4CS0B

Direct visualisation of strain-induced protein post-translational modification
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
MKLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Pand/Panz Protein Complex Reveals Negative Feedback Regulation of Pantothenate Biosynthesis by Coenzyme A.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords ASPARTATE 1-DECARBOXYLASE
total genus 35
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12568 PanZ Acetyltransferase (GNAT) domain, PanZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cs0B00
4Y49B 4CRZB 4H6UA 4AB7A 1NE9A 2Q44A 2R7HA 2PRBA 3FYNA 5IX3A 5ISVA 1IYLA 4KVOE 3GY9A 1KUYA 2PDOA 5HH1A 2REEA 2Z0ZA 1Z4RA 4B5PA 3LODA 4L8AA 3TT2A 3BJ8A 3SXNA 4KOVA 4FD5A 5H86A 3VWEA 4PSXA 2REFA 1KUVA 4B5PB 3TO7A 4KZTA 2OB0A 2JDDA 2Z10A 3SHPA 1XIXA 2QECA 2O28A 2WPWA 2VQYA 3QB8A 4KOSA 3F8KA 3IGRA 1P4NA 2R98A 3IWGA 1OZPA 2PQ8A 3BLNA 5JQ4A 5KTDA 2DXQA 2K5TA 4JXQA 5KTAA 2OH1A 3G3SA 2BSWA 5IV0A 4MI4A 2J8RA 2KCWA 3DDDA 3N7ZA 4YGOA 4KLVA 2OZHA 4R87A 1U6MA 3E0KA 4XNHC 1YVOA 1I12A 4XPLA 3S6GA 4PK2A 4I49A 1YREA 4U9ZA 3EY5A 4KOUA 4E0AA 1Y9WA 1Y9KA 4ZBGA 2EVNA 2JEVA 5F46A 4AVAA 2ZPAA 4FD4A 3R9FA 1Z4EA 3DSBA 1RXTA 1Q2DA 4PK3A 4MY3A 2H5MA 3S6KA 1XEBA 1P0HA 4J3GA 3ZZIA 1YGHA 5FVJA 3NE7A 4HKFA 3I3GA 3S6HA 4Y49C 3P2HA 3FXTA 3JUWA 4KOYA 1CJWA 3QAHA 2IL4A 4XPDB 2P0WA 1MK4A 3D2PA 4JXRA 2X7BA 3D3SA 4YFJA 3PGPA 2PSWA 5E96A 2CNTA 2G0BA 2Y0MA 2Q4YA 1Z9UA 2R1IA 4KLWA 2FXFA 4KUAA 1Q2CA 4YRHA 5C82A 3W91A 4ONUA 3FNCA 5GCNA 4E2AA 1WK4A 4U9YA 1R57A 4U5YA 4UWIA 3RYOA 2R8VA 1Q2YA 4PSWA 3P2FA 1KZFA 4JJXA 2J8NA 4UA3A 3TO6A 3CXSA 1M4GA 3G8WA 5C88A 3C26A 4M3SA 1M1DA 4LUAA 4LX9A 4CAVA 3H4QA 3R1KA 4HNXB 2JDCA 1SQHA 3VWDA 5J8CA 3CXPA 3T90A 1GHEA 2BEIA 3EC4A 2FCKA 1I1DA 4CAXA 4E8OA 2RC4A 2OZGA 5KTCA 2FT0A 3V8IA 2F5IA 4JWPA 4AVCA 2VBQA 4RS2A 4KOTA 1VKCA 3TOBA 1YVKA 2FL4A 1WWZA 1NSLA 3EXNA 4OLLA 2B5GA 1YK3A 3LD2A 2OZUA 4R57A 5JPHA 2CY2A 2CNSA 1I21A 2BL1A 2P6GA 4KOXA 3DR6A 3GKRA 2G3AA 1Y7RA 3D2MA 1PUAA 2I00A 4AG7A 4QB9A 2B5GB 4OADA 1LRZA 2P6EA 1CM0A 3OWCA 2PC1A 3R9GA 5EC4A 4F6AA 4M85A 4KVXA 2HV2A 2VXKA 2ARHA 4MJ8A 5F48A 4UWJA 3PP9A 4ORFA 5F47A 4KUBA 1VHSA 3T9YA 1MJBA 2Q7BA 5J8FA 1QSMA 1YX0A 1S7NA 4HNYB 2HUZA 3TCVA 3BJ7A 3EO4A 1S5KA 3TE4A 1BOBA 2C27A 2FIWA 2D4PA 2ZW5A 2FS5A 2NMTA 3F0AA 4NXYA 2B4BA 1J4JA 2CNMA 3PZJA 1B87A 1S60A 5DWNA 4XPKA 1S3ZA 1YR0A 3S6FA 1FY7A 1PU9A 3GYAA 2VZZA 2FE7A 4KORA 4R3KA 4XNHB 4AG9A 5HMNA 2OU2A 3W6SA 1QSTA 2Q0YA 4IUSA 1K4JA 1RO5A 1QSOA 4NF1A 1IB1E 3DNSA 3MGDA 5CNPA 4OAEA 4B5OA 3FB3A 3KKWA 4H6ZA 2ZW6A 2ZW7A 1IIDA 2PR8A 3JVNA 1MJAA 4AVBA 4FD7A 2JLMA 3R95A 2B3UA 1NMTA 3R9EA 1V0CA 1M4DA 2J8MA 4PV6A 4H89A 1N71A 3K9UA 5DWMA 1M4IA 2B58A 4NSQA 1MJ9A 1XMTA 3DR8A 2PR1A 2B4DB 1S7FA 3EFAA 3B8GA 1TIQA 2Z11A 3I9SA 4F0YA 2HQYA 1XF8A 1B6BA 4JLYA 1ON0A 2QIRA 1KUXA 2VI7A 4KOWA 1QSRA 2EUIA 4EVYA 4R9MA 3TO9A 4X5KA 4GS4A 4QBJA 4R3LA 3FRMA 4KVME 3D8PA 4MY0A 2P6FA 2ZW4A 4CRYB 2VEZA 2D4OA 4IF5A 2A4NA 2FSRA 4MHDA 2GE3A 4L89A 4UBRA 5IB0A 2ATRA 3TFYA 3R96A 2ZXVA 3WR7A 2B3VA 3TTHA 4CAWA 3W6XA 1S7KA 2FIAA 3SXOA 5EBVA 4NEXA 3UY5A 3F5BA 4QC6A 2AE6A 2Q04A 4FD6A 2B4DA 1S7LA 2AJ6A 4HNWB 3ZJ0A 1BO4A 5F49A 4II9A 4K30A 2I79A 2WPXA 1XE4A 4XPDC 4QVTA 1IICA 2BUEA 2GIVA 1M44A 2VZYA 1L0CA 4MBUA 1YLEA 5H84A 2GANA 1IYKA 3CXQA 4DNCA 4QUSA 2G3TA 2Q4VA 4RI1A 4BMHA 3FBUA 3FIXA 4JD6A 2QMLA 3TOAA 1UFHA 5I0CA 4NCZA 1QSNA 4CS0B
chains in the Genus database with same CATH superfamily
