4CS0B

Direct visualisation of strain-induced protein post-translational modification
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE 1-DECARBOXYLASE
publication title The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 35
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cs0B00
4R87A 3R95A 3PZJA 2PSWA 4KUAA 2FIWA 4LX9A 4B5PB 1B87A 4JLYA 5H84A 1S7NA 4KLWA 2FCKA 4KOYA 4PK2A 4JD6A 1LRZA 4F6AA 4E8OA 2HUZA 2B3VA 2Z0ZA 4PSXA 4OAEA 3S6KA 1RXTA 3D2MA 3JVNA 4UWJA 4X5KA 4KVME 5EBVA 3FYNA 4H6UA 2OU2A 2OZHA 3BJ7A 4KZTA 2GANA 3VWEA 2QMLA 2D4OA 2VXKA 2I79A 3LODA 4Y49B 4NEXA 1IB1E 4KOXA 4LUAA 4RI1A 3R9EA 4BMHA 2GE3A 1QSRA 1XMTA 1TIQA 4L8AA 4H89A 2PR1A 2PDOA 5F46A 1KUVA 2J8NA 2ZW4A 2B5GB 4JXRA 3DNSA 4MBUA 4UWIA 3EFAA 3TT2A 4IF5A 4JXQA 4M3SA 1OZPA 1S5KA 5KTCA 1YK3A 3PP9A 2H5MA 1KZFA 1BOBA 5HH1A 4M85A 2REEA 4XNHC 2F5IA 4KOVA 4RS2A 4CS0B 3F8KA 1IIDA 4HNXB 3G8WA 4YRHA 3I3GA 1YREA 4KOUA 4MY3A 3S6FA 2ZXVA 4L89A 3MGDA 5KTDA 3JUWA 2PQ8A 4J3GA 1K4JA 3FXTA 2Q44A 2J8MA 3QAHA 3DR6A 3ZZIA 3G3SA 4QBJA 3E0KA 1U6MA 2AE6A 2ZW5A 2CNTA 4XPLA 2B58A 5C82A 3FNCA 4MI4A 2EUIA 4KOTA 1Z4RA 3GKRA 2HV2A 2JDCA 2BSWA 1S60A 1XE4A 3EC4A 2FT0A 3TE4A 2CY2A 3W91A 2CNSA 2ZPAA 2J8RA 4MJ8A 4HKFA 2Z11A 2VI7A 3GYAA 1WK4A 2OH1A 3N7ZA 4OADA 4QB9A 2C27A 2FIAA 4GS4A 1CJWA 2QIRA 3D8PA 2JEVA 1Y9WA 1S7FA 1Q2CA 5IX3A 1NSLA 3TTHA 4AG9A 4KVOE 3EXNA 1MK4A 4FD5A 1YVOA 2Q7BA 4CAXA 1YVKA 3R96A 3S6HA 4E0AA 2G0BA 1I12A 2GIVA 5HMNA 1QSTA 4II9A 4FD6A 5H86A 4U9ZA 2FSRA 1YGHA 2JDDA 1J4JA 3LD2A 2BUEA 1R57A 1MJ9A 1N71A 1P0HA 4B5PA 2VQYA 3DSBA 4CRYB 2G3AA 4KLVA 1M4IA 3TO9A 4JJXA 3B8GA 2R8VA 1I21A 3NE7A 4F0YA 1Y9KA 4UBRA 3TO7A 1RO5A 3R9FA 4XPDC 3I9SA 4FD4A 2R98A 1S3ZA 2VEZA 1XIXA 5GCNA 4KOWA 4YGOA 3K9UA 3D3SA 4FD7A 3DR8A 3TOBA 1VKCA 2REFA 1MJAA 4MHDA 2IL4A 4I49A 3W6SA 2ATRA 2WPXA 3TO6A 1L0CA 1PU9A 2QECA 4ONUA 2FL4A 2D4PA 2X7BA 5KTAA 2B3UA 2Q04A 3P2FA 1KUYA 2FE7A 3KKWA 4JWPA 5IV0A 4R57A 2ZW6A 3EY5A 3CXPA 2B5GA 4QUSA 2VBQA 1IYLA 5FVJA 1Y7RA 2OB0A 2WPWA 4U9YA 2JLMA 2FS5A 4HNYB 1S7KA 2NMTA 2I00A 4Y49C 3T9YA 2DXQA 4U5YA 2O28A 3H4QA 4YFJA 3IWGA 3UY5A 3P2HA 5JPHA 3TFYA 3PGPA 3WR7A 2ZW7A 1M4DA 4QC6A 4NF1A 3S6GA 2OZGA 2P6FA 5DWNA 2P0WA 3W6XA 4EVYA 1MJBA 3SXOA 4PV6A 1KUXA 4PSWA 2Q4VA 2VZZA 4K30A 4CRZB 2B4BA 1SQHA 3BJ8A 4XNHB 1FY7A 2EVNA 1NMTA 4IUSA 2RC4A 3IGRA 4R3KA 2Q0YA 2AJ6A 1V0CA 1M1DA 1IYKA 3ZJ0A 4AVBA 1VHSA 2BEIA 1Q2DA 4NXYA 2BL1A 2B4DB 4UA3A 5ISVA 4NCZA 3R9GA 4CAVA 4OLLA 2PR8A 1S7LA 4AG7A 2R1IA 2OZUA 3FB3A 1BO4A 1YR0A 4ORFA 2R7HA 1M4GA 4H6ZA 1Q2YA 1XF8A 5CNPA 3RYOA 5F48A 3OWCA 4AVCA 2Y0MA 5C88A 3R1KA 1UFHA 1Z4EA 3DDDA 2P6GA 2FXFA 4AB7A 2K5TA 1YLEA 1GHEA 2VZYA 4R9MA 1PUAA 2PC1A 5JQ4A 4HNWB 2B4DA 4ZBGA 3C26A 1I1DA 1WWZA 3F0AA 5J8CA 3F5BA 4QVTA 3EO4A 3SXNA 4PK3A 5IB0A 2ARHA 1CM0A 3QB8A 5F49A 4MY0A 3CXQA 4AVAA 5DWMA 4DNCA 2KCWA 1QSMA 3TOAA 1B6BA 1QSOA 2A4NA 3VWDA 3FRMA 1YX0A 3GY9A 1IICA 2P6EA 1P4NA 2PRBA 4NSQA 5EC4A 1ON0A 5F47A 2HQYA 3TCVA 4B5OA 2G3TA 5J8FA 2CNMA 1Z9UA 4E2AA 2Q4YA 5I0CA 3D2PA 4R3LA 5E96A 3FBUA 1XEBA 3T90A 1M44A 3FIXA 4CAWA 1NE9A 3BLNA 3V8IA 4KVXA 2Z10A 4KORA 4KOSA 3SHPA 4KUBA 4XPDB 4XPKA 3CXSA 1QSNA
chains in the Genus database with same CATH superfamily
4FWUA 4IK2A 4R87A 5JM6A 1LAMA 3R95A 4C2ZA 4CYPA 3PZJA 2PSWA 4P45A 1M4LA 4MCRA 3KQXA 2FIWA 4KUAA 4LX9A 3RO0A 3IWWA 4B5PB 3KASA 2DF5A 2ZEOA 3GUXA 1B87A 3PB7X 4JLYA 4LQ6A 3SJXA 5H84A 1S7NA 3QAYA 3H5ZA 4KLWA 2WZNA 4A30A 3D66A 2FVGA 4TNUA 1Z8TA 2FCKA 2GLFA 3B3WA 4KOYA 4PK2A 1XBUA 4JD6A 3IFEA 5CPAA 2ZENA 1LRZA 3IU2A 4FAIA 3KGQA 4F6AA 1Z8WA 4E8OA 4MFPA 2HUZA 2B3VA 2Z0ZA 4PSXA 3SI2A 4OAEA 5G1ZA 3S6KA 1RXTA 3D2MA 3JVNA 5BWAB 2ZEMA 2O53A 4UWJA 4X5KA 4KVME 2O4HA 1Z5RA 5EBVA 2AFOA 3FYNA 4P10A 4WJBA 4H6UA 2OU2A 4NGTA 2OZHA 3BJ7A 4PXBA 5LYLA 4KZTA 2GANA 4PXCA 1F2PA 3VWEA 2QMLA 2D4OA 5LRJA 2VXKA 3T8WA 2I79A 3LODA 1Z2LA 3L2NA 4Y49B 5DS0A 1QQ9A 1IY7A 4NEXA 2OR4A 4Q38A 1IB1E 3BI1A 4NGMA 4KOXA 1RTQA 4LUAA 2PJ0A 4RI1A 3R9EA 4X2TA 2PCUA 2PIZA 4BMHA 2GE3A 3KR4A 1QSRA 1XMTA 2PJ2A 