4CSYA

E-selectin lectin, egf-like and two scr domains complexed with sialyl lewis x
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
280
structure length
280
Chain Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-SELECTIN
publication title E-Selectin Ligand Complexes Adopt an Extended High-Affinity Conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 58
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00059 Lectin_C Lectin C-type domain
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4csyA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4csyA04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4csyA03
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 4csyA01
3ALTA 1LPZA 2RIEA 3LTFB 3IX0A 1FM5A 2PF5A 3TK5B 3C22A 2UWOB 2EI8B 2BZMA 3CALA 1HTNA 3P5FA 3M37L 5JW1A 1BV4A 3EJHA 1J34B 2YGPA 5JVZA 1U0NB 3TK6B 1CCVA 1RDO1 3NT1A 4XBMA 4Y71B 2BZ6L 2V8EA 1J34A 1KZE1 3HUPA 3WBRA 4GJXA 4JYUL 3NFPI 3C9AC 1YTTA 1IP0A 3PAQA 1IOEL 4XL1A 1UKMB 1M1XB 5CKNA 4ZXYL 1WMYA 1E87A 1HFHA 1TLGA 4O1ZA 1FSBA 1UZPA 1CVWL 1DY2A 1HUPA 1UKMA 2RICA 1ATDA 1PWBA 1X2TB 1AUTL 2M74A 2IZ4A 4DJZA 1RTM1 2ZWKA 4M17A 3G8LA 3T5OA 2Y80B 1X2TA 1NT0A 1U67A 2I83A 1XARA 2RIDA 4GKOG 2WFXB 3MQEA 3RR3A 4WREA 4N38A 3F6UL 1HJ7A 2D1JB 4RRYA 1LY2A 5CISA 1FFMA 1U0OA 2K2SB 3KCGL 1IJQA 4Z0LA 4AQTA 5L2YL 3VYKA 3FF8C 1HAFA 2OYEP 1O5DL 1XKAL 4Y76B 1AFB1 1UMRA 2BMGA 4LMFA 1FVUB 3N8WB 5CKQA 1KCGA 3U7UG 2B5ID 4RRWA 1QUBA 4E52A 1FVUA 3N8WA 1ATEA 1NQLB 4YLIA 1OJVA 1K9IA 1RDK1 3ZYGA 2YHFA 1UZQA 1XPHA 2CJIB 4KZWA 5I46L 1GKNA 1SZBA 3N8VA 2GD4A 2P16L 4QKIA 4WRFA 4Y6DB 2XBWL 1HCCA 4J6NA 3CCKA 4QKJA 2WIIC 1QO6A 5KTIA 4KI1E 4ZETA 4DN8A 5F1AA 3U73A 3L89M 4Z0KB 2O39C 1NWVA 5FFTA 4N36A 1WMZA 2RLQA 4MTHA 4ZXXL 3OXUD 3P7FA 1U5MA 4WUXA 2XBXL 4WRCA 1JL9A 2J95B 1KLJL 1IGXA 1O9AA 1Y17A 3VLGA 3ENSA 4D0EA 4YMDA 2Y38A 1RDL1 2ADXA 1T8DA 1KX0A 3N8ZA 4Y79B 2P94L 4IOPB 2DDUA 3KQBL 3R05A 1K36A 1P1ZD 3G81A 1HREA 3ALSA 4X8UL 1KMB1 4IOPA 5JB8E 1MQ5L 2G00L 1OK2A 1KLIL 1R13A 4UWWA 2FZZL 1BF9A 2BPDA 1B6EA 3MQLA 2RA0L 1MQ6L 1U8CB 1G4FA 1WK1A 5IKTA 2VVVL 4KZVA 4YT7L 4C16A 1EPHA 2G7IA 2BOXA 2WPJE 4KMB1 4QKGA 5B1WA 3BT2A 3LIWB 2H2RA 2A55A 4BTTA 1GPZA 1ZAQA 2W26B 4GK1A 2VH6B 2KL7A 1YUFA 2XBVL 1KWUA 4ISHL 2VWOL 1FJSL 1EAIC 2BOKL 1OB1C 5K8YA 1KZA1 4YT6L 2IT5A 1ESLA 4LORA 5L2ZL 5M62A 1XDTR 1L5GB 2AFPA 2RHPA 5COXA 1IOXA 4M18A 3WWKC 1LITA 3P5GA 1EMNA 4JHSA 4WUWA 2AYLA 1YPOA 2C6UA 2Y7XB 2MSBA 1N7DA 4ONTD 1X7AL 1AFD1 3V65B 1OK9A 2I9AA 1C1ZA 1BCJ1 1N1IA 3CDGF 4NGAL 1F7EA 2PUQL 1RDJ1 3BDWB 1F0SB 2CKUA 4Y7BB 4AK8A 3GPRD 3BDWA 1ATAA 4E1GA 5FO8C 3SW0X 3IKQA 2YGOA 1P9JA 1YGCL 1KWXA 5EGMB 1BNLA 3WH3A 2BOUA 1SS2A 1MD8A 1RJHA 4ZH1D 3EGFA 1R14A 2KMSA 1H8UA 1IGZA 3M36L 2MTIA 1O7CT 1H04P 1B08A 1DY1A 1F00I 1KZB1 2EC3A 1IXXB 1MPUA 3HO5A 3K9XA 1ELVA 1PW9A 1DY0A 1F7MA 3L9JC 3P5IA 2XWJI 1G1TA 3RJ3D 2P3TA 1IXXA 3KXVA 1L3YA 1WHFA 2XR6A 4ZH8B 3GPRC 5J6GG 3N8YB 2W81A 2CL8A 1CWVA 3N8YA 1G1QA 1APQA 4MMYB 1URKA 5IKVA 1GKGA 1EGGA 1OZ7B 4N32A 3LAQA 4MMXB 1WT9B 2IZ3A 1IQIL 4AYIA 1PRHA 1OZ7A 2RL0A 1WT9A 5F19A 3GXEA 2PY2A 3FF9A 2MGPA 2W3KB 1P0SL 1TN3A 2Y81B 2VRPB 4J6MA 2JGXA 4LOTA 1V7PB 2M94A 1Z92B 3Q3KB 1QO3C 2VRPA 3CS7L 1V7PA 4WCOA 1AFA1 2BOHA 4J6PA 4PP8A 4G9AA 5B1RA 2OYUP 1KWTA 2BQ7A 1BCH1 1PXXA 2K2TA 3TZIA 2CG7A 4ISIL 2RKYA 2Y5HL 3HS5A 4CUDA 5HYTB 3FF7C 3P7HA 4C9FA 1IQLL 2J94B 2RIBA 4J6KA 2XC4L 1PGEA 2J38B 3GISX 3SW2A 1V4LB 3DEMA 3NTGA 3TBDA 1KZC1 2H2TB 3G83A 3ZYIB 5HYUB 1FIHA 3C8JA 1G2MB 3P5HA 1V4LA 5I0QB 1RDI1 1QDDA 2W3IB 1E5GA 3LN0A 4ZESA 2EI7B 2VVCK 3NJPC 2KB9A 4N33A 1TPGA 3FFGL 2YRAA 5JBCE 1GK5A 2VWLL 3BT1A 4X8TL 4Y7AB 4KKDA 2BQ6A 3SOBB 2MCYA 2NPRA 3WWKB 3FBYA 3IKRA 2WPME 1LMJA 2LS8A 4QKHA 1KIGL 1VVDA 1K37A 4MMZB 4YZUB 3WWKA 2VWMK 1Q3XA 1PPQA 1EGFA 3ZHGA 4M11A 1OK3A 3HS7A 2JKHL 1NFXB 5JB9E 1YPQA 1HYRA 1YPUA 1HCGB 4K12A 3ELAL 4GI0A 1TPMA 1CCFA 2BQWA 1RDN1 1MSBA 4PDCA 1CKLA 1BUUA 1BJ3B 1MUQA 1EPIA 1KLOA 1NFWB 1IJKC 3PBFA 1PFXL 3OLTA 1MOXC 1G1RA 2XRBA 1BJ3A 2BO2A 2UWPB 1KOEA 2PHBB 2P3UA 1NFYB 4MUCA 2ZQKA 4YNXA 2EI6B 2UWLB 4CSYA 3PAKA 1LPKA 1WHEA 4BXSA 2WYJB 2VUVA 1FAXL 1IODB 2Y7ZB 2VVUL 4JYVL 3GPRB 1IQFL 2W2NE 4S0UA 4X8SL 1IODA 1FAKL 1DVAL 2J4IB 1TPNA 1JWIB 2VH0B 2EHFA 2P95L 3ZRZA 3GPRA 1DQBA 1P4LD 1PTHA 1FE2A 4D90A 1APOA 1JWIA 1IQJL 1EZQB 1UMRC 2OX9A 3F1SB 2WG4B 4CUFA 1G2LB 1ATBA 2W2ME 3IKNA 1COUA 4IGDA 1C5MF 5LGKE 1J9CL 1HQ8A 1HT5A 1UOSB 2BPEA 2WPHE 3TVJA 1HT8A 4BXWA 3LTGD 1ADXA 2Y5FL 1TLEA 2XC0L 1UOSA 2ZIBA 2GGUA 2B7DL 2XR5A 3N8XA 3LC5B 1SRZA 4TGFA 4ZHAB 2W2QE 3CADA 4RUTA 5JBAE 2H9EL 3OLUA 1EPGA 1UOTP 1UZKA 1B9WA 4COXA 4F4OC 4WR9A 2P93L 1IQHL 3PARA 1KSNB 1WU1B 1NPEB 4JZEL 4M1GA 4N37A 1CQEA 2P3FN 1HRFA 3BX4B 2XQWC 2VWNL 3G84A 3P5EA 4JZFL 1JV2B 4A7IA 2ERJA 3PGHA 2FD6A 4LU5A 3BX4A 4ZAEB 1IQKL 3ZYJB 1SB2B 3UBUB 1YO8A 5E8DA 2E3XC 1KG0C 3K7BA 2Q1JB 5IKRA 2ORJA 1SB2A 3UBUA 1UZJA 3G8KA 3HO3A 3KRKA 3P7GA 3HO4A 2XWBF 3HS6A 3KL6B 3INBC 4A5WB 1KWYA 2KRIA 4D0FA 2Y82B 2W80A 1F0RB 4G1MB 3CDGE 3QCWA 1FBRA 2WFTA 1I0UA 2XC5L 1SL5A 2XRDA 1T8CA 1TDQB 4AYDA 2FLGA 5HYPA 4J6JA 1J35B 3IU3I 3RS1A 3R62A 2VJ3A 1YXJA 2W86A 1J35A 2RNLA 2N40A 4BTUA 3GOVA 4J38B 5CKMA 4J6LA 5FFSA 1EQGA 3TGFA 5F2QA 2VUZA 1DIYA 1H2QP 1IJKB 3MDLA 1KX1A 1MD7A 1E8BA 1JZNA 4LOSA 4G96A 2UWNA 4B2SA 1H03P 3T3AA 1K9JA 1IQGL 2IT6A 4AYEA 4RS0A 3ERBA 2WPLE 2RKZA 5HZPB 3ALUA 1SL4A 1EBVA 4FXGG 4UXMA 3Q7DA 2WG3C 4M10A 1BYFA 3M7PA 2KV4A 3CA7A 3GCXE 1U0OB 1QGBA 1W8BL 1KWVA 1EPJA 1EGIA 3KQDL 1GHQB 1G4GA 2W2OE 5JPMG 1UV0A 1CX2A 1KWWA 2P26A 1FF7A 5KTHA 2GO0A 1Q4GA 4GJ0A 3KZJA 2RLPA 1E8IA 4BTIA 2WPKE 1A3PA 3DBZA 1C3AB 4AYMA 2W2PE 2WYGB 2MHPA 3QMOA 4O02B 1C3AA 1LPGA 1NFUB 5FDQA 1YXKA 3WH2A 1U0NC 3SOQA 1RFNB 1QFKL 4J6QA 4OTJA 1IQEL 1G1SA 1EQHA 2Y5GL 5FFRA 2TGFA 3ASIA 3KK6A 3KQEL 5KIRA 1KWZA 1O7BT 3GCWE 2MGRA 2RIAA 4WQQA 3NCWA 3O8EB 5IKQA 3P5DA 1H2PP 1NZIA 2WPIE 4BDXA 4PZ5A 2YBYA 1OJYA 2PR3B 2KV3A 1EMOA 3HPTA 2P3FL 2OS9A 3IKPA 4N34A 1X2WB 3V64C 1Y17B 4B2RA 4NA9L 3NCXA 1SL6A 3WHDA 3WSRA 2FLBL 3TH3L 4OTYA 3KQCL 3OP8A 3SOVA 3OEDC 5JVYA 4BDWA 1X2WA 1Z6CA 2E3XB 3VPPA 2I9BA 1RDM1 1HAEA 1OJWA 2QY0A 4FM5A 1IQNL 2FLRL 1XFEA 3POYA 4Z6AL 5KN5C 2LOJA 3IITB 5B1XA 1Z6EL 4NG9L 1UEXB 3QH0A 4WJG2 5K0HB 3FCSB 3NTBA 1CVUA 3P5BL 4ZRWA 2ORKA 1UEXA 1HFIA 2P28B 3CENL 1IVOC 3H5CB 1DX5I 3IJEB 2XBYL 4RRXA 2JGWA 1YUKB 4X8VL 3M9ZA 3LN1A 1JBUL 3WBQA 1DV8A 4PH9A 1V3XB 1CEJA 2J34B 2KMB1 3ZHGD 2F9BL 1W7XL 4LQFA 1GZ2A 1F02I 1JA3A 1LQDA 3WBPA 6COXA 3KMB1 3CFWA 4EZMG 5L30L 3VYJA 2BPHA 1HX2A 4XLWA 2J2UB 1KZD1 4RRZA 4CUEA 3FD4A 1E88A 2CG6A 1DDXA 2OX8A 1FIFA 1VVCA 1HZ8A 3ZD2A 1IQML 3LC3B 2JRAA 4CAJA 2MCZA 3ZD1A 3KQGA 1OK1A 1ZJKA 1TOZA 2GGXA 1XKBA 4ZRVA 3BPSE 5JBBE 4N35A 2BRSA 3C8KD 4JZDL 1YUGA 1E5UI
