4CTDA

X-ray structure of an engineered ompg loop6-deletion
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
268
structure length
234
Chain Sequence
RNDWHFNIGAMYEIENVDGLAEPSVYFNAANGPWRIALAYYQEGPVDYTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLADTRVETETGLQYTFNETVALRVNYYLERGFNNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRAGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDKFHYAGVGVNYSFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Engineering of a Minimal Porin Reveals Loop- Independent Channel Closure.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords OUTER MEMBRANE PROTEIN G
total genus 53
structure length 234
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 4ctdA00
2IWVA 4PR7A 2WJQA 2F1CX 4FQEA 2IWWA 2X9KA 2JQYA 2WJRA 4CTDA 2WVPA
chains in the Genus database with same CATH superfamily
2LHFA 4RJXA 4D65A 5D5DA 4PUXA 4N75A 4AYDC 1IZNA 2K4TA 5KAFO 1Q9FA 2KC0A 4O3XB 2FGQX 5DL5A 3VE1A 2ERVA 4D5UA 3SY9A 3FYXA 4O3WA 5KAIO 5H2FO 4E1TA 5ADXK 3PGRA 3QRCA 3KVDD 4C4VB 4PR7A 2KDYA 4K3BA 3HW9A 4FESA 3VZWX 8PRNA 3HOEA 3SZVA 2XTQA 1PHOA 1QJ8A 1ZHTA 3AAEB 2MHLA 6PRNA 3LK2A 2W80C 4LSFA 4C69X 5GV0A 1GFQA 2R8AA 4UB6O 1IZNB 4N74A 2J4UP 2Y2XA 2R4OA 2KZ7A 3LK41 3PF1A 3POXA 4LSIA 1E54A 2O4VA 2XE3A 3C5OA 4FRTA 3VE2A 2KXPA 2YNKA 3RBHA 5ADXL 3LK3B 5B5EO 2XMXA 3A0HO 1P4TA 4JFBA 4C00A 4AYID 4Z3TA 2WJRA 2PRNA 2Y0KA 1BH3A 4U9CA 5E79O 4RJWA 4BUMX 5GTHO 3SYSA 3O0EA 2M07A 1T1LA 2XE1A 4F4BA 3EMNX 2X9KA 3LK2B 4CTDA 4FZLA 4FQEA 1GFNA 5EE2A 2WVPA 3T24A 5B66O 4KR4A 3UAQA 5GTIO 3G7GA 3AA1A 1Q9GA 4RL9A 1GFOA 4XNLA 5DL6A 2XG6A 5PRNA 4FMSA 2MNHA 5DL8A 4AYEC 4FSPA 2IWWA 1QJPA 2R4PA 3LK3A 3PQSA 4IL6O 3VY9X 2J1NA 1OPFA 5G26A 3WI5A 3PORA 3PRNA 4GCQA 1GFPA 3AA7B 1ZHZA 4FOZA 1MM5A 4G76A 3JCUO 3JTYA 3K19A 3SYBA 3SZDA 5IYUA 2QTKA 3KZIO 3VZTX 3PGSA 4O3ZA 4AKMA 1H6S1 2K0LA 3DZMA 4QQ1A 5G3AA 3VZUX 4XNKA 5FVNA 5G39A 4B61A 1THQA 2N2MA 2FGRA 4AKRB 1BXWA 3AA0A 3PQUA 4N59A 4GF4A 5T5FA 2KXPB 2R4LA 2ODJA 2Y7SA 4AZLA 2R4NA 4O4XA 1ZHWA 3AA6B 4O4UA 3WU2O 3DWNA 2LFUA 