4CSQA

Nmr solution structure of pa3793 from pseudomonas aeruginosa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GSHMTTQRYLLDELETADMLEIDGLHAWRFELNENLLDQADLAAEADQPFASEDWVLAVESLDGRTRREWRFSYNAVMEAEPQADGESWRLTTGEGAYQLRCLGAVSASGEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Pa3793 from Pseudomonas
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural protein
molecule keywords UNCHARACTERIZED PROTEIN
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18629 DUF5629 Family of unknown function (DUF5629)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.190 Mainly Beta Roll PH-domain like PH-domain like 4csqA00
4CSQA
chains in the Genus database with same CATH superfamily
5DIFB 1U5GA 4K17A 2HE7A 4HAWB 2CAYA 3FEHA 3KY9A 3PP2A 4PNKA 4PQ0A 1W1HA 2LULA 5GOWB 1ZVRA 1M7RA 2K2JA 2MFQA 4EMOA 3PZDA 3NWDA 4Z2NA 1LW3A 2ADZA 1U2BA 4QJ3B 5FI0A 2YVCA 2OTXA 4HATB 2CRFA 5C16A 2JP2A 1DROA 3ULBA 3D8DA 4MY6A 3T06A 3HQCA 1K5GB 1X11A 2NMBA 3QIJA 1V89A 5KCVA 1WJMA 1X1FA 1XX0A 3MPXA 5JLJB 2RVBB 1U5DA 3PEGA 2LKOA 2AL6A 1TXDA 1FGYA 5HE3A 2D9XA 1UNRA 4HB4B 2ZKMX 3A58A 2FJUB 2GCLA 3AU4A 2UVMA 1W1GA 2W2XC 1N3HA 1X05A 2P0DA 1WVHA 2COCA 1EGXA 2D9YA 4DX8A 3HIEA 1H4RA 4TYZA 1I2HA 2KIEA 3D8EA 5C5BB 2Z59A 1V5PA 3G9WA 2E2XA 5CLLB 5IRSA 3TW1A 2LG1A 2COFA 2M14A 1EF1A 1V5UA 2RGNB 4K81A 4A6HA 2DYQA 2DA0A 1ZC4B 2PZ1A 3CXBB 3P7ZA 4QXAB 1KZGA 2DYNA 1UNQA 2KGXB 2MKRA 4ZRKA 2OQBA 4GPTB 3WA0A 3ODOA 3SV1A 1NU2A 1IRSA 3ODWA 4KHBA 1P5TA 4ZRIA 4OSNA 1UNPA 3WYFB 4KHBB 2R2YA 4GMVA 1ISNA 3D8FA 4P7IA 1XKEA 5LONB 3GYPA 1FHWA 2J0JA 2J59M 2LOXA 3TVVA 3PVLA 4CSQA 2K8EA 1W1DA 4HAZB 3X23A 2EJ8A 1U29A 2CY4A 2CODA 3U12A 5JP4A 2NBVA 3AU5A 1GC7A 1MPHA 2K00A 3FM8C 3VIAA 4F7GA 2J0KA 2X18A 2W2WA 2Z0PA 1AWEA 4H8SA 2W2XD 3KSYA 2DTCA 5D3VA 4ZRJA 3QWMA 1J19A 2DHIA 2D10A 2RNRB 1OMWA 3TCAA 4GN1A 2YRYA 5CLQB 2IFSA 3OANA 1OQNA 3TFMA 2L1CA 1K5DB 5D3WA 3KRXA 2KUQA 1NI2A 2DX5A 2GCJA 5I2SA 4DXAB 2DHJA 2LYDA 1MI1A 1TJ6A 2Z14A 5JHGA 3DCXA 