4CSYA

E-selectin lectin, egf-like and two scr domains complexed with sialyl lewis x
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
280
structure length
280
Chain Sequence
b'WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-SELECTIN
publication title E-Selectin Ligand Complexes Adopt an Extended High-Affinity Conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 58
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00059 Lectin_C Lectin C-type domain
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4csyA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4csyA04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4csyA03
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 4csyA01
2BMGA 1ATDA 1KX0A 4M1GA 1UZJA 2VH0B 3ALSA 4COXA 2JGXA 4D0EA 2Y5HL 4E52A 1X2WA 2XC0L 2RLPA 3GXEA 3LTGD 4J6LA 1RDI1 5I0QB 2KMSA 3SW2A 4Y71B 4BXSA 1P4LD 1FIFA 1T8DA 1F0RB 1YGCL 3P5DA 3OLTA 1YXJA 1ZJKA 1NFYB 2BOXA 1MPUA 1OZ7A 2IT6A 3P7HA 1IQML 1U0NB 1FE2A 3KRKA 1E8IA 6COXA 1YXKA 4ISHL 4ZESA 3UBUB 4MMYB 1CX2A 5JB9E 2VJ3A 1UZQA 4B2SA 4IOPB 1BCJ1 2XBVL 3N8XA 5IKTA 4J38B 2PF5A 2GD4A 3PARA 5F1AA 1J35A 2RKYA 2MTIA 2Q1JB 3DEMA 4F4OC 4EZMG 1Z6CA 4A7IA 4BDXA 5JPMG 4WJG2 3P5EA 1KOEA 1P0SL 3IJEB 5IKRA 2W86A 4PZ5A 3NJPC 1N1IA 3BDWA 3PAKA 4PDCA 1KWWA 3U7UG 1K9JA 1V7PB 2RICA 3BT2A 1E87A 1FVUA 3KQEL 4GK1A 1C3AB 3SOVA 1HJ7A 3HO5A 3G8LA 4AYMA 5COXA 2BPDA 1KCGA 3FBYA 1CCVA 1BYFA 2XRBA 5CISA 1HFIA 4GKOG 3M36L 1AUTL 2XWJI 3WBRA 1WHEA 2Y7XB 3K9XA 3IX0A 3OP8A 2WYJB 1UOSB 2W2NE 2W2PE 3KQGA 2BRSA 1HCCA 1IGZA 1MUQA 2RA0L 4WUXA 3F6UL 4N32A 1Q4GA 3N8WA 2XBXL 4XL1A 2GO0A 4N38A 1G1SA 1CKLA 3GPRD 2BQ7A 2KV4A 1NFUB 4J6PA 1SL5A 3N8YA 1L3YA 1UEXA 2WYGB 5CKMA 1EBVA 1KIGL 3BT1A 1G1TA 1KWZA 1UV0A 3C22A 3NT1A 4YLIA 1IQKL 1EPJA 5IKVA 4PP8A 3WH3A 1CQEA 1QGBA 5JW1A 1NZIA 2GGXA 3P5HA 2G00L 4CAJA 2RL0A 2BOHA 1QO6A 1EMNA 3EGFA 4Y76B 3HS5A 2J4IB 2RLQA 2NPRA 1RDN1 2YHFA 1UKMB 3ZYIB 3WBQA 2K2SB 4LOSA 2JKHL 1G4FA 1SL6A 1IQIL 1IVOC 1HRFA 3H5CB 2TGFA 5L2YL 3M7PA 4AYIA 2C6UA 1H8UA 2BZMA 1H04P 1PGEA 1EPHA 3TH3L 4MMZB 1FSBA 1PWBA 1IXXB 2I9BA 4QKJA 4Y79B 4MUCA 1JZNA 1TLEA 1IODB 1EGGA 1XDTR 4N36A 4C16A 1EAIC 4LORA 2MCZA 3IU3I 1DY2A 2WIIC 1QO3C 3PAQA 3VYJA 2FLGA 1O5DL 1YTTA 3FFGL 1TDQB 3BPSE 1KSNB 4C9FA 1CVWL 2UWPB 3ALUA 1OK2A 1F7MA 1HREA 1NFWB 2B5ID 3ALTA 2ZIBA 1LMJA 3RJ3D 1AFB1 2Y5FL 4X8TL 1J9CL 1HT5A 4ISIL 1V3XB 2B7DL 2W3IB 1E8BA 1IQGL 1M1XB 2BO2A 4E1GA 4JHSA 5FFRA 1Y17A 1EPGA 3BX4A 1U8CB 4X8VL 3GCWE 1BCH1 1VVDA 3OXUD 3ASIA 2MGRA 3TK5B 3P5IA 4KZVA 4CUFA 1FF7A 3LN0A 3IKNA 2MSBA 1APQA 5FFSA 1W8BL 2GGUA 4AYDA 1LPKA 1HX2A 3CDGF 2VWMK 5FO8C 5LGKE 2W2QE 5EGMB 5JVYA 1KZA1 1J35B 3VLGA 1O7BT 2RIAA 2IZ4A 3GPRA 1TN3A 1SB2B 3FF7C 3ZHGD 1UOTP 4IGDA 1COUA 2FZZL 4AK8A 4GJXA 4Z6AL 1H2QP 2JRAA 1EQHA 1WHFA 1KZC1 2WPKE 1TPNA 4ZAEB 2KL7A 1KZB1 3BDWB 2PUQL 5KTHA 5CKQA 2IT5A 4YT6L 1ELVA 3MQEA 1ATEA 4RRWA 1FVUB 5B1XA 2OX9A 2WPLE 1PRHA 1J34A 2RHPA 2UWLB 3F1SB 2D1JB 4ZH1D 1WT9A 4MTHA 4YMDA 3ZRZA 1B6EA 1KG0C 4G96A 4KMB1 2WPIE 1SL4A 1HYRA 4NG9L 3O8EB 3R62A 1DX5I 4J6MA 1G4GA 3LN1A 3TK6B 2WFTA 1KX1A 2VVCK 2XWBF 3M9ZA 3P5GA 1A3PA 1EZQB 1QUBA 1KWYA 1P1ZD 1PXXA 1V4LA 1YPOA 3N8YB 2WPJE 2BPHA 1JA3A 2Y80B 3V64C 2JGWA 2P95L 5J6GG 2H9EL 5HYTB 2OS9A 2CL8A 4KI1E 2XR5A 3ZYJB 2ORJA 1RDL1 1GPZA 3KL6B 1U0OA 1YPQA 3IKRA 2FLRL 3C8KD 3ZYGA 2VUVA 1R13A 1HTNA 1IQFL 1HAEA 4UWWA 3C8JA 1I0UA 1DVAL 4ZRWA 3CDGE 2Y81B 1ESLA 1EGIA 4G9AA 4OTJA 1FAKL 3NCWA 4QKIA 1XPHA 3M37L 2BQ6A 3LC5B 1IQLL 5HYPA 1AFD1 2BPEA 5IKQA 1WMYA 2PY2A 4ZRVA 2WG4B 2XRDA 3INBC 1IP0A 1LQDA 3HS6A 3N8VA 2XR6A 3UBUA 5HZPB 1IJQA 2ORKA 3V65B 2N40A 3CA7A 5JB8E 1JWIA 3WH2A 1UMRC 1RDM1 3LTFB 4RS0A 1KWXA 4WUWA 2OYUP 3HPTA 3MDLA 3P5BL 3FF8C 1CWVA 4DN8A 1G1RA 2OX8A 2DDUA 5KTIA 3ZHGA 1MD8A 3L9JC 4QKHA 5JBAE 1KLIL 2M74A 1NFXB 2P3UA 2MGPA 1VVCA 2UWOB 1BUUA 1UZKA 4AYEA 4WR9A 3NTGA 3ZD2A 4A5WB 1MQ6L 1C5MF 4WREA 3OEDC 2XBWL 4WCOA 1Y17B 3BX4B 4NGAL 1N7DA 1V7PA 4OTYA 4J6JA 4CSYA 1E5GA 1GK5A 4M17A 3R05A 4BTUA 3KZJA 4DJZA 1XARA 3CCKA 3GCXE 3SOBB 3KXVA 3G84A 5F19A 4YT7L 2BZ6L 1LPZA 5M62A 4G1MB 2VWOL 2F9BL 1E88A 4TGFA 2ADXA 2BQWA 2J94B 2LOJA 1DV8A 4BTTA 1L5GB 1G1QA 2FD6A 4BTIA 1JV2B 2XC5L 2ZQKA 2YBYA 1OJWA 5F2QA 1X2WB 4KKDA 4JZFL 4LQFA 2RIEA 3FD4A 1XKBA 4LMFA 4Y7BB 1HQ8A 3KMB1 2KRIA 4N33A 3FCSB 2YRAA 4LOTA 1H2PP 1OZ7B 2O39C 5FFTA 3G83A 1EPIA 1BNLA 1YUKB 2V8EA 2KV3A 4BDWA 1URKA 4Z0LA 5K8YA 1U67A 3EJHA 1J34B 3KQDL 5E8DA 1ATAA 5JBBE 2RNLA 1MSBA 5B1RA 2ERJA 2EI6B 1F0SB 1W7XL 2KB9A 1OJYA 2Y82B 5L30L 3WWKA 3ENSA 3KCGL 1NQLB 5FDQA 2I83A 5KIRA 4JYVL 4FM5A 1EQGA 2AYLA 1OK9A 1X2TA 4RUTA 1Z6EL 3QH0A 4AQTA 2VRPA 3PBFA 1KLOA 1KZD1 2P28B 1GKGA 1C1ZA 1IODA 4ZXXL 4ZETA 1V4LB 2MHPA 1RJHA 5CKNA 4B2RA 2EI7B 4XLWA 1YO8A 1RDJ1 4JZDL 2BOKL 2Y7ZB 1TLGA 3T5OA 1WMZA 1F00I 1U0OB 1HCGB 1OB1C 3KK6A 3Q7DA 4O02B 1BV4A 1R14A 4WQQA 5L2ZL 3IKQA 2G7IA 3IKPA 3TZIA 2VWNL 3NTBA 2BOUA 2W81A 2VUZA 2VVUL 4M11A 1CCFA 5KN5C 4PH9A 1QFKL 1NWVA 3L89M 2P93L 1IQNL 3G81A 1TOZA 3G8KA 1DY0A 3RR3A 1IJKC 2XQWC 1PTHA 5K0HB 3HS7A 1FAXL 3ELAL 3N8WB 4ZXYL 4Y7AB 1K36A 5HYUB 1LPGA 1O9AA 1FM5A 2CG7A 3TGFA 1MOXC 1XFEA 4RRXA 4RRYA 1PFXL 3LC3B 4YZUB 1UEXB 1ATBA 3DBZA 1LY2A 3ZD1A 1KLJL 4WRFA 2EHFA 2YGOA 5JVZA 4NA9L 1JWIB 1RDK1 3ERBA 1BJ3A 3RS1A 2QY0A 1E5UI 1WK1A 4WRCA 2P3FL 4GI0A 4LU5A 4JZEL 1G2LB 4XBMA 1SB2A 3N8ZA 3KQBL 1TPGA 4RRZA 3GOVA 1YUFA 1IJKB 1FJSL 4D0FA 3Q3KB 2CG6A 1DIYA 3P7FA 4QKGA 3T3AA 1CEJA 3U73A 4N35A 4D90A 1WU1B 2P26A 1Q3XA 1KMB1 1MQ5L 2FLBL 2H2TB 1EMOA 1B9WA 5I46L 1MD7A 2VVVL 1OK1A 2EC3A 3TVJA 2XC4L 4Y6DB 3WBPA 1NPEB 1NT0A 4IOPA 3IITB 1KWVA 3HO3A 3QCWA 2P16L 4J6NA 1HZ8A 1KWUA 2Y5GL 1JBUL 1F02I 1FBRA 3PGHA 3SOQA 1DDXA 4X8SL 4M10A 2I9AA 1Z92B 1K9IA 2RIDA 3WWKC 1HAFA 2OYEP 2W3KB 3GPRC 3SW0X 1KWTA 4M18A 3FF9A 2P3TA 1U5MA 1QDDA 3CFWA 1HT8A 1RDO1 2AFPA 4CUEA 3POYA 4MMXB 1DQBA 1C3AA 3CALA 2IZ3A 