4CTDA

X-ray structure of an engineered ompg loop6-deletion
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
268
structure length
234
Chain Sequence
RNDWHFNIGAMYEIENVDGLAEPSVYFNAANGPWRIALAYYQEGPVDYTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLADTRVETETGLQYTFNETVALRVNYYLERGFNNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRAGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDKFHYAGVGVNYSFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Engineering of a Minimal Porin Reveals Loop- Independent Channel Closure.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords OUTER MEMBRANE PROTEIN G
total genus 53
structure length 234
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 4ctdA00
2WJRA 2WJQA 2IWWA 4PR7A 2F1CX 2IWVA 4FQEA 4CTDA 2X9KA 2WVPA 2JQYA
chains in the Genus database with same CATH superfamily
2R88A 4LSHA 5JDPA 3SY9A 3LK2B 2KC0A 4QQ1A 4AKMA 5E79O 3HWBA 4KRAA 5KAFO 2MHLA 1ZHZA 4LSEA 3UAQA 4E1TA 2F1VA 2WJRA 4GF4A 3HOLA 3LK41 1Q9GA 3AAAA 5ADXK 3VE1A 1Q9FA 2Y7SA 5G39A 4N59A 2K0LA 3SZVA 2F1TA 1MPFA 2XE1A 3PORA 3QRCA 4O3ZA 5D5DA 4FSOA 4D5UA 3T24A 3DZMA 5H2FO 1BXWA 3A2SX 1MM5A 5B66O 1THQA 1E54A 1BH3A 3KZIO 4RJWA 4C69X 4D65A 2R8AA 3AA6A 3T0SA 4K3BA 2XE5A 5G26A 2IWVA 5TISO 3LK42 4LSIA 2IWWA 1QJPA 5B5EO 3PQSA 3HOEA 2XG6A 2LFUA 2XMXA 3DA3A 3JCUO 5DL5A 1HXUA 4C4VA 1ZHYA 3TZGA 3POUA 2XE3A 1PHOA 3WI4A 2YNKA 3NSGA 4U9CA 3VZUX 2J4UP 1MM4A 2XE2A 3AA0A 2K4TA 3RBHA 4N75A 2QTKA 4CTDA 2X9KA 2W80C 3AAEA 1YS5A 3AAAB 3AA0B 2GE4A 4AYNA 5GTHO 3PF1A 2KXPA 3FYXA 3LK3A 4N58A 4O3YA 2Y0HA 1QJ9A 4RL9A 4RLBA 4FESA 2ZLDA 6PRNA 2XTQA 4G75A 3UPGA 5T5FA 2R89A 3A0HO 4FOZA 1IZNA 2J1NA 4FRTA 3GP6A 4UB6O 1IZNB 5G3AA 1T16A 3KVDD 8PRNA 2OMFA 3G7GA 1GFMA 3WU2O 2R4OA 1ZHTA 5DL7A 3SZDA 2AXTO 4AKRA 2M06A 1ZHWA 3SY7A 4C00A 2WVPA 1GFQA 3C5OA 1ZHXA 4GCPA 1S5LO 3VY8X 7PRNA 4GCQA 4FUVA 5GV0A 4K3CA 3UU2A 4KR4A 5G38A 4KR8A 4AUIA 2N2MA 2R4LA 4FZLA 2Y2XA 4AZLA 4FQEA 3EMNX 3PQUA 4PJ0O 2M07A 3WI5A 3BS0A 5PRNA 3PRNA 4B61A 1G90A 3BRYA 1BT9A 5ADXL 5FVNA 2FGRA 2KZ7A 2LHFA 