1TIQA 4P4EA 4P6YA 1ELMP 4OC2A 2XEFA 4L8AA 4H89A 3S9MA 4B6ZA 2PR1A 2PDOA 3DLJA 5F46A 1KUVA 2J8NA 3PB4X 3VH9A 3GIUA 4BBHA 2Q51A 4OC3A 2ZW4A 2B5GB 4JXRA 3DNSA 4MBUA 3WC7A 4C7IA 4CGPA 1PCAA 4UWIA 3EFAA 3B3TA 1BPNA 3TT2A 4IF5A 2C6PA 4JXQA 4M3SA 2QYVA 4X3RA 1YW4A 1OZPA 1S5KA 1LAPA 1YK3A 3PEIA 2BO9A 3PP9A 2H5MA 5KTCA 2PJCA 1KZFA 1BOBA 1EE3P 1YMEA 2VL1A 5HH1A 4P4FA 3WC6A 4Z65A 4YU9A 1Q7LA 3BHXA 3KL9A 4M85A 2REEA 4MCPA 4JZ0A 4XNHC 1IU8A 1HEEA 2F5IA 4KOVA 4RS2A 4CS0B 3A9LA 3F8KA 1IIDA 2PVVA 4HNXB 2Z3KA 3G8WA 4YRHA 1YLOA 8CPAA 3I3GA 1YREA 3QNVA 1LFWA 4KOUA 4CYNA 1R3NA 2PJBA 3TC8A 3LMSA 4MY3A 4ZYQA 4RN7A 1BLLE 4OC5A 3S6FA 2DPSA 4CGLA 2ZEPA 2ZXVA 4L89A 3MGDA 3CT9A 4M6HA 3JUWA 2PQ8A 4J3GA 4M6GA 1K4JA 3CDXA 2EK9A 3FXTA 4W9YA 2Q44A 2JEWA 1ARMA 4R8FA 4MFQA 2J8MA 4P4JA 3KHZA 3QAHA 3DGVA 2I3CA 3IC1A 1YQEA 2Z3PA 2NSMA 3DR6A 2C6GA 1TF9A 3NH4A 3KHXA 4ZY0A 4C2YA 3ZZIA 4PQAA 3G3SA 5LYIA 4QBJA 3E0KA 1OBRA 4A94A 5HXDA 1U6MA 3V7ZA 4DYOA 5JGFA 2AE6A 2ZW5A 2CNTA 4XPLA 4MFKA 4ZGYB 2Z3NA 2B58A 3KQZA 4K3NA 2AFUA 3FNCA 4MI4A 2EUIA 4NJQA 5C82A 4F9UA 4CGMA 3PFOA 1KWMA 4KOTA 4KSFA 4UF4A 1Z4RA 3GKRA 1ZLHA 2HV2A 2JDCA 3NFZA 4EMEA 5HVHA 4R76A 2BSWA 1S60A 4A31A 1XE4A 3EC4A 2FT0A 4JYWA 3TE4A 3PB8X 3KR5A 2CY2A 3LWUA 3W91A 1XFOA 3FF3A 4MCQA 4NGSA 5AG4A 2CNSA 2AFSA 3PBEA 2YNEA 3IWEA 3WABA 4A95A 3FX6A 2ZPAA 1IOFA 1PYTB 3B3CA 2J8RA 3RAMA 3V38A 1VHEA 4F0XA 2C6CA 4MJ8A 4HKFA 5F09A 3GLJA 2Z3LA 2Z11A 3ISZA 5J1QA 3VARA 2VI7A 3GYAA 1LCPA 4IAVA 5AG6A 1WK4A 4Q7AA 2OH1A 2ZEHA 1Y0RA 4KS9A 3N7ZA 3S9NA 1JWQA 4OADA 4UCMA 4QB9A 3PB9X 4NGRA 4YWYA 5G20A 2C27A 4UEZA 2PJ9A 2FIAA 4A33A 4GS4A 1CJWA 3BXMA 2QIRA 3D8PA 4OMEA 2JEVA 1Y9WA 1S7FA 2PJ4A 3CPXA 1Q2CA 3D7DA 2PRQA 4GXHA 4F8ZA 5IX3A 3VATA 3NH8A 5HVGA 2IJZA 1NSLA 3TTHA 2GFQA 4OC4A 4AG9A 4B11A 4KVOE 3EXNA 4G1PA 1MK4A 1NSAA 4FD5A 1YVOA 2Q7BA 4A32A 1YVKA 3D67A 3R96A 4A38A 4CAXA 2EWBA 4C2XA 3S6HA 2F8HA 4E0AA 2G0BA 4F9VA 3MN8A 1I12A 4GM5A 2GIVA 3SI0A 5HMNA 2IQ6A 4NJRA 1QSTA 4II9A 3D7HA 4FD6A 5H86A 3I1UA 2YNDA 4U9ZA 1XMBA 3RZAA 4EWTA 4P4DA 2FSRA 1YGHA 2JDDA 1J4JA 3LD2A 2BUEA 1R57A 1MJ9A 1N71A 5LYFA 1P0HA 4P4IA 4CGOA 4B5PA 2BCOA 2VQYA 3DSBA 5D29A 1HDUA 1TKFA 1CG2A 2G3AA 1M4IA 2XEGA 4KLVA 3TO9A 4CRYB 4CGNA 5K8PA 2EK8A 4JJXA 2ZEGA 2ABZA 4R6TA 3B3SA 3B8GA 5EMIA 4M6IA 2R8VA 3SJEA 1HDQA 1I21A 3NE7A 4MHYA 3MRUA 4UIBA 1Y9KA 4F0YA 1LANA 4UBRA 3FH4A 3TO7A 4UEFA 1CPXA 1A2ZA 1RO5A 2HC9A 1CPSA 3R9FA 4XPDC 1FNOA 3I9SA 2R98A 3FECA 4FD4A 1S3ZA 2Q7SA 2VEZA 1XIXA 5GCNA 4MFZA 3FJUA 4KOWA 4YGOA 1LOKA 1UWYA 3TX8A 1TKJA 2JBKA 2NYQA 3K9UA 3D3SA 4MHNA 4MHPA 4WWVA 4FD7A 3DR8A 3TOBA 4B13A 4NGNA 1VKCA 2REFA 1MJAA 4MHDA 2IL4A 4I49A 2PJ1A 3PFEA 3W6SA 2Q4ZA 2ATRA 2ODFA 2WPXA 5AGEA 3TO6A 3WC5A 1L0CA 1PU9A 2GLJA 1F2OA 2QECA 1TKHA 1CP7A 2XEJA 2GREA 4ONWA 1FT7A 3WT4A 4ONUA 2FL4A 2D4PA 4AXVA 3IJ3A 2X7BA 4PPZA 4P4BA 2XEIA 5KTAA 2B3UA 2Q04A 2YGWA 5K8NA 3P2FA 1KUYA 4MCSA 2FE7A 3KKWA 4JWPA 5IV0A 4R57A 2ZW6A 3B2YA 3EY5A 5JH9A 3KI9A 2HB6A 2ZOFA 3CXPA 2B5GA 4MRIA 4QUSA 5G22A 2VBQA 1IYLA 5FVJA 4B10A 4NFRA 1Y7RA 2OB0A 2WPWA 4U9YA 4ZX9A 1R43A 2JLMA 2FS5A 4HNYB 1S7KA 2AFXA 2NMTA 2I00A 4ZX8A 4Y49C 2CTCA 3JRUA 3T9YA 2DXQA 4U5YA 2O28A 2YNCA 3H4QA 3HUVA 1GYTA 2CXAA 4YFJA 3IWGA 3UY5A 4X8IA 3P2HA 3RBUA 3RNZA 5JPHA 3TFYA 1ZG8A 3D4UA 3JTKA 3PGPA 1XOVA 1AMPA 3WR7A 4UCNA 2ZW7A 2PIYA 3PRTA 4A37A 1M4DA 4QC6A 4NF1A 4ZY1A 3S6GA 2RB7A 2OZGA 3D68A 2P6FA 5DWNA 2P0WA 3W6XA 1CX8A 1DE4C 4EVYA 1ARLA 1QMUA 1MJBA 1XRYA 5D8NA 3SXOA 3FEEA 1KUXA 4PV6A 3CPAA 3PBBA 3IO1A 2Q4VA 1DTDA 4PSWA 2VZZA 3NA6A 3N5FA 5AG5A 4K30A 4CRZB 4IHMA 4BD9A 2B4BA 4UFWA 7CPAA 3FVLA 4FBEA 4CAEA 1SQHA 3BJ8A 4DUKA 4XNHB 1FY7A 1AYEA 1YW6A 1Z8XA 1NMTA 2EVNA 4IUSA 4CYQA 2RC4A 3IGRA 4R3KA 5A28A 4MFJA 2Q43A 3LACA 2Q0YA 4MMOA 2AJ6A 1V0CA 2ZOGA 3SI1A 1M1DA 3HLPA 1IYKA 3ZJ0A 1AUGA 1VHSA 2CF4A 2BEIA 4AVBA 1Q2DA 2BOAA 2AFMA 4MXUA 1X10A 4NXYA 2EBJA 3H8EA 2BL1A 4MHZA 2B4DB 2WYRA 4LQGA 4UA3A 5ISVA 4NCZA 3IEHA 1VGYA 2RFHA 1TXRA 3BI0A 3B7IA 3R9GA 4CAVA 4OLLA 2PR8A 1CBXA 2V8DA 4CPAA 