chains in the Genus database with same CATH superfamily
3ALTA 1LPZA 2RIEA 3LTFB 3IX0A 1FM5A 2PF5A 3TK5B 3C22A 2UWOB 2EI8B 2BZMA 3CALA 1HTNA 3P5FA 3M37L 5JW1A 1BV4A 3EJHA 1J34B 2YGPA 5JVZA 1U0NB 3TK6B 1CCVA 1RDO1 3NT1A 4XBMA 4Y71B 2BZ6L 2V8EA 1J34A 1KZE1 3HUPA 3WBRA 4GJXA 4JYUL 3NFPI 3C9AC 1YTTA 2HORA 1IP0A 3PAQA 1IOEL 4XL1A 1UKMB 1M1XB 5CKNA 4ZXYL 1WMYA 1E87A 1HFHA 1TLGA 4O1ZA 1FSBA 1UZPA 1CVWL 1DY2A 1HUPA 1UKMA 2RICA 1ATDA 1PWBA 1X2TB 1AUTL 2M74A 2IZ4A 4DJZA 1RTM1 2ZWKA 4M17A 3G8LA 3T5OA 2Y80B 1X2TA 1NT0A 1U67A 2I83A 1XARA 2RIDA 4GKOG 2WFXB 3MQEA 3RR3A 4WREA 4N38A 3F6UL 1HJ7A 2D1JB 4RRYA 1LY2A 5CISA 1FFMA 1U0OA 2K2SB 3KCGL 1IJQA 4Z0LA 4AQTA 5L2YL 2H9EC 3FF8C 3VYKA 1HAFA 2OYEP 1O5DL 1XKAL 4Y76B 1AFB1 1UMRA 2BMGA 4LMFA 1FVUB 2BT7A 3N8WB 5CKQA 1KCGA 3U7UG 2B5ID 4RRWA 1QUBA 4E52A 1FVUA 3N8WA 1ATEA 1NQLB 4YLIA 1OJVA 1K9IA 1RDK1 3ZYGA 2YHFA 1UZQA 1XPHA 2CJIB 4KZWA 5I46L 1GKNA 2X2ZA 1SZBA 3N8VA 2GD4A 2P16L 4QKIA 4WRFA 4Y6DB 2XBWL 1HCCA 4J6NA 3CCKA 3F6KA 4QKJA 2YGQA 2WIIC 1QO6A 5KTIA 4KI1E 4ZETA 4DN8A 5F1AA 3U73A 3L89M 4Z0KB 2O39C 1NWVA 5FFTA 4N36A 1WMZA 2RLQA 4MTHA 4ZXXL 3OXUD 3P7FA 1U5MA 4WUXA 2XBXL 4WRCA 1JL9A 3FGRA 2J95B 1KLJL 1IGXA 1O9AA 1Y17A 3VLGA 3ENSA 4D0EA 4YMDA 2Y38A 1RDL1 2ADXA 1T8DA 1KX0A 3N8ZA 4Y79B 2P94L 4IOPB 2DDUA 3KQBL 3R05A 1K36A 1P1ZD 3G81A 1HREA 3FGTA 3ALSA 4X8UL 1KMB1 4IOPA 5JB8E 1MQ5L 2G00L 2WZPP 1KLIL 1OK2A 1R13A 4UWWA 2FZZL 2VRSA 1BF9A 2BPDA 1B6EA 3MQLA 2RA0L 1MQ6L 1U8CB 1G4FA 1WK1A 5IKTA 2VVVL 4KZVA 4YT7L 4C16A 1EPHA 2G7IA 2BOXA 2WPJE 4KMB1 4QKGA 5B1WA 3BT2A 3LIWB 2H2RA 2A55A 4BTTA 1GPZA 1ZAQA 2W26B 4GK1A 2VH6B 2KL7A 1YUFA 2XBVL 1KWUA 4ISHL 2VWOL 1FJSL 1EAIC 2BOKL 1OB1C 3S6XA 5K8YA 1KZA1 4YT6L 2IT5A 1ESLA 4LORA 5L2ZL 5M62A 1XDTR 1L5GB 2AFPA 2RHPA 5COXA 1IOXA 4M18A 3WWKC 1LITA 3P5GA 1EMNA 4JHSA 4WUWA 2AYLA 1YPOA 2C6UA 2Y7XB 2MSBA 1N7DA 4ONTD 1X7AL 1AFD1 3V65B 1OK9A 2I9AA 1C1ZA 1BCJ1 1N1IA 3CDGF 4NGAL 1F7EA 2PUQL 1RDJ1 3BDWB 1F0SB 2CKUA 4Y7BB 4AK8A 3GPRD 3BDWA 1ATAA 4E1GA 5FO8C 3SW0X 3IKQA 2YGOA 1P9JA 1YGCL 1KWXA 5EGMB 1BNLA 3WH3A 2BOUA 1SS2A 1MD8A 1RJHA 4ZH1D 3EGFA 1RLHA 2KMSA 1H8UA 1IGZA 3M36L 1R14A 2MTIA 1O7CT 1H04P 1B08A 1DY1A 1F00I 1KZB1 2EC3A 1IXXB 1MPUA 3HO5A 3K9XA 1ELVA 1PW9A 1DY0A 1F7MA 3L9JC 3P5IA 2XWJI 1G1TA 3RJ3D 2P3TA 1IXXA 3KXVA 1L3YA 1WHFA 3VWOA 4ZH8B 2XR6A 3GPRC 3N8YB 5J6GG 2W81A 2CL8A 1CWVA 3N8YA 1G1QA 1APQA 4MMYB 1URKA 5IKVA 1GKGA 1EGGA 1OZ7B 4N32A 3LAQA 4MMXB 1WT9B 2IZ3A 1IQIL 4AYIA 1PRHA 1OZ7A 2RL0A 1WT9A 5F19A 3GXEA 2PY2A 3FF9A 2MGPA 2W3KB 1P0SL 1TN3A 2Y81B 3NJAA 2VRPB 2JGXA 4J6MA 4LOTA 1V7PB 2M94A 1Z92B 3Q3KB 1QO3C 2VRPA 3CS7L 1V7PA 4WCOA 1AFA1 2BOHA 4J6PA 4PP8A 4G9AA 5B1RA 2OYUP 1KWTA 2BQ7A 1BCH1 1PXXA 2K2TA 3TZIA 2CG7A 4ISIL 2RKYA 2Y5HL 3HS5A 4CUDA 5HYTB 3FF7C 3P7HA 4C9FA 1IQLL 2J94B 2Y8SA 4APLA 2XC4L 1PGEA 2J38B 3GISX 3SW2A 1V4LB 3DEMA 3NTGA 3TBDA 3ZLDA 1KZC1 2H2TB 3ZYIB 5HYUB 1FIHA 3C8JA 1G2MB 3G83A 1V4LA 3P5HA 5I0QB 1RDI1 1QDDA 1LK9A 2W3IB 1E5GA 3LN0A 4BWCA 4ZESA 2EI7B 2VVCK 3NJPC 2KB9A 4N33A 1TPGA 3FFGL 2YRAA 5JBCE 1GK5A 2VWLL 3BT1A 4X8TL 4Y7AB 4KKDA 2BQ6A 3SOBB 2MCYA 2NPRA 3WWKB 3FBYA 3IKRA 2WPME 1LMJA 2LS8A 4QKHA 1KIGL 1VVDA 1K37A 4MMZB 4YZUB 3WWKA 2VWMK 1Q3XA 1PPQA 1EGFA 3ZHGA 4M11A 1OK3A 3HS7A 2JKHL 1NFXB 5JB9E 1YPQA 1HYRA 1YPUA 1HCGB 1LMMA 4K12A 4J6KA 3ELAL 2I2LA 2BSFA 4GI0A 1TPMA 1CCFA 2BQWA 1RDN1 1MSBA 4PDCA 1CKLA 1BUUA 1BJ3B 1MUQA 1EPIA 1KLOA 1NFWB 1IJKC 3PBFA 1PFXL 3OLTA 1MOXC 2Y8RA 1G1RA 2XRBA 1BJ3A 2BO2A 2UWPB 1KOEA 2PHBB 2P3UA 1NFYB 4MUCA 2ZQKA 4YNXA 2EI6B 2UWLB 4CSYA 3PAKA 1LPKA 1WHEA 4BXSA 2WYJB 2VUVA 1FAXL 1IODB 2Y7ZB 2VVUL 4JYVL 3GPRB 1IQFL 2W2NE 4S0UA 4X8SL 1IODA 1FAKL 1DVAL 2J4IB 1TPNA 1JWIB 2VH0B 2EHFA 2P95L 3ZRZA 3GPRA 1DQBA 1P4LD 1PTHA 1FE2A 4D90A 1APOA 1JWIA 1IQJL 1EZQB 3CI0J 1UMRC 2OX9A 3F1SB 2WG4B 4CUFA 1G2LB 1ATBA 2W2ME 3IKNA 1COUA 4IGDA 1C5MF 5LGKE 1J9CL 1HQ8A 1HT5A 1UOSB 2BPEA 2WPHE 3TVJA 1HT8A 4BXWA 3LTGD 1ADXA 2Y5FL 1TLEA 2XC0L 1KKEA 1V1IA 4GU3A 1UOSA 2ZIBA 2GGUA 2B7DL 2XR5A 3N8XA 3LC5B 1SRZA 4TGFA 4ZHAB 2W2QE 3CADA 4RUTA 5JBAE 2H9EL 3OLUA 1EPGA 1UOTP 1UZKA 1B9WA 4COXA 4F4OC 4WR9A 2P93L 1IQHL 3PARA 1KSNB 1WU1B 1NPEB 4JZEL 4M1GA 4N37A 1CQEA 2P3FN 1HRFA 3BX4B 2XQWC 2VWNL 3G84A 3P5EA 4JZFL 1JV2B 4A7IA 2ERJA 3PGHA 2FD6A 4PO7A 3BX4A 4ZAEB 1IQKL 3ZYJB 2JJLA 4LU5A 1SB2B 3UBUB 1YO8A 5E8DA 2E3XC 1KG0C 3K7BA 2Q1JB 5IKRA 2ORJA 1SB2A 3UBUA 1UZJA 3G8KA 3HO3A 3KRKA 3P7GA 3HO4A 2XWBF 3HS6A 3KL6B 3INBC 4A5WB 1KWYA 3WSXA 2Y8TA 2KRIA 4D0FA 2Y82B 2W80A 1F0RB 4G1MB 3CDGE 3QCWA 1FBRA 2WFTA 1I0UA 2XC5L 1SL5A 2XRDA 1T8CA 1TDQB 4AYDA 2FLGA 5HYPA 5DN5A 4J6JA 1J35B 3IU3I 3RS1A 3R62A 2VJ3A 1YXJA 2W86A 1J35A 2BT8A 2RNLA 2N40A 4BTUA 3GOVA 4J38B 5CKMA 4J6LA 5FFSA 1EQGA 3TGFA 5F2QA 2VUZA 1DIYA 1H2QP 1IJKB 3MDLA 1KX1A 1MD7A 1E8BA 1JZNA 4LOSA 4G96A 2UWNA 4B2SA 1H03P 3T3AA 1K9JA 1IQGL 2IT6A 4AYEA 4RS0A 3ERBA 2WPLE 2RKZA 5HZPB 3ALUA 1SL4A 1EBVA 4FXGG 4UXMA 3Q7DA 2WG3C 4M10A 1V1HA 1BYFA 3M7PA 2KV4A 3CA7A 3GCXE 1U0OB 3ZLEA 1QGBA 