4CSQA

Nmr solution structure of pa3793 from pseudomonas aeruginosa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSHMTTQRYLLDELETADMLEIDGLHAWRFELNENLLDQADLAAEADQPFASEDWVLAVESLDGRTRREWRFSYNAVMEAEPQADGESWRLTTGEGAYQLRCLGAVSASGEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN
publication title NMR Solution Structure of Pa3793 from Pseudomonas
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural protein
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18629 DUF5629 Family of unknown function (DUF5629)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.190 Mainly Beta Roll PH-domain like PH-domain like 4csqA00
4CSQA
chains in the Genus database with same CATH superfamily
2W2XD 2UZSA 3GYPA 2D2QA 1QC6A 5D3YA 2GUMA 2RUKB 3HW2B 1J19A 3ODOA 4D6WA 1MI1A 4OSNA 1ZM0A 3TFMA 3G9WA 2LULA 1V5UA 1X1GA 4K81A 4L1RA 1ZYIA 2CY5A 4WSFA 1OMWA 4MT7A 3M1IB 1V5MA 3O96A 3PVWA 1EVHA 1U5DA 2DHJA 2IFSA 4C0AA 2I1JA 4TYZA 3CIKA 5C79A 5DIFB 1X05A 2ELBA 3F0WA 1EF1A 4D0NB 4L6EA 2DTCA 4GOUA 2D9YA 2FJLA 4QJ4B 1XODA 4HAWB 1Q67A 1X86A 4HB2B 4KHBA 2Y8FA 4QJ3B 3HIEA 3ULCA 5HE2A 3D8FA 2COAA 4EKUA 2DX1A 2CAYA 4KHOA 2N23A 2NZ8B 1V89A 3N7CA 5C6RA 2ROZB 1ZSQA 4A6HA 1RJ2A 4GMXB 2Q13A 4Z2MB 1DYNA 5EFXA 2K49A 2J0JA 2GJYA 5JP4A 1U5FA 1QQGA 1GC7A 2YVCA 4PQ0A 3D8DA 1X1FA 2IYBA 5IRSA 2I1KA 2COFA 4DIXA 1K5GB 2GS0A 2VRWB 1X11A 1WJ1A 1DBHA 4QJ5B 1NU2A 2ELAA 2DLWA 2R09A 2RSGA 2ZPYA 2K2UA 2D10A 1XCGA 2D11A 4CYEA 3A58A 3PSCA 3PG7A 2M38A 4HDQA 2DX5A 2Z4DA 3ODWA 1MIZB 2LOXA 2EC1A 2EMTA 5L81A 3PZDA 2L2IA 4GZUA 4KVGB 5DH9B 1DDWA 2KIEA 4IAPA 3KZ1A 3ZVRA 2M14A 1UNPA 3QWMA 4HHVA 4DX90 2QKLA 1BTKA 3IVFA 3SNHA 2YT2A 1OQNA 5LG4B 1V5PA 4NY0A 1GG3A 2R0DA 4HB4B 5DI9B 1LW3A 1B55A 5C16A 3MPXA 4MK0A 1TQZA 1V88A 3KRWA 3FEHA 1M7RA 3DCXA 2QKMA 5C5BA 2VSZA 2I5CA 1NI2A 2Z59A 2DYQA 1SHCA 1MPHA 4A6KA 2LYDA 3GYOA 2UZRA 1I2HA 2AEHA 1OY2A 1WG7A 4YONA 2YS3A 4DX8A 3OHMB 2KIGA 5JHGA 2DN6A 3SYXA 5HE3A 4KHBB 3PVLA 1BWNA 3NW8A 3BINA 2J0KA 1PMSA 