1NTYA 2GUMA 3QBVB 2H7EA 1P6SA 2YS5A 1FOEA 2K2UA 3BINA 2YT1A 1PFJA 2DLWA 2V76A 4BBKA 1BTKA 2UZSA 4KAXB 4DBBA 2RRFA 2DHKA 4CHJA 3HSAA 5HE2A 5L81A 1DDWA 2KCJA 3KRWA 4GOUA 2NZ8B 4Z2MB 2Z13A 4GMXB 4YL8A 4K2OA 3SUZA 1UPRA 3V5WA 2ROVA 3NSUA 3A98B 5DHAB 4CHMA 4HAXB 2R0DA 1T77A 2P8VA 5C5BA 4HB0B 4D0NB 1SHCA 5J3QA 4MK0A 1E5WA 3FSSA 3M1IB 5KQ4A 1OY2A 2EMTA 1RRPB 2K49A 4NSWA 3FVCA 4KVGB 2COAA 2Q13A 5FI1A 2CY5A 3SNHA 3DXDA 2UZRA 1FAOA 1XCGA 3PVUA 3PSCA 4DX90 1RJ2A 2AEHA 2KUPA 2LOZA 1KZ7A 1FHXA 3PVWA 2P0FA 2DKPA 2RUKB 3NWFA 2D2QA 4QJ4B 5DHFB 4HDQA 3ML4A 5HE1A 4YONA 1DDVA 2DFKA 4HSIA 1BAKA 1MKEA 5I2MA 4B6HA 4HB3B 1PMSA 2YT0A 4D6WA 1BTNA 1BWNA 1ZM0A 2D4QA 1GC6A 1Y19B 1ZSQA 4GZUA 1PLSA 2H7DA 5LG4B 2ZPYA 2D11A 2L2IA 2GS0A 2ELBA 4A5KA 2DX1A 1J0WA 1V88A 2ELAA 2VKIA 2P0HA 2QKLA 2MWNB 3F0WA 2KIGA 1WJ1A 5C6RA 3HW2B 2Z0OA 3PG7A 3RCPA 5J3TA 2I5FA 2M38A 4TKNA 3DXEA 4C0AA 1ZC3B 2VRWB 4GXBA 2Y7BA 3GYOA 3NW8A 4NY0A 4L6EA 2G35A 4A6FA 1U5FA 4GNKB 3U7DA 4EKUA 2Y8FA 1FB8A 1MK7B 3ZDTA 3A8PA 1SGHA 4DIXA 1U27A 2FJLA 3N7CA 1M7EA 3ULCA 1H10A 2ROZB 5EFXA 4HAYB 2DN6A 1X1GA 1KI1B 1P3RA 3LJUX 4IAPA 4A6KA 1DDMA 4KHAA 4WVFB 2D9VA 2YT2A 2RLOA 5D27A 1X86A 2I1KA 3NWAA 3OHMB 1WI1A 5DH9B 5D3YA 2IYBA 4XWXA 3B77A 4MT7A 1WGUA 2Z4DA 3A8QA 1MIZB 1MAIA 4HB2B 3CIKA 4HAUB 2YS1A 5J3YA 3U8ZA 3KZ1A 4F7UP 3BJIA 3ODXA 4QJ5B 2EC1A 4EJNA 2Y8GA 1U5EA 1TQZA 4IOYX 5C79A 1Y5OA 3SO6A 2MDXA 1XR0B 2QKMA 2I5CA 1WGQA 5M4YB 1NTVA 3VOQA 2RSGA 1GG3A 4HAVB 4L1RA 5D3XA 3HK0A 3O96A 1QQGA 4IFSA 3IVFA 5JHHA 3F5RA 2DKQA 1Q67A 2YF0A 2Z0QA 5HE0A 4A6FB 4KHOA 1XODA 2KR0A 2XQNM 2BCJA 4F7HA 3P6AA 2D9ZA 1FGZA 2VSZA 2YS3A 3UZTA 1B55A 4WJ7A 1V61A 5DI9B 2I1JA 4Y94A 1QC6A 1MIXA 2GJYA 5KQ1A 1ZYIA 1AQCA 5LOPB 3MDBC 1MK9B 2N23A 4WSFA 1XD4A 2HTHB 4CYEA 3ZVRA 4HDOA 2EMSA 3AJ4A 4OT1A 2R09A 3TO1A 1EVHA 1EAZA 2J0MA 3DXCA 1UEFA 1I7AA 2YSZA 3SYXA 1DBHA 4HHVA 1WG7A 1FHOA 1DYNA 1UPQA 4K2PA 1Z87A 1LB1A 2N0YA 1V5MA 2D9WA
chains in the Genus database with same CATH topology