4RJXA 5EE2A 3O0EA 2YPVA 3T20A 3LK2A 3BRZA 2PRNA 2JMMA 5DL6A 5KAIO 3V8UA 3AA7A 3DA4A 5AFUK 3VZTX 1GFOA 4UB8O 3VZWX 4O3XB 5IYUA 3AA1A 3PGUA 3QRAA 3DWOX 4FRXA 5AFUL 1P4TA 2ERVA 3AA7B 5DL8A 3VY9X 4F4BA 4D64A 4O3WA 1HXXA 2X27X 3PGRA 2FGQX 4GCSA 2Y0KA 3POXA 4AKRB 4AYEC 4E1SA 3PGSA 3JTYA 1T1LA 2JQYA 4LSFA 2O4VA 3SYBA 4AYDC 1QJ8A 4Z3TA 4N74A 1GFNA 4FT6A 4PUXA 2PORA 2ZFGA 3DWNA 2MNHA 5GTIO 2F1CX 4O49A 4BUMX 1ORMA 1OSMA 4AFKA 1H6S1 4FSPA 1HXTA 3AA6B 2Y0LA 2N2LA 4FZNA 2KXPB 3LK3B 4AYMC 4G76A 4XNLA 3SYSA 4AYID 3AAEB 3POQA 3HW9A 1PRNA 4FMSA 4O4UA 3A0BO 4GHBA 4O4XA 4FZMA 4XNKA 3NJTA 1OPFA 2KDYA 2WJQA 2R4NA 3K19A 1GFPA 3AA1B 4JFBA 2ODJA 2R4PA 2W81C 4RLCA 4JCHA 3VE2A 4PR7A 4IL6O 4C4VB 2KZ7B 2XTRA
chains in the Genus database with same CATH topology
2WJRA 2WJQA 2IWWA 4PR7A 2F1CX 2IWVA 4FQEA 4CTDA 2X9KA 2WVPA 2JQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WJR A;  2WJQ A;  2IWW A;  4PR7 A;  2F1C X;  2IWV A;  4FQE A;  4CTD A;  2X9K A;  2WVP A;  2JQY A; 
#chains in the Genus database with same CATH topology
 2R88 A;  4LSH A;  5JDP A;  3SY9 A;  3LK2 B;  2KC0 A;  4QQ1 A;  4AKM A;  5E79 O;  3HWB A;  4KRA A;  5KAF O;  2MHL A;  1ZHZ A;  4LSE A;  3UAQ A;  4E1T A;  2F1V A;  2WJR A;  4GF4 A;  3HOL A;  3LK4 1;  1Q9G A;  3AAA A;  5ADX K;  3VE1 A;  1Q9F A;  2Y7S A;  5G39 A;  4N59 A;  2K0L A;  3SZV A;  2F1T A;  1MPF A;  2XE1 A;  3POR A;  3QRC A;  4O3Z A;  5D5D A;  4FSO A;  4D5U A;  3T24 A;  3DZM A;  5H2F O;  1BXW A;  3A2S X;  1MM5 A;  5B66 O;  1THQ A;  1E54 A;  1BH3 A;  3KZI O;  4RJW A;  4C69 X;  4D65 A;  2R8A A;  3AA6 A;  3T0S A;  4K3B A;  2XE5 A;  5G26 A;  2IWV A;  5TIS O;  3LK4 2;  4LSI A;  2IWW A;  1QJP A;  5B5E O;  3PQS A;  3HOE A;  2XG6 A;  2LFU A;  2XMX A;  3DA3 A;  3JCU O;  5DL5 A;  1HXU A;  4C4V A;  1ZHY A;  3TZG A;  3POU A;  2XE3 A;  1PHO A;  3WI4 A;  2YNK A;  3NSG A;  4U9C A;  3VZU X;  2J4U P;  1MM4 A;  2XE2 A;  3AA0 A;  2K4T A;  3RBH A;  4N75 A;  2QTK A;  4CTD A;  2X9K A;  2W80 C;  3AAE A;  1YS5 A;  3AAA B;  3AA0 B;  2GE4 A;  4AYN A;  5GTH O;  3PF1 A;  2KXP