3SUZA 5KCVA 3FVCA 4F7UP 4YL8A 2HTHB 5HE0A 4F7GA 5I2SA 2P0FA 2J0MA 3A98B 2PZ1A 1ZC3B 2RRFA 3KSYA 1BAKA 1XX0A 3DXDA 2FJUB 2KCJA 1W1GA 5CLQB 5LONB 1U27A 4WVFB 3SO6A 2EJ8A 2GCLA 4K2OA 4GXBA 1WGQA 4MY6A 2ROVA 2P0DA 1MK9B 1NTYA 2YSZA 2YT0A 3TVVA 2K00A 5DHAB 5KQ1A 3DXEA 1ZC4B 1P5TA 5GOWB 4CHJA 2YS5A 4ZRJA 1N3HA 4HAYB 4EJNA 1U29A 1MIXA 4A6FA 2Y7BA 1ISNA 2YS1A 3ML4A 2NMBA 3MDBC 2DHIA 2GCJA 1PFJA 2DHKA 3ZDTA 1EGXA 3QIJA 2Z13A 3AU5A 2YRYA 5KQ4A 2LG1A 4IOYX 3VIAA 1NTVA 1WGUA 3HSAA 2DA0A 3P6AA 2YF0A 1H10A 2LOZA 3F5RA 1P3RA 2Z14A 1FHOA 4HB3B 2I5FA 3PP2A 4KAXB 3ULBA 4KHAA 4PNKA 2RLOA 4DBBA 2D9VA 3VOQA 4XWXA 1ZVRA 3KRXA 1SGHA 4H8SA 2MWNB 1PLSA 3P7ZA 5M4YB 2ZKMX 3FSSA 2H7EA 2DFKA 3D8EA 5C5BB 4HAUB 2K2JA 1WJMA 2LKOA 1WVHA 3DXCA 1FHWA 4HAZB 2K8EA 1EAZA 1FHXA 3RCPA 5FI1A 1XKEA 5DHFB 5FI0A 3NWFA 4HAXB 4WJ7A 2NBVA 4BBKA 2E2XA 2P8VA 2D9XA 1IRSA 5JHHA 1J0WA 2CRFA 1KZ7A 1I7AA 4P7IA 2BCJA 3AU4A 4ZRIA 1DDMA 1MKEA 2KUQA 1U5EA 2ADZA 1Z87A 1W1DA 3SV1A 4B6HA 1MAIA 3U12A 2J59M 5I2MA 1UNQA 1FGYA 1UPRA 1UPQA 1KZGA 3T06A 2OTXA 5J3YA 2CY4A 1DDVA 1W1HA 2OQBA 4A6FB 1LB1A 5JLJB 3U8ZA 3FM8C 4HDOA 2VKIA 1UNRA 3KY9A 1UEFA 2XQNM 1T77A 2P0HA 5J3QA 2JP2A 3HK0A 4CHMA 4HATB 3OANA 2COCA 2RGNB 1Y5OA 2UVMA 2D9WA 4Z2NA 1V61A 5D3VA 1BTNA 2H7DA 3NWDA 3QBVB 1XR0B 1U5GA 1FB8A 4GNKB 1FOEA 4A5KA 3HQCA 1RRPB 1AWEA 2RNRB 2X18A 2YT1A 4TKNA 1TXDA 2W2WA 3U7DA 2N0YA 2EMSA 1DROA 2R2YA 3PEGA 1E5WA 5D3XA 2Z0PA 3LJUX 1MK7B 4K17A 4HAVB 3AJ4A 2MFQA 4EMOA 2Y8GA 1U2BA 4GMVA 1KI1B 4ZRKA 3TW1A 2DKQA 3NSUA 5J3TA 2KGXB 1WI1A 3WYFB 4GN1A 4DXAB 3NWAA 2AL6A 2CODA 1TJ6A 3B77A 2RVBB 4HSIA 3TO1A 2DYNA 3BJIA 2D4QA 2Z0OA 2DKPA 3PVUA 1H4RA 5HE1A 1XD4A 1FGZA 1FAOA 2W2XC 1P6SA 2KUPA 4IFSA 2Z0QA 4K2PA 5D27A 3TCAA 5CLLB 4Y94A 1GC6A 2V76A 3CXBB 1Y19B 4CSQA 2HE7A 2G35A 4NSWA 3ODXA 3UZTA 2L1CA 3A8QA 2D9ZA 3V5WA 3WA0A 3A8PA 4QXAB 1AQCA 4HB0B 4OT1A 1K5DB 5D3WA 2MKRA 2MDXA 4F7HA 3X23A 5LOPB 1M7EA 2KR0A 4GPTB
chains in the Genus database with same CATH topology