3HO4A 3QMOA 1CVUA 3CS7L 1BF9A 1YPUA 1OK3A 1FIHA 1AFA1 1IQJL 2J34B 2P94L 3LAQA 4CUDA 2A55A 3CENL 1TPMA 2WG3C 4Z0KB 2K2TA 1UOSA 1EGFA 2PHBB 3WWKB 4ZH8B 4K12A 3GPRB 1GHQB 5JBCE 2PR3B 4JYUL 1JL9A 1RFNB 2LS8A 5B1WA 1SS2A 3VPPA 2VRPB 1P9JA 1IQEL 2WPHE 1X2TB 1FFMA 1GZ2A 1IOEL 2E3XC 3OLUA 3WSRA 1IGXA 4J6KA 1X7AL 2J38B 4ZHAB 2YGPA 2P3FN 2CKUA 1KZE1 2EI8B 1B08A 2CJIB 1DY1A 2M94A 1IOXA 3WHDA 2UWNA 1G2MB 2J95B 4X8UL 1GKNA 4YNXA 2WPME 1ZAQA 3NFPI 2KMB1 3MQLA 4ONTD 1RTM1 1K37A 2ZWKA 1UKMA 3P5FA 3P7GA 1OJVA 1WT9B 1IQHL 4N37A 4S0UA 2MCYA 3NCXA 1XKAL 4KZWA 1ADXA 4GJ0A 3K7BA 2RIBA 2J2UB 1APOA 2H2RA 2W2OE 1YUGA 2Y38A 3LIWB 4J6QA 2W80A 1SRZA 4FXGG 2E3XB 2W26B 1IXXA 2VH6B 2VWLL 1PW9A 3HUPA 2WFXB 3CADA 3GISX 1T8CA 4UXMA 1F7EA 2RKZA 3VYKA 1UMRA 1HFHA 1LITA 4O1ZA 4N34A 2W2ME 3KQCL 2XBYL 1H03P 1HUPA 1U0NC 3TBDA 1PPQA 4BXWA 1O7CT 3C9AC 1BJ3B 1UZPA 1SZBA
chains in the Genus database with same CATH superfamily
2BMGA 1ATDA 1KX0A 4M1GA 1UZJA 2VH0B 3ALSA 4COXA 2JGXA 4D0EA 2Y5HL 4E52A 1X2WA 2XC0L 2RLPA 3GXEA 3LTGD 4J6LA 1RDI1 5I0QB 2KMSA 3SW2A 4Y71B 4BXSA 1P4LD 1FIFA 1T8DA 1F0RB 1YGCL 3P5DA 3OLTA 1YXJA 1ZJKA 1NFYB 2BOXA 1MPUA 1OZ7A 2IT6A 4PO7A 3P7HA 1IQML 1U0NB 1FE2A 3KRKA 1E8IA 6COXA 1YXKA 4ISHL 4APLA 4ZESA 3K3TA 4MMYB 3UBUB 1CX2A 5JB9E 2VJ3A 1UZQA 4B2SA 4IOPB 1BCJ1 2XBVL 3N8XA 5IKTA 4J38B 2PF5A 2GD4A 3PARA 5F1AA 2JJLA 1J35A 2RKYA 2MTIA 2H9EC 2Q1JB 3DEMA 4F4OC 4EZMG 1Z6CA 2VRSA 4A7IA 4BDXA 5JPMG 4WJG2 3P5EA 1KOEA 1P0SL 3IJEB 1LMMA 5IKRA 2W86A 4PZ5A 3NJPC 1N1IA 2ZYCA 3BDWA 3PAKA 4PDCA 1KWWA 3U7UG 1K9JA 1V7PB 2RICA 3BT2A 1E87A 1FVUA 3KQEL 4GK1A 1C3AB 3SOVA 1HJ7A 3HO5A 3G8LA 4AYMA 5COXA 2BPDA 1KCGA 3FBYA 1CCVA 1BYFA 2XRBA 5CISA 1HFIA 4GKOG 3M36L 1AUTL 2XWJI 3WBRA 1WHEA 2Y7XB 3K9XA 3IX0A 3OP8A 2WYJB 1UOSB 2W2NE 2W2PE 5DN4A 3KQGA 2BRSA 1HCCA 1IGZA 1MUQA 2RA0L 4WUXA 3F6UL 4N32A 1Q4GA 3N8WA 2XBXL 4XL1A 2GO0A 4N38A 1G1SA 1CKLA 3GPRD 2BQ7A 2KV4A 1NFUB 4J6PA 1SL5A 3N8YA 1L3YA 1UEXA 2WYGB 5CKMA 1EBVA 1KIGL 3BT1A 1G1TA 1KWZA 1UV0A 3C22A 3NT1A 4MSLA 1IQKL 1EPJA 4YLIA 5IKVA 4PP8A 3WH3A 1CQEA 1QGBA 5JW1A 1NZIA 2GGXA 3P5HA 2G00L 4CAJA 2RL0A 2BOHA 1QO6A 1EMNA 3EGFA 4Y76B 3HS5A 2J4IB 2RLQA 2NPRA 1RDN1 2YHFA 1UKMB 3ZYIB 3WBQA 2K2SB 4LOSA 2JKHL 1G4FA 1SL6A 1IQIL 1IVOC 1HRFA 3H5CB 2TGFA 5L2YL 3M7PA 4AYIA 2C6UA 1QIUA 2BZMA 1H8UA 1H04P 1PGEA 1EPHA 3TH3L 4MMZB 1FSBA 1PWBA 1IXXB 2I9BA 4QKJA 4Y79B 2HORA 4MUCA 1JZNA 1TLEA 1IODB 1EGGA 1XDTR 4N36A 4C16A 1EAIC 4LORA 2MCZA 3IU3I 1DY2A 2WIIC 1QO3C 3PAQA 3VYJA 2FLGA 1O5DL 1YTTA 3FFGL 1TDQB 3BPSE 1KSNB 4C9FA 1CVWL 2UWPB 3ALUA 1OK2A 1F7MA 1LK9A 1HREA 1NFWB 2B5ID 3ALTA 2ZIBA 2YGQA 1LMJA 3RJ3D 1AFB1 2Y5FL 4X8TL 1J9CL 1HT5A 4ISIL 1V3XB 2B7DL 2W3IB 1E8BA 1IQGL 1M1XB 3ZLDA 2BO2A 4E1GA 4JHSA 5FFRA 1Y17A 1EPGA 3BX4A 1U8CB 4X8VL 3GCWE 1BCH1 1VVDA 3OXUD 3ASIA 2MGRA 3TK5B 3P5IA 4KZVA 4CUFA 1FF7A 3LN0A 3IKNA 2MSBA 1APQA 5FFSA 1W8BL 2GGUA 4AYDA 1LPKA 1HX2A 3CDGF 2VWMK 5FO8C 5LGKE 2W2QE 5EGMB 5JVYA 1KZA1 1J35B 3VLGA 1O7BT 2RIAA 2IZ4A 3GPRA 1TN3A 1SB2B 3FF7C 3ZHGD 1UOTP 4IGDA 1COUA 2FZZL 4AK8A 4GJXA 4Z6AL 1H2QP 2JRAA 1EQHA 1WHFA 1KZC1 2WPKE 1TPNA 2BSFA 4ZAEB 2KL7A 4GU3A 1KZB1 3BDWB 2PUQL 5KTHA 5CKQA 2IT5A 4YT6L 1ELVA 3MQEA 1ATEA 4RRWA 1FVUB 5B1XA 2OX9A 2WPLE 1PRHA 1J34A 2RHPA 2UWLB 3F1SB 2D1JB 4ZH1D 1WT9A 4MTHA 4YMDA 3ZRZA 1B6EA 1KG0C 4G96A 4KMB1 2WPIE 1SL4A 1HYRA 4NG9L 3O8EB 3R62A 1DX5I 4J6MA 1G4GA 3LN1A 3TK6B 2WFTA 1KX1A 2VVCK 2XWBF 3M9ZA 3P5GA 1A3PA 1EZQB 1QUBA 1KWYA 1P1ZD 1PXXA 2X2ZA 1V4LA 1YPOA 3N8YB 2WPJE 2BPHA 1JA3A 2Y80B 3V64C 2JGWA 2P95L 5J6GG 2H9EL 5HYTB 2OS9A 2CL8A 4KI1E 2XR5A 3ZYJB 2ORJA 1RDL1 1GPZA 3KL6B 1U0OA 1YPQA 3IKRA 2FLRL 3C8KD 3ZYGA 1V1IA 2VUVA 1R13A 1HTNA 1IQFL 1HAEA 4UWWA 3C8JA 1I0UA 1DVAL 4ZRWA 3CDGE 2Y81B 1ESLA 1EGIA 4G9AA 4OTJA 1FAKL 3NCWA 4QKIA 1XPHA 3M37L 2BT8A 2BQ6A 3LC5B 1IQLL 5HYPA 1AFD1 2BPEA 5IKQA 1KKEA 1WMYA 2PY2A 2WG4B 2XRDA 3INBC 4ZRVA 1IP0A 1LQDA 3HS6A 3N8VA 2XR6A 3UBUA 5HZPB 1IJQA 2ORKA 5DN5A 3V65B 2N40A 3CA7A 5JB8E 1JWIA 3WH2A 1UMRC 1RDM1 3LTFB 4RS0A 1KWXA 4WUWA 2OYUP 3HPTA 3MDLA 3P5BL 3FF8C 1CWVA 4DN8A 1G1RA 2OX8A 2DDUA 5KTIA 3ZHGA 1MD8A 3L9JC 4QKHA 5JBAE 1KLIL 3F6KA 2M74A 1NFXB 2P3UA 2MGPA 1VVCA 2UWOB 1BUUA 1UZKA 4AYEA 4WR9A 3NTGA 3ZD2A 4A5WB 1MQ6L 1C5MF 4WREA 2WZPP 3OEDC 2XBWL 4WCOA 1Y17B 3BX4B 4NGAL 1N7DA 1V7PA 4OTYA 4J6JA 4CSYA 1E5GA 1GK5A 4M17A 3R05A 4BTUA 3KZJA 4DJZA 1XARA 3CCKA 3GCXE 3SOBB 3KXVA 3G84A 5F19A 3ZLEA 4YT7L 2BZ6L 1LPZA 5M62A 3WSYA 4G1MB 2VWOL 2F9BL 1E88A 4TGFA 2ADXA 2BQWA 2J94B 2LOJA 1DV8A 4BTTA 1L5GB 1G1QA 3CI0J 2FD6A 4BTIA 1JV2B 2XC5L 2ZQKA 2YBYA 1OJWA 5F2QA 1X2WB 4KKDA 4JZFL 4LQFA 2RIEA 3FD4A 1XKBA 4LMFA 4Y7BB 1HQ8A 3KMB1 2KRIA 4N33A 2BT7A 3FCSB 2YRAA 4LOTA 1H2PP 2I2LA 2O39C 1OZ7B 5FFTA 3G83A 1EPIA 1BNLA 1YUKB 2V8EA 2KV3A 4BDWA 1URKA 4Z0LA 5K8YA 1U67A 3EJHA 1J34B 3KQDL 5E8DA 1ATAA 5JBBE 2RNLA 1MSBA 5B1RA 2ERJA 2EI6B 1F0SB 1W7XL 2KB9A 1OJYA 2Y82B 5L30L 3WWKA 3NJAA 3ENSA 3KCGL 1NQLB 5FDQA 4BWCA 2I83A 5KIRA 4JYVL 4FM5A 1EQGA 2AYLA 1OK9A 4YIZA 4RUTA 1Z6EL 3QH0A 4AQTA 1X2TA 2VRPA 1KLOA 1KZD1 3PBFA 2P28B 1GKGA 1C1ZA 1IODA 4ZXXL 4ZETA 1V4LB 2MHPA 1RJHA 5CKNA 4B2RA 2EI7B 4XLWA 1YO8A 1RDJ1 4JZDL 2BOKL 2Y7ZB 1TLGA 3T5OA 1WMZA 1F00I 1U0OB 1HCGB 1OB1C 1V1HA 3KK6A 3Q7DA 4O02B 1BV4A 1R14A 5L2ZL 4WQQA 3IKQA 2G7IA 3IKPA 3TZIA 2VWNL 3NTBA 2BOUA 2W81A 2VUZA 2VVUL 4M11A 1CCFA 5KN5C 4PH9A 1QFKL 1NWVA 3L89M 2P93L 1IQNL 3G81A 1TOZA 3G8KA 1DY0A 3RR3A 1IJKC 2XQWC 1RLHA 1PTHA 5K0HB 3HS7A 1FAXL 3ELAL 3N8WB 4ZXYL 4Y7AB 1K36A 5HYUB 1LPGA 1O9AA 1FM5A 2CG7A 3TGFA 1MOXC 1XFEA 4RRXA 4RRYA 1PFXL 3LC3B 4YZUB 1UEXB 1ATBA 3DBZA 1LY2A 3ZD1A 1KLJL 4WRFA 2EHFA 2YGOA 5JVZA 4NA9L 1JWIB 1RDK1 3ERBA 1BJ3A 3RS1A 2QY0A 1E5UI 1WK1A 4WRCA 2P3FL 4GI0A 4LU5A 4JZEL 1G2LB 4XBMA 1SB2A 3N8ZA 3KQBL 1TPGA 4RRZA 3GOVA 1YUFA 1IJKB 1FJSL 4D0FA 3Q3KB 2Y8RA 2CG6A 1DIYA 3P7FA 4QKGA 3T3AA 1CEJA 3U73A 4N35A 