4Y49B 2ZEHA 2PJ2A 2HC9A 2PJ9A 4UCMA 4CRZB 4H6UA 4AB7A 3FJUA 1NE9A 1R3NA 2Q44A 2R7HA 2PRBA 3D66A 2NSMA 3FYNA 4MFKA 4CGOA 1ZO0A 1ELLP 5IX3A 2YNEA 4PXBA 3FX6A 2PIYA 7CPAA 4PXEA 5ISVA 1IYLA 4KVOE 3SI2A 3GY9A 1KUYA 2PDOA 4NGNA 5HH1A 2REEA 2AFXA 2Z0ZA 1Z4RA 4B5PA 3LODA 4L8AA 4WJBA 3KGQA 3TT2A 3BJ8A 3SXNA 1QQ9A 3D7GA 5BWAB 4KOVA 1CX8A 3ISXA 1UWYA 4FD5A 5H86A 3VWEA 5AG5A 1RTQA 4A32A 4PSXA 2REFA 3S9MA 1KUVA 4B5PB 2C6PA 4A31A 4KSFA 3TO7A 4OIDA 4KZTA 2OB0A 2JBKA 4YGOA 4A37A 2JDDA 5K8OA 2Z10A 3GIUA 3PFOA 5DS0A 3SJXA 1BPMA 4ZY1A 1HDQA 2FVGA 3SHPA 4OC0A 1XIXA 3H8GA 2ZEEA 2QECA 2O28A 1VHOA 2WPWA 3IU1A 2YNCC 4WWVA 2VQYA 1AMPA 3KI9A 3QB8A 3F8KA 2AFOA 3IGRA 4KOSA 3CPAA 3RNZA 2PJAA 1P4NA 4Q7AA 2R98A 3IWGA 3LACA 1LANA 4MHYA 1JWQA 1OZPA 1PCAA 4OC4A 1VIXA 2PQ8A 3BLNA 5JQ4A 5KTDA 2DXQA 2K5TA 4JXQA 5KTAA 1Z8WA 2OH1A 1X12A 3G3SA 4P10A 4P4EA 2PVVA 5AG7A 3SI0A 3TC8A 4UEFA 2BSWA 5IV0A 4EMEA 4MI4A 2J8RA 2KCWA 3DDDA 3N7ZA 3BXMA 2Z3LA 3ISZA 2PJ4A 2ZENA 4KLVA 4UF4A 2OZHA 4R87A 1U6MA 3E0KA 4XNHC 1YVOA 1I12A 4XPLA 3S6GA 1CBXA 4I49A 4PK2A 5HXDA 1YREA 4U9ZA 3EY5A 4AXVA 4KOUA 4E0AA 1Y9WA 4G1PA 4F8ZA 1Y9KA 4ZBGA 2EVNA 2JEVA 5F46A 1Y0RA 4NGRA 2ZEPA 4OMEA 3KHXA 2PJ5A 2I3CA 5G21A 4AVAA 4BINA 3KZWA 2ZPAA 4FD4A 3R9FA 2AFUA 4C2ZA 2PJCA 1Z4EA 3DSBA 1RXTA 5JH9A 1TKHA 1Q2DA 3B3WA 4LQGA 4PK3A 4JYWA 1LFWA 3SI1A 4MY3A 2H5MA 4HPSA 3S6KA 1XEBA 2AFZA 4CYPA 1P0HA 2C6CA 2XEFA 3VATA 4J3GA 3ZZIA 1YGHA 4NGMA 4R6TA 2Z3KA 1YMEA 3KHZA 3NE7A 5FVJA 4HKFA 2DEAA 2O53A 3SJGA 3I3GA 3S6HA 4A39A 2ZEMA 4Y49C 3P2HA 3FXTA 3JUWA 4KOYA 4F9UA 2GLFA 3WT4A 1CJWA 2GREA 3QAHA 4ZYQA 4DYOA 2IL4A 4B14A 4MFJA 2P0WA 4XPDB 1MK4A 3D2PA 4KS9A 5K8MA 3PBEA 4JXRA 1YSJA 4ZGYB 4C2XA 2X7BA 3D3SA 4PPZA 3H8FA 4PQAA 2ZOGA 4YFJA 3MN8A 2PJ1A 1CPSA 1TKJA 3NE8A 2Q4ZA 3PGPA 2PSWA 5E96A 4C7HA 2CNTA 2G0BA 2Y0MA 5EMIA 3D67A 2Q4YA 1Z9UA 2R1IA 4KLWA 4FUUA 5LYDA 2FXFA 3K2KA 4LQ6A 4KUAA 4P4IA 1CP6A 1Q2CA 3RZAA 4YRHA 1QMUA 4P4DA 5I4MA 3GLJA 5C82A 3W91A 4BD9A 4W9YA 4M6IA 4ONUA 3FNCA 1F57A 5GCNA 5LRJA 4R76A 4E2AA 1WK4A 4U9YA 1M4LA 1R57A 4U5YA 4UWIA 5D29A 3RYOA 3DGVA 2R8VA 1Q2YA 3P2FA 4PSWA 3IIBA 2BO9A 4UFXA 3PB7X 1VGYA 1TF8A 3B3CA 4YWYA 1KZFA 2VL1A 2ZOFA 3GB0A 4JJXA 2J8NA 4A30A 4UA3A 4UFVA 3TO6A 3IWWA 3BI0A 3CXSA 4MFPA 2ODFA 1M4GA 2WSAA 2ZEDA 3G8WA 2PJ6A 5C88A 2YGWA 2PRQA 3C26A 5AG4A 1BLLE 4KSAA 1M1DA 4LUAA 4LX9A 4M3SA 4CAVA 3H4QA 2EBJA 3R1KA 2V8GA 4HNXB 2JDCA 2HB6A 1SQHA 3VWDA 3JRUA 2J9AA 3VARA 2CXAA 1ELMP 2OOTA 5J8CA 3CXPA 3T90A 1GHEA 4ZX8A 2BEIA 3EC4A 1ZG7A 2FCKA 4X8IA 1I1DA 4CAXA 4E8OA 4OIWA 2Z3OA 1Z5RA 2RC4A 2OZGA 3NA6A 4UFWA 5KTCA 2FT0A 1IU8A 1IOIA 3V8IA 2F5IA 4JWPA 2C1CA 4MRIA 2PIZA 4AVCA 4CYOA 4A38A 2VBQA 2XEJA 4RS2A 1DE4C 3PB4X 1VKCA 4KOTA 4MFZA 3TOBA 2ZEFA 2IJZA 1YVKA 2FL4A 3QAYA 4PXCA 4DJLA 4NGSA 3H8EA 1WWZA 1NSLA 3MRUA 3EXNA 4OLLA 5AG6A 3NH5A 3FH4A 5THWA 3B3SA 2B5GA 1YK3A 4NFRA 3LD2A 2OZUA 2BOAA 2ZEOA 3CPXA 4R57A 1HDUA 4A33A 3FECA 4IAVA 5JPHA 2AFSA 3IWEA 2CY2A 4R7MA 2CNSA 1I21A 3K9TA 2BL1A 3FEDA 1XMBA 2P6GA 4KOXA 3DR6A 3FMCA 5K8PA 3GKRA 2G3AA 4P4FA 1Y7RA 3BI1A 5LRKA 3D2MA 1PUAA 1Z2LA 2I00A 4AG7A 5A27A 1XBUA 4QB9A 2B5GB 4OADA 4H2KA 1LRZA 2YNCA 3IU2A 2P6EA 1CM0A 3PB6X 2PE3A 3A9LA 3OWCA 3B2YA 4MMOA 2O4HA 4OC3A 3D7FA 4R8FA 1BAVA 2PC1A 3FEEA 3R9GA 2PVWA 2WYRA 2Q43A 1A2ZA 3B7IA 2ANPA 3NH8A 5EC4A 1TXRA 4M85A 1F2OA 3HLPA 4F6AA 2ABZA 4KVXA 4CAEA 2HV2A 2V77A 4UCNA 2VXKA 2ARHA 2Z3MA 3IO1A 4MJ8A 4MCQA 4RN7A 5F48A 4CYQA 1IGBA 4UWJA 1YQEA 3PP9A 1Q7LA 4CGNA 5IB9A 4B10A 4ORFA 1R43A 5F47A 4MXUA 4KUBA 1VHSA 3T9YA 1MJBA 3IC1A 2Q7BA 4B12A 2Q51A 5J8FA 1QSMA 3NFZA 1YX0A 1S7NA 1Z8XA 2JBJA 4HNYB 2HUZA 3TCVA 5HVGA 3BJ7A 1OBRA 1S5KA 3EO4A 3TE4A 1BOBA 2C27A 2AFWA 2D4PA 2FIWA 2ZELA 2ZW5A 3WABA 4O23A 2FS5A 2NMTA 3F0AA 4NXYA 2B4BA 3RO0A 1J4JA 2CNMA 2Q7SA 2PJ3A 1B87A 3PZJA 1S60A 1DTDA 3KR4A 5DWNA 4B13A 1ARMA 4XPKA 1H8LA 1S3ZA 1YR0A 3S6FA 1FY7A 2PJ7A 3BHXA 1PU9A 2EO8A 2NYQA 2VZZA 3GYAA 3KL9A 3L2NA 2FE7A 2Z3PA 4KORA 4P45A 4IHMA 4UEZA 4EWTA 4FWUA 4P4JA 4R3KA 4XNHB 4NJRA 4TWEA 4AG9A 3QNVA 5HMNA 5D8NA 4ZX9A 1VHEA 2OU2A 5F09A 5LRGA 3N5FA 3W6SA 4A94A 1LOKA 1QSTA 2Q0YA 4IUSA 4X2TA 1K4JA 5CPAA 1HEEA 1RO5A 1YW4A 1QSOA 3SJFA 4CGLA 3PEIA 1TF9A 2XEGA 3KQZA 4CAFA 5LYLA 3WC7A 4NF1A 3RBUA 1IB1E 1YLOA 3DNSA 3MGDA 1NSAA 5CBMA 5CNPA 4OAEA 4B5OA 3FB3A 3KKWA 2GLJA 3DLJA 2BCOA 2ZW6A 2ZW7A 4H6ZA 1IIDA 2GU2A 2PR8A 3JVNA 1MJAA 4AVBA 4FD7A 1F2PA 2JLMA 5G20A 4P4BA 1FNOA 5LYIA 4UIAA 3R95A 3GUXA 5LYFA 3B35A 2B3UA 1YW6A 2DPSA 3D7DA 1KWMA 3FF3A 3JTKA 5K8NA 4GXHA 1NMTA 3R9EA 2OR4A 3B3VA 1XRYA 4JZ0A 3S9NA 1IY7A 1M4DA 1V0CA 2J8MA 3TX8A 2WUUA 4PV6A 4EFDA 4Q38A 3CDXA 