4CU2A

C-terminal domain of ctp1l endolysin mutant v195p that reduces autoproteolysis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
b'PENLVVYNDGADQRAAEYLADRLACPTINNARKFDYSNVKNVYAVGGNKEQYTSYLTTLIAGSTRYTTMQAVLDYIKNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDOLYSIN
publication title The Cd27L and Ctp1L Endolysins Targeting Clostridia Contain a Built-in Trigger and Release Factor.
pubmed doi rcsb
source organism Clostridium phage phictp1
molecule tags Hydrolase
total genus 26
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cu2A00
4CU5A 5A6SB 4CU2A 5A6SA
chains in the Genus database with same CATH superfamily
1J4AA 2A1TS 1IUOA 4RY0A 5JWHA 2PT9A 2XUKA 4DCGA 2VPZA 2H18A 2HJVA 3LDGA 4ZVOA 2BTQB 4ABYA 2O54A 1JKIA 4HCJA 1EFVB 4WEQA 4F5WA 3AI3A 2PNFA 1NN1A 4KBFA 4V24A 4EB0A 3O90A 3RS5A 4OHRA 3ADDA 5TY0A 1JLLA 1RJWA 4PN7A 3LLVA 4LHZA 3PT5A 2CD9A 1GZ3A 1TOAA 1LLCA 5LA6B 5K05A 4Q3LA 4ND2A 4FOOA 5EWJB 1EM8A 1RD4A 3FIUA 3BDAA 1NW9B 2WTMA 3OETA 1F14A 4JZYA 5TT0A 3T7TA 4ALIA 3U81A 5JDCA 4KMOA 3DMYA 5CFQA 3MAGA 3PL5A 1T6ZA 3RT1A 2VTVA 1AXGA 1CIVA 3FYUA 3DV0A 5FA6A 3HWSA 3UB2A 3PXGA 1F2TA 3U6BA 4U6NA 3WGOA 2QA5A 4AZ0A 2QRPA 1RLIA 4C6SA 3H8VA 4II2A 2MMCA 2JJ1A 2EFHB 3GJ8A 3RNOA 2X40A 3JATA 4L08A 4CJXA 2D1TA 3KS9A 1XLVA 4UQPA 1C9KA 2GZMA 3NHBA 5D6NA 3CLVA 1LS1A 1YZYA 4IMPA 1PJ2A 4PBSA 4PQEA 4CBVA 3VR0A 3MT8A 1A0OA 3QY0A 5HDBB 3H8JA 3PQFA 1XN4A 3R3VA 5FR1A 2Z9BA 2M9MA 1PT7A 3UJ3X 3KTFA 5BVHB 1HZJA 4M1YA 1Z0IA 1IAQA 4BNGA 3P71T 3LUJA 1A71A 1XVVA 2PX4A 3I0NA 3ZV3A 4J1TC 4BZZA 5JJCA 2OZVA 4CEJB 1JHOA 1BS1A 1A4IA 1TUBA 2F9MA 2JASA 1V71A 3N74A 4DSTA 4BNTA 2VBGA 3NDBB 1OXXK 3OTHA 1LPBB 2A8YA 1PEAA 3C7CB 3CBGA 3TMYA 4BE7B 3GRKA 3RVKA 1FY2A 1ZCZA 3O73A 1V5WA 3OUUA 3HXKA 4LYHA 2JATA 3T9CA 1MPXA 3PUHA 4TWZA 1ZNWA 3BD6A 1W4ZA 2D13A 4XJVA 5AK6A 4X6LA 3RANA 3LBAA 4ZMBA 1AQYA 1VPLA 1NU6A 4U2BA 1GV1A 1DUVG 1U7WA 5SY9A 1T1SA 2ONKA 4EO4A 5IF9A 3THWB 1XRPA 1RYEA 4RSMA 3EGDA 4A7PA 1Y5RA 2FUCA 5FOSA 1EEHA 5KYVA 2Q2WA 3ND7A 4D57A 3CRW1 2HK6A 2BR4A 4BV8A 5JH7F 4GMFA 1MABA 4KAJA 3I64A 5AXBA 3DVSX 3U5ZB 3ONDA 2WBLC 3FMIA 4C5CA 4MK4A 4F92B 1AC5A 3D54D 2HDOA 2JBHA 5AYVA 2RHBA 4R2LA 1T9CA 3UFXB 2A9FA 1TF5A 1M2WA 2UZ1B 2YIDA 5G3ZA 3BE4A 3T9AA 3CJQA 2VJLA 1G8SA 2ZI3A 3D4NA 3COVA 4R9RA 4YR7A 3FTNA 3H5VA 1XQ9A 3RAJA 3N8NA 3RFCA 2V7EA 1JE1A 3FZEA 5BMVF 1Z4JA 1IXRC 1J0DA 2DBQA 3OCYA 2RAPA 1LH0A 5I7AA 1WOMA 5CTAA 1LRLA 2VUHB 3V4ZA 3EXFA 2IF0A 3DL2A 4BN4A 4DLTA 3VNUA 3S40A 1NC3A 4GPEA 4RHXA 5FLKA 5JDCC 