4D90A 1WU1B 2P26A 1Q3XA 1KMB1 1MQ5L 2FLBL 2H2TB 1EMOA 1B9WA 5I46L 1MD7A 2VVVL 1OK1A 2EC3A 2Y8TA 3TVJA 2XC4L 4Y6DB 3WBPA 1NPEB 1NT0A 4IOPA 3IITB 2Y8SA 1KWVA 3HO3A 3VWOA 3QCWA 2P16L 4J6NA 1HZ8A 1KWUA 2Y5GL 1JBUL 1F02I 1FBRA 3PGHA 3SOQA 1DDXA 4X8SL 4M10A 2I9AA 1Z92B 1K9IA 4N7EA 2RIDA 3WWKC 1HAFA 2OYEP 2W3KB 3GPRC 3SW0X 1KWTA 4M18A 3FF9A 2P3TA 1U5MA 1QDDA 3CFWA 1HT8A 4A94C 1RDO1 2AFPA 4CUEA 3POYA 4MMXB 1DQBA 1C3AA 3CALA 2IZ3A 3HO4A 3QMOA 1CVUA 3CS7L 1BF9A 1YPUA 1OK3A 1FIHA 1AFA1 3LAQA 1IQJL 2J34B 2P94L 2HOXA 4CUDA 3FGTA 2A55A 3CENL 1TPMA 2WG3C 4Z0KB 2K2TA 3S6XA 1UOSA 1EGFA 2PHBB 3WWKB 4ZH8B 4K12A 3GPRB 1GHQB 5JBCE 2PR3B 4JYUL 1JL9A 1RFNB 3WSXA 2LS8A 1SS2A 5B1WA 3VPPA 2VRPB 1P9JA 1IQEL 2WPHE 1X2TB 1FFMA 1GZ2A 1IOEL 2E3XC 3OLUA 3WSRA 1IGXA 4J6KA 1X7AL 2J38B 4ZHAB 2YGPA 2P3FN 2CKUA 1KZE1 2EI8B 1B08A 2CJIB 1DY1A 2M94A 1IOXA 3WHDA 2UWNA 1G2MB 2J95B 4X8UL 1GKNA 4YNXA 2WPME 1ZAQA 3NFPI 2KMB1 3MQLA 4ONTD 1RTM1 1K37A 2KNIA 2ZWKA 1UKMA 3P5FA 3P7GA 1OJVA 1WT9B 1IQHL 4N37A 4S0UA 2MCYA 3NCXA 1XKAL 4KZWA 1ADXA 4GJ0A 3K7BA 2RIBA 2J2UB 1APOA 2H2RA 2W2OE 1YUGA 2Y38A 3LIWB 4J6QA 2W80A 1SRZA 4GU4A 4FXGG 2E3XB 2W26B 1IXXA 2VH6B 2VWLL 1PW9A 3HUPA 2WFXB 3CADA 3GISX 1T8CA 4UXMA 1F7EA 2RKZA 3VYKA 1UMRA 1HFHA 1LITA 4O1ZA 4N34A 2W2ME 3KQCL 2XBYL 1H03P 1HUPA 1U0NC 3TBDA 3FGRA 1PPQA 4BXWA 1O7CT 3C9AC 1BJ3B 1UZPA 1SZBA
chains in the Genus database with same CATH topology
2BMGA 1ATDA 1KX0A 4M1GA 1UZJA 2VH0B 3ALSA 4COXA 2JGXA 4D0EA 2Y5HL 4E52A 1X2WA 2XC0L 2RLPA 3GXEA 3LTGD 4J6LA 1RDI1 5I0QB 2KMSA 3SW2A 4Y71B 4BXSA 1P4LD 1FIFA 1T8DA 1F0RB 1YGCL 3P5DA 3OLTA 1YXJA 1ZJKA 1NFYB 2BOXA 1MPUA 1OZ7A 2IT6A 3P7HA 1IQML 1U0NB 1FE2A 3KRKA 1E8IA 6COXA 1YXKA 4ISHL 4ZESA 3UBUB 4MMYB 1CX2A 5JB9E 2VJ3A 1UZQA 4B2SA 4IOPB 1BCJ1 2XBVL 3N8XA 5IKTA 4J38B 2PF5A 2GD4A 3PARA 5F1AA 1J35A 2RKYA 2MTIA 2H9EC 2Q1JB 3DEMA 4F4OC 4EZMG 1Z6CA 4A7IA 4BDXA 5JPMG 4WJG2 3P5EA 1KOEA 1P0SL 3IJEB 1LMMA 5IKRA 2W86A 4PZ5A 3NJPC 1N1IA 3BDWA 3PAKA 4PDCA 1KWWA 3U7UG 1K9JA 1V7PB 2RICA 3BT2A 1E87A 1FVUA 3KQEL 4GK1A 1C3AB 3SOVA 1HJ7A 3HO5A 3G8LA 4AYMA 5COXA 2BPDA 1KCGA 3FBYA 1CCVA 1BYFA 2XRBA 5CISA 1HFIA 4GKOG 3M36L 1AUTL 2XWJI 3WBRA 1WHEA 2Y7XB 3K9XA 3IX0A 3OP8A 2WYJB 1UOSB 2W2NE 2W2PE 3KQGA 2BRSA 1HCCA 1IGZA 1MUQA 2RA0L 4WUXA 3F6UL 4N32A 1Q4GA 3N8WA 2XBXL 4XL1A 2GO0A 4N38A 1G1SA 1CKLA 3GPRD 2BQ7A 2KV4A 1NFUB 4J6PA 1SL5A 3N8YA 1L3YA 1UEXA 2WYGB 5CKMA 1EBVA 1KIGL 3BT1A 1G1TA 1KWZA 1UV0A 3C22A 3NT1A 4YLIA 1IQKL 1EPJA 5IKVA 4PP8A 3WH3A 1CQEA 1QGBA 5JW1A 1NZIA 2GGXA 3P5HA 2G00L 4CAJA 2RL0A 2BOHA 1QO6A 1EMNA 3EGFA 4Y76B 3HS5A 2J4IB 2RLQA 2NPRA 1RDN1 2YHFA 1UKMB 3ZYIB 3WBQA 2K2SB 4LOSA 2JKHL 1G4FA 1SL6A 1IQIL 1IVOC 1HRFA 3H5CB 2TGFA 5L2YL 3M7PA 4AYIA 2C6UA 1H8UA 2BZMA 1H04P 1PGEA 1EPHA 3TH3L 4MMZB 1FSBA 1PWBA 1IXXB 2I9BA 4QKJA 4Y79B 4MUCA 1JZNA 1TLEA 1IODB 1EGGA 1XDTR 4N36A 4C16A 1EAIC 4LORA 2MCZA 3IU3I 1DY2A 2WIIC 1QO3C 3PAQA 3VYJA 2FLGA 1O5DL 1YTTA 3FFGL 1TDQB 3BPSE 1KSNB 4C9FA 1CVWL 2UWPB 3ALUA 1OK2A 1F7MA 1HREA 1NFWB 2B5ID 3ALTA 2ZIBA 2YGQA 1LMJA 3RJ3D 1AFB1 2Y5FL 4X8TL 1J9CL 1HT5A 4ISIL 1V3XB 2B7DL 2W3IB 1E8BA 1IQGL 1M1XB 2BO2A 4E1GA 4JHSA 5FFRA 1Y17A 1EPGA 3BX4A 1U8CB 4X8VL 3GCWE 1BCH1 1VVDA 3OXUD 3ASIA 2MGRA 3TK5B 3P5IA 4KZVA 4CUFA 1FF7A 3LN0A 3IKNA 2MSBA 1APQA 5FFSA 1W8BL 2GGUA 4AYDA 1LPKA 1HX2A 3CDGF 2VWMK 5FO8C 5LGKE 2W2QE 5EGMB 5JVYA 1KZA1 1J35B 3VLGA 1O7BT 2RIAA 2IZ4A 3GPRA 1TN3A 1SB2B 3FF7C 3ZHGD 1UOTP 4IGDA 1COUA 2FZZL 4AK8A 4GJXA 4Z6AL 1H2QP 2JRAA 1EQHA 1WHFA 1KZC1 2WPKE 1TPNA 4ZAEB 2KL7A 1KZB1 3BDWB 2PUQL 5KTHA 5CKQA 2IT5A 4YT6L 1ELVA 3MQEA 1ATEA 4RRWA 1FVUB 5B1XA 2OX9A 2WPLE 1PRHA 1J34A 2RHPA 2UWLB 3F1SB 2D1JB 4ZH1D 1WT9A 4MTHA 4YMDA 3ZRZA 1B6EA 1KG0C 4G96A 4KMB1 2WPIE 1SL4A 1HYRA 4NG9L 3O8EB 3R62A 1DX5I 4J6MA 1G4GA 3LN1A 3TK6B 2WFTA 1KX1A 2VVCK 2XWBF 3M9ZA 3P5GA 1A3PA 1EZQB 1QUBA 1KWYA 1P1ZD 1PXXA 1V4LA 1YPOA 3N8YB 2WPJE 2BPHA 1JA3A 2Y80B 3V64C 2JGWA 2P95L 5J6GG 2H9EL 5HYTB 2OS9A 2CL8A 4KI1E 2XR5A 3ZYJB 2ORJA 1RDL1 1GPZA 3KL6B 1U0OA 1YPQA 3IKRA 2FLRL 3C8KD 3ZYGA 2VUVA 1R13A 1HTNA 1IQFL 1HAEA 4UWWA 3C8JA 1I0UA 1DVAL 4ZRWA 3CDGE 2Y81B 1ESLA 1EGIA 4G9AA 4OTJA 1FAKL 3NCWA 4QKIA 1XPHA 3M37L 2BQ6A 3LC5B 1IQLL 5HYPA 1AFD1 2BPEA 5IKQA 1WMYA 2PY2A 4ZRVA 2WG4B 2XRDA 3INBC 1IP0A 1LQDA 3HS6A 3N8VA 2XR6A 3UBUA 5HZPB 1IJQA 2ORKA 3V65B 2N40A 3CA7A 5JB8E 1JWIA 3WH2A 1UMRC 1RDM1 3LTFB 4RS0A 1KWXA 4WUWA 2OYUP 3HPTA 3MDLA 3P5BL 3FF8C 1CWVA 4DN8A 1G1RA 2OX8A 2DDUA 5KTIA 3ZHGA 1MD8A 3L9JC 4QKHA 5JBAE 1KLIL 2M74A 1NFXB 2P3UA 2MGPA 1VVCA 2UWOB 1BUUA 1UZKA 4AYEA 4WR9A 3NTGA 3ZD2A 4A5WB 1MQ6L 1C5MF 4WREA 2WZPP 3OEDC 2XBWL 4WCOA 1Y17B 3BX4B 4NGAL 1N7DA 1V7PA 4OTYA 4J6JA 4CSYA 1E5GA 1GK5A 4M17A 3R05A 4BTUA 3KZJA 4DJZA 1XARA 3CCKA 3GCXE 3SOBB 3KXVA 3G84A 5F19A 4YT7L 2BZ6L 1LPZA 5M62A 4G1MB 2VWOL 2F9BL 1E88A 4TGFA 2ADXA 2BQWA 2J94B 2LOJA 1DV8A 4BTTA 1L5GB 1G1QA 2FD6A 4BTIA 1JV2B 2XC5L 2ZQKA 2YBYA 1OJWA 5F2QA 1X2WB 4KKDA 4JZFL 4LQFA 2RIEA 3FD4A 1XKBA 4LMFA 4Y7BB 1HQ8A 3KMB1 2KRIA 4N33A 3FCSB 2YRAA 4LOTA 1H2PP 1OZ7B 2O39C 5FFTA 3G83A 1EPIA 1BNLA 1YUKB 2V8EA 2KV3A 4BDWA 1URKA 4Z0LA 5K8YA 1U67A 3EJHA 1J34B 3KQDL 5E8DA 1ATAA 5JBBE 2RNLA 1MSBA 5B1RA 2ERJA 2EI6B 1F0SB 1W7XL 2KB9A 1OJYA 2Y82B 5L30L 3WWKA 3ENSA 3KCGL 1NQLB 5FDQA 2I83A 5KIRA 4JYVL 4FM5A 1EQGA 2AYLA 1OK9A 1X2TA 4RUTA 1Z6EL 3QH0A 4AQTA 2VRPA 3PBFA 1KLOA 1KZD1 2P28B 1GKGA 1C1ZA 1IODA 4ZXXL 4ZETA 1V4LB 2MHPA 1RJHA 5CKNA 4B2RA 2EI7B 4XLWA 1YO8A 1RDJ1 4JZDL 2BOKL 2Y7ZB 1TLGA 3T5OA 1WMZA 1F00I 1U0OB 1HCGB 1OB1C 3KK6A 3Q7DA 4O02B 1BV4A 1R14A 4WQQA 5L2ZL 3IKQA 2G7IA 3IKPA 3TZIA 2VWNL 3NTBA 2BOUA 2W81A 2VUZA 2VVUL 4M11A 1CCFA 5KN5C 4PH9A 1QFKL 1NWVA 3L89M 2P93L 1IQNL 3G81A 1TOZA 3G8KA 1DY0A 3RR3A 1IJKC 2XQWC 1PTHA 5K0HB 3HS7A 1FAXL 3ELAL 3N8WB 4ZXYL 4Y7AB 1K36A 5HYUB 1LPGA 1O9AA 1FM5A 2CG7A 3TGFA 1MOXC 1XFEA 4RRXA 4RRYA 1PFXL 3LC3B 