4YIZA 1W8BL 3K3TA 1KWVA 1EPJA 1EGIA 3KQDL 1GHQB 1G4GA 2W2OE 5JPMG 1UV0A 1CX2A 1KWWA 2P26A 4GU4A 1FF7A 5KTHA 2GO0A 1Q4GA 4GJ0A 3KZJA 2RLPA 1E8IA 4BTIA 2WPKE 1A3PA 3DBZA 1C3AB 4AYMA 2W2PE 2WYGB 2MHPA 3QMOA 4O02B 1C3AA 1LPGA 1NFUB 5FDQA 1YXKA 3WH2A 1U0NC 3SOQA 1RFNB 1QFKL 4J6QA 4OTJA 1IQEL 1G1SA 1EQHA 2Y5GL 5FFRA 2TGFA 3ASIA 3KK6A 3KQEL 5KIRA 1KWZA 3WSYA 1O7BT 3GCWE 2MGRA 2RIAA 4WQQA 3NCWA 3O8EB 5IKQA 3P5DA 1H2PP 1NZIA 2WPIE 4BDXA 4PZ5A 2YBYA 1OJYA 2PR3B 2KV3A 1EMOA 3HPTA 2P3FL 2OS9A 3IKPA 4N34A 1X2WB 3V64C 1Y17B 4B2RA 4NA9L 3NCXA 1SL6A 3WHDA 3WSRA 2FLBL 3TH3L 4OTYA 3KQCL 3OP8A 3SOVA 3OEDC 5JVYA 4BDWA 1X2WA 1Z6CA 2E3XB 3VPPA 2I9BA 1RDM1 1QIUA 2HOXA 1HAEA 1OJWA 2QY0A 4FM5A 1IQNL 2FLRL 1XFEA 3POYA 4Z6AL 5KN5C 2LOJA 3IITB 5B1XA 1Z6EL 4NG9L 1UEXB 3QH0A 4WJG2 5K0HB 3FCSB 3NTBA 1CVUA 3P5BL 4ZRWA 2ORKA 1UEXA 1HFIA 2ZYCA 2P28B 3CENL 1IVOC 3H5CB 1DX5I 3IJEB 2XBYL 4RRXA 2JGWA 1YUKB 4X8VL 3M9ZA 3LN1A 1JBUL 3WBQA 1DV8A 4PH9A 1V3XB 1CEJA 2J34B 2KNIA 2KMB1 3ZHGD 2F9BL 1W7XL 4LQFA 1GZ2A 1F02I 1JA3A 1LQDA 2RIBA 3WBPA 6COXA 3KMB1 4A94C 3CFWA 4MSLA 4EZMG 5L30L 3VYJA 2BPHA 1HX2A 4XLWA 2J2UB 1KZD1 4RRZA 4CUEA 3FD4A 1E88A 2CG6A 1DDXA 2OX8A 1FIFA 1VVCA 1HZ8A 4N7EA 3ZD2A 1IQML 3LC3B 2JRAA 4CAJA 2MCZA 3ZD1A 3KQGA 1OK1A 1ZJKA 1TOZA 5DN4A 2GGXA 1XKBA 4ZRVA 3BPSE 5JBBE 4N35A 2BRSA 3C8KD 4JZDL 1YUGA 1E5UI
chains in the Genus database with same CATH topology
3ALTA 1LPZA 2RIEA 3LTFB 3IX0A 1FM5A 2PF5A 3TK5B 3C22A 2UWOB 2EI8B 2BZMA 3CALA 1HTNA 3P5FA 3M37L 5JW1A 1BV4A 3EJHA 1J34B 2YGPA 5JVZA 1U0NB 3TK6B 1CCVA 1RDO1 3NT1A 4XBMA 4Y71B 2BZ6L 2V8EA 1J34A 1KZE1 3HUPA 3WBRA 4GJXA 4JYUL 3NFPI 3C9AC 1YTTA 1IP0A 3PAQA 1IOEL 4XL1A 1UKMB 1M1XB 5CKNA 4ZXYL 1WMYA 1E87A 1HFHA 1TLGA 4O1ZA 1FSBA 1UZPA 1CVWL 1DY2A 1HUPA 1UKMA 2RICA 1ATDA 1PWBA 1X2TB 1AUTL 2M74A 2IZ4A 4DJZA 1RTM1 2ZWKA 4M17A 3G8LA 3T5OA 2Y80B 1X2TA 1NT0A 1U67A 2I83A 1XARA 2RIDA 4GKOG 2WFXB 3MQEA 3RR3A 4WREA 4N38A 3F6UL 1HJ7A 2D1JB 4RRYA 1LY2A 5CISA 1FFMA 1U0OA 2K2SB 3KCGL 1IJQA 4Z0LA 4AQTA 5L2YL 2H9EC 3FF8C 3VYKA 1HAFA 2OYEP 1O5DL 1XKAL 4Y76B 1AFB1 1UMRA 2BMGA 4LMFA 1FVUB 3N8WB 5CKQA 1KCGA 3U7UG 2B5ID 4RRWA 1QUBA 4E52A 1FVUA 3N8WA 1ATEA 1NQLB 4YLIA 1OJVA 1K9IA 1RDK1 3ZYGA 2YHFA 1UZQA 1XPHA 2CJIB 4KZWA 5I46L 1GKNA 1SZBA 3N8VA 2GD4A 2P16L 4QKIA 4WRFA 4Y6DB 2XBWL 1HCCA 4J6NA 3CCKA 4QKJA 2YGQA 2WIIC 1QO6A 5KTIA 4KI1E 4ZETA 4DN8A 5F1AA 3U73A 3L89M 4Z0KB 2O39C 1NWVA 5FFTA 4N36A 1WMZA 2RLQA 4MTHA 4ZXXL 3OXUD 3P7FA 1U5MA 4WUXA 2XBXL 4WRCA 1JL9A 2J95B 1KLJL 1IGXA 1O9AA 1Y17A 3VLGA 3ENSA 4D0EA 4YMDA 2Y38A 1RDL1 2ADXA 1T8DA 1KX0A 3N8ZA 4Y79B 2P94L 4IOPB 2DDUA 3KQBL 3R05A 1K36A 1P1ZD 3G81A 1HREA 3ALSA 4X8UL 1KMB1 4IOPA 5JB8E 1MQ5L 2G00L 2WZPP 1KLIL 1OK2A 1R13A 4UWWA 2FZZL 1BF9A 2BPDA 1B6EA 3MQLA 2RA0L 1MQ6L 1U8CB 1G4FA 1WK1A 5IKTA 2VVVL 4KZVA 4YT7L 4C16A 1EPHA 2G7IA 2BOXA 2WPJE 4KMB1 4QKGA 5B1WA 3BT2A 3LIWB 2H2RA 2A55A 4BTTA 1GPZA 1ZAQA 2W26B 4GK1A 2VH6B 2KL7A 1YUFA 2XBVL 1KWUA 4ISHL 2VWOL 1FJSL 1EAIC 2BOKL 1OB1C 3S6XA 5K8YA 1KZA1 4YT6L 2IT5A 1ESLA 4LORA 5L2ZL 5M62A 1XDTR 1L5GB 2AFPA 2RHPA 5COXA 1IOXA 4M18A 3WWKC 1LITA 3P5GA 1EMNA 4JHSA 4WUWA 2AYLA 1YPOA 2C6UA 2Y7XB 2MSBA 1N7DA 4ONTD 1X7AL 1AFD1 3V65B 1OK9A 2I9AA 1C1ZA 1BCJ1 1N1IA 3CDGF 4NGAL 1F7EA 2PUQL 1RDJ1 3BDWB 1F0SB 2CKUA 4Y7BB 4AK8A 3GPRD 3BDWA 1ATAA 4E1GA 5FO8C 3SW0X 3IKQA 2YGOA 1P9JA 1YGCL 1KWXA 5EGMB 1BNLA 3WH3A 2BOUA 1SS2A 1MD8A 1RJHA 4ZH1D 3EGFA 1R14A 2KMSA 1H8UA 1IGZA 3M36L 2MTIA 1O7CT 1H04P 1B08A 1DY1A 1F00I 1KZB1 2EC3A 1IXXB 1MPUA 3HO5A 3K9XA 1ELVA 1PW9A 1DY0A 1F7MA 3L9JC 3P5IA 2XWJI 1G1TA 3RJ3D 2P3TA 1IXXA 3KXVA 1L3YA 1WHFA 2XR6A 4ZH8B 3GPRC 5J6GG 3N8YB 2W81A 2CL8A 1CWVA 3N8YA 1G1QA 1APQA 4MMYB 1URKA 5IKVA 1GKGA 1EGGA 1OZ7B 4N32A 3LAQA 4MMXB 1WT9B 2IZ3A 1IQIL 4AYIA 1PRHA 1OZ7A 2RL0A 1WT9A 5F19A 3GXEA 2PY2A 3FF9A 2MGPA 2W3KB 1P0SL 1TN3A 2Y81B 2VRPB 4J6MA 2JGXA 4LOTA 1V7PB 2M94A 1Z92B 3Q3KB 1QO3C 2VRPA 3CS7L 1V7PA 4WCOA 1AFA1 2BOHA 4J6PA 4PP8A 4G9AA 5B1RA 2OYUP 1KWTA 2BQ7A 1BCH1 1PXXA 2K2TA 3TZIA 2CG7A 4ISIL 2RKYA 2Y5HL 3HS5A 4CUDA 5HYTB 3FF7C 3P7HA 4C9FA 1IQLL 2J94B 2RIBA 4J6KA 2XC4L 1PGEA 2J38B 3GISX 3SW2A 1V4LB 3DEMA 3NTGA 3TBDA 1KZC1 2H2TB 3G83A 3ZYIB 5HYUB 1FIHA 3C8JA 1G2MB 3P5HA 1V4LA 5I0QB 1RDI1 1QDDA 2W3IB 1E5GA 3LN0A 4ZESA 2EI7B 2VVCK 3NJPC 2KB9A 4N33A 1TPGA 3FFGL 2YRAA 5JBCE 1GK5A 2VWLL 3BT1A 4X8TL 4Y7AB 4KKDA 2BQ6A 3SOBB 2MCYA 2NPRA 3WWKB 3FBYA 3IKRA 2WPME 1LMJA 2LS8A 4QKHA 1KIGL 1VVDA 1K37A 4MMZB 4YZUB 3WWKA 2VWMK 1Q3XA 1PPQA 1EGFA 3ZHGA 4M11A 1OK3A 3HS7A 2JKHL 1NFXB 5JB9E 1YPQA 1HYRA 1YPUA 1HCGB 1LMMA 4K12A 3ELAL 4GI0A 1TPMA 1CCFA 2BQWA 1RDN1 1MSBA 4PDCA 1CKLA 1BUUA 1BJ3B 1MUQA 1EPIA 1KLOA 1NFWB 1IJKC 3PBFA 1PFXL 3OLTA 1MOXC 1G1RA 2XRBA 1BJ3A 2BO2A 2UWPB 1KOEA 2PHBB 2P3UA 1NFYB 4MUCA 2ZQKA 4YNXA 2EI6B 2UWLB 4CSYA 3PAKA 1LPKA 1WHEA 4BXSA 2WYJB 2VUVA 1FAXL 1IODB 2Y7ZB 2VVUL 4JYVL 3GPRB 1IQFL 2W2NE 4S0UA 4X8SL 1IODA 1FAKL 1DVAL 2J4IB 1TPNA 1JWIB 2VH0B 2EHFA 2P95L 3ZRZA 3GPRA 1DQBA 1P4LD 1PTHA 1FE2A 4D90A 1APOA 1JWIA 1IQJL 1EZQB 1UMRC 2OX9A 3F1SB 2WG4B 4CUFA 1G2LB 1ATBA 2W2ME 3IKNA 1COUA 4IGDA 1C5MF 5LGKE 1J9CL 1HQ8A 1HT5A 1UOSB 2BPEA 2WPHE 3TVJA 1HT8A 4BXWA 3LTGD 1ADXA 2Y5FL 1TLEA 2XC0L 1UOSA 2ZIBA 2GGUA 2B7DL 2XR5A 3N8XA 3LC5B 1SRZA 4TGFA 4ZHAB 2W2QE 3CADA 4RUTA 5JBAE 2H9EL 3OLUA 1EPGA 1UOTP 1UZKA 1B9WA 4COXA 4F4OC 4WR9A 2P93L 1IQHL 3PARA 1KSNB 1WU1B 1NPEB 4JZEL 4M1GA 4N37A 1CQEA 2P3FN 1HRFA 3BX4B 2XQWC 2VWNL 3G84A 3P5EA 4JZFL 1JV2B 4A7IA 2ERJA 3PGHA 2FD6A 4LU5A 3BX4A 4ZAEB 1IQKL 3ZYJB 1SB2B 3UBUB 1YO8A 5E8DA 2E3XC 1KG0C 3K7BA 2Q1JB 5IKRA 2ORJA 1SB2A 3UBUA 1UZJA 3G8KA 3HO3A 3KRKA 3P7GA 3HO4A 2XWBF 3HS6A 3KL6B 3INBC 4A5WB 1KWYA 2KRIA 4D0FA 2Y82B 2W80A 1F0RB 4G1MB 3CDGE 3QCWA 1FBRA 2WFTA 1I0UA 2XC5L 1SL5A 2XRDA 1T8CA 1TDQB 4AYDA 2FLGA 5HYPA 4J6JA 1J35B 3IU3I 3RS1A 3R62A 2VJ3A 1YXJA 2W86A 1J35A 2RNLA 2N40A 