3R96A 4ZX8A 4P45A 2VL1A 2PJ1A 4ORFA 2I79A 2GE3A 2F8HA 4KOWA 4ZBGA 4XPDC 2O4HA 1KUXA 2IMOA 2EO8A 5HVFA 2ZEDA 3D4UA 1TKJA 4NGTA 2P0WA 2BCOA 3VH9A 3SJGA 1ZG8A 2JEVA 3PZJA 1TF8A 3RO0A 5I4MA 2B3VA 2ZW5A 3BJ8A 3IO1A 5CNPA 3DR6A 3LACA 2CY2A 4H6ZA 2PJ7A 2OR4A 4OIWA 2PJ3A 2RC4A 4CRZB 4OC2A 4KVOE 4OIDA 3S6HA 2DPSA 4X5KA 2ZW6A 5FVJA 1YREA 2ZELA 3SXOA 3PBBA 2NSMA 3B7IA 4K3NA 2FXFA 4PQAA 4G1PA 4WWVA 1QSRA 5H84A 4KLWA 5DS0A 4MRIA 2FE7A 3DLJA 1Y9KA 1TKHA 1JQGA 4IF5A 4KS9A 4J3GA 4CS0B 3I3GA 3GLJA 3KKWA 3H8GA 3S9LA 1CP6A 3H8EA 2VZZA 3TX8A 2NYQA 3IWEA 4M6HA 2ZEEA 2JLMA 1YW6A 3CT9A 5K8MA 3KI9A 2PVWA 4HPSA 3DR8A 4R76A 2K5TA 5HH1A 4K30A 2GLJA 2EBJA 2QMLA 3D7DA 3IU2A 4FD5A 4NGRA 2O53A 2H5MA 1F2OA 2XEGA 1LAPA 1M4GA 3K9UA 4ONWA 1AUGA 4CYOA 1Z8WA 2DXQA 3LD2A 4QC6A 3NA6A 4P4EA 5EBVA 3FMCA 4B5OA 2AFWA 1GHEA 3HUVA 4O23A 3F0AA 2FVGA 2V8VA 2CNMA 4U9ZA 2BO9A 4UCMA 1R3NA 1IOIA 3RBUA 4NGQA 5HMNA 4NCZA 3B35A 3IWGA 2J8MA 3D3SA 3EXNA 5GCNA 4DNCA 4QBJA 4WJBA 4P6YA 3SI1A 3FX6A 2ARHA 3FRMA 4KOUA 2C27A 3EC4A 3G8WA 4A31A 2G9DA 3R9EA 2PJ5A 3QNVA 4C68A 4CGPA 1IU8A 3VWEA 3B3WA 3JTKA 4NSQA 2B58A 2V8HA 3V8IA 1S60A 4UFWA 1LRZA 3SJFA 2FIAA 4DUKA 3S9MA 4P4DA 3RZAA 4KZTA 2GU2A 3BXMA 4OAEA 2CXAA 2P6EA 4ZYQA 2I3CA 1XJOA 4OC1A 5HVHA 1M4IA 1QSNA 5LYIA 3N5FA 4JZ0A 5H86A 4E8OA 2QJ8A 4B12A 5LRGA 4NGSA 1LFWA 4CRYB 2PR8A 1P0HA 3FBUA 4FAIA 1ON0A 5J1QA 1PYTB 4P4IA 3B8GA 4H89A 4MJ8A 4B10A 2AFXA 4IAVA 4RS2A 1HDQA 2YNDA 1YW4A 2F5IA 3B3VA 1KUVA 4L89A 2IJZA 1XRYA 3MGDA 3TTHA 3P2FA 3R1KA 4FWUA 2JDDA 2Z3OA 5HXDA 2OH1A 2REEA 2A4NA 2HUZA 3DGVA 1HEEA 3C26A 4MCPA 4HKFA 5F48A 1BO4A 2PJ0A 1BAVA 4IK2A 4Q7AA 2B4DB 1H8LA 1Q2CA 1QSTA 1S3ZA 2Q4YA 4C2XA 5AG4A 6CPAA 5CBMA 1RO5A 4BINA 2ZEGA 1LCPA 4MFPA 4AVCA 2D4PA 3IIBA 2I00A 1ARLA 2B4DA 2R1IA 1XE4A 1XEBA 1Y7RA 4UWJA 5G21A 4Z65A 1DTDA 2P6FA 5IB9A 1S7NA 2DF5A 2C1CA 3CZXA 1ZO0A 3LODA 4A94A 4FUUA 1L0CA 5F47A 3BI1A 1I21A 2Z0ZA 1TKFA 4MBUA 4UEZA 1PCAA 2WUUA 4ZGYB 3IC1A 2PRBA 4JJXA 4A39A 4PPZA 3FH4A 1QSOA 1IGBA 4LUAA 4ZY1A 5JPHA 4NEXA 1YGHA 1TIQA 3TC8A 3BLNA 2R8VA 3LMSA 2VI7A 4KLVA 4Q38A 1YR0A 3PRTA 4KVXA 1CM0A 3PFOA 4HNXB 4M85A 4MHYA 4R8FA 3TOAA 3TOBA 2ZW4A 4MFJA 1Z8XA 4EFDA 2Z3MA 2JBKA 1I1DA 4KORA 3W6XA 2ZEHA 5JGFA 1YVKA 2XEIA 4JXRA 4U5YA 4EWTA 3PGPA 2FL4A 4FD6A 1NMTA 4R7MA 1U6MA 2D4OA 4YU9A 4QUSA 3NH4A 2PJCA 1EE3P 3GB0A 3PB7X 4ZY2A 5LRJA 2PJ8A 2QIRA 4KOSA 4MCRA 1VHSA 4CYNA 4P4BA 1Z5RA 2Z3PA 3V38A 4KUBA 2PJAA 4P10A 5IX3A 3FEDA 5AG7A 3PEIA 3UY5A 3GKRA 5DWMA 5J8FA 2VBQA 5G22A 2CTBA 3KHXA 8CPAA 4NFRA 1S7LA 4PXEA 2PJ2A 2WZNA 4FBEA 3MN8A 2HB6A 2V77A 3GY9A 4P4FA 4X8IA 4YWYA 3FJUA 3VWDA 4A2ZA 3KQZA 1V0CA 2ODFA 3P2HA 4GXHA 1AMPA 4UEFA 4XPLA 4MHDA 4UBRA 4MCQA 3BI0A 3GIUA 1F2PA 3NH8A 2ZEMA 3I1UA 1KZFA 4X2TA 4NGNA 5LRKA 3TE4A 1M4DA 5LYDA 3S9NA 4EMEA 1X10A 1VHEA 3DNSA 1OZPA 4CGMA 2JDCA 3DDDA 4H2KA 2CIJA 2IL4A 3IFEA 4JWPA 3CXQA 3R95A 3WR7A 4CAVA 4OADA 2GFQA 2ZEOA 1ARMA 3H8FA 1B6BA 1VKCA 2AJ6A 3K9TA 4MFLA 4A37A 4YFJA 2OB0A 3JUWA 5G20A 2Q7SA 1VIXA 3FECA 3KR4A 2FCKA 2KCWA 2PJ4A 2PR1A 1WK4A 7CPAA 1Y0YA 1SQHA 3FXTA 2BUEA 1YK3A 2J8RA 1Q2DA 4F9UA 5LYFA 2DPTA 1XF8A 3KQXA 3PB6X 4OC5A 2CNTA 3KASA 4F0XA 3CXPA 3WC6A 5C82A 3EFAA 2RFHA 5A28A 1VHOA 4R6TA 5KTAA 1CX8A 4CAWA 2WPXA 2Z3LA 1WWZA 3KL9A 4PK2A 1BLLE 4X3RA 4MHZA 1CPXA 1FT7A 2B5GB 3D68A 4R9MA 3OWCA 3T8WA 2Q44A 1MK4A 4A33A 2RB7A 3D7GA 4C7IA 2Q4VA 2R98A 4XNHB 2R7HA 