4YZUB 1UEXB 1ATBA 3DBZA 1LY2A 3ZD1A 1KLJL 4WRFA 2EHFA 2YGOA 5JVZA 4NA9L 1JWIB 1RDK1 3ERBA 1BJ3A 3RS1A 2QY0A 1E5UI 1WK1A 4WRCA 2P3FL 4GI0A 4LU5A 4JZEL 1G2LB 4XBMA 1SB2A 3N8ZA 3KQBL 1TPGA 4RRZA 3GOVA 1YUFA 1IJKB 1FJSL 4D0FA 3Q3KB 2CG6A 1DIYA 3P7FA 4QKGA 3T3AA 1CEJA 3U73A 4N35A 4D90A 1WU1B 2P26A 1Q3XA 1KMB1 1MQ5L 2FLBL 2H2TB 1EMOA 1B9WA 5I46L 1MD7A 2VVVL 1OK1A 2EC3A 3TVJA 2XC4L 4Y6DB 3WBPA 1NPEB 1NT0A 4IOPA 3IITB 1KWVA 3HO3A 3QCWA 2P16L 4J6NA 1HZ8A 1KWUA 2Y5GL 1JBUL 1F02I 1FBRA 3PGHA 3SOQA 1DDXA 4X8SL 4M10A 2I9AA 1Z92B 1K9IA 2RIDA 3WWKC 1HAFA 2OYEP 2W3KB 3GPRC 3SW0X 1KWTA 4M18A 3FF9A 2P3TA 1U5MA 1QDDA 3CFWA 1HT8A 4A94C 1RDO1 2AFPA 4CUEA 3POYA 4MMXB 1DQBA 1C3AA 3CALA 2IZ3A 3HO4A 3QMOA 1CVUA 3CS7L 1BF9A 1YPUA 1OK3A 1FIHA 1AFA1 1IQJL 2J34B 2P94L 3LAQA 4CUDA 2A55A 3CENL 1TPMA 2WG3C 4Z0KB 2K2TA 3S6XA 1UOSA 1EGFA 2PHBB 3WWKB 4ZH8B 4K12A 3GPRB 1GHQB 5JBCE 2PR3B 4JYUL 1JL9A 1RFNB 2LS8A 5B1WA 1SS2A 3VPPA 2VRPB 1P9JA 1IQEL 2WPHE 1X2TB 1FFMA 1GZ2A 1IOEL 2E3XC 3OLUA 3WSRA 1IGXA 4J6KA 1X7AL 2J38B 4ZHAB 2YGPA 2P3FN 2CKUA 1KZE1 2EI8B 1B08A 2CJIB 1DY1A 2M94A 1IOXA 3WHDA 2UWNA 1G2MB 2J95B 4X8UL 1GKNA 4YNXA 2WPME 1ZAQA 3NFPI 2KMB1 3MQLA 4ONTD 1RTM1 1K37A 2KNIA 2ZWKA 1UKMA 3P5FA 3P7GA 1OJVA 1WT9B 1IQHL 4N37A 4S0UA 2MCYA 3NCXA 1XKAL 4KZWA 1ADXA 4GJ0A 3K7BA 2RIBA 2J2UB 1APOA 2H2RA 2W2OE 1YUGA 2Y38A 3LIWB 4J6QA 2W80A 1SRZA 4FXGG 2E3XB 2W26B 1IXXA 2VH6B 2VWLL 1PW9A 3HUPA 2WFXB 3CADA 3GISX 1T8CA 4UXMA 1F7EA 2RKZA 3VYKA 1UMRA 1HFHA 1LITA 4O1ZA 4N34A 2W2ME 3KQCL 2XBYL 1H03P 1HUPA 1U0NC 3TBDA 1PPQA 4BXWA 1O7CT 3C9AC 1BJ3B 1UZPA 1SZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMG A;  1ATD A;  1KX0 A;  4M1G A;  1UZJ A;  2VH0 B;  3ALS A;  4COX A;  2JGX A;  4D0E A;  2Y5H L;  4E52 A;  1X2W A;  2XC0 L;  2RLP A;  3GXE A;  3LTG D;  4J6L A;  1RDI 1;  5I0Q B;  2KMS A;  3SW2 A;  4Y71 B;  4BXS A;  1P4L D;  1FIF A;  1T8D A;  1F0R B;  1YGC L;  3P5D A;  3OLT A;  1YXJ A;  1ZJK A;  1NFY B;  2BOX A;  1MPU A;  1OZ7 A;  2IT6 A;  3P7H A;  1IQM L;  1U0N B;  1FE2 A;  3KRK A;  1E8I A;  6COX A;  1YXK A;  4ISH L;  4ZES A;  3UBU B;  4MMY B;  1CX2 A;  5JB9 E;  2VJ3 A;  1UZQ A;  4B2S A;  4IOP B;  1BCJ 1;  2XBV L;  3N8X A;  5IKT A;  4J38 B;  2PF5 A;  2GD4 A;  3PAR A;  5F1A A;  1J35 A;  2RKY A;  2MTI A;  2Q1J B;  3DEM A;  4F4O C;  4EZM G;  1Z6C A;  4A7I A;  4BDX A;  5JPM G;  4WJG 2;  3P5E A;  1KOE A;  1P0S L;  3IJE B;  5IKR A;  2W86 A;  4PZ5 A;  3NJP C;  1N1I A;  3BDW A;  3PAK A;  4PDC A;  1KWW A;  3U7U G;  1K9J A;  1V7P B;  2RIC A;  3BT2 A;  1E87 A;  1FVU A;  3KQE L;  4GK1 A;  1C3A B;  3SOV A;  1HJ7 A;  3HO5 A;  3G8L A;  4AYM A;  5COX A;  2BPD A;  1KCG A;  3FBY A;  1CCV A;  1BYF A;  2XRB A;  5CIS A;  1HFI A;  4GKO G;  3M36 L;  1AUT L;  2XWJ I;  3WBR A;  1WHE A;  2Y7X B;  3K9X A;  3IX0 A;  3OP8 A;  2WYJ B;  1UOS B;  2W2N E;  2W2P E;  3KQG A;  2BRS A;  1HCC A;  1IGZ A;  1MUQ A;  2RA0 L;  4WUX A;  3F6U L;  4N32 A;  1Q4G A;  3N8W A;  2XBX L;  4XL1 A;  2GO0 A;  4N38 A;  1G1S A;  1CKL A;  3GPR D;  2BQ7 A;  2KV4 A;  1NFU B;  4J6P A;  1SL5 A;  3N8Y A;  1L3Y A;  1UEX A;  2WYG B;  5CKM A;  1EBV A;  1KIG L;  3BT1 A;  1G1T A;  1KWZ A;  1UV0 A;  3C22 A;  3NT1 A;  4YLI A;  1IQK L;  1EPJ A;  5IKV A;  4PP8 A;  3WH3 A;  1CQE A;  1QGB A;  5JW1 A;  1NZI A;  2GGX A;  3P5H A;  2G00 L;  4CAJ A;  2RL0 A;  2BOH A;  1QO6 A;  1EMN A;  3EGF A;  4Y76 B;  3HS5 A;  2J4I B;  2RLQ A;  2NPR A;  1RDN 1;  2YHF A;  1UKM B;  3ZYI B;  3WBQ A;  2K2S B;  4LOS A;  2JKH L;  1G4F A;  1SL6 A;  1IQI L;  1IVO C;  1HRF A;  3H5C B;  2TGF A;  5L2Y L;  3M7P A;  4AYI A;  2C6U A;  1H8U A;  2BZM A;  1H04 P;  1PGE A;  1EPH A;  3TH3 L;  4MMZ B;  1FSB A;  1PWB A;  1IXX B;  2I9B A;  4QKJ A;  4Y79 B;  4MUC A;  1JZN A;  1TLE A;  1IOD B;  1EGG A;  1XDT R;  4N36 A;  4C16 A;  1EAI C;  4LOR A;  2MCZ A;  3IU3 I;  1DY2 A;  2WII C;  1QO3 C;  3PAQ A;  3VYJ A;  2FLG A;  1O5D L;  1YTT A;  3FFG L;  1TDQ B;  3BPS E;  1KSN B;  4C9F A;  1CVW L;  2UWP B;  3ALU A;  1OK2 A;  1F7M A;  1HRE A;  1NFW B;  2B5I D;  3ALT A;  2ZIB A;  1LMJ A;  3RJ3 D;  1AFB 1;  2Y5F L;  4X8T L;  1J9C L;  1HT5 A;  4ISI L;  1V3X B;  2B7D L;  2W3I B;  1E8B A;  1IQG L;  1M1X B;  2BO2 A;  4E1G A;  4JHS A;  5FFR A;  1Y17 A;  1EPG A;  3BX4 A;  1U8C B;  4X8V L;  3GCW E;  1BCH 1;  1VVD A;  3OXU D;  3ASI A;  2MGR A;  3TK5 B;  3P5I A;  4KZV A;  4CUF A;  1FF7 A;  3LN0 A;  3IKN A;  2MSB A;  1APQ A;  5FFS A;  1W8B L;  2GGU A;  4AYD A;  1LPK A;  1HX2 A;  3CDG F;  2VWM K;  5FO8 C;  5LGK E;  2W2Q E;  5EGM B;  5JVY A;  1KZA 1;  1J35 B;  3VLG A;  1O7B T;  2RIA A;  2IZ4 A;  3GPR A;  1TN3 A;  1SB2 B;  3FF7 C;  3ZHG D;  1UOT P;  4IGD A;  1COU A;  2FZZ L;  4AK8 A;  4GJX A;  4Z6A L;  1H2Q P;  2JRA A;  1EQH A;  1WHF A;  1KZC 1;  2WPK E;  1TPN A;  4ZAE B;  2KL7 A;  1KZB 1;  3BDW B;  2PUQ L;  5KTH A;  5CKQ A;  2IT5 A;  4YT6 L;  1ELV A;  3MQE A;  1ATE A;  4RRW A;  1FVU B;  5B1X A;  2OX9 A;  2WPL E;  1PRH A;  1J34 A;  2RHP A;  2UWL B;  3F1S B;  2D1J B;  4ZH1 D;  1WT9 A;  4MTH A;  4YMD A;  3ZRZ A;  1B6E A;  1KG0 C;  4G96 A;  4KMB 1;  2WPI E;  1SL4 A;  1HYR A;  4NG9 L;  3O8E B;  3R62 A;  1DX5 I;  4J6M A;  1G4G A;  3LN1 A;  3TK6 B;  2WFT A;  1KX1 A;  2VVC K;  2XWB F;  3M9Z A;  3P5G A;  1A3P A;  1EZQ B;  1QUB A;  1KWY A;  1P1Z D;  1PXX A;  1V4L A;  1YPO A;  3N8Y B;  2WPJ E;  2BPH A;  1JA3 A;  2Y80 B;  3V64 C;  2JGW A;  2P95 L;  5J6G G;  2H9E L;  5HYT B;  2OS9 A;  2CL8 A;  4KI1 E;  2XR5 A;  3ZYJ B;  2ORJ A;  1RDL 1;  1GPZ A;  3KL6 B;  1U0O A;  1YPQ A;  3IKR A;  2FLR L;  3C8K D;  3ZYG A;  2VUV A;  1R13 A;  1HTN A;  1IQF L;  1HAE A;  4UWW A;  3C8J A;  1I0U A;  1DVA L;  4ZRW A;  3CDG E;  2Y81 B;  1ESL A;  1EGI A;  4G9A A;  4OTJ A;  1FAK L;  3NCW A;  4QKI A;  1XPH A;  3M37 L;  2BQ6 A;  3LC5 B;  1IQL L;  5HYP A;  1AFD 1;  2BPE A;  5IKQ A;  1WMY A;  2PY2 A;  4ZRV A;  2WG4 