2OMFA 3DWOX 2Y0HA 1GFMA 2XE5A 4O3YA 2XTRA 4E1SA 2F1CX 5JDPA 1ORMA 1T16A 4FRXA 3V8UA 3AAAB 3A0BO 2M06A 2N2LA 4KRAA 4FZNA 2JMMA 4UB8O 3T0SA 3BS0A 4G75A 5AFUK 3AA1B 1HXXA 3GP6A 1MPFA 5G38A 1BT9A 3DA3A 1ZHYA 1HXUA 3NJTA 4GCPA 4JCHA 4AKRA 3PGUA 3VY8X 4D64A 3SY7A 1YS5A 2Y0LA 3T20A 4FT6A 3LK42 2W81C 3AA7A 2WJQA 3DA4A 1QJ9A 2ZFGA 3HOLA 4PJ0O 2R89A 4FSOA 2F1VA 3BRYA 4GCSA 4C4VA 3NSGA 2IWVA 3BRZA 4AYMC 3A2SX 4AFKA 3AAAA 5AFUL 5DL7A 7PRNA 1HXTA 2F1TA 3AAEA 4K3CA 3POUA 1PRNA 2AXTO 3QRAA 4O49A 1MM4A 4RLCA 3POQA 4AUIA 1G90A 1ZHXA 2PORA 2GE4A 1S5LO 4AYNA 2KZ7B 4FZMA 3AA6A 4LSEA 3AA0B 2XE2A 4FUVA 2R88A 2X27X 4GHBA 3UU2A 1OSMA 3WI4A 4N58A 3HWBA 3TZGA 4KR8A 4RLBA 2YPVA 5TISO 2JQYA 4LSHA 3UPGA 2ZLDA
chains in the Genus database with same CATH topology
2IWVA 4PR7A 2WJQA 2F1CX 4FQEA 2IWWA 2X9KA 2JQYA 2WJRA 4CTDA 2WVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWV A;  4PR7 A;  2WJQ A;  2F1C X;  4FQE A;  2IWW A;  2X9K A;  2JQY A;  2WJR A;  4CTD A;  2WVP A; 
#chains in the Genus database with same CATH topology
 2LHF A;  4RJX A;  4D65 A;  5D5D A;  4PUX A;  4N75 A;  4AYD C;  1IZN A;  2K4T A;  5KAF O;  1Q9F A;  2KC0 A;  4O3X B;  2FGQ X;  5DL5 A;  3VE1 A;  2ERV A;  4D5U A;  3SY9 A;  3FYX A;  4O3W A;  5KAI O;  5H2F O;  4E1T A;  5ADX K;  3PGR A;  3QRC A;  3KVD D;  4C4V B;  4PR7 A;  2KDY A;  4K3B A;  3HW9 A;  4FES A;  3VZW X;  8PRN A;  3HOE A;  3SZV A;  2XTQ A;  1PHO A;  1QJ8 A;  1ZHT A;  3AAE B;  2MHL A;  6PRN A;  3LK2 A;  2W80 C;  4LSF A;  4C69 X;  5GV0 A;  1GFQ A;  2R8A A;  4UB6 O;  1IZN B;  4N74 A;  2J4U P;  2Y2X A;  2R4O A;  2KZ7 A;  3LK4 1;  3PF1 A;  3POX A;  4LSI A;  1E54 A;  2O4V A;  2XE3 A;  3C5O A;  4FRT A;  3VE2 A;  2KXP A;  2YNK A;  3RBH A;  5ADX L;  3LK3 B;  5B5E O;  2XMX A;  3A0H O;  1P4T A;  4JFB A;  4C00 A;  4AYI D;  4Z3T A;  2WJR A;  2PRN A;  2Y0K A;  1BH3 A;  4U9C A;  5E79 O;  4RJW A;  4BUM X;  5GTH O;  3SYS A;  3O0E A;  2M07 A;  1T1L A;  2XE1 A;  4F4B A;  3EMN X;  2X9K A;  3LK2 B;  4CTD A;  4FZL A;  4FQE A;  1GFN A;  5EE2 A;  2WVP A;  3T24 A;  5B66 