4CSQA

Nmr solution structure of pa3793 from pseudomonas aeruginosa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSHMTTQRYLLDELETADMLEIDGLHAWRFELNENLLDQADLAAEADQPFASEDWVLAVESLDGRTRREWRFSYNAVMEAEPQADGESWRLTTGEGAYQLRCLGAVSASGEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Pa3793 from Pseudomonas
rcsb
molecule keywords UNCHARACTERIZED PROTEIN
molecule tags Structural protein
source organism Pseudomonas aeruginosa
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18629 DUF5629 Family of unknown function (DUF5629)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.190 Mainly Beta Roll PH-domain like PH-domain like 4csqA00
4CSQA
chains in the Genus database with same CATH superfamily
2EMTA 4ZRKA 1N3HA 3P6AA 1WG7A 1V61A 5FI1A 2RLOA 4K81A 1ZC3B 3U12A 2ZKMX 2W2WA 4D0NB 1P6SA 2KIEA 1GC7A 3WYFB 1X05A 2ROZB 3BJIA 3O96A 2DKPA 5J3YA 2MDXA 2OQBA 2DFKA 4QJ4B 4MY6A 2GS0A 1FHOA 5DI9B 1KZGA 2KUPA 3WA0A 3DXCA 2D9WA 2I5FA 1WGUA 1DBHA 3ZVRA 3KY9A 1LW3A 2D9VA 3B77A 1XD4A 2LKOA 4WSFA 1W1HA 1XX0A 2X18A 2Z0QA 1V89A 2Z13A 3F5RA 4WVFB 3DXEA 2KUQA 4GPTB 1XODA 5JHGA 2R0DA 2J0MA 2I1KA 4F7GA 2H7EA 1PLSA 2DHKA 2HE7A 1MKEA 4KVGB 1KZ7A 2DX1A 1AWEA 2VKIA 5D3WA 2GCJA 1X86A 3T06A 3QIJA 1T77A 2D9XA 2NBVA 4PQ0A 1I2HA 1U5GA 2YS1A 2H7DA 3U8ZA 3OANA 2P0HA 1NU2A 1WJ1A 1DDMA 2L2IA 1WVHA 2PZ1A 4ZRIA 2I1JA 4L1RA 3LJUX 1I7AA 3QWMA 1SHCA 1FAOA 3RCPA 1PFJA 2VSZA 5DHFB 2M38A 4L6EA 1U5DA 5J3TA 1BWNA 5HE1A 2YF0A 2R09A 5LONB 3ZDTA 3DCXA 5C5BB 2D4QA 4ZRJA 2P0DA 4QJ3B 2DN6A 2UVMA 4HDOA 2L1CA 2EMSA 5I2MA 3UZTA 4A5KA 2MKRA 2YS5A 2CODA 2Y8FA 3G9WA 3TFMA 2LOXA 1FHXA 2P0FA 1W1GA 2YVCA 2JP2A 2RRFA 1X1GA 3GYPA 5JP4A 3HQCA 1UNRA 3SV1A 1ZVRA 3VIAA 1WGQA 2COCA 2R2YA 1GC6A 1DDWA 5M4YB 1XR0B 3A58A 2ADZA 4GMVA 3ML4A 5C6RA 4GN1A 1TQZA 5GOWB 2D2QA 1EF1A 1MPHA 1K5DB 1U5FA 5LOPB 2RUKB 4HB3B 1FB8A 5IRSA 2E2XA 4K2OA 2DHJA 2FJLA 2RGNB 1NTYA 2NZ8B 1V5MA 1H10A 5DIFB 2K8EA 1P5TA 2W2XD 1EGXA 4B6HA 1ZC4B 2Y8GA 4HAYB 3CIKA 2YT0A 3HIEA 1UPRA 