4H89A 5JGFA 1N71A 3KR5A 2EK8A 3K9UA 5DWMA 1M4IA 1AUGA 4MCRA 2B58A 4C2YA 4NSQA 4FBEA 1MJ9A 4Q36A 1XMTA 4MCPA 4F0XA 1JQGA 1ZG9A 3DR8A 4CGMA 3PB9X 2PR1A 8CPAA 2CF4A 2B4DB 1S7FA 3EFAA 3H5ZA 2IQ6A 3B8GA 1TIQA 4PXDA 2F7VA 2Z11A 4FAIA 3I9SA 4F0YA 2HQYA 3LMSA 4ONWA 1XF8A 4CPAA 3B3TA 2QYVA 3FVLA 3S9LA 4MFQA 2V8HA 1ZLIA 1B6BA 4JLYA 1X10A 1ON0A 6CPAA 3IJ3A 4OC1A 1IOFA 2EWBA 3V7ZA 1XJOA 2DPTA 2XEIA 2QIRA 1KUXA 2VI7A 4KOWA 2V8DA 1QSRA 2EUIA 1XOVA 4EVYA 4DUKA 1XFOA 2ZEGA 1EE3P 1Z8TA 4R9MA 3TO9A 4X5KA 4GS4A 2QJ8A 4BBHA 4QBJA 1BPNA 2DF5A 4R3LA 2PJ8A 3FRMA 4KVME 3D8PA 4MY0A 5A28A 4YU9A 5G1ZA 5AGEA 1CP7A 4NJQA 2P6FA 4Z65A 2POKA 2ZW4A 4CRYB 4KSIA 4RUHA 2VEZA 2D4OA 5JM6A 4IF5A 1ZG8A 2A4NA 2FSRA 3HUVA 4MHDA 4OP4A 3SJEA 4OKOA 2GE3A 4MFLA 1AYEA 4L89A 4UBRA 5IB0A 4A95A 2ATRA 3TFYA 1TKFA 3R96A 2ZXVA 3KASA 3WR7A 4B6ZA 2B3VA 3WC5A 1Z8LA 1PYTB 4K3NA 3TTHA 3D68A 4C68A 4C7IA 3V38A 1FT7A 4CAWA 2CIJA 3W6XA 1S7KA 2FIAA 1CPXA 2CTCA 2F8HA 2V8VA 2G9DA 3SXOA 5EBVA 3T8WA 5HVHA 4NEXA 3PB8X 3UY5A 3F5BA 3PFEA 4MHNA 3WC6A 4QC6A 2PJ0A 2AE6A 2Q04A 4ZY2A 4FD6A 4A2ZA 2B4DA 2JEWA 1S7LA 2C6GA 2YNDA 1Y0YA 2AJ6A 2PJBA 4HNWB 4OC5A 3ZJ0A 3KQXA 2IMOA 5G22A 3IFEA 1BO4A 3CZXA 5F49A 2QVPA 1Y7EA 2Z3NA 2RB7A 2EK9A 4NGTA 4II9A 3RAMA 4K30A 4MHZA 4CGPA 2I79A 2WPXA 4ZY0A 3NH4A 1XE4A 1GYTA 5HVFA 4XPDC 5ELYA 4P44A 3D7HA 4QVTA 1IICA 4GM5A 1ARLA 4TNUA 1LAMA 3VH9A 2BUEA 4IK2A 2CTBA 2GIVA 1M44A 2VZYA 2WZNA 3CT9A 4NGQA 1L0CA 4B11A 3IEHA 4MBUA 1CG2A 4X3RA 1YLEA 4MCSA 3D4UA 2GANA 5H84A 1IYKA 5J1QA 2AFMA 3CXQA 4DNCA 1LCPA 2G3TA 4QUSA 4UCPA 2Q4VA 1LAPA 2RFHA 4M6GA 4NGPA 4RI1A 3PBBA 1ZLHA 4UIBA 4M6HA 4BMHA 4MHPA 4CYNA 3FBUA 3FIXA 4JD6A 4OC2A 4UEEA 3I1UA 2QMLA 3LWUA 3PRTA 4F9VA 4P6YA 2PCUA 1UFHA 3TOAA 2GFQA 5I0CA 4ZI6A 4NCZA 1QSNA 4CS0B
chains in the Genus database with same CATH topology
4Y49B 4UCMA 4CRZB 4H6UA 4AB7A 1NE9A 2Q44A 2R7HA 2PRBA 3FYNA 4MFKA 4CGOA 1ZO0A 5IX3A 2YNEA 5ISVA 1IYLA 4KVOE 3GY9A 1KUYA 2PDOA 5HH1A 2REEA 2Z0ZA 1Z4RA 4B5PA 3LODA 4L8AA 3TT2A 3BJ8A 3SXNA 5BWAB 4KOVA 4FD5A 5H86A 4A32A 3VWEA 5AG5A 4PSXA 2REFA 1KUVA 4B5PB 4A31A 4KSFA 3TO7A 4KZTA 2OB0A 2JDDA 2Z10A 3SHPA 1XIXA 2QECA 2O28A 2WPWA 3IU1A 2YNCC 2VQYA 3QB8A 4KOSA 3F8KA 3IGRA 1P4NA 2R98A 3IWGA 1OZPA 2PQ8A 3BLNA 5JQ4A 5KTDA 2DXQA 2K5TA 4JXQA 5KTAA 2OH1A 3G3SA 5AG7A 2BSWA 5IV0A 4MI4A 2J8RA 2KCWA 3DDDA 3N7ZA 2Z3LA 4YGOA 4KLVA 2OZHA 4R87A 1U6MA 3E0KA 4XNHC 1YVOA 1I12A 4XPLA 3S6GA 4PK2A 4I49A 1YREA 4U9ZA 3EY5A 4KOUA 4E0AA 1Y9WA 1Y9KA 4ZBGA 2EVNA 2JEVA 5F46A 5G21A 4AVAA 2ZPAA 4FD4A 3R9FA 4C2ZA 1Z4EA 3DSBA 1RXTA 1Q2DA 4PK3A 4MY3A 2H5MA 4CYPA 3S6KA 1XEBA 1P0HA 4J3GA 3ZZIA 1YGHA 5FVJA 2Z3KA 3NE7A 4HKFA 3I3GA 3S6HA 4Y49C 3P2HA 3FXTA 3JUWA 4KOYA 1CJWA 3QAHA 2IL4A 4B14A 4MFJA 2P0WA 4XPDB 1MK4A 3D2PA 4KS9A 4JXRA 4ZGYB 4C2XA 2X7BA 3D3SA 4YFJA 3PGPA 2PSWA 5E96A 4C7HA 2CNTA 2G0BA 2Y0MA 2Q4YA 1Z9UA 2R1IA 4KLWA 2FXFA 4KUAA 1Q2CA 4YRHA 5C82A 3W91A 4ONUA 3FNCA 5GCNA 4E2AA 1WK4A 4U9YA 1R57A 4U5YA 4UWIA 3RYOA 2R8VA 1Q2YA 3P2FA 4PSWA 4UFXA 1KZFA 4JJXA 2J8NA 4A30A 4UA3A 4UFVA 3TO6A 3CXSA 4MFPA 1M4GA 2WSAA 3G8WA 5C88A 2YGWA 3C26A 5AG4A 4KSAA 4M3SA 1M1DA 4LUAA 4LX9A 4CAVA 3H4QA 3R1KA 4HNXB 2JDCA 1SQHA 3VWDA 2CXAA 5J8CA 3CXPA 3T90A 1GHEA 2BEIA 3EC4A 2FCKA 1I1DA 4CAXA 4E8OA 2Z3OA 2RC4A 4UFWA 2OZGA 5KTCA 2FT0A 3V8IA 2F5IA 4JWPA 4AVCA 4CYOA 2VBQA 4RS2A 4KOTA 1VKCA 4MFZA 3TOBA 1YVKA 2FL4A 1WWZA 1NSLA 3EXNA 4OLLA 5AG6A 2B5GA 1YK3A 3LD2A 2OZUA 4R57A 4A33A 5JPHA 3IWEA 2CY2A 2CNSA 1I21A 2BL1A 2P6GA 4KOXA 3DR6A 3GKRA 2G3AA 1Y7RA 3D2MA 1PUAA 2I00A 4AG7A 5A27A 4QB9A 2B5GB 4OADA 1LRZA 2YNCA 3IU2A 2P6EA 1CM0A 3OWCA 3A9LA 2PC1A 3R9GA 5EC4A 4F6AA 4M85A 4KVXA 4CAEA 2HV2A 4UCNA 2VXKA 2ARHA 2Z3MA 4MJ8A 5F48A 4CYQA 4UWJA 3PP9A 4CGNA 4B10A 4ORFA 5F47A 4KUBA 1VHSA 3T9YA 1MJBA 2Q7BA 4B12A 5J8FA 1QSMA 1YX0A 1S7NA 4HNYB 2HUZA 3TCVA 3BJ7A 3EO4A 1S5KA 3TE4A 1BOBA 2C27A 2FIWA 2D4PA 2ZW5A 2FS5A 2NMTA 3F0AA 4NXYA 2B4BA 1J4JA 2CNMA 3PZJA 1B87A 1S60A 5DWNA 4B13A 4XPKA 1S3ZA 1YR0A 3S6FA 1FY7A 1PU9A 3GYAA 2VZZA 2FE7A 2Z3PA 4KORA 4R3KA 4XNHB 4AG9A 