4BTUA 3GOVA 4J38B 5CKMA 4J6LA 5FFSA 1EQGA 3TGFA 5F2QA 2VUZA 1DIYA 1H2QP 1IJKB 3MDLA 1KX1A 1MD7A 1E8BA 1JZNA 4LOSA 4G96A 2UWNA 4B2SA 1H03P 3T3AA 1K9JA 1IQGL 2IT6A 4AYEA 4RS0A 3ERBA 2WPLE 2RKZA 5HZPB 3ALUA 1SL4A 1EBVA 4FXGG 4UXMA 3Q7DA 2WG3C 4M10A 1BYFA 3M7PA 2KV4A 3CA7A 3GCXE 1U0OB 1QGBA 1W8BL 1KWVA 1EPJA 1EGIA 3KQDL 1GHQB 1G4GA 2W2OE 5JPMG 1UV0A 1CX2A 1KWWA 2P26A 1FF7A 5KTHA 2GO0A 1Q4GA 4GJ0A 3KZJA 2RLPA 1E8IA 4BTIA 2WPKE 1A3PA 3DBZA 1C3AB 4AYMA 2W2PE 2WYGB 2MHPA 3QMOA 4O02B 1C3AA 1LPGA 1NFUB 5FDQA 1YXKA 3WH2A 1U0NC 3SOQA 1RFNB 1QFKL 4J6QA 4OTJA 1IQEL 1G1SA 1EQHA 2Y5GL 5FFRA 2TGFA 3ASIA 3KK6A 3KQEL 5KIRA 1KWZA 1O7BT 3GCWE 2MGRA 2RIAA 4WQQA 3NCWA 3O8EB 5IKQA 3P5DA 1H2PP 1NZIA 2WPIE 4BDXA 4PZ5A 2YBYA 1OJYA 2PR3B 2KV3A 1EMOA 3HPTA 2P3FL 2OS9A 3IKPA 4N34A 1X2WB 3V64C 1Y17B 4B2RA 4NA9L 3NCXA 1SL6A 3WHDA 3WSRA 2FLBL 3TH3L 4OTYA 3KQCL 3OP8A 3SOVA 3OEDC 5JVYA 4BDWA 1X2WA 1Z6CA 2E3XB 3VPPA 2I9BA 1RDM1 1HAEA 1OJWA 2QY0A 4FM5A 1IQNL 2FLRL 1XFEA 3POYA 4Z6AL 5KN5C 2LOJA 3IITB 5B1XA 1Z6EL 4NG9L 1UEXB 3QH0A 4WJG2 5K0HB 3FCSB 3NTBA 1CVUA 3P5BL 4ZRWA 2ORKA 1UEXA 1HFIA 2P28B 3CENL 1IVOC 3H5CB 1DX5I 3IJEB 2XBYL 4RRXA 2JGWA 1YUKB 4X8VL 3M9ZA 3LN1A 1JBUL 3WBQA 1DV8A 4PH9A 1V3XB 1CEJA 2J34B 2KNIA 2KMB1 3ZHGD 2F9BL 1W7XL 4LQFA 1GZ2A 1F02I 1JA3A 1LQDA 3WBPA 6COXA 3KMB1 4A94C 3CFWA 4EZMG 5L30L 3VYJA 2BPHA 1HX2A 4XLWA 2J2UB 1KZD1 4RRZA 4CUEA 3FD4A 1E88A 2CG6A 1DDXA 2OX8A 1FIFA 1VVCA 1HZ8A 3ZD2A 1IQML 3LC3B 2JRAA 4CAJA 2MCZA 3ZD1A 3KQGA 1OK1A 1ZJKA 1TOZA 2GGXA 1XKBA 4ZRVA 3BPSE 5JBBE 4N35A 2BRSA 3C8KD 4JZDL 1YUGA 1E5UI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ALT A;  1LPZ A;  2RIE A;  3LTF B;  3IX0 A;  1FM5 A;  2PF5 A;  3TK5 B;  3C22 A;  2UWO B;  2EI8 B;  2BZM A;  3CAL A;  1HTN A;  3P5F A;  3M37 L;  5JW1 A;  1BV4 A;  3EJH A;  1J34 B;  2YGP A;  5JVZ A;  1U0N B;  3TK6 B;  1CCV A;  1RDO 1;  3NT1 A;  4XBM A;  4Y71 B;  2BZ6 L;  2V8E A;  1J34 A;  1KZE 1;  3HUP A;  3WBR A;  4GJX A;  4JYU L;  3NFP I;  3C9A C;  1YTT A;  1IP0 A;  3PAQ A;  1IOE L;  4XL1 A;  1UKM B;  1M1X B;  5CKN A;  4ZXY L;  1WMY A;  1E87 A;  1HFH A;  1TLG A;  4O1Z A;  1FSB A;  1UZP A;  1CVW L;  1DY2 A;  1HUP A;  1UKM A;  2RIC A;  1ATD A;  1PWB A;  1X2T B;  1AUT L;  2M74 A;  2IZ4 A;  4DJZ A;  1RTM 1;  2ZWK A;  4M17 A;  3G8L A;  3T5O A;  2Y80 B;  1X2T A;  1NT0 A;  1U67 A;  2I83 A;  1XAR A;  2RID A;  4GKO G;  2WFX B;  3MQE A;  3RR3 A;  4WRE A;  4N38 A;  3F6U L;  1HJ7 A;  2D1J B;  4RRY A;  1LY2 A;  5CIS A;  1FFM A;  1U0O A;  2K2S B;  3KCG L;  1IJQ A;  4Z0L A;  4AQT A;  5L2Y L;  3VYK A;  3FF8 C;  1HAF A;  2OYE P;  1O5D L;  1XKA L;  4Y76 B;  1AFB 1;  1UMR A;  2BMG A;  4LMF A;  1FVU B;  3N8W B;  5CKQ A;  1KCG A;  3U7U G;  2B5I D;  4RRW A;  1QUB A;  4E52 A;  1FVU A;  3N8W A;  1ATE A;  1NQL B;  4YLI A;  1OJV A;  1K9I A;  1RDK 1;  3ZYG A;  2YHF A;  1UZQ A;  1XPH A;  2CJI B;  4KZW A;  5I46 L;  1GKN A;  1SZB A;  3N8V A;  2GD4 A;  2P16 L;  4QKI A;  4WRF A;  4Y6D B;  2XBW L;  1HCC A;  4J6N A;  3CCK A;  4QKJ A;  2WII C;  1QO6 A;  5KTI A;  4KI1 E;  4ZET A;  4DN8 A;  5F1A A;  3U73 A;  3L89 M;  4Z0K B;  2O39 C;  1NWV A;  5FFT A;  4N36 A;  1WMZ A;  2RLQ A;  4MTH A;  4ZXX L;  3OXU D;  3P7F A;  1U5M A;  4WUX A;  2XBX L;  4WRC A;  1JL9 A;  2J95 B;  1KLJ L;  1IGX A;  1O9A A;  1Y17 A;  3VLG A;  3ENS A;  4D0E A;  4YMD A;  2Y38 A;  1RDL 1;  2ADX A;  1T8D A;  1KX0 A;  3N8Z A;  4Y79 B;  2P94 L;  4IOP B;  2DDU A;  3KQB L;  3R05 A;  1K36 A;  1P1Z D;  3G81 A;  1HRE A;  3ALS A;  4X8U L;  1KMB 1;  4IOP A;  5JB8 E;  1MQ5 L;  2G00 L;  1OK2 A;  1KLI L;  1R13 A;  4UWW A;  2FZZ L;  1BF9 A;  2BPD A;  1B6E A;  3MQL A;  2RA0 L;  1MQ6 L;  1U8C B;  1G4F A;  1WK1 A;  5IKT A;  2VVV L;  4KZV A;  4YT7 L;  4C16 A;  1EPH A;  2G7I A;  2BOX A;  2WPJ E;  4KMB 1;  4QKG A;  5B1W A;  3BT2 A;  3LIW B;  2H2R A;  2A55 A;  4BTT A;  1GPZ A;  1ZAQ A;  2W26 B;  4GK1 A;  2VH6 B;  2KL7 A;  1YUF A;  2XBV L;  1KWU A;  4ISH L;  2VWO L;  1FJS L;  1EAI C;  2BOK L;  1OB1 C;  5K8Y A;  1KZA 1;  4YT6 L;  2IT5 A;  1ESL A;  4LOR A;  5L2Z L;  5M62 A;  1XDT R;  1L5G B;  2AFP A;  2RHP A;  5COX A;  1IOX A;  4M18 A;  3WWK C;  1LIT A;  3P5G A;  1EMN A;  4JHS A;  4WUW A;  2AYL A;  1YPO A;  2C6U A;  2Y7X B;  2MSB A;  1N7D A;  4ONT D;  1X7A L;  1AFD 1;  3V65 B;  1OK9 A;  2I9A A;  1C1Z A;  1BCJ 1;  1N1I A;  3CDG F;  4NGA L;  1F7E A;  2PUQ L;  1RDJ 1;  3BDW B;  1F0S B;  2CKU A;  4Y7B B;  4AK8 A;  3GPR D;  3BDW A;  1ATA A;  4E1G A;  5FO8 C;  3SW0 X;  3IKQ A;  2YGO A;  1P9J A;  1YGC L;  1KWX A;  5EGM B;  1BNL A;  3WH3 A;  2BOU A;  1SS2 A;  1MD8 A;  1RJH A;  4ZH1 D;  3EGF A;  1R14 A;  2KMS A;  1H8U A;  1IGZ A;  3M36 L;  2MTI A;  1O7C T;  1H04 P;  1B08 A;  1DY1 A;  1F00 I;  1KZB 1;  2EC3 A;  1IXX B;  1MPU A;  3HO5 A;  3K9X A;  1ELV A;  1PW9 A;  1DY0 A;  1F7M A;  3L9J C;  3P5I A;  2XWJ I;  1G1T A;  3RJ3 D;  2P3T A;  1IXX A;  3KXV A;  1L3Y A;  1WHF A;  2XR6 A;  4ZH8 B;  3GPR C;  5J6G G;  3N8Y B;  2W81 A;  2CL8 A;  1CWV A;  3N8Y A;  1G1Q A;  1APQ A;  4MMY B;  1URK A;  5IKV A;  1GKG A;  1EGG A;  1OZ7 B;  4N32 A;  3LAQ A;  4MMX B;  1WT9 B;  2IZ3 A;  1IQI L;  4AYI A;  1PRH A;  1OZ7 A;  2RL0 A;  1WT9 A;  5F19 A;  3GXE A;  2PY2 A;  3FF9 A;  2MGP A;  2W3K B;  1P0S L;  1TN3 A;  2Y81 B;  2VRP B;  4J6M A;  2JGX A;  4LOT A;  1V7P B;  2M94 A;  1Z92 B;  3Q3K B;  1QO3 C;  2VRP A;  3CS7 L;  1V7P A;  4WCO A;  1AFA 1;  2BOH A;  4J6P A;  4PP8 A;  4G9A A;  5B1R A;  2OYU P;  1KWT A;  2BQ7 A;  1BCH 1;  1PXX A;  2K2T A;  3TZI A;  2CG7 A;  4ISI L;  2RKY A;  2Y5H L;  3HS5 A;  4CUD A;  5HYT B;  3FF7 C;  3P7H A;  4C9F A;  1IQL L;  2J94 B;  2RIB A;  4J6K A;  2XC4 L;  1PGE A;  2J38 B;  3GIS X;  3SW2 A;  1V4L B;  3DEM A;  3NTG A;  3TBD A;  1KZC 1;  2H2T B;  3G83 A;  3ZYI B;  5HYU B;  1FIH A;  3C8J A;  1G2M B;  3P5H A;  1V4L A;  5I0Q B;  1RDI 1;  1QDD A;  