2DKQA 4GOUA 2YS3A 3ODXA 3KZ1A 2DLWA 3TVVA 3OHMB 1MK7B 2UZSA 3SNHA 3TCAA 3P7ZA 1FGZA 2DYNA 2FJUB 4F7HA 2AEHA 5DHAB 1TJ6A 1Y19B 1DROA 2DA0A 4OSNA 2IFSA 5JHHA 5KCVA 4TYZA 2Z4DA 4HHVA 4MT7A 4DXAB 2CY5A 2VRWB 4YL8A 1AQCA 4CYEA 3FM8C 2LG1A 2UZRA 1J19A 2GCLA 1P3RA 4HAZB 3KRXA 4KAXB 2QKLA 1BTNA 1MI1A 2Z0PA 5EFXA 1OMWA 1ZSQA 3A98B 4QXAB 2CAYA 3PG7A 1LB1A 2IYBA 1V5PA 1M7RA 1UPQA 1J0WA 4DX8A 1FHWA 5JLJB 1U5EA 2YT1A 4PNKA 3PSCA 1MAIA 3PVUA 4CSQA 4P7IA 2COFA 4GZUA 2LULA 3KRWA 5CLLB 2DHIA 1UEFA 2K00A 3NWAA 2V76A 2YSZA 1OQNA 2D9ZA 1OY2A 4A6FB 2W2XC 2CY4A 2HTHB 2P8VA 5C79A 1IRSA 3NWDA 4TKNA 2G35A 4F7UP 3CXBB 3NWFA 1Q67A 1Z87A 5HE2A 3PZDA 4EKUA 5C5BA 1KI1B 2Y7BA 3F0WA 4NSWA 2D10A 5C16A 2KGXB 3D8FA 2Z59A 4EJNA 4EMOA 2Z0OA 4HB4B 2EJ8A 3ULBA 4KHBB 3VOQA 3HK0A 3A8PA 2RSGA 5CLQB 3TW1A 3HSAA 2YT2A 1TXDA 1GG3A 1XKEA 2KR0A 4GMXB 3HW2B 4YONA 2AL6A 1W1DA 5D3VA 3ODOA 1QC6A 4DIXA 1RRPB 5KQ1A 3IVFA 2Z14A 1ISNA 4Z2MB 2ELAA 3MPXA 3NSUA 1MK9B 2J0KA 3PEGA 1WI1A 4DX90 5FI0A 4XWXA 2N23A 2J0JA 2OTXA 2K2JA 2N0YA 2BCJA 4Y94A 3SYXA 5I2SA 4IFSA 4A6KA 1UNPA 2ROVA 3TO1A 4HB2B 1DDVA 2ZPYA 5LG4B 3PVLA 4DBBA 2RVBB 2DYQA 3AU5A 5DH9B 4KHOA 1SGHA 2D11A 1NTVA 3KSYA 1U27A 3PVWA 1DYNA 3D8DA 1MIZB 1EVHA 1M7EA 2K2UA 2J59M 3ULCA 4HAVB 3X23A 1FOEA 2DTCA 5HE0A 2COAA 1FGYA 1EAZA 1U2BA 4HSIA 2NMBA 3AJ4A 1B55A 2EC1A 2M14A 5D27A 1H4RA 3D8EA 4QJ5B 1ZYIA 2KCJA 3V5WA 2D9YA 4GXBA 1K5GB 4NY0A 2XQNM 2GJYA 1RJ2A 4HAWB 2KIGA 4WJ7A 5D3XA 5HE3A 5KQ4A 4Z2NA 1E5WA 4OT1A 4HAXB 2GUMA 2Q13A 1WJMA 3ODWA 2LOZA 2MFQA 1QQGA 2RNRB 3N7CA 3AU4A 4CHJA 2K49A 3FVCA 4C0AA 1XCGA 4D6WA 3SUZA 4GNKB 4H8SA 2I5CA 1UNQA 3MDBC 2LYDA 1BAKA 1V88A 3U7DA 4K17A 4HATB 3DXDA 2QKMA 1X11A 4CHMA 5D3YA 4BBKA 1U29A 2DX5A 3A8QA 4A6FA 4A6HA 4HB0B 3FSSA 2MWNB 4IAPA 5J3QA 1Y5OA 1PMSA 2ELBA 4MK0A 4HAUB 4KHAA 2YRYA 3PP2A 3QBVB 2CRFA 1X1FA 3FEHA 1NI2A 4IOYX 5L81A 3M1IB 1ZM0A 3NW8A 3BINA 4K2PA 1MIXA 1BTKA 4HDQA 4KHBA 3GYOA 3SO6A 1V5UA
chains in the Genus database with same CATH topology