B;  2XRD A;  3INB C;  1IP0 A;  1LQD A;  3HS6 A;  3N8V A;  2XR6 A;  3UBU A;  5HZP B;  1IJQ A;  2ORK A;  3V65 B;  2N40 A;  3CA7 A;  5JB8 E;  1JWI A;  3WH2 A;  1UMR C;  1RDM 1;  3LTF B;  4RS0 A;  1KWX A;  4WUW A;  2OYU P;  3HPT A;  3MDL A;  3P5B L;  3FF8 C;  1CWV A;  4DN8 A;  1G1R A;  2OX8 A;  2DDU A;  5KTI A;  3ZHG A;  1MD8 A;  3L9J C;  4QKH A;  5JBA E;  1KLI L;  2M74 A;  1NFX B;  2P3U A;  2MGP A;  1VVC A;  2UWO B;  1BUU A;  1UZK A;  4AYE A;  4WR9 A;  3NTG A;  3ZD2 A;  4A5W B;  1MQ6 L;  1C5M F;  4WRE A;  3OED C;  2XBW L;  4WCO A;  1Y17 B;  3BX4 B;  4NGA L;  1N7D A;  1V7P A;  4OTY A;  4J6J A;  4CSY A;  1E5G A;  1GK5 A;  4M17 A;  3R05 A;  4BTU A;  3KZJ A;  4DJZ A;  1XAR A;  3CCK A;  3GCX E;  3SOB B;  3KXV A;  3G84 A;  5F19 A;  4YT7 L;  2BZ6 L;  1LPZ A;  5M62 A;  4G1M B;  2VWO L;  2F9B L;  1E88 A;  4TGF A;  2ADX A;  2BQW A;  2J94 B;  2LOJ A;  1DV8 A;  4BTT A;  1L5G B;  1G1Q A;  2FD6 A;  4BTI A;  1JV2 B;  2XC5 L;  2ZQK A;  2YBY A;  1OJW A;  5F2Q A;  1X2W B;  4KKD A;  4JZF L;  4LQF A;  2RIE A;  3FD4 A;  1XKB A;  4LMF A;  4Y7B B;  1HQ8 A;  3KMB 1;  2KRI A;  4N33 A;  3FCS B;  2YRA A;  4LOT A;  1H2P P;  1OZ7 B;  2O39 C;  5FFT A;  3G83 A;  1EPI A;  1BNL A;  1YUK B;  2V8E A;  2KV3 A;  4BDW A;  1URK A;  4Z0L A;  5K8Y A;  1U67 A;  3EJH A;  1J34 B;  3KQD L;  5E8D A;  1ATA A;  5JBB E;  2RNL A;  1MSB A;  5B1R A;  2ERJ A;  2EI6 B;  1F0S B;  1W7X L;  2KB9 A;  1OJY A;  2Y82 B;  5L30 L;  3WWK A;  3ENS A;  3KCG L;  1NQL B;  5FDQ A;  2I83 A;  5KIR A;  4JYV L;  4FM5 A;  1EQG A;  2AYL A;  1OK9 A;  1X2T A;  4RUT A;  1Z6E L;  3QH0 A;  4AQT A;  2VRP A;  3PBF A;  1KLO A;  1KZD 1;  2P28 B;  1GKG A;  1C1Z A;  1IOD A;  4ZXX L;  4ZET A;  1V4L B;  2MHP A;  1RJH A;  5CKN A;  4B2R A;  2EI7 B;  4XLW A;  1YO8 A;  1RDJ 1;  4JZD L;  2BOK L;  2Y7Z B;  1TLG A;  3T5O A;  1WMZ A;  1F00 I;  1U0O B;  1HCG B;  1OB1 C;  3KK6 A;  3Q7D A;  4O02 B;  1BV4 A;  1R14 A;  4WQQ A;  5L2Z L;  3IKQ A;  2G7I A;  3IKP A;  3TZI A;  2VWN L;  3NTB A;  2BOU A;  2W81 A;  2VUZ A;  2VVU L;  4M11 A;  1CCF A;  5KN5 C;  4PH9 A;  1QFK L;  1NWV A;  3L89 M;  2P93 L;  1IQN L;  3G81 A;  1TOZ A;  3G8K A;  1DY0 A;  3RR3 A;  1IJK C;  2XQW C;  1PTH A;  5K0H B;  3HS7 A;  1FAX L;  3ELA L;  3N8W B;  4ZXY L;  4Y7A B;  1K36 A;  5HYU B;  1LPG A;  1O9A A;  1FM5 A;  2CG7 A;  3TGF A;  1MOX C;  1XFE A;  4RRX A;  4RRY A;  1PFX L;  3LC3 B;  4YZU B;  1UEX B;  1ATB A;  3DBZ A;  1LY2 A;  3ZD1 A;  1KLJ L;  4WRF A;  2EHF A;  2YGO A;  5JVZ A;  4NA9 L;  1JWI B;  1RDK 1;  3ERB A;  1BJ3 A;  3RS1 A;  2QY0 A;  1E5U I;  1WK1 A;  4WRC A;  2P3F L;  4GI0 A;  4LU5 A;  4JZE L;  1G2L B;  4XBM A;  1SB2 A;  3N8Z A;  3KQB L;  1TPG A;  4RRZ A;  3GOV A;  1YUF A;  1IJK B;  1FJS L;  4D0F A;  3Q3K B;  2CG6 A;  1DIY A;  3P7F A;  4QKG A;  3T3A A;  1CEJ A;  3U73 A;  4N35 A;  4D90 A;  1WU1 B;  2P26 A;  1Q3X A;  1KMB 1;  1MQ5 L;  2FLB L;  2H2T B;  1EMO A;  1B9W A;  5I46 L;  1MD7 A;  2VVV L;  1OK1 A;  2EC3 A;  3TVJ A;  2XC4 L;  4Y6D B;  3WBP A;  1NPE B;  1NT0 A;  4IOP A;  3IIT B;  1KWV A;  3HO3 A;  3QCW A;  2P16 L;  4J6N A;  1HZ8 A;  1KWU A;  2Y5G L;  1JBU L;  1F02 I;  1FBR A;  3PGH A;  3SOQ A;  1DDX A;  4X8S L;  4M10 A;  2I9A A;  1Z92 B;  1K9I A;  2RID A;  3WWK C;  1HAF A;  2OYE P;  2W3K B;  3GPR C;  3SW0 X;  1KWT A;  4M18 A;  3FF9 A;  2P3T A;  1U5M A;  1QDD A;  3CFW A;  1HT8 A;  1RDO 1;  2AFP A;  4CUE A;  3POY A;  4MMX B;  1DQB A;  1C3A A;  3CAL A;  2IZ3 A;  3HO4 A;  3QMO A;  1CVU A;  3CS7 L;  1BF9 A;  1YPU A;  1OK3 A;  1FIH A;  1AFA 1;  1IQJ L;  2J34 B;  2P94 L;  3LAQ A;  4CUD A;  2A55 A;  3CEN L;  1TPM A;  2WG3 C;  4Z0K B;  2K2T A;  1UOS A;  1EGF A;  2PHB B;  3WWK B;  4ZH8 B;  4K12 A;  3GPR B;  1GHQ B;  5JBC E;  2PR3 B;  4JYU L;  1JL9 A;  1RFN B;  2LS8 A;  5B1W A;  1SS2 A;  3VPP A;  2VRP B;  1P9J A;  1IQE L;  2WPH E;  1X2T B;  1FFM A;  1GZ2 A;  1IOE L;  2E3X C;  3OLU A;  3WSR A;  1IGX A;  4J6K A;  1X7A L;  2J38 B;  4ZHA B;  2YGP A;  2P3F N;  2CKU A;  1KZE 1;  2EI8 B;  1B08 A;  2CJI B;  1DY1 A;  2M94 A;  1IOX A;  3WHD A;  2UWN A;  1G2M B;  2J95 B;  4X8U L;  1GKN A;  4YNX A;  2WPM E;  1ZAQ A;  3NFP I;  2KMB 1;  3MQL A;  4ONT D;  1RTM 1;  1K37 A;  2ZWK A;  1UKM A;  3P5F A;  3P7G A;  1OJV A;  1WT9 B;  1IQH L;  4N37 A;  4S0U A;  2MCY A;  3NCX A;  1XKA L;  4KZW A;  1ADX A;  4GJ0 A;  3K7B A;  2RIB A;  2J2U B;  1APO A;  2H2R A;  2W2O E;  1YUG A;  2Y38 A;  3LIW B;  4J6Q A;  2W80 A;  1SRZ A;  4FXG G;  2E3X B;  2W26 B;  1IXX A;  2VH6 B;  2VWL L;  1PW9 A;  3HUP A;  2WFX B;  3CAD A;  3GIS X;  1T8C A;  4UXM A;  1F7E A;  2RKZ A;  3VYK A;  1UMR A;  1HFH A;  1LIT A;  4O1Z A;  4N34 A;  2W2M E;  3KQC L;  2XBY L;  1H03 P;  1HUP A;  1U0N C;  3TBD A;  1PPQ A;  4BXW A;  1O7C T;  3C9A C;  1BJ3 B;  1UZP A;  1SZB A; 
#chains in the Genus database with same CATH topology
 2BMG A;  1ATD A;  1KX0 A;  4M1G A;  1UZJ A;  2VH0 B;  3ALS A;  4COX A;  2JGX A;  4D0E A;  2Y5H L;  4E52 A;  1X2W A;  2XC0 L;  2RLP A;  3GXE A;  3LTG D;  4J6L A;  1RDI 1;  5I0Q B;  2KMS A;  3SW2 A;  4Y71 B;  4BXS A;  1P4L D;  1FIF A;  1T8D A;  1F0R B;  1YGC L;  3P5D A;  3OLT A;  1YXJ A;  1ZJK A;  1NFY B;  2BOX A;  1MPU A;  1OZ7 A;  2IT6 A;  4PO7 A;  3P7H A;  1IQM L;  1U0N B;  1FE2 A;  3KRK A;  1E8I A;  6COX A;  1YXK A;  4ISH L;  4APL A;  4ZES A;  3K3T A;  4MMY B;  3UBU B;  1CX2 A;  5JB9 E;  2VJ3 A;  1UZQ A;  4B2S A;  4IOP B;  1BCJ 1;  2XBV L;  3N8X A;  5IKT A;  4J38 B;  2PF5 A;  2GD4 A;  3PAR A;  5F1A A;  2JJL A;  1J35 A;  2RKY A;  2MTI A;  2H9E C;  2Q1J B;  3DEM A;  4F4O C;  4EZM G;  1Z6C A;  2VRS A;  4A7I A;  4BDX A;  5JPM G;  4WJG 2;  3P5E A;  1KOE A;  1P0S L;  3IJE B;  1LMM A;  5IKR A;  2W86 A;  4PZ5 A;  3NJP C;  1N1I A;  2ZYC A;  3BDW A;  3PAK A;  4PDC A;  1KWW A;  3U7U G;  1K9J A;  1V7P B;  2RIC A;  3BT2 A;  1E87 A;  1FVU A;  3KQE L;  4GK1 A;  1C3A B;  