4CTDA

X-ray structure of an engineered ompg loop6-deletion
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
268
structure length
234
Chain Sequence
RNDWHFNIGAMYEIENVDGLAEPSVYFNAANGPWRIALAYYQEGPVDYTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLADTRVETETGLQYTFNETVALRVNYYLERGFNNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRAGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDKFHYAGVGVNYSFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Engineering of a Minimal Porin Reveals Loop- Independent Channel Closure.
pubmed doi rcsb
molecule keywords OUTER MEMBRANE PROTEIN G
molecule tags Transport protein
source organism Escherichia coli k-12
total genus 53
structure length 234
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 4ctdA00
2JQYA 2WVPA 2F1CX 4CTDA 2X9KA 4PR7A 2WJRA 4FQEA 2IWVA 2WJQA 2IWWA
chains in the Genus database with same CATH superfamily
2XTQA 3JTYA 1GFOA 1ZHZA 2KZ7A 3SZVA 4AFKA 5ADXK 2YPVA 3PQUA 5G3AA 3VE1A 4FRXA 3VZWX 5FVNA 5DL7A 4AKRB 3POUA 4KR8A 3WU2O 4AYNA 8PRNA 1G90A 3VE2A 3AA7B 2F1CX 3WI4A 5ADXL 3HW9A 2X9KA 4O4XA 3T0SA 2LHFA 4LSHA 3C5OA 1E54A 5E79O 1QJPA 4PUXA 1T1LA 2N2MA 4AYEC 2XG6A 1QJ8A 2KC0A 1ORMA 5PRNA 4JCHA 4PJ0O 5KAIO 5B66O 2M07A 3DWOX 2R4OA 3LK41 4FZNA 4UB6O 4XNLA 5KAFO 4C00A 3PRNA 1Q9GA 3UAQA 2ERVA 3A0HO 4O49A 2W80C 3SYBA 4D64A 4GF4A 2F1TA 3BRZA 1BH3A 4D65A 1PHOA 3KZIO 2R4NA 3DWNA 4K3CA 2R8AA 4LSEA 3DZMA 1HXTA 3QRAA 3SZDA 2Y2XA 3O0EA 5DL5A 5G38A 6PRNA 1MM4A 4IL6O 4FRTA 3UPGA 3VY8X 7PRNA 3VY9X 3AA6A 4O4UA 4AYDC 3RBHA 4RL9A 2N2LA 5EE2A 4E1TA 3A0BO 3LK42 4LSIA 2J1NA 2ZLDA 3AA1B 4FOZA 5TISO 2GE4A 4N75A 4O3WA 4RLCA 3SY9A 4Z3TA 1GFQA 2MHLA 3AAEB 3DA3A 4LSFA 2F1VA 2Y0KA 4QQ1A 2Y7SA 4FMSA 1BT9A 2R88A 4F4BA 5H2FO 1HXUA 1S5LO 4AKRA 2K0LA 2IWWA 3SYSA 3AA7A 3AA1A 3SY7A 5DL6A 1P4TA 4E1SA 4FQEA 3HOLA 4KR4A 5T5FA 1H6S1 2J4UP 4FSOA 3AAEA 3PGUA 2MNHA 1Q9FA 3DA4A 4FSPA 4G75A 2KXPB 1OPFA 3G7GA 3LK2B 2R89A 3POXA 4AKMA 5DL8A 4C4VB 4FZMA 5GTHO 2R4PA 2QTKA 4O3XB 4C69X 4AYID 3BS0A 4FZLA 4U9CA 1ZHWA 3AAAB 4B61A 1ZHYA 4JFBA 3HWBA 2W81C 