5JFOA 3O8RA 1ZM2A 1UZAA 2VBFA 3W2HA 3SXUA 4L3VA 2O8CA 1M8FA 1X8LA 3FYUC 1P0QA 2FWRA 1OTXA 1J5EB 5KKCA 1TAHA 1D9ZA 1HTWA 3FMGA 2P27A 1RQ7A 4LJKA 3N2NA 4YJ2B 3MGGA 3RYHA 5AK3A 3HN2A 4F6RA 1PT8A 1SOWA 2B0CA 3AHCA 3IOBA 3QIAA 3C2QA 4C22A 3G13A 4AXBA 1II0A 1RU3A 4R1LA 5EE0A 2NZXA 4PTZA 1U8TA 4QASA 4KITB 2YN0A 2HO5A 4LTDA 2GX6A 4PCUA 4UKDA 3VHXA 3EMDA 3GFPA 1S7CA 2VNIA 2Y0PA 5HQJA 1V16B 3DONA 3S2ZA 3KD2A 2IXDA 3WRVA 4CHTA 4UXHA 3V7YA 4UOZA 2AE2A 3O95A 4RY2A 3HJCA 3DJFA 4QUIA 1W7AA 4Q1DA 5BR1A 3WV5A 4L22A 3B1ZA 3RK4A 3NALA 3WGJA 1M7GA 3R9WA 3SYTA 5FL7A 1YMVA 3O8OB 3TNDA 4REQB 2OGSA 2L17A 3H99A 4FFMA 1XTTA 2IP2A 3L8DA 3SYLA 1K8QA 4QQFA 4GXRA 3V4FA 3GLGA 3Q1LA 1YRBA 5IAGA 3TUIC 721PA 4KMMA 2YUTA 1RBQA 5KOJB 3F6PA 1K4KA 4TL7A 2B6HA 2PR7A 4EUHA 2VF8A 5LPNA 3QF4B 1YRQA 2B8TA 3COYA 3REQB 1QOZA 3OO1A 3RSFA 2IA5A 3IB3A 3QPUA 1JAIA 3BD8A 3VJMA 5F7JA 3PFGA 4JI6B 1KVQA 1PR4A 2ZUEA 1RRCA 1QJCA 3U3OA 4B76A 1DZIA 3KPVA 3NAZA 1YV9A 3O5AA 3SU8A 2DAPA 2QW1A 3TXAA 4NZ9A 2VNKA 5ES3A 5BPHA 2EJWA 2VT7A 3K9CA 4FPXA 1KQNA 1L1FA 3EUFA 4JLJA 1W93A 4EBBA 2BBWA 2I4IA 1ZN9A 4ITRC 1DJPA 1N6LA 3AY6A 3KD3A 2VP6A 1Z2NX 3REGA 2MSLA 3TVDA 2AGVA 3UJNA 4RORA 5DB4A 1MOPA 2P9BA 3C8UA 3UKOA 4TV8B 1ZLYA 3OTQA 2NYAA 1NE2A 3NC0C 5LQNA 1EEXB 2CBZA 2HEGA 1ZWLA 3VDMA 5C53B 1MIOB 2G70A 2R1VA 1T0BA 5AVXA 5I7HA 3N76A 4UPDA 3X1KA 4ZALA 2OECA 3CX3A 4HYQA 4MMYB 4OAPA 3NT5A 1R16A 2Y1FA 4GLFA 1XTIA 2XQVA 3A4IA 5CGZA 3GL9A 4AKSA 2J4DA 1K06A 2FUNB 5TPWA 4M1EA 3RT7A 4DLNA 2CW5A 4G4JA 3GCWA 3TMKA 4CM4B 4MCAA 4NH0A 4DKJA 4DDHA 2W6JD 4S0ZA 1RLMA 3BGIA 4Z0TA 5JAIA 2I4NA 3OEHD 4M7OA 3P7MA 4WCFB 1HEUA 1MB3A 2QBYA 2A5JA 2EG9A 4J94A 5LLSA 3MIIA 2VEDA 3FVRA 3OM8A 1QB8A 3R24A 4OQFA 3UMSA 4TKMA 5IANA 4LDRA 1QDLB 1TM3E 1XZBA 2C29D 2VDRB 3BRCA 2C94A 4M36A 4F5DA 2EXXA 2XHEA 3QVMA 1YSCA 4J0JA 1UFOA 1K88A 5CH8A 1ZMXA 3E15A 1L6IA 1YL6A 2BKXA 3BHNA 3NP7A 3AHHA 1DAHA 1B0ZA 3AWDA 5ESDA 1WDKA 2PU5A 2VI5A 5JCJA 4EHFA 3ABSB 2ZXFA 2VHEA 4WCFC 1YDMA 4X85A 2FW8A 3BSWA 4K6CA 3U4QA 4KPFC 2OCXA 3RR2A 3CURA 3G79A 4JUIA 3FPSA 3TI7A 5ALHA 1JHXA 4D0SA 4L02A 1XEAA 2A4KA 4ZOEA 4E21A 2BRUC 3HJGA 2WKWA 4PGHA 1U0NA 1PQUA 3HYNA 3ROXA 4B34A 4E5YA 3AF0A 1T4MA 2HV8A 3FTDA 2PZGA 1MENA 3H1BA 1UKBA 2CCJA 1I1HA 4AURA 5IBRA 2AYYA 4ZMSA 4MV6A 2BFBA 1U8FO 2BKAA 1LD3A 1RRPA 1LKZA 4BGEA 2LXNA 4FBLA 5B3KA 2YC4C 1Z15A 3E3MA 1USVA 3AONB 4EUNA 1W76A 1YH3A 3L4SO 4MVYA 4AN4A 2R96A 3AK4A 1CUZA 3KDAA 2B0JA 1NY5A 4M0PA 1NFQA 4OQZA 4E3ZA 3OPXA 2GJ9A 2ZB4A 1YK0A 3KQOA 2FQ1A 3GJ4A 4G0OA 4U02A 