3SOV A;  1HJ7 A;  3HO5 A;  3G8L A;  4AYM A;  5COX A;  2BPD A;  1KCG A;  3FBY A;  1CCV A;  1BYF A;  2XRB A;  5CIS A;  1HFI A;  4GKO G;  3M36 L;  1AUT L;  2XWJ I;  3WBR A;  1WHE A;  2Y7X B;  3K9X A;  3IX0 A;  3OP8 A;  2WYJ B;  1UOS B;  2W2N E;  2W2P E;  5DN4 A;  3KQG A;  2BRS A;  1HCC A;  1IGZ A;  1MUQ A;  2RA0 L;  4WUX A;  3F6U L;  4N32 A;  1Q4G A;  3N8W A;  2XBX L;  4XL1 A;  2GO0 A;  4N38 A;  1G1S A;  1CKL A;  3GPR D;  2BQ7 A;  2KV4 A;  1NFU B;  4J6P A;  1SL5 A;  3N8Y A;  1L3Y A;  1UEX A;  2WYG B;  5CKM A;  1EBV A;  1KIG L;  3BT1 A;  1G1T A;  1KWZ A;  1UV0 A;  3C22 A;  3NT1 A;  4MSL A;  1IQK L;  1EPJ A;  4YLI A;  5IKV A;  4PP8 A;  3WH3 A;  1CQE A;  1QGB A;  5JW1 A;  1NZI A;  2GGX A;  3P5H A;  2G00 L;  4CAJ A;  2RL0 A;  2BOH A;  1QO6 A;  1EMN A;  3EGF A;  4Y76 B;  3HS5 A;  2J4I B;  2RLQ A;  2NPR A;  1RDN 1;  2YHF A;  1UKM B;  3ZYI B;  3WBQ A;  2K2S B;  4LOS A;  2JKH L;  1G4F A;  1SL6 A;  1IQI L;  1IVO C;  1HRF A;  3H5C B;  2TGF A;  5L2Y L;  3M7P A;  4AYI A;  2C6U A;  1QIU A;  2BZM A;  1H8U A;  1H04 P;  1PGE A;  1EPH A;  3TH3 L;  4MMZ B;  1FSB A;  1PWB A;  1IXX B;  2I9B A;  4QKJ A;  4Y79 B;  2HOR A;  4MUC A;  1JZN A;  1TLE A;  1IOD B;  1EGG A;  1XDT R;  4N36 A;  4C16 A;  1EAI C;  4LOR A;  2MCZ A;  3IU3 I;  1DY2 A;  2WII C;  1QO3 C;  3PAQ A;  3VYJ A;  2FLG A;  1O5D L;  1YTT A;  3FFG L;  1TDQ B;  3BPS E;  1KSN B;  4C9F A;  1CVW L;  2UWP B;  3ALU A;  1OK2 A;  1F7M A;  1LK9 A;  1HRE A;  1NFW B;  2B5I D;  3ALT A;  2ZIB A;  2YGQ A;  1LMJ A;  3RJ3 D;  1AFB 1;  2Y5F L;  4X8T L;  1J9C L;  1HT5 A;  4ISI L;  1V3X B;  2B7D L;  2W3I B;  1E8B A;  1IQG L;  1M1X B;  3ZLD A;  2BO2 A;  4E1G A;  4JHS A;  5FFR A;  1Y17 A;  1EPG A;  3BX4 A;  1U8C B;  4X8V L;  3GCW E;  1BCH 1;  1VVD A;  3OXU D;  3ASI A;  2MGR A;  3TK5 B;  3P5I A;  4KZV A;  4CUF A;  1FF7 A;  3LN0 A;  3IKN A;  2MSB A;  1APQ A;  5FFS A;  1W8B L;  2GGU A;  4AYD A;  1LPK A;  1HX2 A;  3CDG F;  2VWM K;  5FO8 C;  5LGK E;  2W2Q E;  5EGM B;  5JVY A;  1KZA 1;  1J35 B;  3VLG A;  1O7B T;  2RIA A;  2IZ4 A;  3GPR A;  1TN3 A;  1SB2 B;  3FF7 C;  3ZHG D;  1UOT P;  4IGD A;  1COU A;  2FZZ L;  4AK8 A;  4GJX A;  4Z6A L;  1H2Q P;  2JRA A;  1EQH A;  1WHF A;  1KZC 1;  2WPK E;  1TPN A;  2BSF A;  4ZAE B;  2KL7 A;  4GU3 A;  1KZB 1;  3BDW B;  2PUQ L;  5KTH A;  5CKQ A;  2IT5 A;  4YT6 L;  1ELV A;  3MQE A;  1ATE A;  4RRW A;  1FVU B;  5B1X A;  2OX9 A;  2WPL E;  1PRH A;  1J34 A;  2RHP A;  2UWL B;  3F1S B;  2D1J B;  4ZH1 D;  1WT9 A;  4MTH A;  4YMD A;  3ZRZ A;  1B6E A;  1KG0 C;  4G96 A;  4KMB 1;  2WPI E;  1SL4 A;  1HYR A;  4NG9 L;  3O8E B;  3R62 A;  1DX5 I;  4J6M A;  1G4G A;  3LN1 A;  3TK6 B;  2WFT A;  1KX1 A;  2VVC K;  2XWB F;  3M9Z A;  3P5G A;  1A3P A;  1EZQ B;  1QUB A;  1KWY A;  1P1Z D;  1PXX A;  2X2Z A;  1V4L A;  1YPO A;  3N8Y B;  2WPJ E;  2BPH A;  1JA3 A;  2Y80 B;  3V64 C;  2JGW A;  2P95 L;  5J6G G;  2H9E L;  5HYT B;  2OS9 A;  2CL8 A;  4KI1 E;  2XR5 A;  3ZYJ B;  2ORJ A;  1RDL 1;  1GPZ A;  3KL6 B;  1U0O A;  1YPQ A;  3IKR A;  2FLR L;  3C8K D;  3ZYG A;  1V1I A;  2VUV A;  1R13 A;  1HTN A;  1IQF L;  1HAE A;  4UWW A;  3C8J A;  1I0U A;  1DVA L;  4ZRW A;  3CDG E;  2Y81 B;  1ESL A;  1EGI A;  4G9A A;  4OTJ A;  1FAK L;  3NCW A;  4QKI A;  1XPH A;  3M37 L;  2BT8 A;  2BQ6 A;  3LC5 B;  1IQL L;  5HYP A;  1AFD 1;  2BPE A;  5IKQ A;  1KKE A;  1WMY A;  2PY2 A;  2WG4 B;  2XRD A;  3INB C;  4ZRV A;  1IP0 A;  1LQD A;  3HS6 A;  3N8V A;  2XR6 A;  3UBU A;  5HZP B;  1IJQ A;  2ORK A;  5DN5 A;  3V65 B;  2N40 A;  3CA7 A;  5JB8 E;  1JWI A;  3WH2 A;  1UMR C;  1RDM 1;  3LTF B;  4RS0 A;  1KWX A;  4WUW A;  2OYU P;  3HPT A;  3MDL A;  3P5B L;  3FF8 C;  1CWV A;  4DN8 A;  1G1R A;  2OX8 A;  2DDU A;  5KTI A;  3ZHG A;  1MD8 A;  3L9J C;  4QKH A;  5JBA E;  1KLI L;  3F6K A;  2M74 A;  1NFX B;  2P3U A;  2MGP A;  1VVC A;  2UWO B;  1BUU A;  1UZK A;  4AYE A;  4WR9 A;  3NTG A;  3ZD2 A;  4A5W B;  1MQ6 L;  1C5M F;  4WRE A;  2WZP P;  3OED C;  2XBW L;  4WCO A;  1Y17 B;  3BX4 B;  4NGA L;  1N7D A;  1V7P A;  4OTY A;  4J6J A;  4CSY A;  1E5G A;  1GK5 A;  4M17 A;  3R05 A;  4BTU A;  3KZJ A;  4DJZ A;  1XAR A;  3CCK A;  3GCX E;  3SOB B;  3KXV A;  3G84 A;  5F19 A;  3ZLE A;  4YT7 L;  2BZ6 L;  1LPZ A;  5M62 A;  3WSY A;  4G1M B;  2VWO L;  2F9B L;  1E88 A;  4TGF A;  2ADX A;  2BQW A;  2J94 B;  2LOJ A;  1DV8 A;  4BTT A;  1L5G B;  1G1Q A;  3CI0 J;  2FD6 A;  4BTI A;  1JV2 B;  2XC5 L;  2ZQK A;  2YBY A;  1OJW A;  5F2Q A;  1X2W B;  4KKD A;  4JZF L;  4LQF A;  2RIE A;  3FD4 A;  1XKB A;  4LMF A;  4Y7B B;  1HQ8 A;  3KMB 1;  2KRI A;  4N33 A;  2BT7 A;  3FCS B;  2YRA A;  4LOT A;  1H2P P;  2I2L A;  2O39 C;  1OZ7 B;  5FFT A;  3G83 A;  1EPI A;  1BNL A;  1YUK B;  2V8E A;  2KV3 A;  4BDW A;  1URK A;  4Z0L A;  5K8Y A;  1U67 A;  3EJH A;  1J34 B;  3KQD L;  5E8D A;  1ATA A;  5JBB E;  2RNL A;  1MSB A;  5B1R A;  2ERJ A;  2EI6 B;  1F0S B;  1W7X L;  2KB9 A;  1OJY A;  2Y82 B;  5L30 L;  3WWK A;  3NJA A;  3ENS A;  3KCG L;  1NQL B;  5FDQ A;  4BWC A;  2I83 A;  5KIR A;  4JYV L;  4FM5 A;  1EQG A;  2AYL A;  1OK9 A;  4YIZ A;  4RUT A;  1Z6E L;  3QH0 A;  4AQT A;  1X2T A;  2VRP A;  1KLO A;  1KZD 1;  3PBF A;  2P28 B;  1GKG A;  1C1Z A;  1IOD A;  4ZXX L;  4ZET A;  1V4L B;  2MHP A;  1RJH A;  5CKN A;  4B2R A;  2EI7 B;  4XLW A;  1YO8 A;  1RDJ 1;  4JZD L;  2BOK L;  2Y7Z B;  1TLG A;  3T5O A;  1WMZ A;  1F00 I;  1U0O B;  1HCG B;  1OB1 C;  1V1H A;  3KK6 A;  3Q7D A;  4O02 B;  1BV4 A;  1R14 A;  5L2Z L;  4WQQ A;  3IKQ A;  2G7I A;  3IKP A;  3TZI A;  2VWN L;  3NTB A;  2BOU A;  2W81 A;  2VUZ A;  2VVU L;  4M11 A;  1CCF A;  5KN5 C;  4PH9 A;  1QFK L;  1NWV A;  3L89 M;  2P93 L;  1IQN L;  3G81 A;  1TOZ A;  3G8K A;  1DY0 A;  3RR3 A;  1IJK C;  2XQW C;  1RLH A;  1PTH A;  5K0H B;  3HS7 A;  1FAX L;  3ELA L;  3N8W B;  4ZXY L;  4Y7A B;  1K36 A;  5HYU B;  1LPG A;  1O9A A;  1FM5 A;  2CG7 A;  3TGF A;  1MOX