2W3I B;  1E5G A;  3LN0 A;  4ZES A;  2EI7 B;  2VVC K;  3NJP C;  2KB9 A;  4N33 A;  1TPG A;  3FFG L;  2YRA A;  5JBC E;  1GK5 A;  2VWL L;  3BT1 A;  4X8T L;  4Y7A B;  4KKD A;  2BQ6 A;  3SOB B;  2MCY A;  2NPR A;  3WWK B;  3FBY A;  3IKR A;  2WPM E;  1LMJ A;  2LS8 A;  4QKH A;  1KIG L;  1VVD A;  1K37 A;  4MMZ B;  4YZU B;  3WWK A;  2VWM K;  1Q3X A;  1PPQ A;  1EGF A;  3ZHG A;  4M11 A;  1OK3 A;  3HS7 A;  2JKH L;  1NFX B;  5JB9 E;  1YPQ A;  1HYR A;  1YPU A;  1HCG B;  4K12 A;  3ELA L;  4GI0 A;  1TPM A;  1CCF A;  2BQW A;  1RDN 1;  1MSB A;  4PDC A;  1CKL A;  1BUU A;  1BJ3 B;  1MUQ A;  1EPI A;  1KLO A;  1NFW B;  1IJK C;  3PBF A;  1PFX L;  3OLT A;  1MOX C;  1G1R A;  2XRB A;  1BJ3 A;  2BO2 A;  2UWP B;  1KOE A;  2PHB B;  2P3U A;  1NFY B;  4MUC A;  2ZQK A;  4YNX A;  2EI6 B;  2UWL B;  4CSY A;  3PAK A;  1LPK A;  1WHE A;  4BXS A;  2WYJ B;  2VUV A;  1FAX L;  1IOD B;  2Y7Z B;  2VVU L;  4JYV L;  3GPR B;  1IQF L;  2W2N E;  4S0U A;  4X8S L;  1IOD A;  1FAK L;  1DVA L;  2J4I B;  1TPN A;  1JWI B;  2VH0 B;  2EHF A;  2P95 L;  3ZRZ A;  3GPR A;  1DQB A;  1P4L D;  1PTH A;  1FE2 A;  4D90 A;  1APO A;  1JWI A;  1IQJ L;  1EZQ B;  1UMR C;  2OX9 A;  3F1S B;  2WG4 B;  4CUF A;  1G2L B;  1ATB A;  2W2M E;  3IKN A;  1COU A;  4IGD A;  1C5M F;  5LGK E;  1J9C L;  1HQ8 A;  1HT5 A;  1UOS B;  2BPE A;  2WPH E;  3TVJ A;  1HT8 A;  4BXW A;  3LTG D;  1ADX A;  2Y5F L;  1TLE A;  2XC0 L;  1UOS A;  2ZIB A;  2GGU A;  2B7D L;  2XR5 A;  3N8X A;  3LC5 B;  1SRZ A;  4TGF A;  4ZHA B;  2W2Q E;  3CAD A;  4RUT A;  5JBA E;  2H9E L;  3OLU A;  1EPG A;  1UOT P;  1UZK A;  1B9W A;  4COX A;  4F4O C;  4WR9 A;  2P93 L;  1IQH L;  3PAR A;  1KSN B;  1WU1 B;  1NPE B;  4JZE L;  4M1G A;  4N37 A;  1CQE A;  2P3F N;  1HRF A;  3BX4 B;  2XQW C;  2VWN L;  3G84 A;  3P5E A;  4JZF L;  1JV2 B;  4A7I A;  2ERJ A;  3PGH A;  2FD6 A;  4LU5 A;  3BX4 A;  4ZAE B;  1IQK L;  3ZYJ B;  1SB2 B;  3UBU B;  1YO8 A;  5E8D A;  2E3X C;  1KG0 C;  3K7B A;  2Q1J B;  5IKR A;  2ORJ A;  1SB2 A;  3UBU A;  1UZJ A;  3G8K A;  3HO3 A;  3KRK A;  3P7G A;  3HO4 A;  2XWB F;  3HS6 A;  3KL6 B;  3INB C;  4A5W B;  1KWY A;  2KRI A;  4D0F A;  2Y82 B;  2W80 A;  1F0R B;  4G1M B;  3CDG E;  3QCW A;  1FBR A;  2WFT A;  1I0U A;  2XC5 L;  1SL5 A;  2XRD A;  1T8C A;  1TDQ B;  4AYD A;  2FLG A;  5HYP A;  4J6J A;  1J35 B;  3IU3 I;  3RS1 A;  3R62 A;  2VJ3 A;  1YXJ A;  2W86 A;  1J35 A;  2RNL A;  2N40 A;  4BTU A;  3GOV A;  4J38 B;  5CKM A;  4J6L A;  5FFS A;  1EQG A;  3TGF A;  5F2Q A;  2VUZ A;  1DIY A;  1H2Q P;  1IJK B;  3MDL A;  1KX1 A;  1MD7 A;  1E8B A;  1JZN A;  4LOS A;  4G96 A;  2UWN A;  4B2S A;  1H03 P;  3T3A A;  1K9J A;  1IQG L;  2IT6 A;  4AYE A;  4RS0 A;  3ERB A;  2WPL E;  2RKZ A;  5HZP B;  3ALU A;  1SL4 A;  1EBV A;  4FXG G;  4UXM A;  3Q7D A;  2WG3 C;  4M10 A;  1BYF A;  3M7P A;  2KV4 A;  3CA7 A;  3GCX E;  1U0O B;  1QGB A;  1W8B L;  1KWV A;  1EPJ A;  1EGI A;  3KQD L;  1GHQ B;  1G4G A;  2W2O E;  5JPM G;  1UV0 A;  1CX2 A;  1KWW A;  2P26 A;  1FF7 A;  5KTH A;  2GO0 A;  1Q4G A;  4GJ0 A;  3KZJ A;  2RLP A;  1E8I A;  4BTI A;  2WPK E;  1A3P A;  3DBZ A;  1C3A B;  4AYM A;  2W2P E;  2WYG B;  2MHP A;  3QMO A;  4O02 B;  1C3A A;  1LPG A;  1NFU B;  5FDQ A;  1YXK A;  3WH2 A;  1U0N C;  3SOQ A;  1RFN B;  1QFK L;  4J6Q A;  4OTJ A;  1IQE L;  1G1S A;  1EQH A;  2Y5G L;  5FFR A;  2TGF A;  3ASI A;  3KK6 A;  3KQE L;  5KIR A;  1KWZ A;  1O7B T;  3GCW E;  2MGR A;  2RIA A;  4WQQ A;  3NCW A;  3O8E B;  5IKQ A;  3P5D A;  1H2P P;  1NZI A;  2WPI E;  4BDX A;  4PZ5 A;  2YBY A;  1OJY A;  2PR3 B;  2KV3 A;  1EMO A;  3HPT A;  2P3F L;  2OS9 A;  3IKP A;  4N34 A;  1X2W B;  3V64 C;  1Y17 B;  4B2R A;  4NA9 L;  3NCX A;  1SL6 A;  3WHD A;  3WSR A;  2FLB L;  3TH3 L;  4OTY A;  3KQC L;  3OP8 A;  3SOV A;  3OED C;  5JVY A;  4BDW A;  1X2W A;  1Z6C A;  2E3X B;  3VPP A;  2I9B A;  1RDM 1;  1HAE A;  1OJW A;  2QY0 A;  4FM5 A;  1IQN L;  2FLR L;  1XFE A;  3POY A;  4Z6A L;  5KN5 C;  2LOJ A;  3IIT B;  5B1X A;  1Z6E L;  4NG9 L;  1UEX B;  3QH0 A;  4WJG 2;  5K0H B;  3FCS B;  3NTB A;  1CVU A;  3P5B L;  4ZRW A;  2ORK A;  1UEX A;  1HFI A;  2P28 B;  3CEN L;  1IVO C;  3H5C B;  1DX5 I;  3IJE B;  2XBY L;  4RRX A;  2JGW A;  1YUK B;  4X8V L;  3M9Z A;  3LN1 A;  1JBU L;  3WBQ A;  1DV8 A;  4PH9 A;  1V3X B;  1CEJ A;  2J34 B;  2KMB 1;  3ZHG D;  2F9B L;  1W7X L;  4LQF A;  1GZ2 A;  1F02 I;  1JA3 A;  1LQD A;  3WBP A;  6COX A;  3KMB 1;  3CFW A;  4EZM G;  5L30 L;  3VYJ A;  2BPH A;  1HX2 A;  4XLW A;  2J2U B;  1KZD 1;  4RRZ A;  4CUE A;  3FD4 A;  1E88 A;  2CG6 A;  1DDX A;  2OX8 A;  1FIF A;  1VVC A;  1HZ8 A;  3ZD2 A;  1IQM L;  3LC3 B;  2JRA A;  4CAJ A;  2MCZ A;  3ZD1 A;  3KQG A;  1OK1 A;  1ZJK A;  1TOZ A;  2GGX A;  1XKB A;  4ZRV A;  3BPS E;  5JBB E;  4N35 A;  2BRS A;  3C8K D;  4JZD L;  1YUG A;  1E5U I; 
#chains in the Genus database with same CATH topology
 3ALT A;  1LPZ A;  2RIE A;  3LTF B;  3IX0 A;  1FM5 A;  2PF5 A;  3TK5 B;  3C22 A;  2UWO B;  2EI8 B;  2BZM A;  3CAL A;  1HTN A;  3P5F A;  3M37 L;  5JW1 A;  1BV4 A;  3EJH A;  1J34 B;  2YGP A;  5JVZ A;  1U0N B;  3TK6 B;  1CCV A;  1RDO 1;  3NT1 A;  4XBM A;  4Y71 B;  2BZ6 L;  2V8E A;  1J34 A;  1KZE 1;  3HUP A;  3WBR A;  4GJX A;  4JYU L;  3NFP I;  3C9A C;  1YTT A;  2HOR A;  1IP0 A;  3PAQ A;  1IOE L;  4XL1 A;  1UKM B;  1M1X B;  5CKN A;  4ZXY L;  1WMY A;  1E87 A;  1HFH A;  1TLG A;  4O1Z A;  1FSB A;  1UZP A;  1CVW L;  1DY2 A;  1HUP A;  1UKM A;  2RIC A;  1ATD A;  1PWB A;  1X2T B;  1AUT L;  2M74 A;  2IZ4 A;  4DJZ A;  1RTM 1;  2ZWK A;  4M17 A;  3G8L A;  3T5O A;  2Y80 B;  1X2T A;  1NT0 A;  1U67 A;  2I83 A;  1XAR A;  2RID A;  4GKO G;  2WFX B;  3MQE A;  3RR3 A;  4WRE A;  4N38 A;  3F6U L;  1HJ7 A;  2D1J B;  4RRY A;  1LY2 A;  5CIS A;  1FFM A;  1U0O A;  2K2S B;  3KCG L;  1IJQ A;  4Z0L A;  4AQT A;  5L2Y L;  2H9E C;  3FF8 C;  3VYK A;  1HAF A;  2OYE P;  1O5D L;  1XKA L;  4Y76 B;  1AFB 