5B7GA 1TTTA 2BGGA 3OHPA 3NYQA 4MS4A 1E7WA 1VSUA 3MOSA 1LGYA 3NNNA 3OD1A 2DOKA 4C6RA 5TXGA 1KKMA 1TJPB 2I29A 2PS0A 4BWFB 2R86A 5DHUA 5AI6A 4KV9A 5T4HA 1DO8A 4YV7A 1VLQA 4MHTA 4R1MA 1K63A 3GYBA 4GO1A 2I4OA 3ZDZB 3OWXA 1Y9AA 4MHOA 4D9NA 3CLUD 5E9QA 2G82A 3RHSA 2WJPA 3VPXA 1KWKA 2CE7A 3OQMA 4HNGA 4IBOA 1CQWA 3MZ0A 4FNAA 1I3NA 2JHPA 4ZV9A 3AFMA 3EGXB 4KE8A 3REFA 4AAYA 2C3PA 1TCAA 3FI0A 2CCKA 5LR6A 3MD0A 2AOVA 2I8AA 4H7DA 2JFXA 1KR2A 1R1DA 2A9RA 4GPBA 3KNZA 1U2RA 3ZVMA 5E6SB 4HK4A 5K8VA 3IXLA 4UJ3A 2W90A 1T5BA 3O1HB 4LDPA 4O2BA 3C6MA 4XPZA 4FJ0A 5CW2A 4BQPA 2DWUA 2V5VA 1EDDA 1U0JA 4ZCTA 1LBEA 3GN2A 5CB0A 1VBFA 4D02A 1W2HA 2Q50A 2Y77A 3WQBA 3OLWA 1EM6A 2J3LA 3AFOA 3BFXA 2R6GA 3HJRA 3QVVA 3OLVA 1VDMA 4MPPA 4DM4A 2OXEA 1HNXB 1V0JA 1R12A 1JJFA 1URPA 3NBXX 4PAWA 5HGJA 5F77A 1W9HA 5B1SA 5CPFA 3TSYA 4EA9A 4C5AA 2QG6A 2WNHA 4OYYA 3GEEA 1O97C 3VYUB 3H3JA 1QOQB 4MR8A 4MJXA 2PLAA 5BORA 1W85A 1ADYA 4MVJI 4RACA 2ATIA 1W8IA 4DW8A 5CYOA 2IU4A 1Q1GA 1EFDN 3M70A 2I6SA 3W6ZA 3IVCA 3CE9A 2JH3A 4D98A 1V3UA 4IMIB 3LECA 4AVYA 4MRSA 1R6BX 3VX4A 1ODJA 3EZGA 3MSXA 3VNSA 1JSRA 3UT5B 4YAJA 2VCEA 3CF6R 3O3OB 4A6EA 3OIFA 4BJ5A 1QLWA 1J1ZA 3PGA1 3A3PA 2RHTA 4Q5IA 4EVSA 2CLKB 5E1DA 5CX1B 1AKNA 4EATA 4CGZA 2AI2A 3C85A 3HJAA 4M0CA 5SYNA 1U3VA 4DGQA 3HXQA 3AL2A 3KYCB 3B2QA 1H3NA 4QD3A 1R50A 1UQUA 3R6TA 3RS0A 5GY7A 3K4QA 3EPKA 1RZVA 4XW2A 1TW2A 3B5IA 3OFND 1EUYA 1YQ9A 2CNLA 2F43A 1G0OA 3T1OA 3WHIA 2R00C 3A6KA 3BE5A 3LY8A 5DNAA 3S2YA 4EPTA 1H4TA 4FUQA 3GAZA 4MQLA 3VUEA 2CLIB 1J0EA 1PFVA 4D8YA 4LRTB 1RHRA 4G5HA 2Q3BA 3JAWB 4RQAA 3KKOA 3ZV4A 3IOEA 5CDFE 1N25A 2PAAA 2FN9A 1C9MA 3IP5A 2WINI 4KK3A 4WL0A 3KVOA 3DOHA 1FYVA 1Z28A 3KE8A 3DVLA 2N3ZA 5IRCD 1X1CA 3LVRE 1CY6A 4GYYA 3VGJA 3P96A 4YUYA 3L1JA 4PLWA 5L6LB 4AJNA 2VNSA 4RUKA 2I7CA 3TSZA 1QHSA 2BW0A 4EGFA 1D6SA 3LOPA 4AUEA 3ZDDA 4W8GA 1LPOA 4BP9A 4ZI5A 5CNKA 4E0BA 4H7EA 3DHNA 1EUCA 1GPJA 2QZJA 1M1YA 2GZAA 1OT3A 2Q5CA 2PZEA 2R6AA 2P77A 2YINC 4PGAA 4C0LA 3AHIA 4F2GA 4G5QA 3VR3A 4LF4B 5LIRA 3E9EA 2WKQA 1EHYA 3GARA 2I3AA 2DBYA 4B1FA 3WV4A 2QDKA 4HSEA 1EBFA 4RV4A 5ES4B 4O4HA 1FDIA 2VP0A 4GDFA 2JLXA 2NUPB 3VM6A 5AVWA 2HA0A 2E1PA 3MUFA 3WB0A 3WQSB 1RBMA 1CF9A 3W8DA 4EYSA 4RTNA 1NVXQ 1TD9A 2AD5A 3N75A 4KAXA 1DBPA 1G64A 1VC2A 2JA1A 4X97A 1SEPA 2W71A 5LBUA 2IL1A 1B8OA 1RQPA 1P5HA 1MAWA 3GLUA 3KJXA 2HK7A 3DBLB 2P6NA 3FCXA 3IJPA 2O5CA 2I3DA 2Q6VA 4LV8B 4DXDA 4CEIA 1K2WA 1EQUA 1BXRB 1ICIA 4Q39A 5I5EA 2XI4A 4WWHA 4TSFA 2YHSA 3C39A 4ALMA 5CB8A 2POCA 3FPLA 4DA9A 2H63A 3CYFA 1IZZA 