5HMNA 2OU2A 3W6SA 1QSTA 2Q0YA 4IUSA 1K4JA 1RO5A 1QSOA 4CGLA 4CAFA 4NF1A 1IB1E 3DNSA 3MGDA 5CNPA 4OAEA 4B5OA 3FB3A 3KKWA 4H6ZA 2ZW6A 2ZW7A 1IIDA 2PR8A 3JVNA 1MJAA 4AVBA 4FD7A 2JLMA 5G20A 3R95A 2B3UA 2DPSA 3JTKA 1NMTA 3R9EA 1V0CA 1M4DA 2J8MA 2WUUA 4PV6A 4Q38A 4H89A 1N71A 3K9UA 5DWMA 1M4IA 2B58A 4C2YA 4NSQA 1MJ9A 4Q36A 1XMTA 4F0XA 3DR8A 4CGMA 2PR1A 2B4DB 1S7FA 3H5ZA 3EFAA 3B8GA 1TIQA 2Z11A 3I9SA 4F0YA 2HQYA 1XF8A 4MFQA 1B6BA 4JLYA 1ON0A 2DPTA 2QIRA 1KUXA 2VI7A 4KOWA 1QSRA 2EUIA 4EVYA 4R9MA 3TO9A 4X5KA 4GS4A 4QBJA 4BBHA 4R3LA 3FRMA 4KVME 3D8PA 4MY0A 5A28A 5G1ZA 5AGEA 2P6FA 2ZW4A 4CRYB 2VEZA 2D4OA 4IF5A 2A4NA 2FSRA 4MHDA 2GE3A 4MFLA 4L89A 4UBRA 5IB0A 4A95A 2ATRA 3TFYA 3R96A 2ZXVA 3WR7A 2B3VA 3TTHA 4CAWA 4C68A 4C7IA 3W6XA 1S7KA 2FIAA 3SXOA 5EBVA 4NEXA 3UY5A 3F5BA 4QC6A 2AE6A 2Q04A 4FD6A 4A2ZA 2B4DA 1S7LA 2YNDA 2AJ6A 4HNWB 3ZJ0A 5G22A 1BO4A 5F49A 2Z3NA 4II9A 4K30A 4CGPA 2I79A 2WPXA 1XE4A 4XPDC 4QVTA 1IICA 2BUEA 2GIVA 1M44A 2VZYA 1L0CA 4B11A 4MBUA 1YLEA 5H84A 2GANA 1IYKA 3CXQA 4DNCA 4QUSA 2G3TA 4UCPA 2Q4VA 4RI1A 4BMHA 4CYNA 3FBUA 3FIXA 4JD6A 2QMLA 3TOAA 1UFHA 5I0CA 4NCZA 1QSNA 4CS0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y49 B;  4CRZ B;  4H6U A;  4AB7 A;  1NE9 A;  2Q44 A;  2R7H A;  2PRB A;  3FYN A;  5IX3 A;  5ISV A;  1IYL A;  4KVO E;  3GY9 A;  1KUY A;  2PDO A;  5HH1 A;  2REE A;  2Z0Z A;  1Z4R A;  4B5P A;  3LOD A;  4L8A A;  3TT2 A;  3BJ8 A;  3SXN A;  4KOV A;  4FD5 A;  5H86 A;  3VWE A;  4PSX A;  2REF A;  1KUV A;  4B5P B;  3TO7 A;  4KZT A;  2OB0 A;  2JDD A;  2Z10 A;  3SHP A;  1XIX A;  2QEC A;  2O28 A;  2WPW A;  2VQY A;  3QB8 A;  4KOS A;  3F8K A;  3IGR A;  1P4N A;  2R98 A;  3IWG A;  1OZP A;  2PQ8 A;  3BLN A;  5JQ4 A;  5KTD A;  2DXQ A;  2K5T A;  4JXQ A;  5KTA A;  2OH1 A;  3G3S A;  2BSW A;  5IV0 A;  4MI4 A;  2J8R A;  2KCW A;  3DDD A;  3N7Z A;  4YGO A;  4KLV A;  2OZH A;  4R87 A;  1U6M A;  3E0K A;  4XNH C;  1YVO A;  1I12 A;  4XPL A;  3S6G A;  4PK2 A;  4I49 A;  1YRE A;  4U9Z A;  3EY5 A;  4KOU A;  4E0A A;  1Y9W A;  1Y9K A;  4ZBG A;  2EVN A;  2JEV A;  5F46 A;  4AVA A;  2ZPA A;  4FD4 A;  3R9F A;  1Z4E A;  3DSB A;  1RXT A;  1Q2D A;  4PK3 A;  4MY3 A;  2H5M A;  3S6K A;  1XEB A;  1P0H A;  4J3G A;  3ZZI A;  1YGH A;  5FVJ A;  3NE7 A;  4HKF A;  3I3G A;  3S6H A;  4Y49 C;  3P2H A;  3FXT A;  3JUW A;  4KOY A;  1CJW A;  3QAH A;  2IL4 A;  4XPD B;  2P0W A;  1MK4 A;  3D2P A;  4JXR A;  2X7B A;  3D3S A;  4YFJ A;  3PGP A;  2PSW A;  5E96 A;  2CNT A;  2G0B A;  2Y0M A;  2Q4Y A;  1Z9U A;  2R1I A;  4KLW A;  2FXF A;  4KUA A;  1Q2C A;  4YRH A;  5C82 A;  3W91 A;  4ONU A;  3FNC A;  5GCN A;  4E2A A;  1WK4 A;  4U9Y A;  1R57 A;  4U5Y A;  4UWI A;  3RYO A;  2R8V A;  1Q2Y A;  4PSW A;  3P2F A;  1KZF A;  4JJX A;  2J8N A;  4UA3 A;  3TO6 A;  3CXS A;  1M4G A;  3G8W A;  5C88 A;  3C26 A;  4M3S A;  1M1D A;  4LUA A;  4LX9 A;  4CAV A;  3H4Q A;  3R1K A;  4HNX B;  2JDC A;  1SQH A;  3VWD A;  5J8C A;  3CXP A;  3T90 A;  1GHE A;  2BEI A;  3EC4 A;  2FCK A;  1I1D A;  4CAX A;  4E8O A;  2RC4 A;  2OZG A;  5KTC A;  2FT0 A;  3V8I A;  2F5I A;  4JWP A;  4AVC A;  2VBQ A;  4RS2 A;  4KOT A;  1VKC A;  3TOB A;  1YVK A;  2FL4 A;  1WWZ A;  1NSL A;  3EXN A;  4OLL A;  2B5G A;  1YK3 A;  3LD2 A;  2OZU A;  4R57 A;  5JPH A;  2CY2 A;  2CNS A;  1I21 A;  2BL1 A;  2P6G A;  4KOX A;  3DR6 A;  3GKR A;  2G3A A;  1Y7R A;  3D2M A;  1PUA A;  2I00 A;  4AG7 A;  4QB9 A;  2B5G B;  4OAD A;  1LRZ A;  2P6E A;  1CM0 A;  3OWC A;  2PC1 A;  3R9G A;  5EC4 A;  4F6A A;  4M85 A;  4KVX A;  2HV2 A;  2VXK A;  2ARH A;  4MJ8 A;  5F48 A;  4UWJ A;  3PP9 A;  4ORF A;  5F47 A;  4KUB A;  1VHS A;  3T9Y A;  1MJB A;  2Q7B A;  5J8F A;  1QSM A;  1YX0 A;  1S7N A;  4HNY B;  2HUZ A;  3TCV A;  3BJ7 A;  3EO4 A;  1S5K A;  3TE4 A;  1BOB A;  2C27 A;  2FIW A;  2D4P A;  2ZW5 A;  2FS5 A;  2NMT A;  3F0A A;  4NXY A;  2B4B A;  1J4J A;  2CNM A;  3PZJ A;  1B87 A;  1S60 A;  5DWN A;  4XPK A;  1S3Z A;  1YR0 A;  3S6F A;  1FY7 A;  1PU9 A;  3GYA A;  2VZZ A;  2FE7 A;  4KOR A;  4R3K A;  4XNH B;  4AG9 A;  5HMN A;  2OU2 A;  3W6S A;  