2C6PA 4KOYA 1QSMA 3FEEA 4IUSA 3V7ZA 1OBRA 3F5BA 2B5GA 2PIYA 5D8NA 5BWAB 1UWYA 4MFKA 2AFUA 5JQ4A 2AFSA 2IQ6A 4R3KA 5D29A 2DEAA 4BD9A 3TO9A 1BOBA 1N71A 4PK3A 4ZI6A 5JM6A 4KSAA 3TO6A 1FNOA 2J8NA 1XBUA 2ATRA 3WABA 4B5PB 4DJLA 3TO7A 5K8NA 1IIDA 1VGYA 1FY7A 1XMTA 2WYRA 3KHZA 1R57A 2GANA 4B5PA 4II9A 5KTCA 4JXQA 2Z10A 5AG6A 4HNWB 3MRUA 2Y0MA 4PXBA 3D7HA 3CPXA 4M6GA 2EVNA 4GM5A 1Q2YA 1CJWA 2F7VA 2OOTA 1YMEA 3H5ZA 2EUIA 4CAEA 5HVGA 1Z4EA 2HQYA 2PIZA 3D66A 3GUXA 4Y49B 5C88A 1DE4C 4JD6A 2BL1A 4AVAA 2PDOA 4JLYA 4UCPA 2VXKA 2V8GA 3A9LA 4RI1A 1XIXA 4BMHA 3BHXA 2FSRA 1ZLIA 2Z3KA 4FD7A 2OZUA 4DYOA 3BJ7A 1A2ZA 1RTQA 4Y49C 2VEZA 5AG5A 3S6KA 4AG9A 3KZWA 3N7ZA 1YSJA 2HC9A 4JYWA 2GREA 2YNCA 5EC4A 2Z11A 4AG7A 1Z8TA 2GIVA 1QMUA 4P4JA 3R9FA 2AE6A 1CP7A 1MJAA 1MJBA 2GLFA 3B3SA 3CPAA 3FYNA 4HNYB 3SHPA 5F09A 1NE9A 2JBJA 2PJ6A 4LQGA 3SI0A 2Q0YA 3EY5A 1XFOA 2PVVA 3LWUA 1Z8LA 4CAXA 1S5KA 3H4QA 4NJQA 4ZY0A 3T9YA 1CPSA 2QECA 4F8ZA 4OC3A 1KWMA 2PRQA 1TF9A 4IHMA 1IOFA 3JVNA 4MFZA 4E0AA 1MJ9A 3QAYA 2EK9A 2FT0A 2BSWA 4MCSA 2Q43A 4B13A 4KOTA 4XPDB 3W6SA 2C6GA 4PSWA 3RNZA
chains in the Genus database with same CATH topology
4AVBA 4UFVA 5IV0A 3FIXA 4PSXA 1IYLA 4M3SA 4L8AA 3I9SA 3FNCA 1UFHA 4MFQA 1IYKA 4ONUA 4LX9A 3FB3A 4UWIA 5AGEA 4AB7A 5F46A 1M44A 4GS4A 4NF1A 3ZZIA 1S7KA 2G0BA 3IU1A 1S7FA 4PV6A 4U9YA 2REFA 4CGLA 1YX0A 4R87A 3D8PA 1K4JA 3QB8A 2BEIA 4KOVA 1Z4RA 5DWNA 1YLEA 3CXSA 3D2MA 4CYPA 1KUYA 2B3UA 3G3SA 1I12A 3TFYA 2Q04A 2FIWA 4KUAA 4A95A 2Q7BA 4MY0A 3T90A 1PU9A 2CNSA 1P4NA 2YNEA 1YVOA 4UCNA 2G3TA 4R57A 2NMTA 2ZW7A 3GYAA 3IGRA 2G3AA 4C2ZA 3RYOA 1IICA 4EVYA 2WSAA 3TT2A 4BBHA 4I49A 4KOXA 4R3LA 2YGWA 3DSBA 3F8KA 2OZHA 4A32A 1J4JA 5G1ZA 1Z9UA 3E0KA 2ZXVA 2ZPAA 4F0YA 4UA3A 4B11A 4A30A 3ZJ0A 4E2AA 2P6GA 2VQYA 4C7HA 4XNHC 4H6UA 2OU2A 4B14A 2WPWA 2HV2A 4OLLA 1M1DA 5IB0A 4F6AA 4QVTA 3S6FA 3S6GA 3SXNA 2PQ8A 3PP9A 4KVME 1PUAA 5KTDA 4UFXA 5J8CA 4CYQA 1IB1E 5A27A 2Z3NA 2PC1A 2OZGA 2B4BA 2VZYA 1Y9WA 4CAFA 4Q36A 2FS5A 3R9GA 3W91A 3D2PA 4KSFA 2YNCC 5F49A 4FD4A 4NXYA 4MI4A 1B87A 1NSLA 4YGOA 3EO4A 2X7BA 4XPKA 3QAHA 4YRHA 4CGOA 3TCVA 4MY3A 5I0CA 1RXTA 3NE7A 5E96A 2PSWA 4C2YA 5ISVA 2O28A 4QB9A 3R96A 4ORFA 2I79A 2GE3A 4KOWA 4ZBGA 4XPDC 1KUXA 2P0WA 2JEVA 3PZJA 2B3VA 2ZW5A 3BJ8A 5CNPA 3DR6A 2CY2A 4H6ZA 4QBJA 4CRZB 2RC4A 3S6HA 4KVOE 2DPSA 4X5KA 2ZW6A 5FVJA 1YREA 3SXOA 2FXFA 5H84A 1QSRA 4KLWA 2FE7A 4KS9A 1Y9KA 4IF5A 4CS0B 4J3GA 3I3GA 3KKWA 2VZZA 3IWEA 2JLMA 3DR8A 2K5TA 5HH1A 4K30A 3IU2A 2QMLA 4FD5A 2H5MA 3K9UA 1M4GA 4CYOA 2DXQA 3LD2A 4QC6A 5EBVA 4B5OA 1GHEA 3F0AA 2CNMA 4U9ZA 4UCMA 5HMNA 4NCZA 3IWGA 2J8MA 3D3SA 3EXNA 5GCNA 4DNCA 2ARHA 3FRMA 4KOUA 2C27A 3EC4A 3G8WA 4A31A 3R9EA 4C68A 4CGPA 3VWEA 3JTKA 4NSQA 2B58A 3V8IA 1S60A 4UFWA 1LRZA 2FIAA 4KZTA 4OAEA 2CXAA 2P6EA 1M4IA 1QSNA 5H86A 4E8OA 4B12A 4CRYB 2PR8A 1P0HA 3FBUA 1ON0A 3B8GA 4H89A 4MJ8A 4B10A 4RS2A 2YNDA 2F5IA 1KUVA 4L89A 3MGDA 3TTHA 3P2FA 3R1KA 2JDDA 2Z3OA 2OH1A 2REEA 2A4NA 2HUZA 3C26A 4HKFA 5F48A 1BO4A 2B4DB 1S3ZA 1Q2CA 1QSTA 4C2XA 2Q4YA 5AG4A 1RO5A 4MFPA 4AVCA 2D4PA 2I00A 2B4DA 2R1IA 1XE4A 1XEBA 1Y7RA 4UWJA 5G21A 2P6FA 1S7NA 1ZO0A 3LODA 1L0CA 1I21A 2Z0ZA 4MBUA 2WUUA 4ZGYB 2PRBA 4JJXA 1QSOA 4LUAA 5JPHA 4NEXA 1YGHA 1TIQA 3BLNA 2R8VA 4KLVA 2VI7A 4Q38A 1YR0A 4KVXA 1CM0A 4HNXB 4M85A 3TOAA 3TOBA 2ZW4A 4MFJA 2Z3MA 4KORA 1I1DA 3W6XA 1YVKA 4JXRA 4U5YA 3PGPA 2FL4A 