4KQGA 1NLUA 1NWCA 2ZKLA 1QG0A 3GPBA 2DPHA 1G8AA 3N0VA 3DULA 2OR3A 4EWLA 2QX4A 2IF2A 1YFKA 2XAUA 3I37X 2FXIA 2E6KA 3BJZA 3IQFA 4YAKA 3PLNA 4LDQA 1GRRA 3SVZA 3JYHA 5IDWA 4GR9A 3P9XA 1L7DA 1CRLA 2BZ0A 2YBEA 5FPQA 3HLTA 1SKMA 3NJ4A 1TFUA 1Z0DA 3PEVA 4FHEA 4HEA6 4X00A 2OBXA 3WNVA 3P9QA 2BCGY 1RIFA 1SU8A 2Z5FA 1P19A 3Q5DA 4TRRA 4XLZA 4C2UA 1XG5A 2ZZMA 2GEBA 3FPBA 3JD3A 4L9AA 4LY0A 4EF4A 3Q1KA 1EVQA 1M1YB 1OI4A 2VOEA 3B36A 4FN5A 5DBOA 3WLMA 1X7HA 5BRAA 1NN5A 3NLLA 4XB2A 3ZNNA 4ZN6A 4RD4A 3VNVA 3IESA 4PGFA 4WXEA 4B4VA 4TYQA 1Q1ZA 2AG8A 2NSLA 3CWQA 3MMXA 2CUZA 2AMYA 2UVPA 4IVRA 5ANRB 3ADBA 4K2AA 4I4TA 5FPSA 4Z49A 2XTZA 3IAS1 3OEHA 2SECE 4YAFA 1K7CA 4OOFA 4A0SA 4N8EA 5CCBA 3WLRA 1ECCA 3W5DA 3PHHA 2DFNA 3ZWKA 3PDIB 2X8JB 1U4NA 3KV1A 4KLRA 2Q7DA 4EYQA 3DXYA 3NC1C 1M6HA 2BFWA 2CNOA 5B4VA 1NX6A 2IYWA 5IULC 3B1VA 1DB3A 5CIWA 1XA0A 2QPOA 3FWPA 3K4PA 4QOIA 2O1EA 4PYNA 2G9ZA 1DDIA 4AECA 4QA9A 1CFZA 5ITSA 3N86A 2FMUA 1KI1A 2WSMA 1T0UA 5L8VA 1JIVA 1GARA 2XTNA 2GF0A 1AKQA 4DUGD 1NJ1A 1T2CA 2Z2YA 4AJHA 4ENWA 5B1EA 2F48A 2QLJA 2P7HA 2QGNA 3LT2A 1E79A 1ZR2A 4GI2A 1JVSA 1RKBA 3O26A 2WM2A 1DQZA 1WZNA 3HACA 3M8KA 4D8UA 2W2XA 1KP3A 1ACMA 1G19A 1EXWA 2XW6A 3E5NA 3I5UA 4R2XA 1EAYA 3PNYA 4P3YA 1JRLA 2DXIA 2HT1A 2OCDA 4ENUA 4XTCS 2LR0A 2ID7A 4HPWA 2O0JA 3GUZA 4PQGA 3MC1A 2Q9UA 2IDJA 3DFFA 2VJPA 4XIIA 1IN6A 5KOHB 1UC9A 4QYTA 3LKVA 1J70A 3E9NA 3NAQA 1A95A 1R0LA 1WHTB 5LC1A 5E7JA 5YASA 3UMMA 4URWR 4AWAA 2HM7A 4K1XA 2X22A 1K7FB 1U94A 2ZJ3A 1VIMA 1CQIA 2YVKA 3KWFA 4I4CA 2W7TA 1R3DA 5K6AC 4QL3A 3D0RA 4FYWA 4K40A 3RVNA 4XUDA 3ETDA 4WOJA 4RSGA 2B6NA 4TWAA 5E8RA 3S55A 4Z1OA 1H22A 2OGTA 2YASA 5I9NA 3LW7A 1M2JA 2NW6A 3DMDA 4L9RA 4WI1A 2OE2A 4DMLA 2HNBA 4L95C 3B7WA 1V7QA 1VJDA 2FN4A 1FIUA 3WQRA 3N8KA 1E1QA 3ORFA 4NMLA 4S3MA 5A5DA 1X7XA 1GN9A 2AI1A 3R8XA 1JHUA 2I9PA 4D9EA 4LYDA 1NW3A 3WDLA 1R6UA 2P2NA 4RVCA 1APBA 3DBHA 1VRWA 3WLIA 1BZYA 4CM9D 4TXMA 3ZV5A 2Q29A 2P2ZA 3QOYA 5K3BA 3LBYA 1II9A 4IDCA 1IG0A 2G6BA 4MQEB 4C03A 4HAWA 3OLZA 1CZUA 2XBMA 4KXMA 1L4EA 5C8YF 3ZWAA 1T6NA 2I0FA 3NWPA 4YTEA 1PJ8A 1PCXA 4QTXA 1V7PC 2O7RA 3WBKA 3ER9A 5ALQA 4ZJPA 1M2EA 2M98A 2XX3A 3AVQA 1HOTA 2QUKA 1LPMA 3PVZA 4ENTA 2J6CA 1GFZA 1SUSA 2F90A 3QV1A 5AHXA 3NJRA 3F46A 4U3JB 3EIOA 3G9ZA 2VHZA 1JH9A 5EJ5A 2O8BA 3RO7A 1FNNA 1CQIB 4ZGWA 4OQ4A 2QQEA 1H8EA 5A1TA 1NF2A 1VHJA 3CUYA 1VKNA 2ZR8A 3KYDA 3CZAA 4P9NA 5J5CA 4CT4B 5TX7A 1R0CA 4GNKA 2KMLA 3R0XA 1N8KA 1OFVA 3AR2A 1AKVA 2HXSA 4Q9HA 5COQA 4B4KA 3NAMA 4Q7EA 1QRUA 2NT3A 3OKAA 3MOGA 4MLPA 4TUYA 