1QST A;  2Q0Y A;  4IUS A;  1K4J A;  1RO5 A;  1QSO A;  4NF1 A;  1IB1 E;  3DNS A;  3MGD A;  5CNP A;  4OAE A;  4B5O A;  3FB3 A;  3KKW A;  4H6Z A;  2ZW6 A;  2ZW7 A;  1IID A;  2PR8 A;  3JVN A;  1MJA A;  4AVB A;  4FD7 A;  2JLM A;  3R95 A;  2B3U A;  1NMT A;  3R9E A;  1V0C A;  1M4D A;  2J8M A;  4PV6 A;  4H89 A;  1N71 A;  3K9U A;  5DWM A;  1M4I A;  2B58 A;  4NSQ A;  1MJ9 A;  1XMT A;  3DR8 A;  2PR1 A;  2B4D B;  1S7F A;  3EFA A;  3B8G A;  1TIQ A;  2Z11 A;  3I9S A;  4F0Y A;  2HQY A;  1XF8 A;  1B6B A;  4JLY A;  1ON0 A;  2QIR A;  1KUX A;  2VI7 A;  4KOW A;  1QSR A;  2EUI A;  4EVY A;  4R9M A;  3TO9 A;  4X5K A;  4GS4 A;  4QBJ A;  4R3L A;  3FRM A;  4KVM E;  3D8P A;  4MY0 A;  2P6F A;  2ZW4 A;  4CRY B;  2VEZ A;  2D4O A;  4IF5 A;  2A4N A;  2FSR A;  4MHD A;  2GE3 A;  4L89 A;  4UBR A;  5IB0 A;  2ATR A;  3TFY A;  3R96 A;  2ZXV A;  3WR7 A;  2B3V A;  3TTH A;  4CAW A;  3W6X A;  1S7K A;  2FIA A;  3SXO A;  5EBV A;  4NEX A;  3UY5 A;  3F5B A;  4QC6 A;  2AE6 A;  2Q04 A;  4FD6 A;  2B4D A;  1S7L A;  2AJ6 A;  4HNW B;  3ZJ0 A;  1BO4 A;  5F49 A;  4II9 A;  4K30 A;  2I79 A;  2WPX A;  1XE4 A;  4XPD C;  4QVT A;  1IIC A;  2BUE A;  2GIV A;  1M44 A;  2VZY A;  1L0C A;  4MBU A;  1YLE A;  5H84 A;  2GAN A;  1IYK A;  3CXQ A;  4DNC A;  4QUS A;  2G3T A;  2Q4V A;  4RI1 A;  4BMH A;  3FBU A;  3FIX A;  4JD6 A;  2QML A;  3TOA A;  1UFH A;  5I0C A;  4NCZ A;  1QSN A;  4CS0 B; 
#chains in the Genus database with same CATH topology
 4Y49 B;  2ZEH A;  2PJ2 A;  2HC9 A;  2PJ9 A;  4UCM A;  4CRZ B;  4H6U A;  4AB7 A;  3FJU A;  1NE9 A;  1R3N A;  2Q44 A;  2R7H A;  2PRB A;  3D66 A;  2NSM A;  3FYN A;  4MFK A;  4CGO A;  1ZO0 A;  1ELL P;  5IX3 A;  2YNE A;  4PXB A;  3FX6 A;  2PIY A;  7CPA A;  4PXE A;  5ISV A;  1IYL A;  4KVO E;  3SI2 A;  3GY9 A;  1KUY A;  2PDO A;  4NGN A;  5HH1 A;  2REE A;  2AFX A;  2Z0Z A;  1Z4R A;  4B5P A;  3LOD A;  4L8A A;  4WJB A;  3KGQ A;  3TT2 A;  3BJ8 A;  3SXN A;  1QQ9 A;  3D7G A;  5BWA B;  4KOV A;  1CX8 A;  3ISX A;  1UWY A;  4FD5 A;  5H86 A;  3VWE A;  5AG5 A;  1RTQ A;  4A32 A;  4PSX A;  2REF A;  3S9M A;  1KUV A;  4B5P B;  2C6P A;  4A31 A;  4KSF A;  3TO7 A;  4OID A;  4KZT A;  2OB0 A;  2JBK A;  4YGO A;  4A37 A;  2JDD A;  5K8O A;  2Z10 A;  3GIU A;  3PFO A;  5DS0 A;  3SJX A;  1BPM A;  4ZY1 A;  1HDQ A;  2FVG A;  3SHP A;  4OC0 A;  1XIX A;  3H8G A;  2ZEE A;  2QEC A;  2O28 A;  1VHO A;  2WPW A;  3IU1 A;  2YNC C;  4WWV A;  2VQY A;  1AMP A;  3KI9 A;  3QB8 A;  3F8K A;  2AFO A;  3IGR A;  4KOS A;  3CPA A;  3RNZ A;  2PJA A;  1P4N A;  4Q7A A;  2R98 A;  3IWG A;  3LAC A;  1LAN A;  4MHY A;  1JWQ A;  1OZP A;  1PCA A;  4OC4 A;  1VIX A;  2PQ8 A;  3BLN A;  5JQ4 A;  5KTD A;  2DXQ A;  2K5T A;  4JXQ A;  5KTA A;  1Z8W A;  2OH1 A;  1X12 A;  3G3S A;  4P10 A;  4P4E A;  2PVV A;  5AG7 A;  3SI0 A;  3TC8 A;  4UEF A;  2BSW A;  5IV0 A;  4EME A;  4MI4 A;  2J8R A;  2KCW A;  3DDD A;  3N7Z A;  3BXM A;  2Z3L A;  3ISZ A;  2PJ4 A;  2ZEN A;  4KLV A;  4UF4 A;  2OZH A;  4R87 A;  1U6M A;  3E0K A;  4XNH C;  1YVO A;  1I12 A;  4XPL A;  3S6G A;  1CBX A;  4I49 A;  4PK2 A;  5HXD A;  1YRE A;  4U9Z A;  3EY5 A;  4AXV A;  4KOU A;  4E0A A;  1Y9W A;  4G1P A;  4F8Z A;  1Y9K A;  4ZBG A;  2EVN A;  2JEV A;  5F46 A;  1Y0R A;  4NGR A;  2ZEP A;  4OME A;  3KHX A;  2PJ5 A;  2I3C A;  5G21 A;  4AVA A;  4BIN A;  3KZW A;  2ZPA A;  4FD4 A;  3R9F A;  2AFU A;  4C2Z A;  2PJC A;  1Z4E A;  3DSB A;  1RXT A;  5JH9 A;  1TKH A;  1Q2D A;  3B3W A;  4LQG A;  4PK3 A;  4JYW A;  1LFW A;  3SI1 A;  4MY3 A;  2H5M A;  4HPS A;  3S6K A;  1XEB A;  2AFZ A;  4CYP A;  1P0H A;  2C6C A;  2XEF A;  3VAT A;  4J3G A;  3ZZI A;  1YGH A;  4NGM A;  4R6T A;  2Z3K A;  1YME A;  3KHZ A;  3NE7 A;  5FVJ A;  4HKF A;  2DEA A;  2O53 A;  3SJG A;  3I3G A;  3S6H A;  4A39 A;  2ZEM A;  4Y49 C;  3P2H A;  3FXT A;  3JUW A;  4KOY A;  4F9U A;  2GLF A;  3WT4 A;  1CJW A;  2GRE A;  3QAH A;  4ZYQ A;  4DYO A;  2IL4 A;  4B14 A;  4MFJ A;  2P0W A;  4XPD B;  1MK4 A;  3D2P A;  4KS9 A;  5K8M A;  3PBE A;  4JXR A;  1YSJ A;  4ZGY B;  4C2X A;  2X7B A;  3D3S A;  4PPZ A;  