3TW1A 4KHBA 5LG4B 2YT2A 4OSNA 3FSSA 3NWFA 4GNKB 4KHBB 2R2YA 2ZKMX 4KHOA 4QJ4B 2KR0A 2RRFA 3A58A 4QJ5B 2K49A 4OT1A 3NWAA 2FJUB 2GCLA 3GYPA 2KUQA 3FVCA 4IOYX 4PQ0A 3OHMB 4GOUA 4QXAB 2GCJA 3TO1A 3TVVA 4HSIA 5I2SA 4CSQA 4Z2MB 2K8EA 2KIGA 5I2MA 2Z13A 4DIXA 5IRSA 2Z14A 5M4YB 4D6WA 2GUMA 3HIEA 3NWDA 3NW8A 4Z2NA 4IFSA 4L1RA 2KIEA 2Z59A 3U12A 1ZYIA 4QJ3B 2Z4DA 4KHAA 3GYOA 2NBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSQ A; 
#chains in the Genus database with same CATH topology
 5DIF B;  1U5G A;  4K17 A;  2HE7 A;  4HAW B;  2CAY A;  3FEH A;  3KY9 A;  3PP2 A;  4PNK A;  4PQ0 A;  1W1H A;  2LUL A;  5GOW B;  1ZVR A;  1M7R A;  2K2J A;  2MFQ A;  4EMO A;  3PZD A;  3NWD A;  4Z2N A;  1LW3 A;  2ADZ A;  1U2B A;  4QJ3 B;  5FI0 A;  2YVC A;  2OTX A;  4HAT B;  2CRF A;  5C16 A;  2JP2 A;  1DRO A;  3ULB A;  3D8D A;  4MY6 A;  3T06 A;  3HQC A;  1K5G B;  1X11 A;  2NMB A;  3QIJ A;  1V89 A;  5KCV A;  1WJM A;  1X1F A;  1XX0 A;  3MPX A;  5JLJ B;  2RVB B;  1U5D A;  3PEG A;  2LKO A;  2AL6 A;  1TXD A;  1FGY A;  5HE3 A;  2D9X A;  1UNR A;  4HB4 B;  2ZKM X;  3A58 A;  2FJU B;  2GCL A;  3AU4 A;  2UVM A;  1W1G A;  2W2X C;  1N3H A;  1X05 A;  2P0D A;  1WVH A;  2COC A;  1EGX A;  2D9Y A;  4DX8 A;  3HIE A;  1H4R A;  4TYZ A;  1I2H A;  2KIE A;  3D8E A;  5C5B B;  2Z59 A;  1V5P A;  3G9W A;  2E2X A;  5CLL B;  5IRS A;  3TW1 A;  2LG1 A;  2COF A;  2M14 A;  1EF1 A;  1V5U A;  2RGN B;  4K81 A;  4A6H A;  2DYQ A;  2DA0 A;  1ZC4 B;  2PZ1 A;  3CXB B;  3P7Z A;  4QXA B;  1KZG A;  2DYN A;  1UNQ A;  2KGX B;  2MKR A;  4ZRK A;  2OQB A;  4GPT B;  3WA0 A;  3ODO A;  3SV1 A;  1NU2 A;  1IRS A;  3ODW A;  4KHB A;  1P5T A;  4ZRI A;  4OSN A;  1UNP A;  3WYF B;  4KHB B;  2R2Y A;  4GMV A;  1ISN A;  3D8F A;  4P7I A;  1XKE A;  5LON B;  3GYP A;  1FHW A;  2J0J A;  2J59 M;  2LOX A;  3TVV A;  3PVL A;  4CSQ A;  2K8E A;  1W1D A;  4HAZ B;  3X23 A;  2EJ8 A;  1U29 A;  2CY4 A;  2COD A;  3U12 A;  5JP4 A;  2NBV A;  3AU5 A;  1GC7 A;  1MPH A;  2K00 A;  3FM8 C;  3VIA A;  4F7G