3TW1A 4OSNA 4OT1A 2YT2A 5I2SA 2GUMA 4IFSA 4Z2NA 2GCJA 3TO1A 2KR0A 2Z4DA 3HIEA 4IOYX 3NWFA 4HSIA 5LG4B 3U12A 4CSQA 2ZKMX 4GOUA 2NBVA 2RRFA 2K49A 2KIEA 4DIXA 3FVCA 3TVVA 3OHMB 5IRSA 4KHOA 3NWAA 4PQ0A 4D6WA 2Z14A 3GYPA 3NW8A 4Z2MB 2GCLA 4GNKB 3FSSA 1ZYIA 2Z13A 4QJ5B 4KHBA 3GYOA 2KUQA 2FJUB 2R2YA 2Z59A 4KHAA 4QJ3B 4QXAB 5M4YB 2KIGA 4L1RA 3A58A 4KHBB 4QJ4B 5I2MA 3NWDA 2K8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSQ A; 
#chains in the Genus database with same CATH topology
 2EMT A;  4ZRK A;  1N3H A;  3P6A A;  1WG7 A;  1V61 A;  5FI1 A;  2RLO A;  4K81 A;  1ZC3 B;  3U12 A;  2ZKM X;  2W2W A;  4D0N B;  1P6S A;  2KIE A;  1GC7 A;  3WYF B;  1X05 A;  2ROZ B;  3BJI A;  3O96 A;  2DKP A;  5J3Y A;  2MDX A;  2OQB A;  2DFK A;  4QJ4 B;  4MY6 A;  2GS0 A;  1FHO A;  5DI9 B;  1KZG A;  2KUP A;  3WA0 A;  3DXC A;  2D9W A;  2I5F A;  1WGU A;  1DBH A;  3ZVR A;  3KY9 A;  1LW3 A;  2D9V A;  3B77 A;  1XD4 A;  2LKO A;  4WSF A;  1W1H A;  1XX0 A;  2X18 A;  2Z0Q A;  1V89 A;  2Z13 A;  3F5R A;  4WVF B;  3DXE A;  2KUQ A;  4GPT B;  1XOD A;  5JHG A;  2R0D A;  2J0M A;  2I1K A;  4F7G A;  2H7E A;  1PLS A;  2DHK A;  2HE7 A;  1MKE A;  4KVG B;  1KZ7 A;  2DX1 A;  1AWE A;  2VKI A;  5D3W A;  2GCJ A;  1X86 A;  3T06 A;  3QIJ A;  1T77 A;  2D9X A;  2NBV A;  4PQ0 A;  1I2H A;  1U5G A;  2YS1 A;  2H7D A;  3U8Z A;  3OAN A;  2P0H A;  1NU2 A;  1WJ1 A;  1DDM A;  2L2I A;  1WVH A;  2PZ1 A;  4ZRI A;  2I1J A;  4L1R A;  3LJU X;  1I7A A;  3QWM A;  1SHC A;  1FAO A;  3RCP A;  1PFJ A;  2VSZ A;  5DHF B;  2M38 A;  4L6E A;  1U5D A;  5J3T A;  1BWN A;  5HE1 A;  2YF0 A;  2R09 A;  5LON B;  3ZDT A;  3DCX A;  5C5B B;  2D4Q A;  4ZRJ A;  2P0D A;  4QJ3 B;  2DN6 A;  2UVM A;  4HDO A;  2L1C A;  2EMS A;  5I2M A;  3UZT A;  4A5K A;  2MKR A;  2YS5 A;  2COD A;  2Y8F A;  3G9W A;  3TFM A;  2LOX A;  1FHX A;  2P0F A;  1W1G A;  2YVC A;  2JP2 A;  2RRF A;  1X1G A;  3GYP A;  5JP4 A;  3HQC A;  1UNR A;  3SV1 A;  1ZVR A;  3VIA A;  1WGQ A;  2COC A;  2R2Y A;  1GC6 A;  1DDW A;  