1D03A 3QMWA 3WGHA 5KC9A 3LHKA 1MAUA 3QI2A 5DEIA 5KDLA 5DTEA 3SBOA 1DIHA 5DW0A 1TUEA 2TMYA 3LPDA 1D4OA 1CJUC 1DAOA 1ND5A 3E7FA 2E4UA 1L7OA 4FCCA 2G36A 4MWTA 4NONA 1HY3A 2R8PA 2WJ3A 4HAIA 2VYFA 4XIJA 4EA6A 1DQNA 2N75A 5JAQA 1F0NA 4H1VA 3FGPA 2AOTB 3SSMA 3OFNA 1HK7A 5D3MB 1LDGA 3K9LA 2QPTA 1ZRHA 4KXYA 5HKKD 3PQ2A 4RJTA 1DWOA 1XQXA 1OYVA 2VDKB 4UBNA 4I3GA 3G89A 2X23A 4Q3CA 5B1YA 4UBKA 1KYIA 3CLUC 3KQLA 2SKCA 4ZOBA 1C1DA 4G1EB 5L4SA 2JIOA 2V55B 1G7CA 2HFKA 2V98A 3IQGX 5JZBA 1Q91A 1SVNA 3T9DA 1M5RA 2X42A 3IEMA 4DLSA 3WLJA 1U2SA 1SC6A 3QKSB 4GXQA 2WWYA 2B61A 1WXXA 2UYGA 4V0OA 4C1NA 5IAAA 2VUSA 4CKBB 1M5UA 3WJ2A 2WJJA 3EPLA 3PNMA 5DISB 1PT6A 1ORWA 5EZQA 4A4DA 2RGCA 5EUMA 3U3KA 4DIFA 5JNLA 2ANCA 2HTEA 5JEDA 4A8HA 3OOHA 4OKNA 1WMFA 2NUAA 4QPNA 4LJLA 4ZKEA 3IFSA 1B74A 3ETGA 4M6WA 4MYHA 4P2BA 2YRWA 4TYYA 3UHAA 3NHRA 4N5IX 3B13B 3PXDA 2CCGA 2WSBA 4BTLA 1KU0A 1EYZA 1S2NA 2LGJA 4KRGA 3CU5A 4KP7A 3UMFA 1KEKA 1PNRA 3K9BA 1GA1A 1XT6A 4E51A 1GLGA 1Y8CA 2ODTX 5SYMA 4BWYA 4D1YA 2IIPA 3ITNA 1VL8A 5DGCA 1U90A 4OXIA 2G06A 3HP4A 2ATVA 2O7SA 2Q45A 1NW5A 3QVTA 2XWJI 4U7WA 4Y6QA 2B82A 1F1BA 2WDZA 4RWZA 2X5NA 3UGQA 1ZGGA 2A58A 4IJVA 2CHFA 2VHTA 4C0XA 3UNXA 3HI4A 2EC5A 1AKTA 2QV7A 2ZREA 4RCVA 5D5PA 5KB3A 2HN9A 3RS3A 1YE3A 3ZVLA 2WJHA 1XFAA 4GM0A 1MJGA 1Z4IA 3N7UA 4N0DA 1PGJA 2QUAA 3WNCA 1FFXA 1N9ZA 3DL7A 3MWGA 3NIBA 1Z22A 2H1SA 4GP6A 4MV1A 4YIKA 5AM1A 4YPFA 4EYEA 3K0CC 3ME5A 1N2JA 4WY2A 4B47A 5M04A 2XD9A 3HV2A 4GSLA 4IH4A 4QUJA 4X20A 4YCLA 1GN8A 1KEPA 4ER5A 5DNUA 1FX0A 4ZP1A 3ONVA 3IPAA 4B7UA 4G4SP 3D9QX 1VA5A 4ML3A 3W8NA 1OAAA 4D74A 3SZUA 4GBMA 1YQWA 3JWIA 5CVEA 4FMPA 1SBQA 2W2PA 3W3AD 5EHXA 5FTLA 3KT3A 1IM8A 3MFYA 4TYPA 4N3BA 3KKEA 1PLLA 1ODCA 2R79A 3F4KA 4JBIA 3UJ9A 3ASZA 3OU6A 5JJBA 5JS2A 3CIOA 1CZOA 1SNYA 1HT0A 2OAGA 2RJNA 3G1UA 4EW6A 3HXOA 5JTTA 3JWHA 3HM9A 4UTZA 3P97A 5LXTA 1PFQA 4DWVA 4Y9TA 2YJ3A 4M1OA 4NZZA 4R6WA 5DCYA 1FNCA 2DU8A 5CFNA 3Q4GA 3BWDD 4EPWA 4MAAA 3ER8A 4F12A 4ZQBA 5EHQA 1M66A 5TE9A 5ARDA 4WBSA 4KR6A 3UXEA 4WZBE 3VTZA 4AZVA 5A4JA 2R11A 1Z13A 4G1MB 4HLCA 1E1MA 4BBAA 2B92A 1ORDA 2LWIA 3RARA 3SJCA 4B3TB 4FEYA 3WMWA 4IGFA 2NADA 2I4MA 3MCTA 4IVNA 1E8DA 2VT6A 3U4DA 1QGDA 4D99A 3Q8LA 1GTRA 1JFFA 4ZJZA 5A5FA 1K5PA 4EUKA 3LD9A 2Y0BA 1XDWA 3KVVA 4Q7KA 3CUVA 3R9IA 2I6XA 4Y6OA 5F2NA 4BZQA 4KREA 1OOEA 2GN2A 3DEFA 4PG8A 2H3HA 1A9XB 1KAEA 1A8UA 2Z2XA 3AM4A 3VQTA 4OHPA 4Z6KA 2HHHB 3KXKA 4UREA 4MRAA 3VU9B 2G83A 4C0KA 4IFTA 1PFKA 4M0DA 4KIJA 3IH5A 3INRA 4HH1A 2X0EA 4M55A 3DNMA 4LPSA 1CQJA 1FUUA 1C8LA 