5A27A 1ELLP 1S7LA 4AG7A 2R1IA 2V8HA 3K2KA 4NGQA 2ZEFA 2JBJA 1TF8A 2OZUA 3FB3A 2J9AA 1BAVA 4UFXA 4A39A 1BO4A 2GU2A 1YR0A 3KZWA 2R7HA 4ORFA 1YSJA 5IB9A 5CBMA 1M4GA 4H6ZA 4BINA 1Q2YA 2Z3OA 1XF8A 4OKOA 2DPTA 5CNPA 4NGPA 3RYOA 4C68A 1X12A 5F48A 2PJ5A 1IOIA 3H8FA 3OWCA 2EO8A 2Y0MA 4AVCA 3R1KA 1UFHA 2ZELA 5C88A 1F57A 1Z4EA 3DDDA 3FEDA 4ZI6A 2P6GA 2PE3A 3IIBA 3H8GA 2FXFA 5K8MA 4AB7A 2PJ3A 2K5TA 1YLEA 1GHEA 4B14A 4FUUA 4OC1A 2VZYA 2PJAA 4HPSA 3GB0A 2DEAA 4R9MA 1PUAA 2PC1A 3D7GA 4OC0A 2AFZA 2PJ7A 3PB6X 4O23A 4P44A 2CTBA 2B4DA 4HNWB 4ZBGA 5JQ4A 1VHOA 3C26A 4KSAA 1I1DA 1WWZA 3K9TA 3F0AA 5J8CA 1ZG7A 1H8LA 3F5BA 4QVTA 3EO4A 3SXNA 6CPAA 4PK3A 5ELYA 2PJ8A 2QVPA 3S9LA 5IB0A 2ARHA 1CM0A 3IU1A 3QB8A 2C1CA 4C7HA 2PVWA 2POKA 5F49A 4TWEA 4MY0A 3CXQA 4AVAA 5DWMA 1Y0YA 4R7MA 4DNCA 4KSIA 2WUUA 1ZLIA 2KCWA 4ZY2A 3NH5A 4CAFA 4RUHA 4UFVA 5LRGA 4DJLA 3ISXA 5KTDA 1Y7EA 4Q36A 2CIJA 3CZXA 5HVFA 1QSMA 3TOAA 2V8VA 1B6BA 1QSOA 2A4NA 2Z3MA 3VWDA 3FRMA 1YX0A 3GY9A 4OIWA 1IICA 4OIDA 2P6EA 1P4NA 2PRBA 2V8GA 4NSQA 5EC4A 1CP6A 1ON0A 2ZEDA 5F47A 2HQYA 3TCVA 1XJOA 4B5OA 1VIXA 4UCPA 5G21A 5LRKA 2G3TA 3D7FA 1IGBA 4OP4A 5LYDA 4MFLA 5J8FA 1JQGA 2CNMA 1Z9UA 4B12A 3NE8A 3FMCA 4UEEA 2V77A 2Q4YA 4E2AA 5I0CA 2AFWA 3D2PA 5THWA 4R3LA 5E96A 4A2ZA 1ZG9A 4UIAA 3FBUA 1XEBA 3T90A 1M44A 4EFDA 1Z8LA 3SJFA 5I4MA 4CYOA 4PXDA 3FIXA 5K8OA 1ZO0A 1BPMA 4CAWA 1NE9A 4H2KA 3BLNA 3SJGA 3B3VA 4KVXA 3V8IA 4PXEA 2Z10A 4KORA 2F7VA 2QJ8A 4KOSA 2IMOA 5AG7A 3B35A 3SHPA 2ZEEA 4KUBA 4XPDB 2ANPA 4XPKA 3CXSA 2OOTA 2WSAA 2YNCC 2G9DA 2PJ6A 1QSNA
chains in the Genus database with same CATH topology
4R87A 3R95A 4C2ZA 4CYPA 3PZJA 2PSWA 4KUAA 2FIWA 4LX9A 4B5PB 1B87A 4JLYA 5H84A 1S7NA 3H5ZA 4KLWA 4A30A 2FCKA 4KOYA 4PK2A 4JD6A 1LRZA 3IU2A 4F6AA 4E8OA 4MFPA 2HUZA 2B3VA 2Z0ZA 4PSXA 4OAEA 5G1ZA 3S6KA 1RXTA 3D2MA 3JVNA 5BWAB 4UWJA 4X5KA 4KVME 5EBVA 3FYNA 4H6UA 2OU2A 2OZHA 3BJ7A 4KZTA 2GANA 3VWEA 2QMLA 2D4OA 2VXKA 2I79A 3LODA 4Y49B 4NEXA 4Q38A 1IB1E 4KOXA 4LUAA 4RI1A 3R9EA 4BMHA 2GE3A 1QSRA 1XMTA 1TIQA 4L8AA 4H89A 2PR1A 2PDOA 5F46A 1KUVA 2J8NA 4BBHA 2ZW4A 2B5GB 4JXRA 3DNSA 4MBUA 4C7IA 4CGPA 4UWIA 3EFAA 3TT2A 4IF5A 4JXQA 4M3SA 1OZPA 1S5KA 5KTCA 1YK3A 3PP9A 2H5MA 1KZFA 1BOBA 5HH1A 4M85A 2REEA 4XNHC 2F5IA 4KOVA 4RS2A 4CS0B 3A9LA 3F8KA 1IIDA 4HNXB 2Z3KA 3G8WA 4YRHA 3I3GA 1YREA 4KOUA 4CYNA 4MY3A 3S6FA 2DPSA 4CGLA 2ZXVA 4L89A 3MGDA 5KTDA 3JUWA 2PQ8A 4J3GA 1K4JA 3FXTA 2Q44A 4MFQA 2J8MA 3QAHA 2Z3PA 3DR6A 4C2YA 3ZZIA 3G3SA 4QBJA 3E0KA 1U6MA 2AE6A 2ZW5A 2CNTA 4XPLA 4MFKA 4ZGYB 2Z3NA 2B58A 5C82A 3FNCA 4MI4A 2EUIA 4CGMA 4KSFA 4KOTA 1Z4RA 3GKRA 2HV2A 2JDCA 2BSWA 1S60A 4A31A 1XE4A 3EC4A 2FT0A 3TE4A 2CY2A 3W91A 5AG4A 2CNSA 2YNEA 3IWEA 4A95A 2ZPAA 2J8RA 4F0XA 4MJ8A 4HKFA 2Z3LA 2Z11A 2VI7A 3GYAA 5AG6A 1WK4A 2OH1A 4KS9A 3N7ZA 4OADA 4UCMA 4QB9A 5G20A 2C27A 2FIAA 4A33A 4GS4A 1CJWA 2QIRA 3D8PA 2JEVA 1Y9WA 1S7FA 1Q2CA 5IX3A 1NSLA 3TTHA 4AG9A 4B11A 4KVOE 3EXNA 1MK4A 4FD5A 1YVOA 2Q7BA 4A32A 1YVKA 3R96A 4CAXA 4C2XA 3S6HA 4E0AA 2G0BA 1I12A 2GIVA 5HMNA 1QSTA 4II9A 4FD6A 5H86A 2YNDA 4U9ZA 2FSRA 1YGHA 2JDDA 1J4JA 3LD2A 2BUEA 1R57A 1MJ9A 1N71A 1P0HA 4CGOA 4B5PA 2VQYA 3DSBA 4CRYB 2G3AA 4KLVA 1M4IA 3TO9A 4CGNA 4JJXA 3B8GA 2R8VA 1I21A 3NE7A 4F0YA 1Y9KA 4UBRA 3TO7A 1RO5A 3R9FA 4XPDC 3I9SA 4FD4A 2R98A 1S3ZA 2VEZA 1XIXA 5GCNA 4MFZA 4KOWA 4YGOA 3K9UA 3D3SA 4B13A 4FD7A 3DR8A 3TOBA 1VKCA 2REFA 1MJAA 4MHDA 2IL4A 4I49A 3W6SA 2ATRA 2WPXA 5AGEA 3TO6A 1L0CA 1PU9A 2QECA 4ONUA 2FL4A 2D4PA 2X7BA 5KTAA 2B3UA 2Q04A 2YGWA 3P2FA 1KUYA 2FE7A 3KKWA 4JWPA 5IV0A 4R57A 2ZW6A 3EY5A 3CXPA 2B5GA 4QUSA 5G22A 2VBQA 1IYLA 5FVJA 4B10A 1Y7RA 2OB0A 2WPWA 4U9YA 2JLMA 2FS5A 4HNYB 1S7KA 2NMTA 2I00A 4Y49C 3T9YA 2DXQA 4U5YA 2O28A 2YNCA 3H4QA 2CXAA 4YFJA 3IWGA 3UY5A 3P2HA 5JPHA 3TFYA 3JTKA 3PGPA 3WR7A 4UCNA 2ZW7A 1M4DA 4QC6A 4NF1A 3S6GA 2OZGA 2P6FA 5DWNA 2P0WA 3W6XA 4EVYA 1MJBA 3SXOA 4PV6A 1KUXA 4PSWA 2Q4VA 5AG5A 2VZZA 4K30A 4CRZB 2B4BA 4UFWA 4CAEA 1SQHA 3BJ8A 4XNHB 1FY7A 2EVNA 1NMTA 4IUSA 4CYQA 2RC4A 3IGRA 4R3KA 