4Z2MB 2K49A 3GYOA 2FJUB 2YT2A 3GYPA 2GUMA 3A58A 2K8EA 5LG4B 4GOUA 4Z2NA 4KHAA 4CSQA 4QJ4B 4D6WA 2GCJA 2KUQA 3NWAA 2GCLA 2R2YA 3OHMB 4KHBA 4OSNA 3NWFA 4PQ0A 2KIGA 2Z4DA 2Z13A 3NWDA 4QJ3B 3TO1A 4HSIA 5IRSA 4DIXA 2NBVA 3HIEA 4QXAB 3TVVA 4GNKB 4KHBB 3U12A 4L1RA 4OT1A 4IOYX 1ZYIA 3NW8A 2KIEA 4IFSA 5I2MA 5M4YB 4KHOA 3FVCA 2ZKMX 3FSSA 5I2SA 4QJ5B 3TW1A 2Z59A 2Z14A 2KR0A 2RRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSQ A; 
#chains in the Genus database with same CATH topology
 2W2X D;  2UZS A;  3GYP A;  2D2Q A;  1QC6 A;  5D3Y A;  2GUM A;  2RUK B;  3HW2 B;  1J19 A;  3ODO A;  4D6W A;  1MI1 A;  4OSN A;  1ZM0 A;  3TFM A;  3G9W A;  2LUL A;  1V5U A;  1X1G A;  4K81 A;  4L1R A;  1ZYI A;  2CY5 A;  4WSF A;  1OMW A;  4MT7 A;  3M1I B;  1V5M A;  3O96 A;  3PVW A;  1EVH A;  1U5D A;  2DHJ A;  2IFS A;  4C0A A;  2I1J A;  4TYZ A;  3CIK A;  5C79 A;  5DIF B;  1X05 A;  2ELB A;  3F0W A;  1EF1 A;  4D0N B;  4L6E A;  2DTC A;  4GOU A;  2D9Y A;  2FJL A;  4QJ4 B;  1XOD A;  4HAW B;  1Q67 A;  1X86 A;  4HB2 B;  4KHB A;  2Y8F A;  4QJ3 B;  3HIE A;  3ULC A;  5HE2 A;  3D8F A;  2COA A;  4EKU A;  2DX1 A;  2CAY A;  4KHO A;  2N23 A;  2NZ8 B;  1V89 A;  3N7C A;  5C6R A;  2ROZ B;  1ZSQ A;  4A6H A;  1RJ2 A;  4GMX B;  2Q13 A;  4Z2M B;  1DYN A;  5EFX A;  2K49 A;  2J0J A;  2GJY A;  5JP4 A;  1U5F A;  1QQG A;  1GC7 A;  2YVC A;  4PQ0 A;  3D8D A;  1X1F A;  2IYB A;  5IRS A;  2I1K A;  2COF A;  4DIX A;  1K5G B;  2GS0 A;  2VRW B;  1X11 A;  1WJ1 A;  1DBH A;  4QJ5 B;  1NU2 A;  2ELA A;  2DLW A;  2R09 A;  2RSG A;  2ZPY A;  2K2U A;  2D10 A;  1XCG A;  2D11 A;  4CYE A;  3A58 A;  3PSC A;  3PG7 A;  2M38 A;  4HDQ A;  2DX5 A;  2Z4D A;  3ODW A;  1MIZ B;  2LOX A;  2EC1 A;  2EMT A;  5L81 A;  3PZD A;  2L2I A;  4GZU A;  4KVG B;  5DH9 B;  1DDW A;  2KIE A;  4IAP A;  3KZ1 A;  3ZVR A;  2M14 A;  1UNP A;  3QWM A;  4HHV A;  4DX9 0;  2QKL A;  1BTK A;  3IVF A;  3SNH A;  2YT2 A;  1OQN A;  5LG4 B;  1V5P A;  4NY0 A;  1GG3 A;  2R0D A;  4HB4 B;  5DI9 B;  1LW3 A;  1B55 