O;  4KR4 A;  3UAQ A;  5GTI O;  3G7G A;  3AA1 A;  1Q9G A;  4RL9 A;  1GFO A;  4XNL A;  5DL6 A;  2XG6 A;  5PRN A;  4FMS A;  2MNH A;  5DL8 A;  4AYE C;  4FSP A;  2IWW A;  1QJP A;  2R4P A;  3LK3 A;  3PQS A;  4IL6 O;  3VY9 X;  2J1N A;  1OPF A;  5G26 A;  3WI5 A;  3POR A;  3PRN A;  4GCQ A;  1GFP A;  3AA7 B;  1ZHZ A;  4FOZ A;  1MM5 A;  4G76 A;  3JCU O;  3JTY A;  3K19 A;  3SYB A;  3SZD A;  5IYU A;  2QTK A;  3KZI O;  3VZT X;  3PGS A;  4O3Z A;  4AKM A;  1H6S 1;  2K0L A;  3DZM A;  4QQ1 A;  5G3A A;  3VZU X;  4XNK A;  5FVN A;  5G39 A;  4B61 A;  1THQ A;  2N2M A;  2FGR A;  4AKR B;  1BXW A;  3AA0 A;  3PQU A;  4N59 A;  4GF4 A;  5T5F A;  2KXP B;  2R4L A;  2ODJ A;  2Y7S A;  4AZL A;  2R4N A;  4O4X A;  1ZHW A;  3AA6 B;  4O4U A;  3WU2 O;  3DWN A;  2LFU A;  2OMF A;  3DWO X;  2Y0H A;  1GFM A;  2XE5 A;  4O3Y A;  2XTR A;  4E1S A;  2F1C X;  5JDP A;  1ORM A;  1T16 A;  4FRX A;  3V8U A;  3AAA B;  3A0B O;  2M06 A;  2N2L A;  4KRA A;  4FZN A;  2JMM A;  4UB8 O;  3T0S A;  3BS0 A;  4G75 A;  5AFU K;  3AA1 B;  1HXX A;  3GP6 A;  1MPF A;  5G38 A;  1BT9 A;  3DA3 A;  1ZHY A;  1HXU A;  3NJT A;  4GCP A;  4JCH A;  4AKR A;  3PGU A;  3VY8 X;  4D64 A;  3SY7 A;  1YS5 A;  2Y0L A;  3T20 A;  4FT6 A;  3LK4 2;  2W81 C;  3AA7 A;  2WJQ A;  3DA4 A;  1QJ9 A;  2ZFG A;  3HOL A;  4PJ0 O;  2R89 A;  4FSO A;  2F1V A;  3BRY A;  4GCS A;  4C4V A;  3NSG A;  2IWV A;  3BRZ A;  4AYM C;  3A2S X;  4AFK A;  3AAA A;  5AFU L;  5DL7 A;  7PRN A;  1HXT A;  2F1T A;  3AAE A;  4K3C A;  3POU A;  1PRN A;  2AXT O;  3QRA A;  4O49 A;  1MM4 A;  4RLC A;  3POQ A;  4AUI A;  1G90 A;  1ZHX A;  2POR A;  2GE4 A;  1S5L O;  4AYN A;  2KZ7 B;  4FZM A;  3AA6 A;  4LSE A;  3AA0 B;  2XE2 A;  4FUV A;  2R88 A;  2X27 X;  4GHB A;  3UU2 A;  1OSM A;  3WI4 A;  4N58 A;  3HWB A;  3TZG A;  4KR8 A;  4RLB A;  2YPV A;  5TIS O;  2JQY A;  4LSH A;  3UPG A;  2ZLD A; 
#chains in the Genus database with same CATH homology
 2IWV A;  4PR7 A;  2WJQ A;  2F1C X;  4FQE A;  2IWW A;  2X9K A;  2JQY A;  2WJR A;  4CTD A;  2WVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...