C;  1XFE A;  4RRX A;  4RRY A;  1PFX L;  3LC3 B;  4YZU B;  1UEX B;  1ATB A;  3DBZ A;  1LY2 A;  3ZD1 A;  1KLJ L;  4WRF A;  2EHF A;  2YGO A;  5JVZ A;  4NA9 L;  1JWI B;  1RDK 1;  3ERB A;  1BJ3 A;  3RS1 A;  2QY0 A;  1E5U I;  1WK1 A;  4WRC A;  2P3F L;  4GI0 A;  4LU5 A;  4JZE L;  1G2L B;  4XBM A;  1SB2 A;  3N8Z A;  3KQB L;  1TPG A;  4RRZ A;  3GOV A;  1YUF A;  1IJK B;  1FJS L;  4D0F A;  3Q3K B;  2Y8R A;  2CG6 A;  1DIY A;  3P7F A;  4QKG A;  3T3A A;  1CEJ A;  3U73 A;  4N35 A;  4D90 A;  1WU1 B;  2P26 A;  1Q3X A;  1KMB 1;  1MQ5 L;  2FLB L;  2H2T B;  1EMO A;  1B9W A;  5I46 L;  1MD7 A;  2VVV L;  1OK1 A;  2EC3 A;  2Y8T A;  3TVJ A;  2XC4 L;  4Y6D B;  3WBP A;  1NPE B;  1NT0 A;  4IOP A;  3IIT B;  2Y8S A;  1KWV A;  3HO3 A;  3VWO A;  3QCW A;  2P16 L;  4J6N A;  1HZ8 A;  1KWU A;  2Y5G L;  1JBU L;  1F02 I;  1FBR A;  3PGH A;  3SOQ A;  1DDX A;  4X8S L;  4M10 A;  2I9A A;  1Z92 B;  1K9I A;  4N7E A;  2RID A;  3WWK C;  1HAF A;  2OYE P;  2W3K B;  3GPR C;  3SW0 X;  1KWT A;  4M18 A;  3FF9 A;  2P3T A;  1U5M A;  1QDD A;  3CFW A;  1HT8 A;  4A94 C;  1RDO 1;  2AFP A;  4CUE A;  3POY A;  4MMX B;  1DQB A;  1C3A A;  3CAL A;  2IZ3 A;  3HO4 A;  3QMO A;  1CVU A;  3CS7 L;  1BF9 A;  1YPU A;  1OK3 A;  1FIH A;  1AFA 1;  3LAQ A;  1IQJ L;  2J34 B;  2P94 L;  2HOX A;  4CUD A;  3FGT A;  2A55 A;  3CEN L;  1TPM A;  2WG3 C;  4Z0K B;  2K2T A;  3S6X A;  1UOS A;  1EGF A;  2PHB B;  3WWK B;  4ZH8 B;  4K12 A;  3GPR B;  1GHQ B;  5JBC E;  2PR3 B;  4JYU L;  1JL9 A;  1RFN B;  3WSX A;  2LS8 A;  1SS2 A;  5B1W A;  3VPP A;  2VRP B;  1P9J A;  1IQE L;  2WPH E;  1X2T B;  1FFM A;  1GZ2 A;  1IOE L;  2E3X C;  3OLU A;  3WSR A;  1IGX A;  4J6K A;  1X7A L;  2J38 B;  4ZHA B;  2YGP A;  2P3F N;  2CKU A;  1KZE 1;  2EI8 B;  1B08 A;  2CJI B;  1DY1 A;  2M94 A;  1IOX A;  3WHD A;  2UWN A;  1G2M B;  2J95 B;  4X8U L;  1GKN A;  4YNX A;  2WPM E;  1ZAQ A;  3NFP I;  2KMB 1;  3MQL A;  4ONT D;  1RTM 1;  1K37 A;  2KNI A;  2ZWK A;  1UKM A;  3P5F A;  3P7G A;  1OJV A;  1WT9 B;  1IQH L;  4N37 A;  4S0U A;  2MCY A;  3NCX A;  1XKA L;  4KZW A;  1ADX A;  4GJ0 A;  3K7B A;  2RIB A;  2J2U B;  1APO A;  2H2R A;  2W2O E;  1YUG A;  2Y38 A;  3LIW B;  4J6Q A;  2W80 A;  1SRZ A;  4GU4 A;  4FXG G;  2E3X B;  2W26 B;  1IXX A;  2VH6 B;  2VWL L;  1PW9 A;  3HUP A;  2WFX B;  3CAD A;  3GIS X;  1T8C A;  4UXM A;  1F7E A;  2RKZ A;  3VYK A;  1UMR A;  1HFH A;  1LIT A;  4O1Z A;  4N34 A;  2W2M E;  3KQC L;  2XBY L;  1H03 P;  1HUP A;  1U0N C;  3TBD A;  3FGR A;  1PPQ A;  4BXW A;  1O7C T;  3C9A C;  1BJ3 B;  1UZP A;  1SZB A; 
#chains in the Genus database with same CATH homology
 2BMG A;  1ATD A;  1KX0 A;  4M1G A;  1UZJ A;  2VH0 B;  3ALS A;  4COX A;  2JGX A;  4D0E A;  2Y5H L;  4E52 A;  1X2W A;  2XC0 L;  2RLP A;  3GXE A;  3LTG D;  4J6L A;  1RDI 1;  5I0Q B;  2KMS A;  3SW2 A;  4Y71 B;  4BXS A;  1P4L D;  1FIF A;  1T8D A;  1F0R B;  1YGC L;  3P5D A;  3OLT A;  1YXJ A;  1ZJK A;  1NFY B;  2BOX A;  1MPU A;  1OZ7 A;  2IT6 A;  3P7H A;  1IQM L;  1U0N B;  1FE2 A;  3KRK A;  1E8I A;  6COX A;  1YXK A;  4ISH L;  4ZES A;  3UBU B;  4MMY B;  1CX2 A;  5JB9 E;  2VJ3 A;  1UZQ A;  4B2S A;  4IOP B;  1BCJ 1;  2XBV L;  3N8X A;  5IKT A;  4J38 B;  2PF5 A;  2GD4 A;  3PAR A;  5F1A A;  1J35 A;  2RKY A;  2MTI A;  2H9E C;  2Q1J B;  3DEM A;  4F4O C;  4EZM G;  1Z6C A;  4A7I A;  4BDX A;  5JPM G;  4WJG 2;  3P5E A;  1KOE A;  1P0S L;  3IJE B;  1LMM A;  5IKR A;  2W86 A;  4PZ5 A;  3NJP C;  1N1I A;  3BDW A;  3PAK A;  4PDC A;  1KWW A;  3U7U G;  1K9J A;  1V7P B;  2RIC A;  3BT2 A;  1E87 A;  1FVU A;  3KQE L;  4GK1 A;  1C3A B;  3SOV A;  1HJ7 A;  3HO5 A;  3G8L A;  4AYM A;  5COX A;  2BPD A;  1KCG A;  3FBY A;  1CCV A;  1BYF A;  2XRB A;  5CIS A;  1HFI A;  4GKO G;  3M36 L;  1AUT L;  2XWJ I;  3WBR A;  1WHE A;  2Y7X B;  3K9X A;  3IX0 A;  3OP8 A;  2WYJ B;  1UOS B;  2W2N E;  2W2P E;  3KQG A;  2BRS A;  1HCC A;  1IGZ A;  1MUQ A;  2RA0 L;  4WUX A;  3F6U L;  4N32 A;  1Q4G A;  3N8W A;  2XBX L;  4XL1 A;  2GO0 A;  4N38 A;  1G1S A;  1CKL A;  3GPR D;  2BQ7 A;  2KV4 A;  1NFU B;  4J6P A;  1SL5 A;  3N8Y A;  1L3Y A;  1UEX A;  2WYG B;  5CKM A;  1EBV A;  1KIG L;  3BT1 A;  1G1T A;  1KWZ A;  1UV0 A;  3C22 A;  3NT1 A;  4YLI A;  1IQK L;  1EPJ A;  5IKV A;  4PP8 A;  3WH3 A;  1CQE A;  1QGB A;  5JW1 A;  1NZI A;  2GGX A;  3P5H A;  2G00 L;  4CAJ A;  2RL0 A;  2BOH A;  1QO6 A;  1EMN A;  3EGF A;  4Y76 B;  3HS5 A;  2J4I B;  2RLQ A;  2NPR A;  1RDN 1;  2YHF A;  1UKM B;  3ZYI B;  3WBQ A;  2K2S B;  4LOS A;  2JKH L;  1G4F A;  1SL6 A;  1IQI L;  1IVO C;  1HRF A;  3H5C B;  2TGF A;  5L2Y L;  3M7P A;  4AYI A;  2C6U A;  1H8U A;  2BZM A;  1H04 P;  1PGE A;  1EPH A;  3TH3 L;  4MMZ B;  1FSB A;  1PWB A;  1IXX B;  2I9B A;  4QKJ A;  4Y79 B;  4MUC A;  1JZN A;  1TLE A;  1IOD B;  1EGG A;  1XDT R;  4N36 A;  4C16 A;  1EAI C;  4LOR A;  2MCZ A;  3IU3 I;  1DY2 A;  2WII C;  1QO3 C;  3PAQ A;  3VYJ A;  2FLG A;  1O5D L;  1YTT A;  3FFG L;  1TDQ B;  3BPS E;  1KSN B;  4C9F A;  1CVW L;  2UWP B;  3ALU A;  1OK2 A;  1F7M A;  1HRE A;  1NFW B;  2B5I D;  3ALT A;  2ZIB A;  2YGQ A;  1LMJ A;  3RJ3 D;  1AFB 1;  2Y5F L;  4X8T L;  1J9C L;  1HT5 A;  4ISI L;  1V3X B;  2B7D L;  2W3I B;  1E8B A;  1IQG L;  1M1X B;  2BO2 A;  4E1G A;  4JHS A;  5FFR A;  1Y17 A;  1EPG A;  3BX4 A;  1U8C B;  4X8V L;  3GCW E;  1BCH 1;  1VVD A;  3OXU D;  3ASI A;  2MGR A;  3TK5 B;  3P5I A;  4KZV A;  4CUF A;  1FF7 A;  3LN0 A;  3IKN A;  2MSB A;  1APQ A;  5FFS A;  1W8B L;  2GGU A;  4AYD A;  1LPK A;  1HX2 A;  3CDG F;  2VWM K;  5FO8 C;  5LGK E;  2W2Q E;  5EGM B;  5JVY A;  1KZA 1;  1J35 B;  3VLG A;  1O7B T;  2RIA A;  2IZ4 A;  3GPR A;  1TN3 A;  1SB2 B;  3FF7 C;  3ZHG D;  1UOT P;  4IGD A;  1COU A;  2FZZ L;  4AK8 A;  4GJX A;  4Z6A L;  1H2Q P;  2JRA A;  1EQH A;  1WHF A;  1KZC 1;  2WPK E;  1TPN A;  4ZAE B;  2KL7 A;  1KZB 1;  3BDW B;  2PUQ L;  5KTH A;  5CKQ A;  2IT5 A;  4YT6 L;  1ELV A;  