3H8F A;  4PQA A;  2ZOG A;  4YFJ A;  3MN8 A;  2PJ1 A;  1CPS A;  1TKJ A;  3NE8 A;  2Q4Z A;  3PGP A;  2PSW A;  5E96 A;  4C7H A;  2CNT A;  2G0B A;  2Y0M A;  5EMI A;  3D67 A;  2Q4Y A;  1Z9U A;  2R1I A;  4KLW A;  4FUU A;  5LYD A;  2FXF A;  3K2K A;  4LQ6 A;  4KUA A;  4P4I A;  1CP6 A;  1Q2C A;  3RZA A;  4YRH A;  1QMU A;  4P4D A;  5I4M A;  3GLJ A;  5C82 A;  3W91 A;  4BD9 A;  4W9Y A;  4M6I A;  4ONU A;  3FNC A;  1F57 A;  5GCN A;  5LRJ A;  4R76 A;  4E2A A;  1WK4 A;  4U9Y A;  1M4L A;  1R57 A;  4U5Y A;  4UWI A;  5D29 A;  3RYO A;  3DGV A;  2R8V A;  1Q2Y A;  3P2F A;  4PSW A;  3IIB A;  2BO9 A;  4UFX A;  3PB7 X;  1VGY A;  1TF8 A;  3B3C A;  4YWY A;  1KZF A;  2VL1 A;  2ZOF A;  3GB0 A;  4JJX A;  2J8N A;  4A30 A;  4UA3 A;  4UFV A;  3TO6 A;  3IWW A;  3BI0 A;  3CXS A;  4MFP A;  2ODF A;  1M4G A;  2WSA A;  2ZED A;  3G8W A;  2PJ6 A;  5C88 A;  2YGW A;  2PRQ A;  3C26 A;  5AG4 A;  1BLL E;  4KSA A;  1M1D A;  4LUA A;  4LX9 A;  4M3S A;  4CAV A;  3H4Q A;  2EBJ A;  3R1K A;  2V8G A;  4HNX B;  2JDC A;  2HB6 A;  1SQH A;  3VWD A;  3JRU A;  2J9A A;  3VAR A;  2CXA A;  1ELM P;  2OOT A;  5J8C A;  3CXP A;  3T90 A;  1GHE A;  4ZX8 A;  2BEI A;  3EC4 A;  1ZG7 A;  2FCK A;  4X8I A;  1I1D A;  4CAX A;  4E8O A;  4OIW A;  2Z3O A;  1Z5R A;  2RC4 A;  2OZG A;  3NA6 A;  4UFW A;  5KTC A;  2FT0 A;  1IU8 A;  1IOI A;  3V8I A;  2F5I A;  4JWP A;  2C1C A;  4MRI A;  2PIZ A;  4AVC A;  4CYO A;  4A38 A;  2VBQ A;  2XEJ A;  4RS2 A;  1DE4 C;  3PB4 X;  1VKC A;  4KOT A;  4MFZ A;  3TOB A;  2ZEF A;  2IJZ A;  1YVK A;  2FL4 A;  3QAY A;  4PXC A;  4DJL A;  4NGS A;  3H8E A;  1WWZ A;  1NSL A;  3MRU A;  3EXN A;  4OLL A;  5AG6 A;  3NH5 A;  3FH4 A;  5THW A;  3B3S A;  2B5G A;  1YK3 A;  4NFR A;  3LD2 A;  2OZU A;  2BOA A;  2ZEO A;  3CPX A;  4R57 A;  1HDU A;  4A33 A;  3FEC A;  4IAV A;  5JPH A;  2AFS A;  3IWE A;  2CY2 A;  4R7M A;  2CNS A;  1I21 A;  3K9T A;  2BL1 A;  3FED A;  1XMB A;  2P6G A;  4KOX A;  3DR6 A;  3FMC A;  5K8P A;  3GKR A;  2G3A A;  4P4F A;  1Y7R A;  3BI1 A;  5LRK A;  3D2M A;  1PUA A;  1Z2L A;  2I00 A;  4AG7 A;  5A27 A;  1XBU A;  4QB9 A;  2B5G B;  4OAD A;  4H2K A;  1LRZ A;  2YNC A;  3IU2 A;  2P6E A;  1CM0 A;  3PB6 X;  2PE3 A;  3A9L A;  3OWC A;  3B2Y A;  4MMO A;  2O4H A;  4OC3 A;  3D7F A;  4R8F A;  1BAV A;  2PC1 A;  3FEE A;  3R9G A;  2PVW A;  2WYR A;  2Q43 A;  1A2Z A;  3B7I A;  2ANP A;  3NH8 A;  5EC4 A;  1TXR A;  4M85 A;  1F2O A;  3HLP A;  4F6A A;  2ABZ A;  4KVX A;  4CAE A;  2HV2 A;  2V77 A;  4UCN A;  2VXK A;  2ARH A;  2Z3M A;  3IO1 A;  4MJ8 A;  4MCQ A;  4RN7 A;  5F48 A;  4CYQ A;  1IGB A;  4UWJ A;  1YQE A;  3PP9 A;  1Q7L A;  4CGN A;  5IB9 A;  4B10 A;  4ORF A;  1R43 A;  5F47 A;  4MXU A;  4KUB A;  1VHS A;  3T9Y A;  1MJB A;  3IC1 A;  2Q7B A;  4B12 A;  2Q51 A;  5J8F A;  1QSM A;  3NFZ A;  1YX0 A;  1S7N A;  1Z8X A;  2JBJ A;  4HNY B;  2HUZ A;  3TCV A;  5HVG A;  3BJ7 A;  1OBR A;  1S5K A;  3EO4 A;  3TE4 A;  1BOB A;  2C27 A;  2AFW A;  2D4P A;  2FIW A;  2ZEL A;  2ZW5 A;  3WAB A;  4O23 A;  2FS5 A;  2NMT A;  3F0A A;  4NXY A;  2B4B A;  3RO0 A;  1J4J A;  2CNM A;  2Q7S A;  2PJ3 A;  1B87 A;  3PZJ A;  1S60 A;  1DTD A;  3KR4 A;  5DWN A;  4B13 A;  1ARM A;  4XPK A;  1H8L A;  1S3Z A;  1YR0 A;  3S6F A;  1FY7 A;  2PJ7 A;  3BHX A;  1PU9 A;  2EO8 A;  2NYQ A;  2VZZ A;  3GYA A;  3KL9 A;  3L2N A;  2FE7 A;  2Z3P A;  4KOR A;  4P45 A;  4IHM A;  4UEZ A;  4EWT A;  4FWU A;  4P4J A;  4R3K A;  4XNH B;  4NJR A;  4TWE A;  4AG9 A;  3QNV A;  5HMN A;  5D8N A;  4ZX9 A;  1VHE A;  2OU2 A;  5F09 A;  5LRG A;  3N5F A;  3W6S A;  4A94 A;  1LOK A;  1QST A;  2Q0Y A;  4IUS A;  4X2T A;  1K4J A;  5CPA A;  1HEE A;  1RO5 A;  1YW4 A;  1QSO A;  3SJF A;  4CGL A;  3PEI A;  1TF9 A;  2XEG A;  3KQZ A;  4CAF A;  5LYL A;  3WC7 A;  4NF1 A;  3RBU A;  1IB1 E;  1YLO A;  3DNS A;  3MGD A;  1NSA A;  5CBM A;  5CNP A;  4OAE A;  4B5O A;  3FB3 A;  3KKW A;  2GLJ A;  3DLJ A;  2BCO A;  2ZW6 A;  2ZW7 A;  4H6Z A;  1IID A;  2GU2 A;  2PR8 A;  3JVN A;  1MJA A;  4AVB A;  4FD7 A;  1F2P A;  2JLM A;  5G20 A;  4P4B A;  1FNO A;  5LYI A;  4UIA A;  3R95 