5A28A 4MFJA 2Q0YA 2AJ6A 1V0CA 1M1DA 1IYKA 3ZJ0A 4AVBA 1VHSA 2BEIA 1Q2DA 4NXYA 2BL1A 2B4DB 4UA3A 5ISVA 4NCZA 3R9GA 4CAVA 4OLLA 2PR8A 5A27A 1S7LA 4AG7A 2R1IA 2OZUA 3FB3A 4UFXA 1BO4A 1YR0A 4ORFA 2R7HA 1M4GA 4H6ZA 1Q2YA 2Z3OA 1XF8A 2DPTA 5CNPA 3RYOA 4C68A 5F48A 3OWCA 4AVCA 2Y0MA 5C88A 3R1KA 1UFHA 1Z4EA 3DDDA 2P6GA 2FXFA 4AB7A 2K5TA 1YLEA 1GHEA 4B14A 2VZYA 4R9MA 1PUAA 2PC1A 5JQ4A 4HNWB 2B4DA 4ZBGA 4KSAA 3C26A 1I1DA 1WWZA 3F0AA 5J8CA 3F5BA 4QVTA 3EO4A 3SXNA 4PK3A 5IB0A 2ARHA 1CM0A 3IU1A 3QB8A 4C7HA 5F49A 4MY0A 3CXQA 4AVAA 5DWMA 4DNCA 2WUUA 2KCWA 4CAFA 4UFVA 4Q36A 1QSMA 3TOAA 1B6BA 1QSOA 2A4NA 2Z3MA 3VWDA 3FRMA 1YX0A 3GY9A 1IICA 2P6EA 1P4NA 2PRBA 4NSQA 5EC4A 1ON0A 5F47A 2HQYA 3TCVA 4B5OA 5G21A 4UCPA 2G3TA 4MFLA 5J8FA 2CNMA 1Z9UA 4B12A 4E2AA 2Q4YA 5I0CA 3D2PA 4R3LA 5E96A 4A2ZA 3FBUA 1XEBA 3T90A 1M44A 4CYOA 3FIXA 1ZO0A 4CAWA 1NE9A 3BLNA 3V8IA 4KVXA 2Z10A 4KORA 4KOSA 5AG7A 3SHPA 4KUBA 4XPDB 4XPKA 3CXSA 2WSAA 2YNCC 1QSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R87 A;  3R95 A;  3PZJ A;  2PSW A;  4KUA A;  2FIW A;  4LX9 A;  4B5P B;  1B87 A;  4JLY A;  5H84 A;  1S7N A;  4KLW A;  2FCK A;  4KOY A;  4PK2 A;  4JD6 A;  1LRZ A;  4F6A A;  4E8O A;  2HUZ A;  2B3V A;  2Z0Z A;  4PSX A;  4OAE A;  3S6K A;  1RXT A;  3D2M A;  3JVN A;  4UWJ A;  4X5K A;  4KVM E;  5EBV A;  3FYN A;  4H6U A;  2OU2 A;  2OZH A;  3BJ7 A;  4KZT A;  2GAN A;  3VWE A;  2QML A;  2D4O A;  2VXK A;  2I79 A;  3LOD A;  4Y49 B;  4NEX A;  1IB1 E;  4KOX A;  4LUA A;  4RI1 A;  3R9E A;  4BMH A;  2GE3 A;  1QSR A;  1XMT A;  1TIQ A;  4L8A A;  4H89 A;  2PR1 A;  2PDO A;  5F46 A;  1KUV A;  2J8N A;  2ZW4 A;  2B5G B;  4JXR A;  3DNS A;  4MBU A;  4UWI A;  3EFA A;  3TT2 A;  4IF5 A;  4JXQ A;  4M3S A;  1OZP A;  1S5K A;  5KTC A;  1YK3 A;  3PP9 A;  2H5M A;  1KZF A;  1BOB A;  5HH1 A;  4M85 A;  2REE A;  4XNH C;  2F5I A;  4KOV A;  4RS2 A;  4CS0 B;  3F8K A;  1IID A;  4HNX B;  3G8W A;  4YRH A;  3I3G A;  1YRE A;  4KOU A;  4MY3 A;  3S6F A;  2ZXV A;  4L89 A;  3MGD A;  5KTD A;  3JUW A;  2PQ8 A;  4J3G A;  1K4J A;  3FXT A;  2Q44 A;  2J8M A;  3QAH A;  3DR6 A;  3ZZI A;  3G3S A;  4QBJ A;  3E0K A;  1U6M A;  2AE6 A;  2ZW5 A;  2CNT A;  4XPL A;  2B58 A;  5C82 A;  3FNC A;  4MI4 A;  2EUI A;  4KOT A;  1Z4R A;  3GKR A;  2HV2 A;  2JDC A;  2BSW A;  1S60 A;  1XE4 A;  3EC4 A;  2FT0 A;  3TE4 A;  2CY2 A;  3W91 A;  2CNS A;  2ZPA A;  2J8R A;  4MJ8 A;  4HKF A;  2Z11 A;  2VI7 A;  3GYA A;  1WK4 A;  2OH1 A;  3N7Z A;  4OAD A;  4QB9 A;  2C27 A;  2FIA A;  4GS4 A;  1CJW A;  2QIR A;  3D8P A;  2JEV A;  1Y9W A;  1S7F A;  1Q2C A;  5IX3 A;  1NSL A;  3TTH A;  4AG9 A;  4KVO E;  3EXN A;  1MK4 A;  4FD5 A;  1YVO A;  2Q7B A;  4CAX A;  1YVK A;  3R96 A;  3S6H A;  4E0A A;  2G0B A;  1I12 A;  2GIV A;  5HMN A;  1QST A;  4II9 A;  4FD6 A;  5H86 A;  4U9Z A;  2FSR A;  1YGH A;  2JDD A;  1J4J A;  3LD2 A;  2BUE A;  1R57 A;  1MJ9 A;  1N71 A;  1P0H A;  4B5P A;  2VQY A;  3DSB A;  4CRY B;  2G3A A;  4KLV A;  1M4I A;  3TO9 A;  4JJX A;  3B8G A;  2R8V A;  1I21 A;  3NE7 A;  4F0Y A;  1Y9K A;  4UBR A;  3TO7 A;  1RO5 A;  3R9F A;  4XPD C;  3I9S A;  4FD4 A;  2R98 A;  1S3Z A;  2VEZ A;  1XIX A;  5GCN A;  4KOW A;  4YGO A;  3K9U A;  3D3S A;  4FD7 A;  3DR8 A;  3TOB A;  1VKC A;  2REF A;  1MJA A;  4MHD A;  2IL4 A;  4I49 A;  3W6S A;  2ATR A;  2WPX A;  3TO6 A;  1L0C A;  1PU9 A;  2QEC A;  4ONU A;  2FL4 A;  2D4P A;  2X7B A;  5KTA A;  2B3U A;  2Q04 A;  3P2F A;  1KUY A;  2FE7 A;  3KKW A;  4JWP A;  5IV0 A;  4R57 A;  2ZW6 A;  3EY5 A;  3CXP A;  2B5G A;  4QUS A;  2VBQ A;  1IYL A;  5FVJ A;  1Y7R A;  2OB0 A;  2WPW A;  4U9Y A;  2JLM A;  2FS5 A;  4HNY B;  1S7K A;  2NMT A;  2I00 A;  4Y49 C;  3T9Y A;  2DXQ A;  4U5Y A;  2O28 A;  3H4Q A;  4YFJ A;  3IWG A;  3UY5 A;  3P2H A;  5JPH A;  3TFY A;  3PGP A;  3WR7 A;  2ZW7 A;  1M4D A;  4QC6 A;  4NF1 A;  3S6G A;  2OZG A;  2P6F A;  5DWN A;  2P0W A;  3W6X A;  4EVY A;  1MJB A;  3SXO A;  4PV6 A;  1KUX A;  4PSW A;  2Q4V A;  2VZZ A;  4K30 A;  4CRZ B;  2B4B A;  1SQH A;  3BJ8 A;  4XNH B;  1FY7 