A;  2J0K A;  2X18 A;  2W2W A;  2Z0P A;  1AWE A;  4H8S A;  2W2X D;  3KSY A;  2DTC A;  5D3V A;  4ZRJ A;  3QWM A;  1J19 A;  2DHI A;  2D10 A;  2RNR B;  1OMW A;  3TCA A;  4GN1 A;  2YRY A;  5CLQ B;  2IFS A;  3OAN A;  1OQN A;  3TFM A;  2L1C A;  1K5D B;  5D3W A;  3KRX A;  2KUQ A;  1NI2 A;  2DX5 A;  2GCJ A;  5I2S A;  4DXA B;  2DHJ A;  2LYD A;  1MI1 A;  1TJ6 A;  2Z14 A;  5JHG A;  3DCX A;  1NTY A;  2GUM A;  3QBV B;  2H7E A;  1P6S A;  2YS5 A;  1FOE A;  2K2U A;  3BIN A;  2YT1 A;  1PFJ A;  2DLW A;  2V76 A;  4BBK A;  1BTK A;  2UZS A;  4KAX B;  4DBB A;  2RRF A;  2DHK A;  4CHJ A;  3HSA A;  5HE2 A;  5L81 A;  1DDW A;  2KCJ A;  3KRW A;  4GOU A;  2NZ8 B;  4Z2M B;  2Z13 A;  4GMX B;  4YL8 A;  4K2O A;  3SUZ A;  1UPR A;  3V5W A;  2ROV A;  3NSU A;  3A98 B;  5DHA B;  4CHM A;  4HAX B;  2R0D A;  1T77 A;  2P8V A;  5C5B A;  4HB0 B;  4D0N B;  1SHC A;  5J3Q A;  4MK0 A;  1E5W A;  3FSS A;  3M1I B;  5KQ4 A;  1OY2 A;  2EMT A;  1RRP B;  2K49 A;  4NSW A;  3FVC A;  4KVG B;  2COA A;  2Q13 A;  5FI1 A;  2CY5 A;  3SNH A;  3DXD A;  2UZR A;  1FAO A;  1XCG A;  3PVU A;  3PSC A;  4DX9 0;  1RJ2 A;  2AEH A;  2KUP A;  2LOZ A;  1KZ7 A;  1FHX A;  3PVW A;  2P0F A;  2DKP A;  2RUK B;  3NWF A;  2D2Q A;  4QJ4 B;  5DHF B;  4HDQ A;  3ML4 A;  5HE1 A;  4YON A;  1DDV A;  2DFK A;  4HSI A;  1BAK A;  1MKE A;  5I2M A;  4B6H A;  4HB3 B;  1PMS A;  2YT0 A;  4D6W A;  1BTN A;  1BWN A;  1ZM0 A;  2D4Q A;  1GC6 A;  1Y19 B;  1ZSQ A;  4GZU A;  1PLS A;  2H7D A;  5LG4 B;  2ZPY A;  2D11 A;  2L2I A;  2GS0 A;  2ELB A;  4A5K A;  2DX1 A;  1J0W A;  1V88 A;  2ELA A;  2VKI A;  2P0H A;  2QKL A;  2MWN B;  3F0W A;  2KIG A;  1WJ1 A;  5C6R A;  3HW2 B;  2Z0O A;  3PG7 A;  3RCP A;  5J3T A;  2I5F A;  2M38 A;  4TKN A;  3DXE A;  4C0A A;  1ZC3 B;  2VRW B;  4GXB A;  2Y7B A;  3GYO A;  3NW8 A;  4NY0 A;  4L6E A;  2G35 A;  4A6F A;  1U5F A;  4GNK B;  3U7D A;  4EKU A;  2Y8F A;  1FB8 A;  1MK7 B;  3ZDT A;  3A8P A;  1SGH A;  4DIX A;  1U27 A;  2FJL A;  3N7C A;  1M7E A;  3ULC A;  1H10 