4FD6A 1NMTA 1U6MA 2D4OA 4QUSA 2QIRA 4KOSA 1VHSA 4CYNA 2Z3PA 4KUBA 5IX3A 5AG7A 3UY5A 3GKRA 5DWMA 5J8FA 2VBQA 5G22A 1S7LA 3GY9A 3VWDA 4A2ZA 1V0CA 3P2HA 4XPLA 4MHDA 4UBRA 1KZFA 1M4DA 3DNSA 1OZPA 4CGMA 2JDCA 3DDDA 2IL4A 4JWPA 3R95A 3WR7A 3CXQA 4CAVA 4OADA 5F47A 1B6BA 1VKCA 2AJ6A 4MFLA 4YFJA 3TE4A 2OB0A 3JUWA 5G20A 2FCKA 2KCWA 2PR1A 1WK4A 1SQHA 3FXTA 2BUEA 1YK3A 2J8RA 1Q2DA 2DPTA 1XF8A 2CNTA 4F0XA 3CXPA 5C82A 3EFAA 5A28A 4CAWA 2WPXA 2Z3LA 1WWZA 4PK2A 2B5GB 4R9MA 5KTAA 4A33A 3OWCA 4C7IA 2Q44A 1MK4A 2Q4VA 2R98A 4XNHB 2R7HA 4KOYA 1QSMA 4IUSA 3F5BA 2B5GA 5BWAB 4MFKA 5JQ4A 4R3KA 3TO9A 1BOBA 1N71A 4PK3A 4KSAA 3TO6A 4B5PB 2J8NA 2ATRA 3TO7A 1IIDA 1FY7A 1XMTA 1R57A 2GANA 4B5PA 4II9A 5KTCA 4JXQA 2Z10A 5AG6A 4HNWB 2Y0MA 2EVNA 1Q2YA 1CJWA 3H5ZA 2EUIA 4CAEA 1Z4EA 2HQYA 4Y49B 5C88A 4JD6A 2BL1A 4AVAA 2PDOA 4JLYA 4UCPA 2VXKA 3A9LA 4RI1A 1XIXA 4BMHA 4FD7A 2FSRA 2Z3KA 2OZUA 3BJ7A 4Y49C 2VEZA 5AG5A 3S6KA 4AG9A 5EC4A 3N7ZA 4CGNA 4AG7A 2YNCA 2Z11A 2GIVA 3R9FA 2AE6A 1MJBA 1MJAA 3FYNA 4HNYB 3SHPA 1NE9A 2Q0YA 3EY5A 4CAXA 1S5KA 3H4QA 3T9YA 2QECA 3JVNA 4MFZA 4E0AA 1MJ9A 2FT0A 2BSWA 4B13A 4KOTA 4XPDB 3W6SA 4PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVB A;  5IV0 A;  3FIX A;  4PSX A;  1IYL A;  4M3S A;  4L8A A;  3I9S A;  3FNC A;  1UFH A;  1IYK A;  4ONU A;  4LX9 A;  3FB3 A;  4UWI A;  4AB7 A;  5F46 A;  1M44 A;  4GS4 A;  4NF1 A;  3ZZI A;  1S7K A;  2G0B A;  1S7F A;  4PV6 A;  4U9Y A;  2REF A;  1YX0 A;  4R87 A;  3D8P A;  1K4J A;  3QB8 A;  2BEI A;  4KOV A;  1Z4R A;  5DWN A;  1YLE A;  3CXS A;  3D2M A;  1KUY A;  2B3U A;  3G3S A;  1I12 A;  3TFY A;  2Q04 A;  2FIW A;  4KUA A;  2Q7B A;  4MY0 A;  3T90 A;  1PU9 A;  2CNS A;  1P4N A;  1YVO A;  2G3T A;  4R57 A;  2NMT A;  2ZW7 A;  3GYA A;  3IGR A;  2G3A A;  3RYO A;  1IIC A;  4EVY A;  3TT2 A;  4I49 A;  4KOX A;  4R3L A;  3DSB A;  3F8K A;  2OZH A;  1J4J A;  1Z9U A;  3E0K A;  2ZXV A;  2ZPA A;  4F0Y A;  4UA3 A;  3ZJ0 A;  4E2A A;  2P6G A;  2VQY A;  4XNH C;  4H6U A;  2OU2 A;  2WPW A;  2HV2 A;  4OLL A;  1M1D A;  5IB0 A;  4F6A A;  4QVT A;  3S6F A;  3S6G A;  3SXN A;  2PQ8 A;  3PP9 A;  4KVM E;  1PUA A;  5KTD A;  5J8C A;  1IB1 E;  2PC1 A;  2OZG A;  2B4B A;  2VZY A;  1Y9W A;  3W91 A;  2FS5 A;  3R9G A;  3D2P A;  5F49 A;  4FD4 A;  4NXY A;  4MI4 A;  1B87 A;  1NSL A;  4YGO A;  3EO4 A;  2X7B A;  4XPK A;  3QAH A;  4YRH A;  3TCV A;  4MY3 A;  5I0C A;  1RXT A;  3NE7 A;  5E96 A;  2PSW A;  5ISV A;  2O28 A;  4QB9 A;  3R96 A;  4ORF A;  2I79 A;  2GE3 A;  4KOW A;  4ZBG A;  4XPD C;  1KUX A;  2P0W A;  2JEV A;  3PZJ A;  2B3V A;  2ZW5 A;  3BJ8 A;  5CNP A;  3DR6 A;  2CY2 A;  4H6Z A;  4QBJ A;  4CRZ B;  2RC4 A;  3S6H A;  4KVO E;  5FVJ A;  4X5K A;  2ZW6 A;  1YRE A;  3SXO A;  2FXF A;  5H84 A;  1QSR A;  4KLW A;  2FE7 A;  1Y9K A;  4IF5 A;  4CS0 B;  4J3G A;  3I3G A;  3KKW A;  2VZZ A;  2JLM A;  3DR8 A;  2K5T A;  5HH1 A;  4K30 A;  2QML A;  4FD5 A;  2H5M A;  3K9U A;  1M4G A;  2DXQ A;  3LD2 A;  4QC6 A;  5EBV A;  4B5O A;  1GHE A;  3F0A A;  2CNM A;  4U9Z A;  5HMN A;  4NCZ A;  3IWG A;  2J8M A;  3D3S A;  3EXN A;  5GCN A;  4DNC A;  2ARH A;  3FRM A;  4KOU A;  2C27 A;  3EC4 A;  3G8W A;  3R9E A;  3VWE A;  4NSQ A;  2B58 A;  3V8I A;  1S60 A;  1LRZ A;  2FIA A;  4KZT A;  4OAE A;  2P6E A;  1M4I A;  1QSN A;  5H86 A;  4E8O A;  4CRY B;  2PR8 A;  1P0H A;  3FBU A;  1ON0 A;  3B8G A;  4H89 A;  4MJ8 A;  4RS2 A;  