4G76A 3K19A 5GV0A 2JMMA 5B5EO 1ZHXA 3LK3B 4K3BA 3VZTX 3PORA 3WI5A 2OMFA 4GCQA 2FGQX 5JDPA 2KZ7B 3PGRA 2KXPA 3LK2A 3A2SX 5G39A 4BUMX 3POQA 1MPFA 3AA0B 3VZUX 4FUVA 1T16A 2K4TA 2JQYA 1IZNB 2R4LA 4KRAA 2FGRA 2PRNA 2XTRA 3QRCA 4RJWA 5G26A 4D5UA 4RJXA 2KDYA 4N58A 4N74A 5D5DA 3EMNX 3KVDD 3HOEA 1HXXA 1QJ9A 2XMXA 4FESA 4CTDA 4O3ZA 1GFMA 2ODJA 2PORA 4AZLA 4GHBA 4AYMC 2YNKA 2LFUA 3AA0A 2ZFGA 2WJQA 5AFUK 4XNKA 1IZNA 1ZHTA 1BXWA 2XE3A 3PF1A 2Y0HA 4O3YA 5IYUA 2XE1A 4N59A 2IWVA 4FT6A 4UB8O 3V8UA 3NJTA 5AFUL 2WVPA 1OSMA 1PRNA 2Y0LA 3GP6A 1GFNA 3PQSA 4C4VA 1MM5A 2XE5A 2WJRA 3AA6B 3PGSA 4GCPA 3TZGA 2XE2A 3BRYA 1THQA 1YS5A 2AXTO 2X27X 3AAAA 2M06A 3JCUO 4PR7A 5GTIO 3T24A 3T20A 1GFPA 4AUIA 3LK3A 3NSGA 2O4VA 4GCSA 3UU2A 4RLBA 3FYXA
chains in the Genus database with same CATH topology
2JQYA 2WVPA 2F1CX 4CTDA 2X9KA 4PR7A 2WJRA 4FQEA 2IWVA 2WJQA 2IWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQY A;  2WVP A;  2F1C X;  4CTD A;  2X9K A;  4PR7 A;  2WJR A;  4FQE A;  2IWV A;  2WJQ A;  2IWW A; 
#chains in the Genus database with same CATH topology
 2XTQ A;  3JTY A;  1GFO A;  1ZHZ A;  2KZ7 A;  3SZV A;  4AFK A;  5ADX K;  2YPV A;  3PQU A;  5G3A A;  3VE1 A;  4FRX A;  3VZW X;  5FVN A;  5DL7 A;  4AKR B;  3POU A;  4KR8 A;  3WU2 O;  4AYN A;  8PRN A;  1G90 A;  3VE2 A;  3AA7 B;  2F1C X;  3WI4 A;  5ADX L;  3HW9 A;  2X9K A;  4O4X A;  3T0S A;  2LHF A;  4LSH A;  3C5O A;  1E54 A;  5E79 O;  1QJP A;  4PUX A;  1T1L A;  2N2M A;  4AYE C;  2XG6 A;  1QJ8 A;  2KC0 A;  1ORM A;  5PRN A;  4JCH A;  4PJ0 O;  5KAI O;  5B66 O;  2M07 A;  3DWO X;  2R4O A;  3LK4 1;  4FZN A;  4UB6 O;  4XNL A;  5KAF O;  4C00 A;  3PRN A;  1Q9G A;  3UAQ A;  2ERV A;  3A0H O;  4O49 A;  2W80 C;  3SYB A;  4D64 A;  4GF4 A;  2F1T A;  3BRZ A;  1BH3 A;  4D65 A;  1PHO A;  3KZI O;  2R4N A;  3DWN A;  4K3C A;  2R8A A;  4LSE A;  3DZM A;  1HXT A;  3QRA A;  3SZD A;  2Y2X A;  3O0E A;  5DL5 A;  5G38 A;  6PRN A;  1MM4 A;  4IL6 O;  4FRT A;  3UPG A;  3VY8 X;  7PRN A;  3VY9 X;  3AA6 A;  4O4U A;  4AYD C;  3RBH A;  4RL9 A;  2N2L A;  5EE2 A;  4E1T A;  3A0B O;  