1;  1UMR A;  2BMG A;  4LMF A;  1FVU B;  2BT7 A;  3N8W B;  5CKQ A;  1KCG A;  3U7U G;  2B5I D;  4RRW A;  1QUB A;  4E52 A;  1FVU A;  3N8W A;  1ATE A;  1NQL B;  4YLI A;  1OJV A;  1K9I A;  1RDK 1;  3ZYG A;  2YHF A;  1UZQ A;  1XPH A;  2CJI B;  4KZW A;  5I46 L;  1GKN A;  2X2Z A;  1SZB A;  3N8V A;  2GD4 A;  2P16 L;  4QKI A;  4WRF A;  4Y6D B;  2XBW L;  1HCC A;  4J6N A;  3CCK A;  3F6K A;  4QKJ A;  2YGQ A;  2WII C;  1QO6 A;  5KTI A;  4KI1 E;  4ZET A;  4DN8 A;  5F1A A;  3U73 A;  3L89 M;  4Z0K B;  2O39 C;  1NWV A;  5FFT A;  4N36 A;  1WMZ A;  2RLQ A;  4MTH A;  4ZXX L;  3OXU D;  3P7F A;  1U5M A;  4WUX A;  2XBX L;  4WRC A;  1JL9 A;  3FGR A;  2J95 B;  1KLJ L;  1IGX A;  1O9A A;  1Y17 A;  3VLG A;  3ENS A;  4D0E A;  4YMD A;  2Y38 A;  1RDL 1;  2ADX A;  1T8D A;  1KX0 A;  3N8Z A;  4Y79 B;  2P94 L;  4IOP B;  2DDU A;  3KQB L;  3R05 A;  1K36 A;  1P1Z D;  3G81 A;  1HRE A;  3FGT A;  3ALS A;  4X8U L;  1KMB 1;  4IOP A;  5JB8 E;  1MQ5 L;  2G00 L;  2WZP P;  1KLI L;  1OK2 A;  1R13 A;  4UWW A;  2FZZ L;  2VRS A;  1BF9 A;  2BPD A;  1B6E A;  3MQL A;  2RA0 L;  1MQ6 L;  1U8C B;  1G4F A;  1WK1 A;  5IKT A;  2VVV L;  4KZV A;  4YT7 L;  4C16 A;  1EPH A;  2G7I A;  2BOX A;  2WPJ E;  4KMB 1;  4QKG A;  5B1W A;  3BT2 A;  3LIW B;  2H2R A;  2A55 A;  4BTT A;  1GPZ A;  1ZAQ A;  2W26 B;  4GK1 A;  2VH6 B;  2KL7 A;  1YUF A;  2XBV L;  1KWU A;  4ISH L;  2VWO L;  1FJS L;  1EAI C;  2BOK L;  1OB1 C;  3S6X A;  5K8Y A;  1KZA 1;  4YT6 L;  2IT5 A;  1ESL A;  4LOR A;  5L2Z L;  5M62 A;  1XDT R;  1L5G B;  2AFP A;  2RHP A;  5COX A;  1IOX A;  4M18 A;  3WWK C;  1LIT A;  3P5G A;  1EMN A;  4JHS A;  4WUW A;  2AYL A;  1YPO A;  2C6U A;  2Y7X B;  2MSB A;  1N7D A;  4ONT D;  1X7A L;  1AFD 1;  3V65 B;  1OK9 A;  2I9A A;  1C1Z A;  1BCJ 1;  1N1I A;  3CDG F;  4NGA L;  1F7E A;  2PUQ L;  1RDJ 1;  3BDW B;  1F0S B;  2CKU A;  4Y7B B;  4AK8 A;  3GPR D;  3BDW A;  1ATA A;  4E1G A;  5FO8 C;  3SW0 X;  3IKQ A;  2YGO A;  1P9J A;  1YGC L;  1KWX A;  5EGM B;  1BNL A;  3WH3 A;  2BOU A;  1SS2 A;  1MD8 A;  1RJH A;  4ZH1 D;  3EGF A;  1RLH A;  2KMS A;  1H8U A;  1IGZ A;  3M36 L;  1R14 A;  2MTI A;  1O7C T;  1H04 P;  1B08 A;  1DY1 A;  1F00 I;  1KZB 1;  2EC3 A;  1IXX B;  1MPU A;  3HO5 A;  3K9X A;  1ELV A;  1PW9 A;  1DY0 A;  1F7M A;  3L9J C;  3P5I A;  2XWJ I;  1G1T A;  3RJ3 D;  2P3T A;  1IXX A;  3KXV A;  1L3Y A;  1WHF A;  3VWO A;  4ZH8 B;  2XR6 A;  3GPR C;  3N8Y B;  5J6G G;  2W81 A;  2CL8 A;  1CWV A;  3N8Y A;  1G1Q A;  1APQ A;  4MMY B;  1URK A;  5IKV A;  1GKG A;  1EGG A;  1OZ7 B;  4N32 A;  3LAQ A;  4MMX B;  1WT9 B;  2IZ3 A;  1IQI L;  4AYI A;  1PRH A;  1OZ7 A;  2RL0 A;  1WT9 A;  5F19 A;  3GXE A;  2PY2 A;  3FF9 A;  2MGP A;  2W3K B;  1P0S L;  1TN3 A;  2Y81 B;  3NJA A;  2VRP B;  2JGX A;  4J6M A;  4LOT A;  1V7P B;  2M94 A;  1Z92 B;  3Q3K B;  1QO3 C;  2VRP A;  3CS7 L;  1V7P A;  4WCO A;  1AFA 1;  2BOH A;  4J6P A;  4PP8 A;  4G9A A;  5B1R A;  2OYU P;  1KWT A;  2BQ7 A;  1BCH 1;  1PXX A;  2K2T A;  3TZI A;  2CG7 A;  4ISI L;  2RKY A;  2Y5H L;  3HS5 A;  4CUD A;  5HYT B;  3FF7 C;  3P7H A;  4C9F A;  1IQL L;  2J94 B;  2Y8S A;  4APL A;  2XC4 L;  1PGE A;  2J38 B;  3GIS X;  3SW2 A;  1V4L B;  3DEM A;  3NTG A;  3TBD A;  3ZLD A;  1KZC 1;  2H2T B;  3ZYI B;  5HYU B;  1FIH A;  3C8J A;  1G2M B;  3G83 A;  1V4L A;  3P5H A;  5I0Q B;  1RDI 1;  1QDD A;  1LK9 A;  2W3I B;  1E5G A;  3LN0 A;  4BWC A;  4ZES A;  2EI7 B;  2VVC K;  3NJP C;  2KB9 A;  4N33 A;  1TPG A;  3FFG L;  2YRA A;  5JBC E;  1GK5 A;  2VWL L;  3BT1 A;  4X8T L;  4Y7A B;  4KKD A;  2BQ6 A;  3SOB B;  2MCY A;  2NPR A;  3WWK B;  3FBY A;  3IKR A;  2WPM E;  1LMJ A;  2LS8 A;  4QKH A;  1KIG L;  1VVD A;  1K37 A;  4MMZ B;  4YZU B;  3WWK A;  2VWM K;  1Q3X A;  1PPQ A;  1EGF A;  3ZHG A;  4M11 A;  1OK3 A;  3HS7 A;  2JKH L;  1NFX B;  5JB9 E;  1YPQ A;  1HYR A;  1YPU A;  1HCG B;  1LMM A;  4K12 A;  4J6K A;  3ELA L;  2I2L A;  2BSF A;  4GI0 A;  1TPM A;  1CCF A;  2BQW A;  1RDN 1;  1MSB A;  4PDC A;  1CKL A;  1BUU A;  1BJ3 B;  1MUQ A;  1EPI A;  1KLO A;  1NFW B;  1IJK C;  3PBF A;  1PFX L;  3OLT A;  1MOX C;  2Y8R A;  1G1R A;  2XRB A;  1BJ3 A;  2BO2 A;  2UWP B;  1KOE A;  2PHB B;  2P3U A;  1NFY B;  4MUC A;  2ZQK A;  4YNX A;  2EI6 B;  2UWL B;  4CSY A;  3PAK A;  1LPK A;  1WHE A;  4BXS A;  2WYJ B;  2VUV A;  1FAX L;  1IOD B;  2Y7Z B;  2VVU L;  4JYV L;  3GPR B;  1IQF L;  2W2N E;  4S0U A;  4X8S L;  1IOD A;  1FAK L;  1DVA L;  2J4I B;  1TPN A;  1JWI B;  2VH0 B;  2EHF A;  2P95 L;  3ZRZ A;  3GPR A;  1DQB A;  1P4L D;  1PTH A;  1FE2 A;  4D90 A;  1APO A;  1JWI A;  1IQJ L;  1EZQ B;  3CI0 J;  1UMR C;  2OX9 A;  3F1S B;  2WG4 B;  4CUF A;  1G2L B;  1ATB A;  2W2M E;  3IKN A;  1COU A;  4IGD A;  1C5M F;  5LGK E;  1J9C L;  1HQ8 A;  1HT5 A;  1UOS B;  2BPE A;  2WPH E;  3TVJ A;  1HT8 A;  4BXW A;  3LTG D;  1ADX A;  2Y5F L;  1TLE A;  2XC0 L;  1KKE A;  1V1I A;  4GU3 A;  1UOS A;  2ZIB A;  2GGU A;  2B7D L;  2XR5 A;  3N8X A;  3LC5 B;  1SRZ A;  4TGF A;  4ZHA B;  2W2Q E;  3CAD A;  4RUT A;  5JBA E;  2H9E L;  3OLU A;  1EPG A;  1UOT P;  1UZK A;  1B9W A;  4COX A;  4F4O C;  4WR9 A;  2P93 L;  1IQH L;  3PAR A;  1KSN B;  1WU1 B;  1NPE B;  4JZE L;  4M1G A;  4N37 A;  1CQE A;  2P3F N;  1HRF A;  3BX4 B;  2XQW C;  2VWN L;  3G84 A;  3P5E A;  4JZF L;  1JV2 B;  4A7I A;  2ERJ A;  3PGH A;  2FD6 A;  4PO7 A;  3BX4 A;  4ZAE B;  1IQK L;  3ZYJ B;  2JJL A;  4LU5 A;  1SB2 B;  3UBU B;  1YO8 A;  5E8D A;  2E3X C;  1KG0 C;  3K7B A;  2Q1J B;  5IKR A;  2ORJ A;  1SB2 A;  3UBU A;  1UZJ A;  3G8K A;  3HO3 A;  3KRK A;  3P7G A;  3HO4 A;  2XWB F;  3HS6 A;  3KL6 B;  3INB C;  4A5W B;  1KWY A;  3WSX A;  2Y8T A;  2KRI A;  4D0F A;  2Y82 B;  2W80 A;  1F0R B;  4G1M B;  3CDG E;  3QCW A;  1FBR A;  2WFT A;  1I0U A;  2XC5 L;  1SL5 A;  2XRD A;  1T8C A;  1TDQ B;  4AYD A;  2FLG A;  5HYP A;  5DN5 A;  4J6J A;  1J35 B;  3IU3 I;  3RS1 A;  3R62 A;  2VJ3 A;  1YXJ A;  2W86 A;  