A;  2EVN A;  1NMT A;  4IUS A;  2RC4 A;  3IGR A;  4R3K A;  2Q0Y A;  2AJ6 A;  1V0C A;  1M1D A;  1IYK A;  3ZJ0 A;  4AVB A;  1VHS A;  2BEI A;  1Q2D A;  4NXY A;  2BL1 A;  2B4D B;  4UA3 A;  5ISV A;  4NCZ A;  3R9G A;  4CAV A;  4OLL A;  2PR8 A;  1S7L A;  4AG7 A;  2R1I A;  2OZU A;  3FB3 A;  1BO4 A;  1YR0 A;  4ORF A;  2R7H A;  1M4G A;  4H6Z A;  1Q2Y A;  1XF8 A;  5CNP A;  3RYO A;  5F48 A;  3OWC A;  4AVC A;  2Y0M A;  5C88 A;  3R1K A;  1UFH A;  1Z4E A;  3DDD A;  2P6G A;  2FXF A;  4AB7 A;  2K5T A;  1YLE A;  1GHE A;  2VZY A;  4R9M A;  1PUA A;  2PC1 A;  5JQ4 A;  4HNW B;  2B4D A;  4ZBG A;  3C26 A;  1I1D A;  1WWZ A;  3F0A A;  5J8C A;  3F5B A;  4QVT A;  3EO4 A;  3SXN A;  4PK3 A;  5IB0 A;  2ARH A;  1CM0 A;  3QB8 A;  5F49 A;  4MY0 A;  3CXQ A;  4AVA A;  5DWM A;  4DNC A;  2KCW A;  1QSM A;  3TOA A;  1B6B A;  1QSO A;  2A4N A;  3VWD A;  3FRM A;  1YX0 A;  3GY9 A;  1IIC A;  2P6E A;  1P4N A;  2PRB A;  4NSQ A;  5EC4 A;  1ON0 A;  5F47 A;  2HQY A;  3TCV A;  4B5O A;  2G3T A;  5J8F A;  2CNM A;  1Z9U A;  4E2A A;  2Q4Y A;  5I0C A;  3D2P A;  4R3L A;  5E96 A;  3FBU A;  1XEB A;  3T90 A;  1M44 A;  3FIX A;  4CAW A;  1NE9 A;  3BLN A;  3V8I A;  4KVX A;  2Z10 A;  4KOR A;  4KOS A;  3SHP A;  4KUB A;  4XPD B;  4XPK A;  3CXS A;  1QSN A; 
#chains in the Genus database with same CATH topology
 4FWU A;  4IK2 A;  4R87 A;  5JM6 A;  1LAM A;  3R95 A;  4C2Z A;  4CYP A;  3PZJ A;  2PSW A;  4P45 A;  1M4L A;  4MCR A;  3KQX A;  2FIW A;  4KUA A;  4LX9 A;  3RO0 A;  3IWW A;  4B5P B;  3KAS A;  2DF5 A;  2ZEO A;  3GUX A;  1B87 A;  3PB7 X;  4JLY A;  4LQ6 A;  3SJX A;  5H84 A;  1S7N A;  3QAY A;  3H5Z A;  4KLW A;  2WZN A;  4A30 A;  3D66 A;  2FVG A;  4TNU A;  1Z8T A;  2FCK A;  2GLF A;  3B3W A;  4KOY A;  4PK2 A;  1XBU A;  4JD6 A;  3IFE A;  5CPA A;  2ZEN A;  1LRZ A;  3IU2 A;  4FAI A;  3KGQ A;  4F6A A;  1Z8W A;  4E8O A;  4MFP A;  2HUZ A;  2B3V A;  2Z0Z A;  4PSX A;  3SI2 A;  4OAE A;  5G1Z A;  3S6K A;  1RXT A;  3D2M A;  3JVN A;  5BWA B;  2ZEM A;  2O53 A;  4UWJ A;  4X5K A;  4KVM E;  2O4H A;  1Z5R A;  5EBV A;  2AFO A;  3FYN A;  4P10 A;  4WJB A;  4H6U A;  2OU2 A;  4NGT A;  2OZH A;  3BJ7 A;  4PXB A;  5LYL A;  4KZT A;  2GAN A;  4PXC A;  1F2P A;  3VWE A;  2QML A;  2D4O A;  5LRJ A;  2VXK A;  3T8W A;  2I79 A;  3LOD A;  1Z2L A;  3L2N A;  4Y49 B;  5DS0 A;  1QQ9 A;  1IY7 A;  4NEX A;  2OR4 A;  4Q38 A;  1IB1 E;  3BI1 A;  4NGM A;  4KOX A;  1RTQ A;  4LUA A;  2PJ0 A;  4RI1 A;  3R9E A;  4X2T A;  2PCU A;  2PIZ A;  4BMH A;  2GE3 A;  3KR4 A;  1QSR A;  1XMT A;  2PJ2 A;  1TIQ A;  4P4E A;  4P6Y A;  1ELM P;  4OC2 A;  2XEF A;  4L8A A;  4H89 A;  3S9M A;  4B6Z A;  2PR1 A;  2PDO A;  3DLJ A;  5F46 A;  1KUV A;  2J8N A;  3PB4 X;  3VH9 A;  3GIU A;  4BBH A;  2Q51 A;  4OC3 A;  2ZW4 A;  2B5G B;  4JXR A;  3DNS A;  4MBU A;  3WC7 A;  4C7I A;  4CGP A;  1PCA A;  4UWI A;  3EFA A;  3B3T A;  1BPN A;  3TT2 A;  4IF5 A;  2C6P A;  4JXQ A;  4M3S A;  2QYV A;  4X3R A;  1YW4 A;  1OZP A;  1S5K A;  1LAP A;  1YK3 A;  3PEI A;  2BO9 A;  3PP9 A;  2H5M A;  5KTC A;  2PJC A;  1KZF A;  1BOB A;  1EE3 P;  1YME A;  2VL1 A;  5HH1 A;  4P4F A;  3WC6 A;  4Z65 A;  4YU9 A;  1Q7L A;  3BHX A;  3KL9 A;  4M85 A;  2REE A;  4MCP A;  4JZ0 A;  4XNH C;  1IU8 A;  1HEE A;  2F5I A;  4KOV A;  4RS2 A;  4CS0 B;  3A9L A;  3F8K A;  1IID A;  2PVV A;  4HNX B;  2Z3K A;  3G8W A;  4YRH A;  1YLO A;  8CPA A;  3I3G A;  1YRE A;  3QNV A;  1LFW A;  4KOU A;  4CYN A;  1R3N A;  2PJB A;  3TC8 A;  3LMS A;  4MY3 A;  4ZYQ A;  4RN7 A;  1BLL E;  4OC5 A;  3S6F A;  2DPS A;  4CGL A;  2ZEP A;  2ZXV A;  4L89 A;  3MGD A;  3CT9 A;  4M6H A;  3JUW A;  2PQ8 A;  4J3G A;  4M6G A;  1K4J A;  3CDX A;  2EK9 A;  3FXT A;  4W9Y A;  2Q44 A;  2JEW A;  1ARM A;  4R8F A;  4MFQ A;  2J8M A;  4P4J A;  3KHZ A;  3QAH A;  3DGV A;  2I3C A;  3IC1 A;  1YQE A;  2Z3P A;  2NSM A;  3DR6 A;  2C6G A;  1TF9 A;  3NH4 A;  3KHX A;  4ZY0 A;  4C2Y A;  3ZZI A;  4PQA A;  3G3S A;  5LYI A;  4QBJ A;  3E0K A;  1OBR A;  4A94 A;  5HXD A;  1U6M A;  3V7Z A;  4DYO A;  5JGF A;  2AE6 A;  2ZW5 