5CVCA 4Q6WA 4ADSG 1T3LA 1PX0A 1QYCA 2ZAIA 4HQNA 4M4SA 1SH7A 3VVLA 3R76A 2Q3JA 1UZLA 1YB7A 3EGCA 3QYJA 4Y9UA 3RHZA 4YP6A 4YHHB 1ORIA 1UMBB 3DFKA 2B36A 4B2YA 5IN4A 3KXLA 5LSAA 1DBRA 2Q5EA 3IP8A 3P2OA 1JQ5A 2QI9F 2KM1A 5KIAA 3VO8A 2DEUA 3LC1O 3OKPA 4OTZA 5CT9A 4LF6B 2AJBA 3HVUA 4RFVA 2ZRGA 5TMPA 3N53A 2CMGA 3ZWCA 3ZWPA 1GL3A 4F91B 1JR3D 5CDFA 3CVJA 1AQUA 1T9BA 3DUFB 4V39A 3WICA 1P4SA 4NCHA 1EXNA 2L82A 4N8DA 2N0SA 3NEAA 3SNKA 3WLFA 3QYPA 2MSEB 3D3QA 4GR4A 1YJAA 3FSRA 4PZ0A 4GWGA 2VDJA 2YYSA 2Q7OE 1PVOA 3QBEA 3A8TA 4M9CA 5H81A 2EBFX 2NZ2A 4RGBA 4JQZA 2WTNA 2G0AA 4WY8A 4FSDA 1L5HA 4IKEA 2VJMB 4GWLA 1C4XA 3C7TA 3R5XA 4D9CA 3SQXA 3T5AA 1E6CA 3ZJVA 1B0UA 2GZDA 2QXYA 4M8KA 1SD1A 2Z6AA 3G8BA 4QPJC 2QTFA 2FZEA 1BYUA 3SHFA 4BEJA 4UTRA 2P4UA 3RRNA 4YC7A 2HA4A 1NULA 1EFPA 2AWNA 3IMEA 2ID8A 1WUHS 2YHUA 4YN3A 1CUYA 5D1NA 1PLJA 4O0MA 4IPTA 3H2BA 4TQ9A 4P53A 1XALA 3DNPA 3RSHA 3TR5A 1Y8ZA 4BP1A 5KWIA 2J5BA 4XM0A 2C99A 1WPRA 4N7RA 4NK5A 1QKJA 4IIEA 5BWNA 3IB6A 2H16A 4ITUA 1LQUA 5A3SA 4EBFA 3AVVA 2BGLA 5KJEA 3RUAA 5LNK1 1RMQA 1G98A 5JG7A 1MC8A 3JD1A 2IU6A 2BN4A 2QROA 3JYQA 5JSUA 9ATCA 3AI2A 4R51A 4Z2YA 1G8PA 1W59A 5JH7A 1EWYA 2HBQA 3UJ6A 1YOVA 4WESA 3TGLA 1J5XA 1JDUA 3UPTA 3SIWA 2AUMA 1W87A 3RVOA 1MB2A 5CP8A 5DLDA 4C4YA 4DMHA 1B14A 1RXEA 4E2WA 5IJ9A 2BFCA 3KOWA 2GJKA 4FFRA 4UHCA 5DN6D 3F5FA 1M6VB 1P3DA 1BXKA 2IYSA 3LHIA 3A10A 5K0NA 5I45A 3GCGA 2ZJ0A 2H1OA 5KNCH 4RNDB 5GOZA 5AOCA 5P8WA 4H15A 2OAEA 3QOXA 1JZTA 4IUCS 3R41A 4LDAA 2VHQA 1D2HA 2O2GA 4XDYA 1P2BA 2B7CA 3BIWA 3RWOA 1OYWA 1S9DA 3IIMA 2CKDA 5CEJA 1TJ4A 3GT7A 4RF3A 3UKDA 5DRYA 3T5GA 4BRSA 4ZKDA 4DILA 1KEUA 2IYQA 2JFYA 4DSAA 3WKEA 3QFRA 4X6YA 3V7UA 5HK9A 2OV2A 4ZEOA 5C7IO 1EFPB 1FJGB 3ETEA 3RF7A 1PJCA 3FCAA 2GZSA 3RU7A 1XEXA 3CHYA 1BE1A 3OE1A 4PO9A 1S1CA 3L4EA 4LY3A 3E9QA 2C8JA 4FKBA 3MT9A 5EUCA 4M1TA 2JAXA 2RMKA 3WNBA 4RVFA 2IWRA 3UOWA 1XMOB 3BG5A 3NPMA 3SLRA 5IN5A 5HBGA 4M86A 2J5QA 1PG2A 3WNDA 2OV4A 1SVOA 4YJHA 1P8AA 2PBLA 4H1UA 4CU5A 4DPMA 3AESA 1EE1A 1VGRA 2AMVA 1YI8A 2WM3A 1BWQA 3P8ZA 3S8MA 3ABZA 2FQQA 3KU1A 1MX1A 3K96A 3UOAB 4YT8A 5LOVF 1L5GB 5DFAA 3K35A 3DTYA 1IXKA 4RGYA 4PYIA 4RS4A 4L5CA 3AUYA 4ZO4A 1KEEA 4X41A 4YMUA 4GICA 5K8TA 1LXCA 2ZR0A 4Y6GB 1NMZA 3EDOA 9LDBA 4CF6A 1CUWA 4ARZA 5LMCA 5J23A 4PE5B 4DAOA 3HWX1 2ORED 3NGMA 1DKMA 5BMVB 3JD2A 5DI3B 5EZYB 3SJ7A 1CJVC 1SOAA 3H9CA 2XV1A 4B3HA 2AEJA 5CYGA 5H9WA 3VR4A 2EJBA 3TL2A 5KNCD 1JQ3A 4A2CA 5TVKA 3KLOA 3PKIA 4R6XA 1MG0A 1PV2A 3VU8A 2PYDA 4OREX 5DPMA 1R37A 4H3SA 4PNZA 3ZHBA 5EJEA 