2F5I A;  1KUV A;  4L89 A;  3MGD A;  3TTH A;  3P2F A;  3R1K A;  2JDD A;  2OH1 A;  2REE A;  2A4N A;  2HUZ A;  3C26 A;  4HKF A;  5F48 A;  1BO4 A;  2B4D B;  1S3Z A;  1Q2C A;  1QST A;  2Q4Y A;  1RO5 A;  4AVC A;  2D4P A;  2I00 A;  2B4D A;  2R1I A;  1XE4 A;  1XEB A;  1Y7R A;  4UWJ A;  2P6F A;  1S7N A;  3LOD A;  1L0C A;  1I21 A;  2Z0Z A;  4MBU A;  2PRB A;  4JJX A;  1QSO A;  4LUA A;  5JPH A;  4NEX A;  1YGH A;  1TIQ A;  3BLN A;  2R8V A;  4KLV A;  2VI7 A;  1YR0 A;  4KVX A;  1CM0 A;  4HNX B;  4M85 A;  3TOA A;  3TOB A;  2ZW4 A;  4KOR A;  1I1D A;  3W6X A;  1YVK A;  4JXR A;  4U5Y A;  3PGP A;  2FL4 A;  4FD6 A;  1NMT A;  1U6M A;  2D4O A;  4QUS A;  2QIR A;  4KOS A;  1VHS A;  4KUB A;  5IX3 A;  3UY5 A;  3GKR A;  5DWM A;  5J8F A;  2VBQ A;  1S7L A;  3GY9 A;  3VWD A;  1V0C A;  3P2H A;  4XPL A;  4MHD A;  4UBR A;  1KZF A;  1M4D A;  3DNS A;  1OZP A;  2JDC A;  3DDD A;  2IL4 A;  4JWP A;  3R95 A;  3WR7 A;  3CXQ A;  4CAV A;  4OAD A;  5F47 A;  1B6B A;  1VKC A;  2AJ6 A;  4YFJ A;  3TE4 A;  2OB0 A;  3JUW A;  2FCK A;  2KCW A;  2PR1 A;  1WK4 A;  1SQH A;  3FXT A;  2BUE A;  1YK3 A;  2J8R A;  1Q2D A;  1XF8 A;  2CNT A;  3CXP A;  5C82 A;  3EFA A;  4CAW A;  2WPX A;  1WWZ A;  4PK2 A;  2B5G B;  4R9M A;  5KTA A;  3OWC A;  2Q44 A;  1MK4 A;  2Q4V A;  2R98 A;  4XNH B;  2R7H A;  4KOY A;  1QSM A;  4IUS A;  3F5B A;  2B5G A;  5JQ4 A;  4R3K A;  3TO9 A;  1BOB A;  1N71 A;  4PK3 A;  3TO6 A;  4B5P B;  2J8N A;  2ATR A;  3TO7 A;  1IID A;  1FY7 A;  1XMT A;  1R57 A;  2GAN A;  4B5P A;  4II9 A;  5KTC A;  4JXQ A;  2Z10 A;  4HNW B;  2Y0M A;  2EVN A;  1Q2Y A;  1CJW A;  2EUI A;  1Z4E A;  2HQY A;  4Y49 B;  5C88 A;  4JD6 A;  2BL1 A;  4AVA A;  2PDO A;  4JLY A;  2VXK A;  4RI1 A;  1XIX A;  4BMH A;  4FD7 A;  2FSR A;  2OZU A;  3BJ7 A;  4Y49 C;  2VEZ A;  3S6K A;  4AG9 A;  5EC4 A;  3N7Z A;  4AG7 A;  2Z11 A;  2GIV A;  3R9F A;  2AE6 A;  1MJB A;  1MJA A;  3FYN A;  4HNY B;  3SHP A;  1NE9 A;  2Q0Y A;  3EY5 A;  4CAX A;  1S5K A;  3H4Q A;  3T9Y A;  2QEC A;  3JVN A;  4E0A A;  1MJ9 A;  2FT0 A;  2BSW A;  4KOT A;  4XPD B;  3W6S A;  4PSW A; 
#chains in the Genus database with same CATH topology
 4AVB A;  4UFV A;  5IV0 A;  2CF4 A;  1ZG9 A;  3FF3 A;  2J9A A;  3FIX A;  4M6I A;  1IYL A;  1JWQ A;  4PSX A;  4F9V A;  2JEW A;  4M3S A;  4L8A A;  3NE8 A;  2PJ9 A;  3I9S A;  2QYV A;  3FNC A;  1UFH A;  5K8O A;  3KGQ A;  5ELY A;  4MFQ A;  1IYK A;  4ONU A;  4LX9 A;  1Q7L A;  3NH5 A;  3FB3 A;  4UWI A;  5AGE A;  4OC4 A;  5CPA A;  4AB7 A;  5F46 A;  4MHP A;  1M44 A;  3PB8 X;  4OKO A;  4GS4 A;  4NF1 A;  3ZZI A;  1S7K A;  1YLO A;  2G0B A;  3PFE A;  3IU1 A;  1S7F A;  4PV6 A;  4U9Y A;  4UIB A;  2EK8 A;  2REF A;  4CGL A;  1AYE A;  1YX0 A;  4B6Z A;  1R43 A;  2PJB A;  4TWE A;  4R87 A;  3D8P A;  1K4J A;  1LAN A;  1LOK A;  3QB8 A;  4MXU A;  2BEI A;  3HLP A;  3SJX A;  2ANP A;  2EWB A;  1CBX A;  4KOV A;  1Z4R A;  3IWW A;  1YLE A;  3CXS A;  1ZLH A;  3D2M A;  5DWN A;  4P44 A;  4CYP A;  2ZEF A;  1KUY A;  2B3U A;  3G3S A;  1I12 A;  2AFZ A;  3TFY A;  2Q04 A;  2FIW A;  2ZEP A;  4KUA A;  4A95 A;  2Q7B A;  4MY0 A;  4KSI A;  5EMI A;  3JRU A;  3T90 A;  1PU9 A;  2CNS A;  4LQ6 A;  4UEE A;  3WT4 A;  2BOA A;  1Z2L A;  1P4N A;  2YNE A;  1YVO A;  3ISZ A;  4OP4 A;  2G3T A;  3K2K A;  4R57 A;  4UCN A;  4W9Y A;  2NMT A;  2ZW7 A;  3D67 A;  3GYA A;  4NJR A;  2ZEN A;  3IGR A;  1CG2 A;  2G3A A;  