5M4Y B;  1XR0 B;  3A58 A;  2ADZ A;  4GMV A;  3ML4 A;  5C6R A;  4GN1 A;  1TQZ A;  5GOW B;  2D2Q A;  1EF1 A;  1MPH A;  1K5D B;  1U5F A;  5LOP B;  2RUK B;  4HB3 B;  1FB8 A;  5IRS A;  2E2X A;  4K2O A;  2DHJ A;  2FJL A;  2RGN B;  1NTY A;  2NZ8 B;  1V5M A;  1H10 A;  5DIF B;  2K8E A;  1P5T A;  2W2X D;  1EGX A;  4B6H A;  1ZC4 B;  2Y8G A;  4HAY B;  3CIK A;  2YT0 A;  3HIE A;  1UPR A;  2DKQ A;  4GOU A;  2YS3 A;  3ODX A;  3KZ1 A;  2DLW A;  3TVV A;  3OHM B;  1MK7 B;  2UZS A;  3SNH A;  3TCA A;  3P7Z A;  1FGZ A;  2DYN A;  2FJU B;  4F7H A;  2AEH A;  5DHA B;  1TJ6 A;  1Y19 B;  1DRO A;  2DA0 A;  4OSN A;  2IFS A;  5JHH A;  5KCV A;  4TYZ A;  2Z4D A;  4HHV A;  4MT7 A;  4DXA B;  2CY5 A;  2VRW B;  4YL8 A;  1AQC A;  4CYE A;  3FM8 C;  2LG1 A;  2UZR A;  1J19 A;  2GCL A;  1P3R A;  4HAZ B;  3KRX A;  4KAX B;  2QKL A;  1BTN A;  1MI1 A;  2Z0P A;  5EFX A;  1OMW A;  1ZSQ A;  3A98 B;  4QXA B;  2CAY A;  3PG7 A;  1LB1 A;  2IYB A;  1V5P A;  1M7R A;  1UPQ A;  1J0W A;  4DX8 A;  1FHW A;  5JLJ B;  1U5E A;  2YT1 A;  4PNK A;  3PSC A;  1MAI A;  3PVU A;  4CSQ A;  4P7I A;  2COF A;  4GZU A;  2LUL A;  3KRW A;  5CLL B;  2DHI A;  1UEF A;  2K00 A;  3NWA A;  2V76 A;  2YSZ A;  1OQN A;  2D9Z A;  1OY2 A;  4A6F B;  2W2X C;  2CY4 A;  2HTH B;  2P8V A;  5C79 A;  1IRS A;  3NWD A;  4TKN A;  2G35 A;  4F7U P;  3CXB B;  3NWF A;  1Q67 A;  1Z87 A;  5HE2 A;  3PZD A;  4EKU A;  5C5B A;  1KI1 B;  2Y7B A;  3F0W A;  4NSW A;  2D10 A;  5C16 A;  2KGX B;  3D8F A;  2Z59 A;  4EJN A;  4EMO A;  2Z0O A;  4HB4 B;  2EJ8 A;  3ULB A;  4KHB B;  3VOQ A;  3HK0 A;  3A8P A;  2RSG A;  5CLQ B;  3TW1 A;  3HSA A;  2YT2 A;  1TXD A;  1GG3 A;  1XKE A;  2KR0 A;  4GMX B;  3HW2 B;  4YON A;  2AL6 A;  1W1D A;  5D3V A;  3ODO A;  1QC6 A;  4DIX A;  1RRP B;  5KQ1 A;  3IVF A;  2Z14 A;  1ISN A;  4Z2M B;  2ELA A;  3MPX A;  3NSU A;  1MK9 B;  2J0K A;  3PEG A;  1WI1 A;  4DX9 0;  5FI0 A;  4XWX A;  2N23 A;  2J0J A;  2OTX A;  2K2J A;  2N0Y A;  2BCJ A;  4Y94 A;  3SYX A;  5I2S A;  4IFS A;  4A6K