1J35 A;  2BT8 A;  2RNL A;  2N40 A;  4BTU A;  3GOV A;  4J38 B;  5CKM A;  4J6L A;  5FFS A;  1EQG A;  3TGF A;  5F2Q A;  2VUZ A;  1DIY A;  1H2Q P;  1IJK B;  3MDL A;  1KX1 A;  1MD7 A;  1E8B A;  1JZN A;  4LOS A;  4G96 A;  2UWN A;  4B2S A;  1H03 P;  3T3A A;  1K9J A;  1IQG L;  2IT6 A;  4AYE A;  4RS0 A;  3ERB A;  2WPL E;  2RKZ A;  5HZP B;  3ALU A;  1SL4 A;  1EBV A;  4FXG G;  4UXM A;  3Q7D A;  2WG3 C;  4M10 A;  1V1H A;  1BYF A;  3M7P A;  2KV4 A;  3CA7 A;  3GCX E;  1U0O B;  3ZLE A;  1QGB A;  4YIZ A;  1W8B L;  3K3T A;  1KWV A;  1EPJ A;  1EGI A;  3KQD L;  1GHQ B;  1G4G A;  2W2O E;  5JPM G;  1UV0 A;  1CX2 A;  1KWW A;  2P26 A;  4GU4 A;  1FF7 A;  5KTH A;  2GO0 A;  1Q4G A;  4GJ0 A;  3KZJ A;  2RLP A;  1E8I A;  4BTI A;  2WPK E;  1A3P A;  3DBZ A;  1C3A B;  4AYM A;  2W2P E;  2WYG B;  2MHP A;  3QMO A;  4O02 B;  1C3A A;  1LPG A;  1NFU B;  5FDQ A;  1YXK A;  3WH2 A;  1U0N C;  3SOQ A;  1RFN B;  1QFK L;  4J6Q A;  4OTJ A;  1IQE L;  1G1S A;  1EQH A;  2Y5G L;  5FFR A;  2TGF A;  3ASI A;  3KK6 A;  3KQE L;  5KIR A;  1KWZ A;  3WSY A;  1O7B T;  3GCW E;  2MGR A;  2RIA A;  4WQQ A;  3NCW A;  3O8E B;  5IKQ A;  3P5D A;  1H2P P;  1NZI A;  2WPI E;  4BDX A;  4PZ5 A;  2YBY A;  1OJY A;  2PR3 B;  2KV3 A;  1EMO A;  3HPT A;  2P3F L;  2OS9 A;  3IKP A;  4N34 A;  1X2W B;  3V64 C;  1Y17 B;  4B2R A;  4NA9 L;  3NCX A;  1SL6 A;  3WHD A;  3WSR A;  2FLB L;  3TH3 L;  4OTY A;  3KQC L;  3OP8 A;  3SOV A;  3OED C;  5JVY A;  4BDW A;  1X2W A;  1Z6C A;  2E3X B;  3VPP A;  2I9B A;  1RDM 1;  1QIU A;  2HOX A;  1HAE A;  1OJW A;  2QY0 A;  4FM5 A;  1IQN L;  2FLR L;  1XFE A;  3POY A;  4Z6A L;  5KN5 C;  2LOJ A;  3IIT B;  5B1X A;  1Z6E L;  4NG9 L;  1UEX B;  3QH0 A;  4WJG 2;  5K0H B;  3FCS B;  3NTB A;  1CVU A;  3P5B L;  4ZRW A;  2ORK A;  1UEX A;  1HFI A;  2ZYC A;  2P28 B;  3CEN L;  1IVO C;  3H5C B;  1DX5 I;  3IJE B;  2XBY L;  4RRX A;  2JGW A;  1YUK B;  4X8V L;  3M9Z A;  3LN1 A;  1JBU L;  3WBQ A;  1DV8 A;  4PH9 A;  1V3X B;  1CEJ A;  2J34 B;  2KNI A;  2KMB 1;  3ZHG D;  2F9B L;  1W7X L;  4LQF A;  1GZ2 A;  1F02 I;  1JA3 A;  1LQD A;  2RIB A;  3WBP A;  6COX A;  3KMB 1;  4A94 C;  3CFW A;  4MSL A;  4EZM G;  5L30 L;  3VYJ A;  2BPH A;  1HX2 A;  4XLW A;  2J2U B;  1KZD 1;  4RRZ A;  4CUE A;  3FD4 A;  1E88 A;  2CG6 A;  1DDX A;  2OX8 A;  1FIF A;  1VVC A;  1HZ8 A;  4N7E A;  3ZD2 A;  1IQM L;  3LC3 B;  2JRA A;  4CAJ A;  2MCZ A;  3ZD1 A;  3KQG A;  1OK1 A;  1ZJK A;  1TOZ A;  5DN4 A;  2GGX A;  1XKB A;  4ZRV A;  3BPS E;  5JBB E;  4N35 A;  2BRS A;  3C8K D;  4JZD L;  1YUG A;  1E5U I; 
#chains in the Genus database with same CATH homology
 3ALT A;  1LPZ A;  2RIE A;  3LTF B;  3IX0 A;  1FM5 A;  2PF5 A;  3TK5 B;  3C22 A;  2UWO B;  2EI8 B;  2BZM A;  3CAL A;  1HTN A;  3P5F A;  3M37 L;  5JW1 A;  1BV4 A;  3EJH A;  1J34 B;  2YGP A;  5JVZ A;  1U0N B;  3TK6 B;  1CCV A;  1RDO 1;  3NT1 A;  4XBM A;  4Y71 B;  2BZ6 L;  2V8E A;  1J34 A;  1KZE 1;  3HUP A;  3WBR A;  4GJX A;  4JYU L;  3NFP I;  3C9A C;  1YTT A;  1IP0 A;  3PAQ A;  1IOE L;  4XL1 A;  1UKM B;  1M1X B;  5CKN A;  4ZXY L;  1WMY A;  1E87 A;  1HFH A;  1TLG A;  4O1Z A;  1FSB A;  1UZP A;  1CVW L;  1DY2 A;  1HUP A;  1UKM A;  2RIC A;  1ATD A;  1PWB A;  1X2T B;  1AUT L;  2M74 A;  2IZ4 A;  4DJZ A;  1RTM 1;  2ZWK A;  4M17 A;  3G8L A;  3T5O A;  2Y80 B;  1X2T A;  1NT0 A;  1U67 A;  2I83 A;  1XAR A;  2RID A;  4GKO G;  2WFX B;  3MQE A;  3RR3 A;  4WRE A;  4N38 A;  3F6U L;  1HJ7 A;  2D1J B;  4RRY A;  1LY2 A;  5CIS A;  1FFM A;  1U0O A;  2K2S B;  3KCG L;  1IJQ A;  4Z0L A;  4AQT A;  5L2Y L;  2H9E C;  3FF8 C;  3VYK A;  1HAF A;  2OYE P;  1O5D L;  1XKA L;  4Y76 B;  1AFB 1;  1UMR A;  2BMG A;  4LMF A;  1FVU B;  3N8W B;  5CKQ A;  1KCG A;  3U7U G;  2B5I D;  4RRW A;  1QUB A;  4E52 A;  1FVU A;  3N8W A;  1ATE A;  1NQL B;  4YLI A;  1OJV A;  1K9I A;  1RDK 1;  3ZYG A;  2YHF A;  1UZQ A;  1XPH A;  2CJI B;  4KZW A;  5I46 L;  1GKN A;  1SZB A;  3N8V A;  2GD4 A;  2P16 L;  4QKI A;  4WRF A;  4Y6D B;  2XBW L;  1HCC A;  4J6N A;  3CCK A;  4QKJ A;  2YGQ A;  2WII C;  1QO6 A;  5KTI A;  4KI1 E;  4ZET A;  4DN8 A;  5F1A A;  3U73 A;  3L89 M;  4Z0K B;  2O39 C;  1NWV A;  5FFT A;  4N36 A;  1WMZ A;  2RLQ A;  4MTH A;  4ZXX L;  3OXU D;  3P7F A;  1U5M A;  4WUX A;  2XBX L;  4WRC A;  1JL9 A;  2J95 B;  1KLJ L;  1IGX A;  1O9A A;  1Y17 A;  3VLG A;  3ENS A;  4D0E A;  4YMD A;  2Y38 A;  1RDL 1;  2ADX A;  1T8D A;  1KX0 A;  3N8Z A;  4Y79 B;  2P94 L;  4IOP B;  2DDU A;  3KQB L;  3R05 A;  1K36 A;  1P1Z D;  3G81 A;  1HRE A;  3ALS A;  4X8U L;  1KMB 1;  4IOP A;  5JB8 E;  1MQ5 L;  2G00 L;  2WZP P;  1KLI L;  1OK2 A;  1R13 A;  4UWW A;  2FZZ L;  1BF9 A;  2BPD A;  1B6E A;  3MQL A;  2RA0 L;  1MQ6 L;  1U8C B;  1G4F A;  1WK1 A;  5IKT A;  2VVV L;  4KZV A;  4YT7 L;  4C16 A;  1EPH A;  2G7I A;  2BOX A;  2WPJ E;  4KMB 1;  4QKG A;  5B1W A;  3BT2 A;  3LIW B;  2H2R A;  2A55 A;  4BTT A;  1GPZ A;  1ZAQ A;  2W26 B;  4GK1 A;  2VH6 B;  2KL7 A;  1YUF A;  2XBV L;  1KWU A;  4ISH L;  2VWO L;  1FJS L;  1EAI C;  2BOK L;  1OB1 C;  3S6X A;  5K8Y A;  1KZA 1;  4YT6 L;  2IT5 A;  1ESL A;  4LOR A;  5L2Z L;  5M62 A;  1XDT R;  1L5G B;  2AFP A;  2RHP A;  5COX A;  1IOX A;  4M18 A;  3WWK C;  1LIT A;  3P5G A;  1EMN A;  4JHS A;  4WUW A;  2AYL A;  1YPO A;  2C6U A;  2Y7X B;  2MSB A;  1N7D A;  4ONT D;  1X7A L;  1AFD 1;  3V65 B;  1OK9 A;  2I9A A;  1C1Z A;  1BCJ 1;  1N1I A;  3CDG F;  4NGA L;  1F7E A;  2PUQ L;  1RDJ 1;  3BDW B;  1F0S B;  2CKU A;  4Y7B B;  4AK8 A;  3GPR D;  3BDW A;  1ATA A;  4E1G A;  5FO8 C;  3SW0 X;  3IKQ A;  2YGO A;  1P9J A;  1YGC L;  1KWX A;  5EGM B;  1BNL A;  3WH3 A;  2BOU A;  1SS2 A;  1MD8 A;  1RJH A;  4ZH1 D;  3EGF A;  1R14 A;  2KMS A;  1H8U A;  1IGZ A;  3M36 L;  2MTI A;  1O7C T;  1H04 P;  1B08 A;  1DY1 A;  1F00 I;  1KZB 1;  2EC3 A;  1IXX B;  1MPU A;  3HO5 A;  3K9X A;  1ELV A;  1PW9 A;  1DY0 A;  1F7M A;  3L9J C;  3P5I A;  2XWJ I;  1G1T