3VAR A;  4C2Z A;  3B3T A;  3PB9 X;  3D7F A;  3RYO A;  1IIC A;  4EVY A;  5K8P A;  2WSA A;  3TT2 A;  2Q51 A;  4BBH A;  4I49 A;  4KOX A;  4R3L A;  2YGW A;  3DSB A;  3F8K A;  2OZH A;  4A32 A;  1YQE A;  1J4J A;  4OC0 A;  5G1Z A;  1Z9U A;  3E0K A;  2ZXV A;  4CGN A;  2ZPA A;  2AFO A;  4F0Y A;  2ZOF A;  4UA3 A;  1XMB A;  1Y0R A;  4B11 A;  4A30 A;  3ZJ0 A;  4E2A A;  2P6G A;  1ELL P;  2VQY A;  4MHN A;  2QVP A;  3WC7 A;  1LAM A;  4C7H A;  3IJ3 A;  3B3C A;  4XNH C;  4H6U A;  2C6C A;  2OU2 A;  1GYT A;  4B14 A;  1IY7 A;  4A38 A;  2WPW A;  5JH9 A;  3WC5 A;  4UF4 A;  2HV2 A;  2XEJ A;  2V8D A;  3NFZ A;  4OLL A;  4RUH A;  4OME A;  1M1D A;  3FVL A;  3RAM A;  4AXV A;  5IB0 A;  4F6A A;  2PCU A;  1ZG7 A;  3SI2 A;  4PXC A;  4QVT A;  3S6F A;  3S6G A;  3SXN A;  3VAT A;  3B2Y A;  1F57 A;  4UIA A;  2PQ8 A;  3PP9 A;  4KVM E;  1PUA A;  3ISX A;  5THW A;  5KTD A;  1TXR A;  2ZOG A;  2CTC A;  5LYL A;  4UFX A;  3L2N A;  4MMO A;  5J8C A;  2ABZ A;  4CYQ A;  1ELM P;  1IB1 E;  1M4L A;  5A27 A;  2Z3N A;  2PC1 A;  2OZG A;  2B4B A;  2VZY A;  1Y9W A;  4CAF A;  4Q36 A;  1BPM A;  2FS5 A;  3R9G A;  3W91 A;  2PE3 A;  3D2P A;  3PBE A;  4CPA A;  4KSF A;  2YNC C;  5F49 A;  4FD4 A;  4NXY A;  3KR5 A;  1QQ9 A;  4MI4 A;  1B87 A;  1NSL A;  4YGO A;  3EO4 A;  1XOV A;  3SJE A;  2XEF A;  2X7B A;  3IEH A;  4XPK A;  4RN7 A;  4TNU A;  4ZX9 A;  3QAH A;  4YRH A;  3CDX A;  3TCV A;  4CGO A;  4MY3 A;  5I0C A;  2POK A;  1RXT A;  1HDU A;  3PB4 X;  1BPN A;  3NE7 A;  1X12 A;  4NGP A;  1NSA A;  2AFM A;  4PXD A;  5E96 A;  2PSW A;  4C2Y A;  5ISV A;  2O28 A;  1Y7E A;  4QB9 A;  2Q4Z A;  4NGM A;  3R96 A;  4ZX8 A;  4P45 A;  2VL1 A;  2PJ1 A;  4ORF A;  2I79 A;  2GE3 A;  2F8H A;  4KOW A;  4ZBG A;  4XPD C;  2O4H A;  1KUX A;  2IMO A;  2EO8 A;  5HVF A;  2ZED A;  3D4U A;  1TKJ A;  4NGT A;  2P0W A;  2BCO A;  3VH9 A;  3SJG A;  1ZG8 A;  2JEV A;  3PZJ A;  1TF8 A;  3RO0 A;  5I4M A;  2B3V A;  2ZW5 A;  3BJ8 A;  3IO1 A;  5CNP A;  3DR6 A;  3LAC A;  2CY2 A;  4H6Z A;  2PJ7 A;  2OR4 A;  4OIW A;  2PJ3 A;  2RC4 A;  4CRZ B;  4OC2 A;  4KVO E;  4OID A;  3S6H A;  2DPS A;  4X5K A;  2ZW6 A;  5FVJ A;  1YRE A;  2ZEL A;  3SXO A;  3PBB A;  2NSM A;  3B7I A;  4K3N A;  2FXF A;  4PQA A;  4G1P A;  4WWV A;  1QSR A;  5H84 A;  4KLW A;  5DS0 A;  4MRI A;  2FE7 A;  3DLJ A;  1Y9K A;  1TKH A;  1JQG A;  4IF5 A;  4KS9 A;  4J3G A;  4CS0 B;  3I3G A;  3GLJ A;  3KKW A;  3H8G A;  3S9L A;  1CP6 A;  3H8E A;  2VZZ A;  3TX8 A;  2NYQ A;  3IWE A;  4M6H A;  2ZEE A;  2JLM A;  1YW6 A;  3CT9 A;  5K8M A;  3KI9 A;  2PVW A;  4HPS A;  3DR8 A;  4R76 A;  2K5T A;  5HH1 A;  4K30 A;  2GLJ A;  2EBJ A;  2QML A;  3D7D A;  3IU2 A;  4FD5 A;  4NGR A;  2O53 A;  2H5M A;  1F2O A;  2XEG A;  1LAP A;  1M4G A;  3K9U A;  4ONW A;  1AUG A;  4CYO A;  1Z8W A;  2DXQ A;  3LD2 A;  4QC6 A;  3NA6 A;  4P4E A;  5EBV A;  3FMC A;  4B5O A;  2AFW A;  1GHE A;  3HUV A;  4O23 A;  3F0A A;  2FVG A;  2V8V A;  2CNM A;  4U9Z A;  2BO9 A;  4UCM A;  1R3N A;  1IOI A;  3RBU A;  4NGQ A;  5HMN A;  4NCZ A;  3B35 A;  3IWG A;  2J8M A;  3D3S A;  3EXN A;  5GCN A;  4DNC A;  4QBJ A;  4WJB A;  4P6Y A;  3SI1 A;  3FX6 A;  2ARH A;  3FRM A;  4KOU A;  2C27 A;  3EC4 A;  3G8W A;  4A31 A;  2G9D A;  3R9E A;  2PJ5 A;  3QNV A;  4C68 A;  4CGP A;  1IU8 A;  3VWE A;  3B3W A;  3JTK A;  4NSQ A;  2B58 A;  2V8H A;  3V8I A;  1S60 A;  4UFW A;  1LRZ A;  3SJF A;  2FIA A;  