A;  5C16 A;  3MPX A;  4MK0 A;  1TQZ A;  1V88 A;  3KRW A;  3FEH A;  1M7R A;  3DCX A;  2QKM A;  5C5B A;  2VSZ A;  2I5C A;  1NI2 A;  2Z59 A;  2DYQ A;  1SHC A;  1MPH A;  4A6K A;  2LYD A;  3GYO A;  2UZR A;  1I2H A;  2AEH A;  1OY2 A;  1WG7 A;  4YON A;  2YS3 A;  4DX8 A;  3OHM B;  2KIG A;  5JHG A;  2DN6 A;  3SYX A;  5HE3 A;  4KHB B;  3PVL A;  1BWN A;  3NW8 A;  3BIN A;  2J0K A;  1PMS A;  3SUZ A;  5KCV A;  3FVC A;  4F7U P;  4YL8 A;  2HTH B;  5HE0 A;  4F7G A;  5I2S A;  2P0F A;  2J0M A;  3A98 B;  2PZ1 A;  1ZC3 B;  2RRF A;  3KSY A;  1BAK A;  1XX0 A;  3DXD A;  2FJU B;  2KCJ A;  1W1G A;  5CLQ B;  5LON B;  1U27 A;  4WVF B;  3SO6 A;  2EJ8 A;  2GCL A;  4K2O A;  4GXB A;  1WGQ A;  4MY6 A;  2ROV A;  2P0D A;  1MK9 B;  1NTY A;  2YSZ A;  2YT0 A;  3TVV A;  2K00 A;  5DHA B;  5KQ1 A;  3DXE A;  1ZC4 B;  1P5T A;  5GOW B;  4CHJ A;  2YS5 A;  4ZRJ A;  1N3H A;  4HAY B;  4EJN A;  1U29 A;  1MIX A;  4A6F A;  2Y7B A;  1ISN A;  2YS1 A;  3ML4 A;  2NMB A;  3MDB C;  2DHI A;  2GCJ A;  1PFJ A;  2DHK A;  3ZDT A;  1EGX A;  3QIJ A;  2Z13 A;  3AU5 A;  2YRY A;  5KQ4 A;  2LG1 A;  4IOY X;  3VIA A;  1NTV A;  1WGU A;  3HSA A;  2DA0 A;  3P6A A;  2YF0 A;  1H10 A;  2LOZ A;  3F5R A;  1P3R A;  2Z14 A;  1FHO A;  4HB3 B;  2I5F A;  3PP2 A;  4KAX B;  3ULB A;  4KHA A;  4PNK A;  2RLO A;  4DBB A;  2D9V A;  3VOQ A;  4XWX A;  1ZVR A;  3KRX A;  1SGH A;  4H8S A;  2MWN B;  1PLS A;  3P7Z A;  5M4Y B;  2ZKM X;  3FSS A;  2H7E A;  2DFK A;  3D8E A;  5C5B B;  4HAU B;  2K2J A;  1WJM A;  2LKO A;  1WVH A;  3DXC A;  1FHW A;  4HAZ B;  2K8E A;  1EAZ A;  1FHX A;  3RCP A;  5FI1 A;  1XKE A;  5DHF B;  5FI0 A;  3NWF A;  4HAX B;  4WJ7 A;  2NBV A;  4BBK A;  2E2X A;  2P8V A;  2D9X A;  1IRS A;  5JHH A;  1J0W A;  2CRF A;  1KZ7 A;  1I7A A;  4P7I A;  2BCJ A;  3AU4 A;  4ZRI A;  1DDM A;  1MKE A;  2KUQ A;  1U5E A;  2ADZ A;  1Z87 A;  1W1D A;  3SV1 A;  4B6H A;  1MAI A;  3U12 A;  2J59 M;  5I2M A;  1UNQ A;  1FGY A;  1UPR A;  1UPQ A;  1KZG A;  3T06 A;  2OTX A;  5J3Y A;  2CY4 