A;  3FYX A;  3LK3 A;  4N58 A;  4O3Y A;  2Y0H A;  1QJ9 A;  4RL9 A;  4RLB A;  4FES A;  2ZLD A;  6PRN A;  2XTQ A;  4G75 A;  3UPG A;  5T5F A;  2R89 A;  3A0H O;  4FOZ A;  1IZN A;  2J1N A;  4FRT A;  3GP6 A;  4UB6 O;  1IZN B;  5G3A A;  1T16 A;  3KVD D;  8PRN A;  2OMF A;  3G7G A;  1GFM A;  3WU2 O;  2R4O A;  1ZHT A;  5DL7 A;  3SZD A;  2AXT O;  4AKR A;  2M06 A;  1ZHW A;  3SY7 A;  4C00 A;  2WVP A;  1GFQ A;  3C5O A;  1ZHX A;  4GCP A;  1S5L O;  3VY8 X;  7PRN A;  4GCQ A;  4FUV A;  5GV0 A;  4K3C A;  3UU2 A;  4KR4 A;  5G38 A;  4KR8 A;  4AUI A;  2N2M A;  2R4L A;  4FZL A;  2Y2X A;  4AZL A;  4FQE A;  3EMN X;  3PQU A;  4PJ0 O;  2M07 A;  3WI5 A;  3BS0 A;  5PRN A;  3PRN A;  4B61 A;  1G90 A;  3BRY A;  1BT9 A;  5ADX L;  5FVN A;  2FGR A;  2KZ7 A;  2LHF A;  4RJX A;  5EE2 A;  3O0E A;  2YPV A;  3T20 A;  3LK2 A;  3BRZ A;  2PRN A;  2JMM A;  5DL6 A;  5KAI O;  3V8U A;  3AA7 A;  3DA4 A;  5AFU K;  3VZT X;  1GFO A;  4UB8 O;  3VZW X;  4O3X B;  5IYU A;  3AA1 A;  3PGU A;  3QRA A;  3DWO X;  4FRX A;  5AFU L;  1P4T A;  2ERV A;  3AA7 B;  5DL8 A;  3VY9 X;  4F4B A;  4D64 A;  4O3W A;  1HXX A;  2X27 X;  3PGR A;  2FGQ X;  4GCS A;  2Y0K A;  3POX A;  4AKR B;  4AYE C;  4E1S A;  3PGS A;  3JTY A;  1T1L A;  2JQY A;  4LSF A;  2O4V A;  3SYB A;  4AYD C;  1QJ8 A;  4Z3T A;  4N74 A;  1GFN A;  4FT6 A;  4PUX A;  2POR A;  2ZFG A;  3DWN A;  2MNH A;  5GTI O;  2F1C X;  4O49 A;  4BUM X;  1ORM A;  1OSM A;  4AFK A;  1H6S 1;  4FSP A;  1HXT A;  3AA6 B;  2Y0L A;  2N2L A;  4FZN A;  2KXP B;  3LK3 B;  4AYM C;  4G76 A;  4XNL A;  3SYS A;  4AYI D;  3AAE B;  3POQ A;  3HW9 A;  1PRN A;  4FMS A;  4O4U A;  3A0B O;  4GHB A;  4O4X A;  4FZM A;  4XNK A;  3NJT A;  1OPF A;  2KDY A;  2WJQ A;  2R4N A;  3K19 A;  1GFP A;  3AA1 B;  4JFB A;  2ODJ A;  2R4P A;  2W81 C;  4RLC A;  4JCH A;  3VE2 A;  4PR7 A;  4IL6 O;  4C4V B;  2KZ7 B;  2XTR A; 
#chains in the Genus database with same CATH homology
 2WJR A;  2WJQ A;  2IWW A;  4PR7 A;  2F1C X;  2IWV A;  4FQE A;  4CTD A;  2X9K A;  2WVP A;  2JQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...