A;  2CNT A;  4XPL A;  4MFK A;  4ZGY B;  2Z3N A;  2B58 A;  3KQZ A;  4K3N A;  2AFU A;  3FNC A;  4MI4 A;  2EUI A;  4NJQ A;  5C82 A;  4F9U A;  4CGM A;  3PFO A;  1KWM A;  4KOT A;  4KSF A;  4UF4 A;  1Z4R A;  3GKR A;  1ZLH A;  2HV2 A;  2JDC A;  3NFZ A;  4EME A;  5HVH A;  4R76 A;  2BSW A;  1S60 A;  4A31 A;  1XE4 A;  3EC4 A;  2FT0 A;  4JYW A;  3TE4 A;  3PB8 X;  3KR5 A;  2CY2 A;  3LWU A;  3W91 A;  1XFO A;  3FF3 A;  4MCQ A;  4NGS A;  5AG4 A;  2CNS A;  2AFS A;  3PBE A;  2YNE A;  3IWE A;  3WAB A;  4A95 A;  3FX6 A;  2ZPA A;  1IOF A;  1PYT B;  3B3C A;  2J8R A;  3RAM A;  3V38 A;  1VHE A;  4F0X A;  2C6C A;  4MJ8 A;  4HKF A;  5F09 A;  3GLJ A;  2Z3L A;  2Z11 A;  3ISZ A;  5J1Q A;  3VAR A;  2VI7 A;  3GYA A;  1LCP A;  4IAV A;  5AG6 A;  1WK4 A;  4Q7A A;  2OH1 A;  2ZEH A;  1Y0R A;  4KS9 A;  3N7Z A;  3S9N A;  1JWQ A;  4OAD A;  4UCM A;  4QB9 A;  3PB9 X;  4NGR A;  4YWY A;  5G20 A;  2C27 A;  4UEZ A;  2PJ9 A;  2FIA A;  4A33 A;  4GS4 A;  1CJW A;  3BXM A;  2QIR A;  3D8P A;  4OME A;  2JEV A;  1Y9W A;  1S7F A;  2PJ4 A;  3CPX A;  1Q2C A;  3D7D A;  2PRQ A;  4GXH A;  4F8Z A;  5IX3 A;  3VAT A;  3NH8 A;  5HVG A;  2IJZ A;  1NSL A;  3TTH A;  2GFQ A;  4OC4 A;  4AG9 A;  4B11 A;  4KVO E;  3EXN A;  4G1P A;  1MK4 A;  1NSA A;  4FD5 A;  1YVO A;  2Q7B A;  4A32 A;  1YVK A;  3D67 A;  3R96 A;  4A38 A;  4CAX A;  2EWB A;  4C2X A;  3S6H A;  2F8H A;  4E0A A;  2G0B A;  4F9V A;  3MN8 A;  1I12 A;  4GM5 A;  2GIV A;  3SI0 A;  5HMN A;  2IQ6 A;  4NJR A;  1QST A;  4II9 A;  3D7H A;  4FD6 A;  5H86 A;  3I1U A;  2YND A;  4U9Z A;  1XMB A;  3RZA A;  4EWT A;  4P4D A;  2FSR A;  1YGH A;  2JDD A;  1J4J A;  3LD2 A;  2BUE A;  1R57 A;  1MJ9 A;  1N71 A;  5LYF A;  1P0H A;  4P4I A;  4CGO A;  4B5P A;  2BCO A;  2VQY A;  3DSB A;  5D29 A;  1HDU A;  1TKF A;  1CG2 A;  2G3A A;  1M4I A;  2XEG A;  4KLV A;  3TO9 A;  4CRY B;  4CGN A;  5K8P A;  2EK8 A;  4JJX A;  2ZEG A;  2ABZ A;  4R6T A;  3B3S A;  3B8G A;  5EMI A;  4M6I A;  2R8V A;  3SJE A;  1HDQ A;  1I21 A;  3NE7 A;  4MHY A;  3MRU A;  4UIB A;  1Y9K A;  4F0Y A;  1LAN A;  4UBR A;  3FH4 A;  3TO7 A;  4UEF A;  1CPX A;  1A2Z A;  1RO5 A;  2HC9 A;  1CPS A;  3R9F A;  4XPD C;  1FNO A;  3I9S A;  2R98 A;  3FEC A;  4FD4 A;  1S3Z A;  2Q7S A;  2VEZ A;  1XIX A;  5GCN A;  4MFZ A;  3FJU A;  4KOW A;  4YGO A;  1LOK A;  1UWY A;  3TX8 A;  1TKJ A;  2JBK A;  2NYQ A;  3K9U A;  3D3S A;  4MHN A;  4MHP A;  4WWV A;  4FD7 A;  3DR8 A;  3TOB A;  4B13 A;  4NGN A;  1VKC A;  2REF A;  1MJA A;  4MHD A;  2IL4 A;  4I49 A;  2PJ1 A;  3PFE A;  3W6S A;  2Q4Z A;  2ATR A;  2ODF A;  2WPX A;  5AGE A;  3TO6 A;  3WC5 A;  1L0C A;  1PU9 A;  2GLJ A;  1F2O A;  2QEC A;  1TKH A;  1CP7 A;  2XEJ A;  2GRE A;  4ONW A;  1FT7 A;  3WT4 A;  4ONU A;  2FL4 A;  2D4P A;  4AXV A;  3IJ3 A;  2X7B A;  4PPZ A;  4P4B A;  2XEI A;  5KTA A;  2B3U A;  2Q04 A;  2YGW A;  5K8N A;  3P2F A;  1KUY A;  4MCS A;  2FE7 A;  3KKW A;  4JWP A;  5IV0 A;  4R57 A;  2ZW6 A;  3B2Y A;  3EY5 A;  5JH9 A;  3KI9 A;  2HB6 A;  2ZOF A;  3CXP A;  2B5G A;  4MRI A;  4QUS A;  5G22 A;  2VBQ A;  1IYL A;  5FVJ A;  4B10 A;  4NFR A;  1Y7R A;  2OB0 A;  2WPW A;  4U9Y A;  4ZX9 A;  1R43 A;  2JLM A;  2FS5 A;  4HNY B;  1S7K A;  2AFX A;  2NMT A;  2I00 A;  4ZX8 A;  4Y49 C;  2CTC A;  3JRU A;  3T9Y A;  2DXQ A;  4U5Y A;  2O28 A;  2YNC A;  3H4Q A;  3HUV A;  1GYT A;  2CXA A;  4YFJ A;  3IWG A;  3UY5 A;  4X8I A;  3P2H A;  3RBU A;  3RNZ A;  5JPH A;  3TFY A;  1ZG8 A;  3D4U A;  3JTK A;  3PGP A;  1XOV A;  1AMP A;  3WR7 A;  4UCN A;  2ZW7 A;  2PIY A;  3PRT A;  4A37 A;  1M4D A;  4QC6 A;  4NF1 A;  4ZY1 A;  3S6G A;  2RB7 A;  2OZG A;  3D68 A;  2P6F A;  5DWN A;  2P0W A;  3W6X A;  1CX8 A;  1DE4 C;  4EVY A;  1ARL A;  1QMU A;  1MJB A;  1XRY A;  5D8N A;  3SXO A;  3FEE A;  1KUX A;  4PV6 A;  3CPA A;  3PBB A;  3IO1 A;  2Q4V A;  1DTD A;  4PSW A;  2VZZ A;  3NA6 A;  3N5F A;  5AG5 A;  4K30 A;  4CRZ B;  4IHM A;  4BD9 A;  2B4B A;  4UFW A;  7CPA A;  3FVL A;  4FBE A;  4CAE A;  1SQH A;  3BJ8 A;  4DUK A;  4XNH B;  1FY7 A;  1AYE A;  1YW6 A;  