A;  1DDV A;  1W1H A;  2OQB A;  4A6F B;  1LB1 A;  5JLJ B;  3U8Z A;  3FM8 C;  4HDO A;  2VKI A;  1UNR A;  3KY9 A;  1UEF A;  2XQN M;  1T77 A;  2P0H A;  5J3Q A;  2JP2 A;  3HK0 A;  4CHM A;  4HAT B;  3OAN A;  2COC A;  2RGN B;  1Y5O A;  2UVM A;  2D9W A;  4Z2N A;  1V61 A;  5D3V A;  1BTN A;  2H7D A;  3NWD A;  3QBV B;  1XR0 B;  1U5G A;  1FB8 A;  4GNK B;  1FOE A;  4A5K A;  3HQC A;  1RRP B;  1AWE A;  2RNR B;  2X18 A;  2YT1 A;  4TKN A;  1TXD A;  2W2W A;  3U7D A;  2N0Y A;  2EMS A;  1DRO A;  2R2Y A;  3PEG A;  1E5W A;  5D3X A;  2Z0P A;  3LJU X;  1MK7 B;  4K17 A;  4HAV B;  3AJ4 A;  2MFQ A;  4EMO A;  2Y8G A;  1U2B A;  4GMV A;  1KI1 B;  4ZRK A;  3TW1 A;  2DKQ A;  3NSU A;  5J3T A;  2KGX B;  1WI1 A;  3WYF B;  4GN1 A;  4DXA B;  3NWA A;  2AL6 A;  2COD A;  1TJ6 A;  3B77 A;  2RVB B;  4HSI A;  3TO1 A;  2DYN A;  3BJI A;  2D4Q A;  2Z0O A;  2DKP A;  3PVU A;  1H4R A;  5HE1 A;  1XD4 A;  1FGZ A;  1FAO A;  2W2X C;  1P6S A;  2KUP A;  4IFS A;  2Z0Q A;  4K2P A;  5D27 A;  3TCA A;  5CLL B;  4Y94 A;  1GC6 A;  2V76 A;  3CXB B;  1Y19 B;  4CSQ A;  2HE7 A;  2G35 A;  4NSW A;  3ODX A;  3UZT A;  2L1C A;  3A8Q A;  2D9Z A;  3V5W A;  3WA0 A;  3A8P A;  4QXA B;  1AQC A;  4HB0 B;  4OT1 A;  1K5D B;  5D3W A;  2MKR A;  2MDX A;  4F7H A;  3X23 A;  5LOP B;  1M7E A;  2KR0 A;  4GPT B; 
#chains in the Genus database with same CATH homology
 4Z2M B;  2K49 A;  3GYO A;  2FJU B;  2YT2 A;  3GYP A;  2GUM A;  3A58 A;  2K8E A;  5LG4 B;  4GOU A;  4Z2N A;  4KHA A;  4CSQ A;  4QJ4 B;  4D6W A;  2GCJ A;  2KUQ A;  3NWA A;  2GCL A;  2R2Y A;  3OHM B;  4KHB A;  4OSN A;  3NWF A;  4PQ0 A;  2KIG A;  2Z4D A;  2Z13 A;  3NWD A;  4QJ3 B;  3TO1 A;  4HSI A;  5IRS A;  4DIX A;  2NBV A;  3HIE A;  4QXA B;  3TVV A;  4GNK B;  4KHB B;  3U12 A;  4L1R A;  4OT1 A;  4IOY X;  1ZYI A;  3NW8 A;  2KIE A;  4IFS A;  5I2M A;  5M4Y B;  4KHO A;  3FVC A;  2ZKM X;  3FSS A;  5I2S A;  4QJ5 B;  3TW1 A;  2Z59 A;  2Z14 A;  2KR0 A;  2RRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...