A;  3GUX A;  5LYF A;  3B35 A;  2B3U A;  1YW6 A;  2DPS A;  3D7D A;  1KWM A;  3FF3 A;  3JTK A;  5K8N A;  4GXH A;  1NMT A;  3R9E A;  2OR4 A;  3B3V A;  1XRY A;  4JZ0 A;  3S9N A;  1IY7 A;  1M4D A;  1V0C A;  2J8M A;  3TX8 A;  2WUU A;  4PV6 A;  4EFD A;  4Q38 A;  3CDX A;  4H89 A;  5JGF A;  1N71 A;  3KR5 A;  2EK8 A;  3K9U A;  5DWM A;  1M4I A;  1AUG A;  4MCR A;  2B58 A;  4C2Y A;  4NSQ A;  4FBE A;  1MJ9 A;  4Q36 A;  1XMT A;  4MCP A;  4F0X A;  1JQG A;  1ZG9 A;  3DR8 A;  4CGM A;  3PB9 X;  2PR1 A;  8CPA A;  2CF4 A;  2B4D B;  1S7F A;  3EFA A;  3H5Z A;  2IQ6 A;  3B8G A;  1TIQ A;  4PXD A;  2F7V A;  2Z11 A;  4FAI A;  3I9S A;  4F0Y A;  2HQY A;  3LMS A;  4ONW A;  1XF8 A;  4CPA A;  3B3T A;  2QYV A;  3FVL A;  3S9L A;  4MFQ A;  2V8H A;  1ZLI A;  1B6B A;  4JLY A;  1X10 A;  1ON0 A;  6CPA A;  3IJ3 A;  4OC1 A;  1IOF A;  2EWB A;  3V7Z A;  1XJO A;  2DPT A;  2XEI A;  2QIR A;  1KUX A;  2VI7 A;  4KOW A;  2V8D A;  1QSR A;  2EUI A;  1XOV A;  4EVY A;  4DUK A;  1XFO A;  2ZEG A;  1EE3 P;  1Z8T A;  4R9M A;  3TO9 A;  4X5K A;  4GS4 A;  2QJ8 A;  4BBH A;  4QBJ A;  1BPN A;  2DF5 A;  4R3L A;  2PJ8 A;  3FRM A;  4KVM E;  3D8P A;  4MY0 A;  5A28 A;  4YU9 A;  5G1Z A;  5AGE A;  1CP7 A;  4NJQ A;  2P6F A;  4Z65 A;  2POK A;  2ZW4 A;  4CRY B;  4KSI A;  4RUH A;  2VEZ A;  2D4O A;  5JM6 A;  4IF5 A;  1ZG8 A;  2A4N A;  2FSR A;  3HUV A;  4MHD A;  4OP4 A;  3SJE A;  4OKO A;  2GE3 A;  4MFL A;  1AYE A;  4L89 A;  4UBR A;  5IB0 A;  4A95 A;  2ATR A;  3TFY A;  1TKF A;  3R96 A;  2ZXV A;  3KAS A;  3WR7 A;  4B6Z A;  2B3V A;  3WC5 A;  1Z8L A;  1PYT B;  4K3N A;  3TTH A;  3D68 A;  4C68 A;  4C7I A;  3V38 A;  1FT7 A;  4CAW A;  2CIJ A;  3W6X A;  1S7K A;  2FIA A;  1CPX A;  2CTC A;  2F8H A;  2V8V A;  2G9D A;  3SXO A;  5EBV A;  3T8W A;  5HVH A;  4NEX A;  3PB8 X;  3UY5 A;  3F5B A;  3PFE A;  4MHN A;  3WC6 A;  4QC6 A;  2PJ0 A;  2AE6 A;  2Q04 A;  4ZY2 A;  4FD6 A;  4A2Z A;  2B4D A;  2JEW A;  1S7L A;  2C6G A;  2YND A;  1Y0Y A;  2AJ6 A;  2PJB A;  4HNW B;  4OC5 A;  3ZJ0 A;  3KQX A;  2IMO A;  5G22 A;  3IFE A;  1BO4 A;  3CZX A;  5F49 A;  2QVP A;  1Y7E A;  2Z3N A;  2RB7 A;  2EK9 A;  4NGT A;  4II9 A;  3RAM A;  4K30 A;  4MHZ A;  4CGP A;  2I79 A;  2WPX A;  4ZY0 A;  3NH4 A;  1XE4 A;  1GYT A;  5HVF A;  4XPD C;  5ELY A;  4P44 A;  3D7H A;  4QVT A;  1IIC A;  4GM5 A;  1ARL A;  4TNU A;  1LAM A;  3VH9 A;  2BUE A;  4IK2 A;  2CTB A;  2GIV A;  1M44 A;  2VZY A;  2WZN A;  3CT9 A;  4NGQ A;  1L0C A;  4B11 A;  3IEH A;  4MBU A;  1CG2 A;  4X3R A;  1YLE A;  4MCS A;  3D4U A;  2GAN A;  5H84 A;  1IYK A;  5J1Q A;  2AFM A;  3CXQ A;  4DNC A;  1LCP A;  2G3T A;  4QUS A;  4UCP A;  2Q4V A;  1LAP A;  2RFH A;  4M6G A;  4NGP A;  4RI1 A;  3PBB A;  1ZLH A;  4UIB A;  4M6H A;  4BMH A;  4MHP A;  4CYN A;  3FBU A;  3FIX A;  4JD6 A;  4OC2 A;  4UEE A;  3I1U A;  2QML A;  3LWU A;  3PRT A;  4F9V A;  4P6Y A;  2PCU A;  1UFH A;  3TOA A;  2GFQ A;  5I0C A;  4ZI6 A;  4NCZ A;  1QSN A;  4CS0 B; 
#chains in the Genus database with same CATH homology
 4Y49 B;  4UCM A;  4CRZ B;  4H6U A;  4AB7 A;  1NE9 A;  2Q44 A;  2R7H A;  2PRB A;  3FYN A;  4MFK A;  4CGO A;  1ZO0 A;  5IX3 A;  2YNE A;  5ISV A;  1IYL A;  4KVO E;  3GY9 A;  1KUY A;  2PDO A;  5HH1 A;  2REE A;  2Z0Z A;  1Z4R A;  4B5P A;  3LOD A;  4L8A A;  3TT2 A;  3BJ8 A;  3SXN A;  5BWA B;  4KOV A;  4FD5 A;  5H86 A;  4A32 A;  3VWE A;  5AG5 A;  4PSX A;  2REF A;  1KUV A;  4B5P B;  4A31 A;  4KSF A;  3TO7 A;  4KZT A;  2OB0 A;  2JDD A;  2Z10 A;  3SHP A;  1XIX A;  2QEC A;  2O28 A;  2WPW A;  3IU1 A;  2YNC C;  2VQY A;  3QB8 A;  4KOS A;  3F8K A;  3IGR A;  1P4N A;  2R98 A;  3IWG A;  1OZP A;  2PQ8 A;  3BLN A;  5JQ4 A;  5KTD A;  2DXQ A;  2K5T A;  4JXQ A;  5KTA A;  2OH1 A;  3G3S A;  5AG7 A;  2BSW A;  5IV0 A;  4MI4 A;  2J8R A;  2KCW A;  3DDD A;  3N7Z A;  2Z3L A;  4YGO A;  4KLV A;  2OZH A;  4R87 A;  1U6M A;  3E0K A;  4XNH C;  1YVO A;  1I12 A;  4XPL A;  3S6G A;  4PK2 A;  4I49 A;  1YRE A;  4U9Z A;  3EY5 A;  4KOU A;  4E0A A;  1Y9W A;  1Y9K A;  4ZBG A;  2EVN A;  2JEV A;  5F46 A;  5G21 A;  4AVA A;  2ZPA A;  