A;  2ROZ B;  5EFX A;  4HAY B;  2DN6 A;  1X1G A;  1KI1 B;  1P3R A;  3LJU X;  4IAP A;  4A6K A;  1DDM A;  4KHA A;  4WVF B;  2D9V A;  2YT2 A;  2RLO A;  5D27 A;  1X86 A;  2I1K A;  3NWA A;  3OHM B;  1WI1 A;  5DH9 B;  5D3Y A;  2IYB A;  4XWX A;  3B77 A;  4MT7 A;  1WGU A;  2Z4D A;  3A8Q A;  1MIZ B;  1MAI A;  4HB2 B;  3CIK A;  4HAU B;  2YS1 A;  5J3Y A;  3U8Z A;  3KZ1 A;  4F7U P;  3BJI A;  3ODX A;  4QJ5 B;  2EC1 A;  4EJN A;  2Y8G A;  1U5E A;  1TQZ A;  4IOY X;  5C79 A;  1Y5O A;  3SO6 A;  2MDX A;  1XR0 B;  2QKM A;  2I5C A;  1WGQ A;  5M4Y B;  1NTV A;  3VOQ A;  2RSG A;  1GG3 A;  4HAV B;  4L1R A;  5D3X A;  3HK0 A;  3O96 A;  1QQG A;  4IFS A;  3IVF A;  5JHH A;  3F5R A;  2DKQ A;  1Q67 A;  2YF0 A;  2Z0Q A;  5HE0 A;  4A6F B;  4KHO A;  1XOD A;  2KR0 A;  2XQN M;  2BCJ A;  4F7H A;  3P6A A;  2D9Z A;  1FGZ A;  2VSZ A;  2YS3 A;  3UZT A;  1B55 A;  4WJ7 A;  1V61 A;  5DI9 B;  2I1J A;  4Y94 A;  1QC6 A;  1MIX A;  2GJY A;  5KQ1 A;  1ZYI A;  1AQC A;  5LOP B;  3MDB C;  1MK9 B;  2N23 A;  4WSF A;  1XD4 A;  2HTH B;  4CYE A;  3ZVR A;  4HDO A;  2EMS A;  3AJ4 A;  4OT1 A;  2R09 A;  3TO1 A;  1EVH A;  1EAZ A;  2J0M A;  3DXC A;  1UEF A;  1I7A A;  2YSZ A;  3SYX A;  1DBH A;  4HHV A;  1WG7 A;  1FHO A;  1DYN A;  1UPQ A;  4K2P A;  1Z87 A;  1LB1 A;  2N0Y A;  1V5M A;  2D9W A; 
#chains in the Genus database with same CATH homology
 3TW1 A;  4KHB A;  5LG4 B;  2YT2 A;  4OSN A;  3FSS A;  3NWF A;  4GNK B;  4KHB B;  2R2Y A;  2ZKM X;  4KHO A;  4QJ4 B;  2KR0 A;  2RRF A;  3A58 A;  4QJ5 B;  2K49 A;  4OT1 A;  3NWA A;  2FJU B;  2GCL A;  3GYP A;  2KUQ A;  3FVC A;  4IOY X;  4PQ0 A;  3OHM B;  4GOU A;  4QXA B;  2GCJ A;  3TO1 A;  3TVV A;  4HSI A;  5I2S A;  4CSQ A;  4Z2M B;  2K8E A;  2KIG A;  5I2M A;  2Z13 A;  4DIX A;  5IRS A;  2Z14 A;  5M4Y B;  4D6W A;  2GUM A;  3HIE A;  3NWD A;  3NW8 A;  4Z2N A;  4IFS A;  4L1R A;  2KIE A;  2Z59 A;  3U12 A;  1ZYI A;  4QJ3 B;  2Z4D A;  4KHA A;  3GYO A;  2NBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...