4DUK A;  3S9M A;  4P4D A;  3RZA A;  4KZT A;  2GU2 A;  3BXM A;  4OAE A;  2CXA A;  2P6E A;  4ZYQ A;  2I3C A;  1XJO A;  4OC1 A;  5HVH A;  1M4I A;  1QSN A;  5LYI A;  3N5F A;  4JZ0 A;  5H86 A;  4E8O A;  2QJ8 A;  4B12 A;  5LRG A;  4NGS A;  1LFW A;  4CRY B;  2PR8 A;  1P0H A;  3FBU A;  4FAI A;  1ON0 A;  5J1Q A;  1PYT B;  4P4I A;  3B8G A;  4H89 A;  4MJ8 A;  4B10 A;  2AFX A;  4IAV A;  4RS2 A;  1HDQ A;  2YND A;  1YW4 A;  2F5I A;  3B3V A;  1KUV A;  4L89 A;  2IJZ A;  1XRY A;  3MGD A;  3TTH A;  3P2F A;  3R1K A;  4FWU A;  2JDD A;  2Z3O A;  5HXD A;  2OH1 A;  2REE A;  2A4N A;  2HUZ A;  3DGV A;  1HEE A;  3C26 A;  4MCP A;  4HKF A;  5F48 A;  1BO4 A;  2PJ0 A;  1BAV A;  4IK2 A;  4Q7A A;  2B4D B;  1H8L A;  1Q2C A;  1QST A;  1S3Z A;  2Q4Y A;  4C2X A;  5AG4 A;  6CPA A;  5CBM A;  1RO5 A;  4BIN A;  2ZEG A;  1LCP A;  4MFP A;  4AVC A;  2D4P A;  3IIB A;  2I00 A;  1ARL A;  2B4D A;  2R1I A;  1XE4 A;  1XEB A;  1Y7R A;  4UWJ A;  5G21 A;  4Z65 A;  1DTD A;  2P6F A;  5IB9 A;  1S7N A;  2DF5 A;  2C1C A;  3CZX A;  1ZO0 A;  3LOD A;  4A94 A;  4FUU A;  1L0C A;  5F47 A;  3BI1 A;  1I21 A;  2Z0Z A;  1TKF A;  4MBU A;  4UEZ A;  1PCA A;  2WUU A;  4ZGY B;  3IC1 A;  2PRB A;  4JJX A;  4A39 A;  4PPZ A;  3FH4 A;  1QSO A;  1IGB A;  4LUA A;  4ZY1 A;  5JPH A;  4NEX A;  1YGH A;  1TIQ A;  3TC8 A;  3BLN A;  2R8V A;  3LMS A;  2VI7 A;  4KLV A;  4Q38 A;  1YR0 A;  3PRT A;  4KVX A;  1CM0 A;  3PFO A;  4HNX B;  4M85 A;  4MHY A;  4R8F A;  3TOA A;  3TOB A;  2ZW4 A;  4MFJ A;  1Z8X A;  4EFD A;  2Z3M A;  2JBK A;  1I1D A;  4KOR A;  3W6X A;  2ZEH A;  5JGF A;  1YVK A;  2XEI A;  4JXR A;  4U5Y A;  4EWT A;  3PGP A;  2FL4 A;  4FD6 A;  1NMT A;  4R7M A;  1U6M A;  2D4O A;  4YU9 A;  4QUS A;  3NH4 A;  2PJC A;  1EE3 P;  3GB0 A;  3PB7 X;  4ZY2 A;  5LRJ A;  2PJ8 A;  2QIR A;  4KOS A;  4MCR A;  1VHS A;  4CYN A;  4P4B A;  1Z5R A;  2Z3P A;  3V38 A;  4KUB A;  2PJA A;  4P10 A;  5IX3 A;  3FED A;  5AG7 A;  3PEI A;  3UY5 A;  3GKR A;  5DWM A;  5J8F A;  2VBQ A;  5G22 A;  2CTB A;  3KHX A;  8CPA A;  4NFR A;  1S7L A;  4PXE A;  2PJ2 A;  2WZN A;  4FBE A;  3MN8 A;  2HB6 A;  2V77 A;  3GY9 A;  4P4F A;  4X8I A;  4YWY A;  3FJU A;  3VWD A;  4A2Z A;  3KQZ A;  1V0C A;  2ODF A;  3P2H A;  4GXH A;  1AMP A;  4UEF A;  4XPL A;  4MHD A;  4UBR A;  4MCQ A;  3BI0 A;  3GIU A;  1F2P A;  3NH8 A;  2ZEM A;  3I1U A;  1KZF A;  4X2T A;  4NGN A;  5LRK A;  3TE4 A;  1M4D A;  5LYD A;  3S9N A;  4EME A;  1X10 A;  1VHE A;  3DNS A;  1OZP A;  4CGM A;  2JDC A;  3DDD A;  4H2K A;  2CIJ A;  2IL4 A;  3IFE A;  4JWP A;  3CXQ A;  3R95 A;  3WR7 A;  4CAV A;  4OAD A;  2GFQ A;  2ZEO A;  1ARM A;  3H8F A;  1B6B A;  1VKC A;  2AJ6 A;  3K9T A;  4MFL A;  4A37 A;  4YFJ A;  2OB0 A;  3JUW A;  5G20 A;  2Q7S A;  1VIX A;  3FEC A;  3KR4 A;  2FCK A;  2KCW A;  2PJ4 A;  2PR1 A;  1WK4 A;  7CPA A;  1Y0Y A;  1SQH A;  3FXT A;  2BUE A;  1YK3 A;  2J8R A;  1Q2D A;  4F9U A;  5LYF A;  2DPT A;  1XF8 A;  3KQX A;  3PB6 X;  4OC5 A;  2CNT A;  3KAS A;  4F0X A;  3CXP A;  3WC6 A;  5C82 A;  3EFA A;  2RFH A;  5A28 A;  1VHO A;  4R6T A;  5KTA A;  1CX8 A;  4CAW A;  2WPX A;  2Z3L A;  1WWZ A;  3KL9 A;  4PK2 A;  1BLL E;  4X3R A;  4MHZ A;  1CPX A;  1FT7 A;  2B5G B;  3D68 A;  4R9M A;  3OWC A;  3T8W A;  2Q44 A;  1MK4 A;  4A33 A;  2RB7 A;  3D7G A;  4C7I A;  2Q4V A;  2R98 A;  4XNH B;  2R7H A;  2C6P A;  4KOY A;  1QSM A;  3FEE A;  4IUS A;  3V7Z A;  1OBR