4FD4 A;  3R9F A;  4C2Z A;  1Z4E A;  3DSB A;  1RXT A;  1Q2D A;  4PK3 A;  4MY3 A;  2H5M A;  4CYP A;  3S6K A;  1XEB A;  1P0H A;  4J3G A;  3ZZI A;  1YGH A;  5FVJ A;  2Z3K A;  3NE7 A;  4HKF A;  3I3G A;  3S6H A;  4Y49 C;  3P2H A;  3FXT A;  3JUW A;  4KOY A;  1CJW A;  3QAH A;  2IL4 A;  4B14 A;  4MFJ A;  2P0W A;  4XPD B;  1MK4 A;  3D2P A;  4KS9 A;  4JXR A;  4ZGY B;  4C2X A;  2X7B A;  3D3S A;  4YFJ A;  3PGP A;  2PSW A;  5E96 A;  4C7H A;  2CNT A;  2G0B A;  2Y0M A;  2Q4Y A;  1Z9U A;  2R1I A;  4KLW A;  2FXF A;  4KUA A;  1Q2C A;  4YRH A;  5C82 A;  3W91 A;  4ONU A;  3FNC A;  5GCN A;  4E2A A;  1WK4 A;  4U9Y A;  1R57 A;  4U5Y A;  4UWI A;  3RYO A;  2R8V A;  1Q2Y A;  3P2F A;  4PSW A;  4UFX A;  1KZF A;  4JJX A;  2J8N A;  4A30 A;  4UA3 A;  4UFV A;  3TO6 A;  3CXS A;  4MFP A;  1M4G A;  2WSA A;  3G8W A;  5C88 A;  2YGW A;  3C26 A;  5AG4 A;  4KSA A;  4M3S A;  1M1D A;  4LUA A;  4LX9 A;  4CAV A;  3H4Q A;  3R1K A;  4HNX B;  2JDC A;  1SQH A;  3VWD A;  2CXA A;  5J8C A;  3CXP A;  3T90 A;  1GHE A;  2BEI A;  3EC4 A;  2FCK A;  1I1D A;  4CAX A;  4E8O A;  2Z3O A;  2RC4 A;  4UFW A;  2OZG A;  5KTC A;  2FT0 A;  3V8I A;  2F5I A;  4JWP A;  4AVC A;  4CYO A;  2VBQ A;  4RS2 A;  4KOT A;  1VKC A;  4MFZ A;  3TOB A;  1YVK A;  2FL4 A;  1WWZ A;  1NSL A;  3EXN A;  4OLL A;  5AG6 A;  2B5G A;  1YK3 A;  3LD2 A;  2OZU A;  4R57 A;  4A33 A;  5JPH A;  3IWE A;  2CY2 A;  2CNS A;  1I21 A;  2BL1 A;  2P6G A;  4KOX A;  3DR6 A;  3GKR A;  2G3A A;  1Y7R A;  3D2M A;  1PUA A;  2I00 A;  4AG7 A;  5A27 A;  4QB9 A;  2B5G B;  4OAD A;  1LRZ A;  2YNC A;  3IU2 A;  2P6E A;  1CM0 A;  3OWC A;  3A9L A;  2PC1 A;  3R9G A;  5EC4 A;  4F6A A;  4M85 A;  4KVX A;  4CAE A;  2HV2 A;  4UCN A;  2VXK A;  2ARH A;  2Z3M A;  4MJ8 A;  5F48 A;  4CYQ A;  4UWJ A;  3PP9 A;  4CGN A;  4B10 A;  4ORF A;  5F47 A;  4KUB A;  1VHS A;  3T9Y A;  1MJB A;  2Q7B A;  4B12 A;  5J8F A;  1QSM A;  1YX0 A;  1S7N A;  4HNY B;  2HUZ A;  3TCV A;  3BJ7 A;  3EO4 A;  1S5K A;  3TE4 A;  1BOB A;  2C27 A;  2FIW A;  2D4P A;  2ZW5 A;  2FS5 A;  2NMT A;  3F0A A;  4NXY A;  2B4B A;  1J4J A;  2CNM A;  3PZJ A;  1B87 A;  1S60 A;  5DWN A;  4B13 A;  4XPK A;  1S3Z A;  1YR0 A;  3S6F A;  1FY7 A;  1PU9 A;  3GYA A;  2VZZ A;  2FE7 A;  2Z3P A;  4KOR A;  4R3K A;  4XNH B;  4AG9 A;  5HMN A;  2OU2 A;  3W6S A;  1QST A;  2Q0Y A;  4IUS A;  1K4J A;  1RO5 A;  1QSO A;  4CGL A;  4CAF A;  4NF1 A;  1IB1 E;  3DNS A;  3MGD A;  5CNP A;  4OAE A;  4B5O A;  3FB3 A;  3KKW A;  4H6Z A;  2ZW6 A;  2ZW7 A;  1IID A;  2PR8 A;  3JVN A;  1MJA A;  4AVB A;  4FD7 A;  2JLM A;  5G20 A;  3R95 A;  2B3U A;  2DPS A;  3JTK A;  1NMT A;  3R9E A;  1V0C A;  1M4D A;  2J8M A;  2WUU A;  4PV6 A;  4Q38 A;  4H89 A;  1N71 A;  3K9U A;  5DWM A;  1M4I A;  2B58 A;  4C2Y A;  4NSQ A;  1MJ9 A;  4Q36 A;  1XMT A;  4F0X A;  3DR8 A;  4CGM A;  2PR1 A;  2B4D B;  1S7F A;  3H5Z A;  3EFA A;  3B8G A;  1TIQ A;  2Z11 A;  3I9S A;  4F0Y A;  2HQY A;  1XF8 A;  4MFQ A;  1B6B A;  4JLY A;  1ON0 A;  2DPT A;  2QIR A;  1KUX A;  2VI7 A;  4KOW A;  1QSR A;  2EUI A;  4EVY A;  4R9M A;  3TO9 A;  4X5K A;  4GS4 A;  4QBJ A;  4BBH A;  4R3L A;  3FRM A;  4KVM E;  3D8P A;  4MY0 A;  5A28 A;  5G1Z A;  5AGE A;  2P6F A;  2ZW4 A;  4CRY B;  2VEZ A;  2D4O A;  4IF5 A;  2A4N A;  2FSR A;  4MHD A;  2GE3 A;  4MFL A;  4L89 A;  4UBR A;  5IB0 A;  4A95 A;  2ATR A;  3TFY A;  3R96 A;  2ZXV A;  3WR7 A;  2B3V A;  3TTH A;  4CAW A;  4C68 A;  4C7I A;  3W6X A;  1S7K A;  2FIA A;  3SXO A;  5EBV A;  4NEX A;  3UY5 A;  3F5B A;  4QC6 A;  2AE6 A;  2Q04 A;  4FD6 A;  4A2Z A;  2B4D A;  1S7L A;  2YND A;  2AJ6 A;  4HNW B;  3ZJ0 A;  5G22 A;  1BO4 A;  5F49 A;  2Z3N A;  4II9 A;  4K30 A;  4CGP A;  2I79 A;  2WPX A;  1XE4 A;  4XPD C;  4QVT A;  1IIC A;  2BUE A;  2GIV A;  1M44 A;  2VZY A;  1L0C A;  4B11 A;  4MBU A;  1YLE A;  5H84 A;  2GAN A;  1IYK A;  3CXQ A;  4DNC A;  4QUS A;  2G3T A;  4UCP A;  2Q4V A;  4RI1 A;  4BMH A;  4CYN A;  3FBU A;  3FIX A;  4JD6 A;  2QML A;  3TOA A;  1UFH A;  5I0C A;  4NCZ A;  1QSN A;  4CS0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...