3THYA 1WG8A 3SBEA 1ZN2A 2Q0HA 2V3VA 2QVZX 5C1PA 4BKQA 2D5LA 2IHVA 4N6GA 4PAOA 4RTLA 1PFYA 3HP7A 4EVQA 1PW5A 4R68A 3CX4A 1M8JA 1TIKA 3ZY5A 1YR2A 2VQSA 3DLBA 4AJOA 3OZGA 2NXWA 4JDPA 3M3HA 4XB6B 3NC4A 1QRTA 4G86A 3S1LA 4XI9A 5KO2A 3HK2A 1ONBA 4J4TA 3FCYA 4QELA 4C3ZA 4XWKA 3BZWA 4Q66C 3EB9A 4MMZB 5IAKA 3GP3A 4P6VF 2ZR7A 4WKBA 3VYSB 5FTWA 4QJ3A 2B1GA 1XMXA 1KQOA 3EXEB 4NEGA 1PR5A 2QN6A 3AEQA 2FG7C 3HCWA 2OV1A 1KI3A 1VI6A 3AESB 4P1ZA 4WZAB 3Q6IA 2GBFA 4JWKA 4R7TA 4PCLA 4OXQA 3GX1A 2A1TR 3WGYA 4O2AF 1ZKMA 4PQRA 1KSGA 2NO5A 2ZROA 3VVMA 4N0MA 4YBZA 3FPFA 4QTYA 1AUQA 4OPMA 3TQIA 4OMUA 4UCQA 3V8EA 4DEVA 2O3TA 5DM70 1C3OB 3I04A 1M2GA 3OY7A 4PYMA 5ALPA 3HNOA 2BUAA 1ESCA 4I81A 3NKVA 2C0CA 1NBME 3RROA 1P7VA 2CEAA 1SBTA 3O31A 3OX2A 2J3EA 1VL1A 1Z6TA 3MMZA 5AM2A 1I6KA 4PANA 1O77A 2O05A 3IAXA 4Q21A 4NRDA 4WFIA 5A5GA 3D1VA 2FPPB 1WM1A 4IZOA 2RK3A 4AZSA 1UOOA 1VXRA 1X1DA 3OJWA 1R0RE 5J3JA 3DB2A 3GFGA 5EJAA 5IUNC 3GA7A 1DFGA 2QG4A 4BVLA 2WA2A 4BNWA 1W88B 4EJ6A 1RRFA 1Z6YA 3UBMA 4L6IA 4OX9Y 4R9VA 3GVPA 2B9EA 3GNSA 3SKYA 3D8SA 3GN1A 2H5LA 1CDZA 5JSKA 3I2JA 2OT3B 3DFIA 2WIBA 3I01A 2HDNB 1Q74A 2B1IA 1Z7BA 2ZGVA 4KO1S 4PTLA 4XPIB 5AICA 4YRKA 1KOGA 4QDUA 4DSNA 1P7WA 2C1ZA 4ZZ0A 2I2FA 3I3SR 3FYHA 3EAQA 4IEIA 1GADO 3CVOA 2PXHA 4ALKA 2WD8A 3HEMA 3LZDA 3FLMA 2WWWA 2ZI9A 1IE3A 1S3SA 2N1BA 3H7IA 3STXA 4BGUA 4UU8A 1N32B 1WU7A 1JNXX 2OZEA 3ADPA 3TECE 4K9SA 1FMTA 1QYDA 2ZIXA 5IK2D 1Z6PA 3A2MA 2F00A 3LPLA 4FQ7A 2GPSA 4B4UA 2WSYB 4DT1B 1TTPB 1NG1A 2HF2A 2R8EA 3RYIB 1FRQA 4EOGA 4IV8A 5J1TB 1E9RA 1KORA 5TDHA 1NOJA 1YZKA 2IWHA 1QTIA 2JIMA 1UDWA 2OKCA 4PSCA 2HRZA 3B3GA 1QFXA 4BVBA 1ZUD1 1KYVA 5A3VA 1Z8FA 2KSQA 1F8XA 1YR1A 5IX8A 1EJBA 1EDEA 4PSDA 3N6VA 1RYBA 3GFSA 1PHRA 5B6PA 3GBVA 2WD9A 1RLJA 1QHXA 3OBIA 3LGXA 3T38A 5NULA 3K16A 3TL6A 1PWXA 4TMYA 2VYQA 5IBQA 2O2CA 1GNVA 4L5BA 5KJ6A 4FC6A 2GFIA 3Q3EA 2BWJA 3FNRA 5TQ2B 5CB4A 1EG7A 2BGKA 1YFJA 4RJLA 4EQ6A 1M3SA 5CHYA 1N57A 5JYBA 2BFFA 1KVTA 3A6GA 1RM4A 4WN9B 2PXXA 4DXHA 1U7PA 1ETUA 4NPAA 3DEKA 1DKOA 1EUZA 1UJ5A 2FEXA 3ZBPA 4LF7B 2O59A 5DRTA 1MB9A 1VCIA 2CHQA 1P74A 1Q83A 4P81A 3ROTA 3CGWA 3GZNA 4NU0A 5FYQA 1FSFA 3LK6A 3W6NA 2W2NA 1TMOA 4YFYA 4OQNA 3ZU4A 2NP7A 3QKRB 1UDAA 2NQTA 3QPBA 4MULA 4QPCA 4G5XA 4JBNA 3KKMA 3LU1A 4E31A 3W5BA 2O2JA 4DR1B 2E4AA 4UASA 4KVAA 1N0IA 2GPTA 3KAPA 3ZBUA 1O87A 4ZAXA 4JSYA 1WDMA 4IO1A 1XROA 4KPUA 5J63A 1CF4A 3OFJA 2R9VA 4Y2HA 3K15A 4ND3A 4LJ4A 3BMNB 4F1WA 4ZQEA 2IV7A 2JFQA 5JCZA 8OHMA 4X90A 1T0PA 5AM4A 2H1RA 1JI0A 1VSBA 4GLOA 4GUDA 1T2FA 