A;  3RJ3 D;  2P3T A;  1IXX A;  3KXV A;  1L3Y A;  1WHF A;  2XR6 A;  4ZH8 B;  3GPR C;  5J6G G;  3N8Y B;  2W81 A;  2CL8 A;  1CWV A;  3N8Y A;  1G1Q A;  1APQ A;  4MMY B;  1URK A;  5IKV A;  1GKG A;  1EGG A;  1OZ7 B;  4N32 A;  3LAQ A;  4MMX B;  1WT9 B;  2IZ3 A;  1IQI L;  4AYI A;  1PRH A;  1OZ7 A;  2RL0 A;  1WT9 A;  5F19 A;  3GXE A;  2PY2 A;  3FF9 A;  2MGP A;  2W3K B;  1P0S L;  1TN3 A;  2Y81 B;  2VRP B;  4J6M A;  2JGX A;  4LOT A;  1V7P B;  2M94 A;  1Z92 B;  3Q3K B;  1QO3 C;  2VRP A;  3CS7 L;  1V7P A;  4WCO A;  1AFA 1;  2BOH A;  4J6P A;  4PP8 A;  4G9A A;  5B1R A;  2OYU P;  1KWT A;  2BQ7 A;  1BCH 1;  1PXX A;  2K2T A;  3TZI A;  2CG7 A;  4ISI L;  2RKY A;  2Y5H L;  3HS5 A;  4CUD A;  5HYT B;  3FF7 C;  3P7H A;  4C9F A;  1IQL L;  2J94 B;  2RIB A;  4J6K A;  2XC4 L;  1PGE A;  2J38 B;  3GIS X;  3SW2 A;  1V4L B;  3DEM A;  3NTG A;  3TBD A;  1KZC 1;  2H2T B;  3G83 A;  3ZYI B;  5HYU B;  1FIH A;  3C8J A;  1G2M B;  3P5H A;  1V4L A;  5I0Q B;  1RDI 1;  1QDD A;  2W3I B;  1E5G A;  3LN0 A;  4ZES A;  2EI7 B;  2VVC K;  3NJP C;  2KB9 A;  4N33 A;  1TPG A;  3FFG L;  2YRA A;  5JBC E;  1GK5 A;  2VWL L;  3BT1 A;  4X8T L;  4Y7A B;  4KKD A;  2BQ6 A;  3SOB B;  2MCY A;  2NPR A;  3WWK B;  3FBY A;  3IKR A;  2WPM E;  1LMJ A;  2LS8 A;  4QKH A;  1KIG L;  1VVD A;  1K37 A;  4MMZ B;  4YZU B;  3WWK A;  2VWM K;  1Q3X A;  1PPQ A;  1EGF A;  3ZHG A;  4M11 A;  1OK3 A;  3HS7 A;  2JKH L;  1NFX B;  5JB9 E;  1YPQ A;  1HYR A;  1YPU A;  1HCG B;  1LMM A;  4K12 A;  3ELA L;  4GI0 A;  1TPM A;  1CCF A;  2BQW A;  1RDN 1;  1MSB A;  4PDC A;  1CKL A;  1BUU A;  1BJ3 B;  1MUQ A;  1EPI A;  1KLO A;  1NFW B;  1IJK C;  3PBF A;  1PFX L;  3OLT A;  1MOX C;  1G1R A;  2XRB A;  1BJ3 A;  2BO2 A;  2UWP B;  1KOE A;  2PHB B;  2P3U A;  1NFY B;  4MUC A;  2ZQK A;  4YNX A;  2EI6 B;  2UWL B;  4CSY A;  3PAK A;  1LPK A;  1WHE A;  4BXS A;  2WYJ B;  2VUV A;  1FAX L;  1IOD B;  2Y7Z B;  2VVU L;  4JYV L;  3GPR B;  1IQF L;  2W2N E;  4S0U A;  4X8S L;  1IOD A;  1FAK L;  1DVA L;  2J4I B;  1TPN A;  1JWI B;  2VH0 B;  2EHF A;  2P95 L;  3ZRZ A;  3GPR A;  1DQB A;  1P4L D;  1PTH A;  1FE2 A;  4D90 A;  1APO A;  1JWI A;  1IQJ L;  1EZQ B;  1UMR C;  2OX9 A;  3F1S B;  2WG4 B;  4CUF A;  1G2L B;  1ATB A;  2W2M E;  3IKN A;  1COU A;  4IGD A;  1C5M F;  5LGK E;  1J9C L;  1HQ8 A;  1HT5 A;  1UOS B;  2BPE A;  2WPH E;  3TVJ A;  1HT8 A;  4BXW A;  3LTG D;  1ADX A;  2Y5F L;  1TLE A;  2XC0 L;  1UOS A;  2ZIB A;  2GGU A;  2B7D L;  2XR5 A;  3N8X A;  3LC5 B;  1SRZ A;  4TGF A;  4ZHA B;  2W2Q E;  3CAD A;  4RUT A;  5JBA E;  2H9E L;  3OLU A;  1EPG A;  1UOT P;  1UZK A;  1B9W A;  4COX A;  4F4O C;  4WR9 A;  2P93 L;  1IQH L;  3PAR A;  1KSN B;  1WU1 B;  1NPE B;  4JZE L;  4M1G A;  4N37 A;  1CQE A;  2P3F N;  1HRF A;  3BX4 B;  2XQW C;  2VWN L;  3G84 A;  3P5E A;  4JZF L;  1JV2 B;  4A7I A;  2ERJ A;  3PGH A;  2FD6 A;  4LU5 A;  3BX4 A;  4ZAE B;  1IQK L;  3ZYJ B;  1SB2 B;  3UBU B;  1YO8 A;  5E8D A;  2E3X C;  1KG0 C;  3K7B A;  2Q1J B;  5IKR A;  2ORJ A;  1SB2 A;  3UBU A;  1UZJ A;  3G8K A;  3HO3 A;  3KRK A;  3P7G A;  3HO4 A;  2XWB F;  3HS6 A;  3KL6 B;  3INB C;  4A5W B;  1KWY A;  2KRI A;  4D0F A;  2Y82 B;  2W80 A;  1F0R B;  4G1M B;  3CDG E;  3QCW A;  1FBR A;  2WFT A;  1I0U A;  2XC5 L;  1SL5 A;  2XRD A;  1T8C A;  1TDQ B;  4AYD A;  2FLG A;  5HYP A;  4J6J A;  1J35 B;  3IU3 I;  3RS1 A;  3R62 A;  2VJ3 A;  1YXJ A;  2W86 A;  1J35 A;  2RNL A;  2N40 A;  4BTU A;  3GOV A;  4J38 B;  5CKM A;  4J6L A;  5FFS A;  1EQG A;  3TGF A;  5F2Q A;  2VUZ A;  1DIY A;  1H2Q P;  1IJK B;  3MDL A;  1KX1 A;  1MD7 A;  1E8B A;  1JZN A;  4LOS A;  4G96 A;  2UWN A;  4B2S A;  1H03 P;  3T3A A;  1K9J A;  1IQG L;  2IT6 A;  4AYE A;  4RS0 A;  3ERB A;  2WPL E;  2RKZ A;  5HZP B;  3ALU A;  1SL4 A;  1EBV A;  4FXG G;  4UXM A;  3Q7D A;  2WG3 C;  4M10 A;  1BYF A;  3M7P A;  2KV4 A;  3CA7 A;  3GCX E;  1U0O B;  1QGB A;  1W8B L;  1KWV A;  1EPJ A;  1EGI A;  3KQD L;  1GHQ B;  1G4G A;  2W2O E;  5JPM G;  1UV0 A;  1CX2 A;  1KWW A;  2P26 A;  1FF7 A;  5KTH A;  2GO0 A;  1Q4G A;  4GJ0 A;  3KZJ A;  2RLP A;  1E8I A;  4BTI A;  2WPK E;  1A3P A;  3DBZ A;  1C3A B;  4AYM A;  2W2P E;  2WYG B;  2MHP A;  3QMO A;  4O02 B;  1C3A A;  1LPG A;  1NFU B;  5FDQ A;  1YXK A;  3WH2 A;  1U0N C;  3SOQ A;  1RFN B;  1QFK L;  4J6Q A;  4OTJ A;  1IQE L;  1G1S A;  1EQH A;  2Y5G L;  5FFR A;  2TGF A;  3ASI A;  3KK6 A;  3KQE L;  5KIR A;  1KWZ A;  1O7B T;  3GCW E;  2MGR A;  2RIA A;  4WQQ A;  3NCW A;  3O8E B;  5IKQ A;  3P5D A;  1H2P P;  1NZI A;  2WPI E;  4BDX A;  4PZ5 A;  2YBY A;  1OJY A;  2PR3 B;  2KV3 A;  1EMO A;  3HPT A;  2P3F L;  2OS9 A;  3IKP A;  4N34 A;  1X2W B;  3V64 C;  1Y17 B;  4B2R A;  4NA9 L;  3NCX A;  1SL6 A;  3WHD A;  3WSR A;  2FLB L;  3TH3 L;  4OTY A;  3KQC L;  3OP8 A;  3SOV A;  3OED C;  5JVY A;  4BDW A;  1X2W A;  1Z6C A;  2E3X B;  3VPP A;  2I9B A;  1RDM 1;  1HAE A;  1OJW A;  2QY0 A;  4FM5 A;  1IQN L;  2FLR L;  1XFE A;  3POY A;  4Z6A L;  5KN5 C;  2LOJ A;  3IIT B;  5B1X A;  1Z6E L;  4NG9 L;  1UEX B;  3QH0 A;  4WJG 2;  5K0H B;  3FCS B;  3NTB A;  1CVU A;  3P5B L;  4ZRW A;  2ORK A;  1UEX A;  1HFI A;  2P28 B;  3CEN L;  1IVO C;  3H5C B;  1DX5 I;  3IJE B;  2XBY L;  4RRX A;  2JGW A;  1YUK B;  4X8V L;  3M9Z A;  3LN1 A;  1JBU L;  3WBQ A;  1DV8 A;  4PH9 A;  1V3X B;  1CEJ A;  2J34 B;  2KNI A;  2KMB 1;  3ZHG D;  2F9B L;  1W7X L;  4LQF A;  1GZ2 A;  1F02 I;  1JA3 A;  1LQD A;  3WBP A;  6COX A;  3KMB 1;  4A94 C;  3CFW A;  4EZM G;  5L30 L;  3VYJ A;  2BPH A;  1HX2 A;  4XLW A;  2J2U B;  1KZD 1;  4RRZ A;  4CUE A;  3FD4 A;  1E88 A;  2CG6 A;  1DDX A;  2OX8 A;  1FIF A;  1VVC A;  1HZ8 A;  3ZD2 A;  1IQM L;  3LC3 B;  2JRA A;  4CAJ A;  2MCZ A;  3ZD1 A;  3KQG A;  1OK1 A;  1ZJK A;  1TOZ A;  2GGX A;  1XKB A;  4ZRV A;  3BPS E;  5JBB E;  4N35 A;  2BRS A;  3C8K D;  4JZD L;  1YUG A;  1E5U I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...