A;  3F5B A;  2B5G A;  2PIY A;  5D8N A;  5BWA B;  1UWY A;  4MFK A;  2AFU A;  5JQ4 A;  2AFS A;  2IQ6 A;  4R3K A;  5D29 A;  2DEA A;  4BD9 A;  3TO9 A;  1BOB A;  1N71 A;  4PK3 A;  4ZI6 A;  5JM6 A;  4KSA A;  3TO6 A;  1FNO A;  2J8N A;  1XBU A;  2ATR A;  3WAB A;  4B5P B;  4DJL A;  3TO7 A;  5K8N A;  1IID A;  1VGY A;  1FY7 A;  1XMT A;  2WYR A;  3KHZ A;  1R57 A;  2GAN A;  4B5P A;  4II9 A;  5KTC A;  4JXQ A;  2Z10 A;  5AG6 A;  4HNW B;  3MRU A;  2Y0M A;  4PXB A;  3D7H A;  3CPX A;  4M6G A;  2EVN A;  4GM5 A;  1Q2Y A;  1CJW A;  2F7V A;  2OOT A;  1YME A;  3H5Z A;  2EUI A;  4CAE A;  5HVG A;  1Z4E A;  2HQY A;  2PIZ A;  3D66 A;  3GUX A;  4Y49 B;  5C88 A;  1DE4 C;  4JD6 A;  2BL1 A;  4AVA A;  2PDO A;  4JLY A;  4UCP A;  2VXK A;  2V8G A;  3A9L A;  4RI1 A;  1XIX A;  4BMH A;  3BHX A;  2FSR A;  1ZLI A;  2Z3K A;  4FD7 A;  2OZU A;  4DYO A;  3BJ7 A;  1A2Z A;  1RTQ A;  4Y49 C;  2VEZ A;  5AG5 A;  3S6K A;  4AG9 A;  3KZW A;  3N7Z A;  1YSJ A;  2HC9 A;  4JYW A;  2GRE A;  2YNC A;  5EC4 A;  2Z11 A;  4AG7 A;  1Z8T A;  2GIV A;  1QMU A;  4P4J A;  3R9F A;  2AE6 A;  1CP7 A;  1MJA A;  1MJB A;  2GLF A;  3B3S A;  3CPA A;  3FYN A;  4HNY B;  3SHP A;  5F09 A;  1NE9 A;  2JBJ A;  2PJ6 A;  4LQG A;  3SI0 A;  2Q0Y A;  3EY5 A;  1XFO A;  2PVV A;  3LWU A;  1Z8L A;  4CAX A;  1S5K A;  3H4Q A;  4NJQ A;  4ZY0 A;  3T9Y A;  1CPS A;  2QEC A;  4F8Z A;  4OC3 A;  1KWM A;  2PRQ A;  1TF9 A;  4IHM A;  1IOF A;  3JVN A;  4MFZ A;  4E0A A;  1MJ9 A;  3QAY A;  2EK9 A;  2FT0 A;  2BSW A;  4MCS A;  2Q43 A;  4B13 A;  4KOT A;  4XPD B;  3W6S A;  2C6G A;  4PSW A;  3RNZ A; 
#chains in the Genus database with same CATH homology
 4AVB A;  4UFV A;  5IV0 A;  3FIX A;  4PSX A;  1IYL A;  4M3S A;  4L8A A;  3I9S A;  3FNC A;  1UFH A;  4MFQ A;  1IYK A;  4ONU A;  4LX9 A;  3FB3 A;  4UWI A;  5AGE A;  4AB7 A;  5F46 A;  1M44 A;  4GS4 A;  4NF1 A;  3ZZI A;  1S7K A;  2G0B A;  3IU1 A;  1S7F A;  4PV6 A;  4U9Y A;  2REF A;  4CGL A;  1YX0 A;  4R87 A;  3D8P A;  1K4J A;  3QB8 A;  2BEI A;  4KOV A;  1Z4R A;  5DWN A;  1YLE A;  3CXS A;  3D2M A;  4CYP A;  1KUY A;  2B3U A;  3G3S A;  1I12 A;  3TFY A;  2Q04 A;  2FIW A;  4KUA A;  4A95 A;  2Q7B A;  4MY0 A;  3T90 A;  1PU9 A;  2CNS A;  1P4N A;  2YNE A;  1YVO A;  4UCN A;  2G3T A;  4R57 A;  2NMT A;  2ZW7 A;  3GYA A;  3IGR A;  2G3A A;  4C2Z A;  3RYO A;  1IIC A;  4EVY A;  2WSA A;  3TT2 A;  4BBH A;  4I49 A;  4KOX A;  4R3L A;  2YGW A;  3DSB A;  3F8K A;  2OZH A;  4A32 A;  1J4J A;  5G1Z A;  1Z9U A;  3E0K A;  2ZXV A;  2ZPA A;  4F0Y A;  4UA3 A;  4B11 A;  4A30 A;  3ZJ0 A;  4E2A A;  2P6G A;  2VQY A;  4C7H A;  4XNH C;  4H6U A;  2OU2 A;  4B14 A;  2WPW A;  2HV2 A;  4OLL A;  1M1D A;  5IB0 A;  4F6A A;  4QVT A;  3S6F A;  3S6G A;  3SXN A;  2PQ8 A;  3PP9 A;  4KVM E;  1PUA A;  5KTD A;  4UFX A;  5J8C A;  4CYQ A;  1IB1 E;  5A27 A;  2Z3N A;  2PC1 A;  2OZG A;  2B4B A;  2VZY A;  1Y9W A;  4CAF A;  4Q36 A;  2FS5 A;  3R9G A;  3W91 A;  3D2P A;  4KSF A;  2YNC C;  5F49 A;  4FD4 A;  4NXY A;  4MI4 A;  1B87 A;  1NSL A;  4YGO A;  3EO4 A;  2X7B A;  4XPK A;  3QAH A;  4YRH A;  4CGO A;  3TCV A;  4MY3 A;  5I0C A;  1RXT A;  3NE7 A;  5E96 A;  2PSW A;  4C2Y A;  5ISV A;  2O28 A;  4QB9 A;  3R96 A;  4ORF A;  2I79 A;  2GE3 A;  4KOW A;  4ZBG A;  4XPD C;  1KUX A;  2P0W A;  2JEV A;  3PZJ A;  2B3V A;  2ZW5 A;  3BJ8 A;  5CNP A;  3DR6 A;  2CY2 A;  4H6Z A;  4QBJ A;  4CRZ B;  2RC4 