3MQE A;  1ATE A;  4RRW A;  1FVU B;  5B1X A;  2OX9 A;  2WPL E;  1PRH A;  1J34 A;  2RHP A;  2UWL B;  3F1S B;  2D1J B;  4ZH1 D;  1WT9 A;  4MTH A;  4YMD A;  3ZRZ A;  1B6E A;  1KG0 C;  4G96 A;  4KMB 1;  2WPI E;  1SL4 A;  1HYR A;  4NG9 L;  3O8E B;  3R62 A;  1DX5 I;  4J6M A;  1G4G A;  3LN1 A;  3TK6 B;  2WFT A;  1KX1 A;  2VVC K;  2XWB F;  3M9Z A;  3P5G A;  1A3P A;  1EZQ B;  1QUB A;  1KWY A;  1P1Z D;  1PXX A;  1V4L A;  1YPO A;  3N8Y B;  2WPJ E;  2BPH A;  1JA3 A;  2Y80 B;  3V64 C;  2JGW A;  2P95 L;  5J6G G;  2H9E L;  5HYT B;  2OS9 A;  2CL8 A;  4KI1 E;  2XR5 A;  3ZYJ B;  2ORJ A;  1RDL 1;  1GPZ A;  3KL6 B;  1U0O A;  1YPQ A;  3IKR A;  2FLR L;  3C8K D;  3ZYG A;  2VUV A;  1R13 A;  1HTN A;  1IQF L;  1HAE A;  4UWW A;  3C8J A;  1I0U A;  1DVA L;  4ZRW A;  3CDG E;  2Y81 B;  1ESL A;  1EGI A;  4G9A A;  4OTJ A;  1FAK L;  3NCW A;  4QKI A;  1XPH A;  3M37 L;  2BQ6 A;  3LC5 B;  1IQL L;  5HYP A;  1AFD 1;  2BPE A;  5IKQ A;  1WMY A;  2PY2 A;  4ZRV A;  2WG4 B;  2XRD A;  3INB C;  1IP0 A;  1LQD A;  3HS6 A;  3N8V A;  2XR6 A;  3UBU A;  5HZP B;  1IJQ A;  2ORK A;  3V65 B;  2N40 A;  3CA7 A;  5JB8 E;  1JWI A;  3WH2 A;  1UMR C;  1RDM 1;  3LTF B;  4RS0 A;  1KWX A;  4WUW A;  2OYU P;  3HPT A;  3MDL A;  3P5B L;  3FF8 C;  1CWV A;  4DN8 A;  1G1R A;  2OX8 A;  2DDU A;  5KTI A;  3ZHG A;  1MD8 A;  3L9J C;  4QKH A;  5JBA E;  1KLI L;  2M74 A;  1NFX B;  2P3U A;  2MGP A;  1VVC A;  2UWO B;  1BUU A;  1UZK A;  4AYE A;  4WR9 A;  3NTG A;  3ZD2 A;  4A5W B;  1MQ6 L;  1C5M F;  4WRE A;  2WZP P;  3OED C;  2XBW L;  4WCO A;  1Y17 B;  3BX4 B;  4NGA L;  1N7D A;  1V7P A;  4OTY A;  4J6J A;  4CSY A;  1E5G A;  1GK5 A;  4M17 A;  3R05 A;  4BTU A;  3KZJ A;  4DJZ A;  1XAR A;  3CCK A;  3GCX E;  3SOB B;  3KXV A;  3G84 A;  5F19 A;  4YT7 L;  2BZ6 L;  1LPZ A;  5M62 A;  4G1M B;  2VWO L;  2F9B L;  1E88 A;  4TGF A;  2ADX A;  2BQW A;  2J94 B;  2LOJ A;  1DV8 A;  4BTT A;  1L5G B;  1G1Q A;  2FD6 A;  4BTI A;  1JV2 B;  2XC5 L;  2ZQK A;  2YBY A;  1OJW A;  5F2Q A;  1X2W B;  4KKD A;  4JZF L;  4LQF A;  2RIE A;  3FD4 A;  1XKB A;  4LMF A;  4Y7B B;  1HQ8 A;  3KMB 1;  2KRI A;  4N33 A;  3FCS B;  2YRA A;  4LOT A;  1H2P P;  1OZ7 B;  2O39 C;  5FFT A;  3G83 A;  1EPI A;  1BNL A;  1YUK B;  2V8E A;  2KV3 A;  4BDW A;  1URK A;  4Z0L A;  5K8Y A;  1U67 A;  3EJH A;  1J34 B;  3KQD L;  5E8D A;  1ATA A;  5JBB E;  2RNL A;  1MSB A;  5B1R A;  2ERJ A;  2EI6 B;  1F0S B;  1W7X L;  2KB9 A;  1OJY A;  2Y82 B;  5L30 L;  3WWK A;  3ENS A;  3KCG L;  1NQL B;  5FDQ A;  2I83 A;  5KIR A;  4JYV L;  4FM5 A;  1EQG A;  2AYL A;  1OK9 A;  1X2T A;  4RUT A;  1Z6E L;  3QH0 A;  4AQT A;  2VRP A;  3PBF A;  1KLO A;  1KZD 1;  2P28 B;  1GKG A;  1C1Z A;  1IOD A;  4ZXX L;  4ZET A;  1V4L B;  2MHP A;  1RJH A;  5CKN A;  4B2R A;  2EI7 B;  4XLW A;  1YO8 A;  1RDJ 1;  4JZD L;  2BOK L;  2Y7Z B;  1TLG A;  3T5O A;  1WMZ A;  1F00 I;  1U0O B;  1HCG B;  1OB1 C;  3KK6 A;  3Q7D A;  4O02 B;  1BV4 A;  1R14 A;  4WQQ A;  5L2Z L;  3IKQ A;  2G7I A;  3IKP A;  3TZI A;  2VWN L;  3NTB A;  2BOU A;  2W81 A;  2VUZ A;  2VVU L;  4M11 A;  1CCF A;  5KN5 C;  4PH9 A;  1QFK L;  1NWV A;  3L89 M;  2P93 L;  1IQN L;  3G81 A;  1TOZ A;  3G8K A;  1DY0 A;  3RR3 A;  1IJK C;  2XQW C;  1PTH A;  5K0H B;  3HS7 A;  1FAX L;  3ELA L;  3N8W B;  4ZXY L;  4Y7A B;  1K36 A;  5HYU B;  1LPG A;  1O9A A;  1FM5 A;  2CG7 A;  3TGF A;  1MOX C;  1XFE A;  4RRX A;  4RRY A;  1PFX L;  3LC3 B;  4YZU B;  1UEX B;  1ATB A;  3DBZ A;  1LY2 A;  3ZD1 A;  1KLJ L;  4WRF A;  2EHF A;  2YGO A;  5JVZ A;  4NA9 L;  1JWI B;  1RDK 1;  3ERB A;  1BJ3 A;  3RS1 A;  2QY0 A;  1E5U I;  1WK1 A;  4WRC A;  2P3F L;  4GI0 A;  4LU5 A;  4JZE L;  1G2L B;  4XBM A;  1SB2 A;  3N8Z A;  3KQB L;  1TPG A;  4RRZ A;  3GOV A;  1YUF A;  1IJK B;  1FJS L;  4D0F A;  3Q3K B;  2CG6 A;  1DIY A;  3P7F A;  4QKG A;  3T3A A;  1CEJ A;  3U73 A;  4N35 A;  4D90 A;  1WU1 B;  2P26 A;  1Q3X A;  1KMB 1;  1MQ5 L;  2FLB L;  2H2T B;  1EMO A;  1B9W A;  5I46 L;  1MD7 A;  2VVV L;  1OK1 A;  2EC3 A;  3TVJ A;  2XC4 L;  4Y6D B;  3WBP A;  1NPE B;  1NT0 A;  4IOP A;  3IIT B;  1KWV A;  3HO3 A;  3QCW A;  2P16 L;  4J6N A;  1HZ8 A;  1KWU A;  2Y5G L;  1JBU L;  1F02 I;  1FBR A;  3PGH A;  3SOQ A;  1DDX A;  4X8S L;  4M10 A;  2I9A A;  1Z92 B;  1K9I A;  2RID A;  3WWK C;  1HAF A;  2OYE P;  2W3K B;  3GPR C;  3SW0 X;  1KWT A;  4M18 A;  3FF9 A;  2P3T A;  1U5M A;  1QDD A;  3CFW A;  1HT8 A;  4A94 C;  1RDO 1;  2AFP A;  4CUE A;  3POY A;  4MMX B;  1DQB A;  1C3A A;  3CAL A;  2IZ3 A;  3HO4 A;  3QMO A;  1CVU A;  3CS7 L;  1BF9 A;  1YPU A;  1OK3 A;  1FIH A;  1AFA 1;  1IQJ L;  2J34 B;  2P94 L;  3LAQ A;  4CUD A;  2A55 A;  3CEN L;  1TPM A;  2WG3 C;  4Z0K B;  2K2T A;  3S6X A;  1UOS A;  1EGF A;  2PHB B;  3WWK B;  4ZH8 B;  4K12 A;  3GPR B;  1GHQ B;  5JBC E;  2PR3 B;  4JYU L;  1JL9 A;  1RFN B;  2LS8 A;  5B1W A;  1SS2 A;  3VPP A;  2VRP B;  1P9J A;  1IQE L;  2WPH E;  1X2T B;  1FFM A;  1GZ2 A;  1IOE L;  2E3X C;  3OLU A;  3WSR A;  1IGX A;  4J6K A;  1X7A L;  2J38 B;  4ZHA B;  2YGP A;  2P3F N;  2CKU A;  1KZE 1;  2EI8 B;  1B08 A;  2CJI B;  1DY1 A;  2M94 A;  1IOX A;  3WHD A;  2UWN A;  1G2M B;  2J95 B;  4X8U L;  1GKN A;  4YNX A;  2WPM E;  1ZAQ A;  3NFP I;  2KMB 1;  3MQL A;  4ONT D;  1RTM 1;  1K37 A;  2KNI A;  2ZWK A;  1UKM A;  3P5F A;  3P7G A;  1OJV A;  1WT9 B;  1IQH L;  4N37 A;  4S0U A;  2MCY A;  3NCX A;  1XKA L;  4KZW A;  1ADX A;  4GJ0 A;  3K7B A;  2RIB A;  2J2U B;  1APO A;  2H2R A;  2W2O E;  1YUG A;  2Y38 A;  3LIW B;  4J6Q A;  2W80 A;  1SRZ A;  4FXG G;  2E3X B;  2W26 B;  1IXX A;  2VH6 B;  2VWL L;  1PW9 A;  3HUP A;  2WFX B;  3CAD A;  3GIS X;  1T8C A;  4UXM A;  1F7E A;  2RKZ A;  3VYK A;  1UMR A;  1HFH A;  1LIT A;  4O1Z A;  4N34 A;  2W2M E;  3KQC L;  2XBY L;  1H03 P;  1HUP A;  1U0N C;  3TBD A;  1PPQ A;  4BXW A;  1O7C T;  3C9A C;  1BJ3 B;  1UZP A;  1SZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...