3LK4 2;  4LSI A;  2J1N A;  2ZLD A;  3AA1 B;  4FOZ A;  5TIS O;  2GE4 A;  4N75 A;  4O3W A;  4RLC A;  3SY9 A;  4Z3T A;  1GFQ A;  2MHL A;  3AAE B;  3DA3 A;  4LSF A;  2F1V A;  2Y0K A;  4QQ1 A;  2Y7S A;  4FMS A;  1BT9 A;  2R88 A;  4F4B A;  5H2F O;  1HXU A;  1S5L O;  4AKR A;  2K0L A;  2IWW A;  3SYS A;  3AA7 A;  3AA1 A;  3SY7 A;  5DL6 A;  1P4T A;  4E1S A;  4FQE A;  3HOL A;  4KR4 A;  5T5F A;  1H6S 1;  2J4U P;  4FSO A;  3AAE A;  3PGU A;  2MNH A;  1Q9F A;  3DA4 A;  4FSP A;  4G75 A;  2KXP B;  1OPF A;  3G7G A;  3LK2 B;  2R89 A;  3POX A;  4AKM A;  5DL8 A;  4C4V B;  4FZM A;  5GTH O;  2R4P A;  2QTK A;  4O3X B;  4C69 X;  4AYI D;  3BS0 A;  4FZL A;  4U9C A;  1ZHW A;  3AAA B;  4B61 A;  1ZHY A;  4JFB A;  3HWB A;  2W81 C;  4G76 A;  3K19 A;  5GV0 A;  2JMM A;  5B5E O;  1ZHX A;  3LK3 B;  4K3B A;  3VZT X;  3POR A;  3WI5 A;  2OMF A;  4GCQ A;  2FGQ X;  5JDP A;  2KZ7 B;  3PGR A;  2KXP A;  3LK2 A;  3A2S X;  5G39 A;  4BUM X;  3POQ A;  1MPF A;  3AA0 B;  3VZU X;  4FUV A;  1T16 A;  2K4T A;  2JQY A;  1IZN B;  2R4L A;  4KRA A;  2FGR A;  2PRN A;  2XTR A;  3QRC A;  4RJW A;  5G26 A;  4D5U A;  4RJX A;  2KDY A;  4N58 A;  4N74 A;  5D5D A;  3EMN X;  3KVD D;  3HOE A;  1HXX A;  1QJ9 A;  2XMX A;  4FES A;  4CTD A;  4O3Z A;  1GFM A;  2ODJ A;  2POR A;  4AZL A;  4GHB A;  4AYM C;  2YNK A;  2LFU A;  3AA0 A;  2ZFG A;  2WJQ A;  5AFU K;  4XNK A;  1IZN A;  1ZHT A;  1BXW A;  2XE3 A;  3PF1 A;  2Y0H A;  4O3Y A;  5IYU A;  2XE1 A;  4N59 A;  2IWV A;  4FT6 A;  4UB8 O;  3V8U A;  3NJT A;  5AFU L;  2WVP A;  1OSM A;  1PRN A;  2Y0L A;  3GP6 A;  1GFN A;  3PQS A;  4C4V A;  1MM5 A;  2XE5 A;  2WJR A;  3AA6 B;  3PGS A;  4GCP A;  3TZG A;  2XE2 A;  3BRY A;  1THQ A;  1YS5 A;  2AXT O;  2X27 X;  3AAA A;  2M06 A;  3JCU O;  4PR7 A;  5GTI O;  3T24 A;  3T20 A;  1GFP A;  4AUI A;  3LK3 A;  3NSG A;  2O4V A;  4GCS A;  3UU2 A;  4RLB A;  3FYX A; 
#chains in the Genus database with same CATH homology
 2JQY A;  2WVP A;  2F1C X;  4CTD A;  2X9K A;  4PR7 A;  2WJR A;  4FQE A;  2IWV A;  2WJQ A;  2IWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...