A;  3S6H A;  4KVO E;  2DPS A;  4X5K A;  2ZW6 A;  5FVJ A;  1YRE A;  3SXO A;  2FXF A;  5H84 A;  1QSR A;  4KLW A;  2FE7 A;  4KS9 A;  1Y9K A;  4IF5 A;  4CS0 B;  4J3G A;  3I3G A;  3KKW A;  2VZZ A;  3IWE A;  2JLM A;  3DR8 A;  2K5T A;  5HH1 A;  4K30 A;  3IU2 A;  2QML A;  4FD5 A;  2H5M A;  3K9U A;  1M4G A;  4CYO A;  2DXQ A;  3LD2 A;  4QC6 A;  5EBV A;  4B5O A;  1GHE A;  3F0A A;  2CNM A;  4U9Z A;  4UCM A;  5HMN A;  4NCZ A;  3IWG A;  2J8M A;  3D3S A;  3EXN A;  5GCN A;  4DNC A;  2ARH A;  3FRM A;  4KOU A;  2C27 A;  3EC4 A;  3G8W A;  4A31 A;  3R9E A;  4C68 A;  4CGP A;  3VWE A;  3JTK A;  4NSQ A;  2B58 A;  3V8I A;  1S60 A;  4UFW A;  1LRZ A;  2FIA A;  4KZT A;  4OAE A;  2CXA A;  2P6E A;  1M4I A;  1QSN A;  5H86 A;  4E8O A;  4B12 A;  4CRY B;  2PR8 A;  1P0H A;  3FBU A;  1ON0 A;  3B8G A;  4H89 A;  4MJ8 A;  4B10 A;  4RS2 A;  2YND A;  2F5I A;  1KUV A;  4L89 A;  3MGD A;  3TTH A;  3P2F A;  3R1K A;  2JDD A;  2Z3O A;  2OH1 A;  2REE A;  2A4N A;  2HUZ A;  3C26 A;  4HKF A;  5F48 A;  1BO4 A;  2B4D B;  1S3Z A;  1Q2C A;  1QST A;  4C2X A;  2Q4Y A;  5AG4 A;  1RO5 A;  4MFP A;  4AVC A;  2D4P A;  2I00 A;  2B4D A;  2R1I A;  1XE4 A;  1XEB A;  1Y7R A;  4UWJ A;  5G21 A;  2P6F A;  1S7N A;  1ZO0 A;  3LOD A;  1L0C A;  1I21 A;  2Z0Z A;  4MBU A;  2WUU A;  4ZGY B;  2PRB A;  4JJX A;  1QSO A;  4LUA A;  5JPH A;  4NEX A;  1YGH A;  1TIQ A;  3BLN A;  2R8V A;  4KLV A;  2VI7 A;  4Q38 A;  1YR0 A;  4KVX A;  1CM0 A;  4HNX B;  4M85 A;  3TOA A;  3TOB A;  2ZW4 A;  4MFJ A;  2Z3M A;  4KOR A;  1I1D A;  3W6X A;  1YVK A;  4JXR A;  4U5Y A;  3PGP A;  2FL4 A;  4FD6 A;  1NMT A;  1U6M A;  2D4O A;  4QUS A;  2QIR A;  4KOS A;  1VHS A;  4CYN A;  2Z3P A;  4KUB A;  5IX3 A;  5AG7 A;  3UY5 A;  3GKR A;  5DWM A;  5J8F A;  2VBQ A;  5G22 A;  1S7L A;  3GY9 A;  3VWD A;  4A2Z A;  1V0C A;  3P2H A;  4XPL A;  4MHD A;  4UBR A;  1KZF A;  1M4D A;  3DNS A;  1OZP A;  4CGM A;  2JDC A;  3DDD A;  2IL4 A;  4JWP A;  3R95 A;  3WR7 A;  3CXQ A;  4CAV A;  4OAD A;  5F47 A;  1B6B A;  1VKC A;  2AJ6 A;  4MFL A;  4YFJ A;  3TE4 A;  2OB0 A;  3JUW A;  5G20 A;  2FCK A;  2KCW A;  2PR1 A;  1WK4 A;  1SQH A;  3FXT A;  2BUE A;  1YK3 A;  2J8R A;  1Q2D A;  2DPT A;  1XF8 A;  2CNT A;  4F0X A;  3CXP A;  5C82 A;  3EFA A;  5A28 A;  4CAW A;  2WPX A;  2Z3L A;  1WWZ A;  4PK2 A;  2B5G B;  4R9M A;  5KTA A;  4A33 A;  3OWC A;  4C7I A;  2Q44 A;  1MK4 A;  2Q4V A;  2R98 A;  4XNH B;  2R7H A;  4KOY A;  1QSM A;  4IUS A;  3F5B A;  2B5G A;  5BWA B;  4MFK A;  5JQ4 A;  4R3K A;  3TO9 A;  1BOB A;  1N71 A;  4PK3 A;  4KSA A;  3TO6 A;  4B5P B;  2J8N A;  2ATR A;  3TO7 A;  1IID A;  1FY7 A;  1XMT A;  1R57 A;  2GAN A;  4B5P A;  4II9 A;  5KTC A;  4JXQ A;  2Z10 A;  5AG6 A;  4HNW B;  2Y0M A;  2EVN A;  1Q2Y A;  1CJW A;  3H5Z A;  2EUI A;  4CAE A;  1Z4E A;  2HQY A;  4Y49 B;  5C88 A;  4JD6 A;  2BL1 A;  4AVA A;  2PDO A;  4JLY A;  4UCP A;  2VXK A;  3A9L A;  4RI1 A;  1XIX A;  4BMH A;  4FD7 A;  2FSR A;  2Z3K A;  2OZU A;  3BJ7 A;  4Y49 C;  2VEZ A;  5AG5 A;  3S6K A;  4AG9 A;  5EC4 A;  3N7Z A;  4CGN A;  4AG7 A;  2YNC A;  2Z11 A;  2GIV A;  3R9F A;  2AE6 A;  1MJB A;  1MJA A;  3FYN A;  4HNY B;  3SHP A;  1NE9 A;  2Q0Y A;  3EY5 A;  4CAX A;  1S5K A;  3H4Q A;  3T9Y A;  2QEC A;  3JVN A;  4MFZ A;  4E0A A;  1MJ9 A;  2FT0 A;  2BSW A;  4B13 A;  4KOT A;  4XPD B;  3W6S A;  4PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...