A;  1UNP A;  2ROV A;  3TO1 A;  4HB2 B;  1DDV A;  2ZPY A;  5LG4 B;  3PVL A;  4DBB A;  2RVB B;  2DYQ A;  3AU5 A;  5DH9 B;  4KHO A;  1SGH A;  2D11 A;  1NTV A;  3KSY A;  1U27 A;  3PVW A;  1DYN A;  3D8D A;  1MIZ B;  1EVH A;  1M7E A;  2K2U A;  2J59 M;  3ULC A;  4HAV B;  3X23 A;  1FOE A;  2DTC A;  5HE0 A;  2COA A;  1FGY A;  1EAZ A;  1U2B A;  4HSI A;  2NMB A;  3AJ4 A;  1B55 A;  2EC1 A;  2M14 A;  5D27 A;  1H4R A;  3D8E A;  4QJ5 B;  1ZYI A;  2KCJ A;  3V5W A;  2D9Y A;  4GXB A;  1K5G B;  4NY0 A;  2XQN M;  2GJY A;  1RJ2 A;  4HAW B;  2KIG A;  4WJ7 A;  5D3X A;  5HE3 A;  5KQ4 A;  4Z2N A;  1E5W A;  4OT1 A;  4HAX B;  2GUM A;  2Q13 A;  1WJM A;  3ODW A;  2LOZ A;  2MFQ A;  1QQG A;  2RNR B;  3N7C A;  3AU4 A;  4CHJ A;  2K49 A;  3FVC A;  4C0A A;  1XCG A;  4D6W A;  3SUZ A;  4GNK B;  4H8S A;  2I5C A;  1UNQ A;  3MDB C;  2LYD A;  1BAK A;  1V88 A;  3U7D A;  4K17 A;  4HAT B;  3DXD A;  2QKM A;  1X11 A;  4CHM A;  5D3Y A;  4BBK A;  1U29 A;  2DX5 A;  3A8Q A;  4A6F A;  4A6H A;  4HB0 B;  3FSS A;  2MWN B;  4IAP A;  5J3Q A;  1Y5O A;  1PMS A;  2ELB A;  4MK0 A;  4HAU B;  4KHA A;  2YRY A;  3PP2 A;  3QBV B;  2CRF A;  1X1F A;  3FEH A;  1NI2 A;  4IOY X;  5L81 A;  3M1I B;  1ZM0 A;  3NW8 A;  3BIN A;  4K2P A;  1MIX A;  1BTK A;  4HDQ A;  4KHB A;  3GYO A;  3SO6 A;  1V5U A; 
#chains in the Genus database with same CATH homology
 3TW1 A;  4OSN A;  4OT1 A;  2YT2 A;  5I2S A;  2GUM A;  4IFS A;  4Z2N A;  2GCJ A;  3TO1 A;  2KR0 A;  2Z4D A;  3HIE A;  4IOY X;  3NWF A;  4HSI A;  5LG4 B;  3U12 A;  4CSQ A;  2ZKM X;  4GOU A;  2NBV A;  2RRF A;  2K49 A;  2KIE A;  4DIX A;  3FVC A;  3TVV A;  3OHM B;  5IRS A;  4KHO A;  3NWA A;  4PQ0 A;  4D6W A;  2Z14 A;  3GYP A;  3NW8 A;  4Z2M B;  2GCL A;  4GNK B;  3FSS A;  1ZYI A;  2Z13 A;  4QJ5 B;  4KHB A;  3GYO A;  2KUQ A;  2FJU B;  2R2Y A;  2Z59 A;  4KHA A;  4QJ3 B;  4QXA B;  5M4Y B;  2KIG A;  4L1R A;  3A58 A;  4KHB B;  4QJ4 B;  5I2M A;  3NWD A;  2K8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...