1Z8X A;  1NMT A;  2EVN A;  4IUS A;  4CYQ A;  2RC4 A;  3IGR A;  4R3K A;  5A28 A;  4MFJ A;  2Q43 A;  3LAC A;  2Q0Y A;  4MMO A;  2AJ6 A;  1V0C A;  2ZOG A;  3SI1 A;  1M1D A;  3HLP A;  1IYK A;  3ZJ0 A;  1AUG A;  1VHS A;  2CF4 A;  2BEI A;  4AVB A;  1Q2D A;  2BOA A;  2AFM A;  4MXU A;  1X10 A;  4NXY A;  2EBJ A;  3H8E A;  2BL1 A;  4MHZ A;  2B4D B;  2WYR A;  4LQG A;  4UA3 A;  5ISV A;  4NCZ A;  3IEH A;  1VGY A;  2RFH A;  1TXR A;  3BI0 A;  3B7I A;  3R9G A;  4CAV A;  4OLL A;  2PR8 A;  1CBX A;  2V8D A;  4CPA A;  5A27 A;  1ELL P;  1S7L A;  4AG7 A;  2R1I A;  2V8H A;  3K2K A;  4NGQ A;  2ZEF A;  2JBJ A;  1TF8 A;  2OZU A;  3FB3 A;  2J9A A;  1BAV A;  4UFX A;  4A39 A;  1BO4 A;  2GU2 A;  1YR0 A;  3KZW A;  2R7H A;  4ORF A;  1YSJ A;  5IB9 A;  5CBM A;  1M4G A;  4H6Z A;  4BIN A;  1Q2Y A;  2Z3O A;  1XF8 A;  4OKO A;  2DPT A;  5CNP A;  4NGP A;  3RYO A;  4C68 A;  1X12 A;  5F48 A;  2PJ5 A;  1IOI A;  3H8F A;  3OWC A;  2EO8 A;  2Y0M A;  4AVC A;  3R1K A;  1UFH A;  2ZEL A;  5C88 A;  1F57 A;  1Z4E A;  3DDD A;  3FED A;  4ZI6 A;  2P6G A;  2PE3 A;  3IIB A;  3H8G A;  2FXF A;  5K8M A;  4AB7 A;  2PJ3 A;  2K5T A;  1YLE A;  1GHE A;  4B14 A;  4FUU A;  4OC1 A;  2VZY A;  2PJA A;  4HPS A;  3GB0 A;  2DEA A;  4R9M A;  1PUA A;  2PC1 A;  3D7G A;  4OC0 A;  2AFZ A;  2PJ7 A;  3PB6 X;  4O23 A;  4P44 A;  2CTB A;  2B4D A;  4HNW B;  4ZBG A;  5JQ4 A;  1VHO A;  3C26 A;  4KSA A;  1I1D A;  1WWZ A;  3K9T A;  3F0A A;  5J8C A;  1ZG7 A;  1H8L A;  3F5B A;  4QVT A;  3EO4 A;  3SXN A;  6CPA A;  4PK3 A;  5ELY A;  2PJ8 A;  2QVP A;  3S9L A;  5IB0 A;  2ARH A;  1CM0 A;  3IU1 A;  3QB8 A;  2C1C A;  4C7H A;  2PVW A;  2POK A;  5F49 A;  4TWE A;  4MY0 A;  3CXQ A;  4AVA A;  5DWM A;  1Y0Y A;  4R7M A;  4DNC A;  4KSI A;  2WUU A;  1ZLI A;  2KCW A;  4ZY2 A;  3NH5 A;  4CAF A;  4RUH A;  4UFV A;  5LRG A;  4DJL A;  3ISX A;  5KTD A;  1Y7E A;  4Q36 A;  2CIJ A;  3CZX A;  5HVF A;  1QSM A;  3TOA A;  2V8V A;  1B6B A;  1QSO A;  2A4N A;  2Z3M A;  3VWD A;  3FRM A;  1YX0 A;  3GY9 A;  4OIW A;  1IIC A;  4OID A;  2P6E A;  1P4N A;  2PRB A;  2V8G A;  4NSQ A;  5EC4 A;  1CP6 A;  1ON0 A;  2ZED A;  5F47 A;  2HQY A;  3TCV A;  1XJO A;  4B5O A;  1VIX A;  4UCP A;  5G21 A;  5LRK A;  2G3T A;  3D7F A;  1IGB A;  4OP4 A;  5LYD A;  4MFL A;  5J8F A;  1JQG A;  2CNM A;  1Z9U A;  4B12 A;  3NE8 A;  3FMC A;  4UEE A;  2V77 A;  2Q4Y A;  4E2A A;  5I0C A;  2AFW A;  3D2P A;  5THW A;  4R3L A;  5E96 A;  4A2Z A;  1ZG9 A;  4UIA A;  3FBU A;  1XEB A;  3T90 A;  1M44 A;  4EFD A;  1Z8L A;  3SJF A;  5I4M A;  4CYO A;  4PXD A;  3FIX A;  5K8O A;  1ZO0 A;  1BPM A;  4CAW A;  1NE9 A;  4H2K A;  3BLN A;  3SJG A;  3B3V A;  4KVX A;  3V8I A;  4PXE A;  2Z10 A;  4KOR A;  2F7V A;  2QJ8 A;  4KOS A;  2IMO A;  5AG7 A;  3B35 A;  3SHP A;  2ZEE A;  4KUB A;  4XPD B;  2ANP A;  4XPK A;  3CXS A;  2OOT A;  2WSA A;  2YNC C;  2G9D A;  2PJ6 A;  1QSN A; 
#chains in the Genus database with same CATH homology
 4R87 A;  3R95 A;  4C2Z A;  4CYP A;  3PZJ A;  2PSW A;  4KUA A;  2FIW A;  4LX9 A;  4B5P B;  1B87 A;  4JLY A;  5H84 A;  1S7N A;  3H5Z A;  4KLW A;  4A30 A;  2FCK A;  4KOY A;  4PK2 A;  4JD6 A;  1LRZ A;  3IU2 A;  4F6A A;  4E8O A;  4MFP A;  2HUZ A;  2B3V A;  2Z0Z A;  4PSX A;  4OAE A;  5G1Z A;  3S6K A;  1RXT A;  3D2M A;  3JVN A;  5BWA B;  4UWJ A;  4X5K A;  4KVM E;  5EBV A;  3FYN A;  4H6U A;  2OU2 A;  2OZH A;  3BJ7 A;  4KZT A;  2GAN A;  3VWE A;  2QML A;  2D4O A;  2VXK A;  2I79 A;  3LOD A;  4Y49 B;  4NEX A;  4Q38 A;  1IB1 E;  4KOX A;  4LUA A;  4RI1 A;  3R9E A;  4BMH A;  2GE3 A;  1QSR A;  1XMT A;  1TIQ A;  4L8A A;  4H89 A;  2PR1 A;  2PDO A;  5F46 A;  1KUV A;  2J8N A;  4BBH A;  2ZW4 A;  2B5G B;  4JXR A;  3DNS A;  4MBU A;  4C7I A;  4CGP A;  4UWI A;  3EFA A;  3TT2 A;  4IF5 A;  4JXQ A;  4M3S A;  1OZP A;  1S5K A;  5KTC A;  1YK3 A;  3PP9 A;  2H5M A;  1KZF A;  1BOB A;  5HH1 A;  4M85 A;  2REE A;  4XNH C;  2F5I A;  4KOV A;  4RS2 A;  4CS0 B;  3A9L A;  3F8K A;  1IID A;  4HNX B;  2Z3K A;  3G8W A;  4YRH A;  3I3G A;  1YRE A;  4KOU A;  4CYN A;  4MY3 A;  3S6F A;  2DPS A;  4CGL A;  2ZXV A;  4L89 A;  3MGD A;  5KTD A;  3JUW A;  2PQ8 A;  4J3G A;  1K4J A;  3FXT A;  2Q44 A;  4MFQ A;  2J8M A;  3QAH A;  2Z3P A;  3DR6 A;  4C2Y A;  3ZZI A;  3G3S A;  4QBJ A;  3E0K A;  1U6M A;  2AE6 A;  2ZW5 A;  2CNT A;  4XPL A;  4MFK A;  4ZGY B;  2Z3N A;  2B58 A;  5C82 A;  3FNC A;  4MI4 A;  2EUI A;  4CGM A;  4KSF A;  4KOT A;  1Z4R A;  3GKR A;  2HV2 A;  2JDC A;  2BSW A;  1S60 A;  4A31 A;  1XE4 A;  3EC4 A;  2FT0 A;  3TE4 A;  2CY2 A;  3W91 A;  5AG4 A;  2CNS A;  2YNE A;  3IWE A;  4A95 A;  2ZPA A;  2J8R A;  4F0X A;  4MJ8 A;  4HKF A;  2Z3L A;  2Z11 A;  2VI7 A;  3GYA A;  5AG6 A;  1WK4 A;  2OH1 A;  4KS9 A;  3N7Z A;  4OAD A;  4UCM A;  4QB9 A;  5G20 A;  2C27 A;  2FIA A;  4A33 A;  4GS4 A;  1CJW A;  2QIR A;  3D8P A;  2JEV A;  1Y9W A;  1S7F A;  1Q2C A;  5IX3 A;  1NSL A;  3TTH A;  4AG9 A;  4B11 A;  4KVO E;  3EXN A;  1MK4 A;  4FD5 A;  1YVO A;  2Q7B A;  4A32 A;  1YVK A;  3R96 A;  4CAX A;  4C2X A;  3S6H A;  4E0A A;  2G0B A;  1I12 A;  2GIV A;  5HMN A;  1QST A;  4II9 A;  4FD6 A;  5H86 A;  2YND A;  4U9Z A;  2FSR A;  1YGH A;  2JDD A;  1J4J A;  3LD2 A;  2BUE A;  1R57 A;  1MJ9 A;  1N71 A;  1P0H A;  4CGO A;  4B5P A;  2VQY A;  3DSB A;  4CRY B;  2G3A A;  4KLV A;  1M4I A;  3TO9 A;  4CGN A;  4JJX A;  3B8G A;  2R8V A;  1I21 A;  3NE7 A;  4F0Y A;  1Y9K A;  4UBR A;  3TO7 A;  1RO5 A;  3R9F A;  4XPD C;  3I9S A;  4FD4 A;  2R98 A;  1S3Z A;  2VEZ A;  1XIX A;  5GCN A;  4MFZ A;  4KOW A;  4YGO A;  3K9U A;  3D3S A;  4B13 A;  4FD7 A;  3DR8 A;  3TOB A;  1VKC A;  2REF A;  1MJA A;  4MHD A;  2IL4 A;  4I49 A;  3W6S A;  2ATR A;  2WPX A;  5AGE A;  3TO6 A;  1L0C A;  1PU9 A;  2QEC A;  4ONU A;  2FL4 A;  2D4P A;  2X7B A;  5KTA A;  2B3U A;  2Q04 A;  2YGW A;  3P2F A;  1KUY A;  2FE7 A;  3KKW A;  4JWP A;  5IV0 A;  4R57 A;  2ZW6 A;  3EY5 A;  3CXP A;  2B5G A;  4QUS A;  5G22 A;  2VBQ A;  1IYL A;  5FVJ A;  4B10 A;  1Y7R A;  2OB0 A;  2WPW A;  4U9Y A;  2JLM A;  2FS5 A;  4HNY B;  1S7K A;  2NMT A;  2I00 A;  4Y49 C;  3T9Y A;  2DXQ A;  4U5Y A;  2O28 A;  2YNC A;  3H4Q A;  2CXA A;  4YFJ A;  3IWG A;  3UY5 A;  3P2H A;  5JPH A;  3TFY A;  3JTK A;  3PGP A;  3WR7 A;  4UCN A;  2ZW7 A;  1M4D A;  4QC6 A;  4NF1 A;  3S6G A;  2OZG A;  2P6F A;  5DWN A;  2P0W A;  3W6X A;  4EVY A;  1MJB A;  3SXO A;  4PV6 A;  1KUX A;  4PSW A;  2Q4V A;  5AG5 A;  2VZZ A;  4K30 A;  4CRZ B;  2B4B A;  4UFW A;  4CAE A;  1SQH A;  3BJ8 A;  4XNH B;  1FY7 A;  2EVN A;  1NMT A;  4IUS A;  4CYQ A;  2RC4 A;  3IGR A;  4R3K A;  5A28 A;  4MFJ A;  2Q0Y A;  2AJ6 A;  1V0C A;  1M1D A;  1IYK A;  3ZJ0 A;  4AVB A;  1VHS A;  2BEI A;  1Q2D A;  4NXY A;  2BL1 A;  2B4D B;  4UA3 A;  5ISV A;  4NCZ A;  3R9G A;  4CAV A;  4OLL A;  2PR8 A;  5A27 A;  1S7L A;  4AG7 A;  2R1I A;  2OZU A;  3FB3 A;  4UFX A;  1BO4 A;  1YR0 A;  4ORF A;  2R7H A;  1M4G A;  4H6Z A;  1Q2Y A;  2Z3O A;  1XF8 A;  2DPT A;  5CNP A;  3RYO A;  4C68 A;  5F48 A;  3OWC A;  4AVC A;  2Y0M A;  5C88 A;  3R1K A;  1UFH A;  1Z4E A;  3DDD A;  2P6G A;  2FXF A;  4AB7 A;  2K5T A;  1YLE A;  1GHE A;  4B14 A;  2VZY A;  4R9M A;  1PUA A;  2PC1 A;  5JQ4 A;  4HNW B;  2B4D A;  4ZBG A;  4KSA A;  3C26 A;  1I1D A;  1WWZ A;  3F0A A;  5J8C A;  3F5B A;  4QVT A;  3EO4 A;  3SXN A;  4PK3 A;  5IB0 A;  2ARH A;  1CM0 A;  3IU1 A;  3QB8 A;  4C7H A;  5F49 A;  4MY0 A;  3CXQ A;  4AVA A;  5DWM A;  4DNC A;  2WUU A;  2KCW A;  4CAF A;  4UFV A;  4Q36 A;  1QSM A;  3TOA A;  1B6B A;  1QSO A;  2A4N A;  2Z3M A;  3VWD A;  3FRM A;  1YX0 A;  3GY9 A;  1IIC A;  2P6E A;  1P4N A;  2PRB A;  4NSQ A;  5EC4 A;  1ON0 A;  5F47 A;  2HQY A;  3TCV A;  4B5O A;  5G21 A;  4UCP A;  2G3T A;  4MFL A;  5J8F A;  2CNM A;  1Z9U A;  4B12 A;  4E2A A;  2Q4Y A;  5I0C A;  3D2P A;  4R3L A;  5E96 A;  4A2Z A;  3FBU A;  1XEB A;  3T90 A;  1M44 A;  4CYO A;  3FIX A;  1ZO0 A;  4CAW A;  1NE9 A;  3BLN A;  3V8I A;  4KVX A;  2Z10 A;  4KOR A;  4KOS A;  5AG7 A;  3SHP A;  4KUB A;  4XPD B;  4XPK A;  3CXS A;  2WSA A;  2YNC C;  1QSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...