2PUTA 5J2TA 2A5YB 1PEDA 5REQA 4CKYA 2DBZA 4RZ2A 4P82A 3ICQB 3CVWA 2EGHA 4PZPA 2BELA 4OHKA 4XZ3A 5LIPA 4ZC8A 1H2AS 4CMHA 2W6QA 3CJRA 5JCOA 3RC3A 3EVEA 1RTTA 3HGTA 3LX8A 4Z3KA 4HNUA 3OPQA 1QHYA 4IFBA 3K1AA 4HUQB 2JARA 1NQUA 2OFOA 2ZJYA 3IR6A 5KYXB 1OI2A 1IY1A 4LPKA 1AU9A 1X1AA 2IYNA 1UEXC 3AUTA 2WJ6A 2ZJ4A 2EKZA 2RB5A 1PJ3A 2ZVDA 4G4IA 4HAUA 4JVLA 4M1MA 3S4YA 2NNWB 1SQ6A 3W06A 3BL5A 1MH9A 1LJUA 1DQSA 1NBMD 4OHVA 3U9SA 4RSHA 3ZU3A 4HQ6A 2Q1YA 2Q4TA 3EZ2A 3OG9A 4Y0AA 1OI7A 5B12A 2WVAA 2ONJA 3UJHA 1JDNA 1R5BA 1V3QE 4CNQA 1E6UA 3PFFA 4Z4CA 5JS7A 5AW1A 5KSWB 1KBOA 1N0WA 1TEHA 3I8SA 5ARBA 3ZD7A 4WK0B 4WAUA 1U8ZA 1XI2A 2BHTA 2G1JA 3BHIA 3O8BA 821PA 2W98A 1G2PA 1JALA 3C1UA 1HFWA 1R10A 3C4VA 3DOFA 3I2YX 3TRIA 5IUJC 2QAIA 2UVQA 4GMDA 5AJHA 1REQA 1ZM4A 1VE5A 2WJVA 3DZKA 4XYEA 5COAA 3WRYA 3O91A 1FUKA 2P0YA 3I2FA 1V3VA 3OQIA 3FM9A 2WFLA 2G9NA 3UA4A 4DJAA 1EGVB 1NU8A 4HZIA 3JVEA 2DWOA 2C92A 2IJGX 3N8GA 4KQIA 5B3AA 2FI1A 2AR7A 2OXCA 1K0UA 4H27A 4M38A 2HSJA 3RC9A 4GNRA 5DK4A 2H1VA 4AJ1A 2JHCA 3SEZA 3IV7A 1FFEA 3C48A 3WSVA 4QRIA 1FJHA 3GEPA 4B44A 1WP4A 5D86A 4BAGA 1N3BA 1N2EA 3SZRA 1V1RB 4ZDIA 3M81A 1GILA 2FX5A 4OGGA 1TKCA 1NXSA 3ABOB 2XQJA 3WWZA 1GPUA 4F38A 5M2QA 4EJSA 5J4YA 3D2CA 2IEZA 4L4RA 4UAGA 3FDJA 3G02A 2FPIA 1M2HA 1M1NA 1DTWA 1U6KA 3MLEA 3COJA 5LYJF 1OBOA 1YVDA 4C4SA 4Z4EA 5F98A 5CB6A 1JA0A 5LBTA 3HKCA 5BXYA 1WXIA 4QECA 1JTFA 2HNAA 3LOUA 4LC1A 3H5TA 4H35A 4XIFA 5EQFA 3WMFA 4DGSA 3BPSA 3E03A 2W6NA 3AFNA 4RH1A 1T5IA 5L3ZA 5LMUB 3ROGA 1G7RA 3GP8A 3OZBA 3NI2A 5JCOC 4UTVA 4DR4B 1BJKA 2C4NA 2Y05A 4FE3A 4KBYA 3AERA 4RGQA 2GBLA 3LP6A 4MARA 4WZBB 2OOKA 1C8VB 5EPEA 5INTA 1XJCA 4RPGA 2N46A 1FP4B 2VRCA 3KJNA 5G40A 5AUOB 1CW2B 4BX8A 4E15A 3RF6A 5ITWA 4MVCA 1REQB 3C3EA 3RABA 3LIPA 1X9HA 2J1LA 1F6WA 5B3JA 2LCFA 4ECAA 5IABA 1UKZA 4FYIA 2B69A 1SG9A 3KELA 3OQIB 3OH8A 3CSUA 4ND8B 5DLYA 1Q5PA 2XNDD 5E6RA 3R7BA 1PTJA 2X3YA 1LLQA 1XLUA 1VMKA 1UUFA 2NAPA 3RREA 4QG7A 4P32A 3KETA 1R3UA 1N6NA 4MYSA 3B60A 4G4SO 4LNHA 5LJIA 1ECPA 2CL7X 4XYBA 2AD1A 2GEUA 2RIRA 3PGJA 2E3JA 3EASA 2ON6A 3DBRA 4P22A 1QYIA 1YMUA 1LC0A 1UJ6A 4BZPA 1WHSA 1X1BA 2GZ3A 4KQ6A 4TMVA 4V3CA 4RO0A 5DNWA 5F2OA 1CUGA 1KK0A 4EJSB 2IXFA 3QPCA 2VRBA 1L5NA 2FPIB 3OZDA 4BNDA 2I7TA 4URZR 4GT1A 4EZBA 1T43A 5J9FA 9LDTA 4EHIA 1SR8A 1OJ7A 4BRUA 2H07A 3CTMA 3JTMA 3NDIA 4W5HA 1T2UA 1DBIA 2YHAA 1G8GA 2ERYA 4L0QA 3L41A 4UC0A 3R7WB 3TINA 2JAUA 2ZTSA 5ICCA 3PJDA 3ZW9A 5IKXA 4LJRA 2JJMA 4IHJF 4QU9A 4F2DA 4QG3A 4ASUD 2Z30A 3G5TA 2OCAA 1N92A 4P8RA 4MP3A 3TLJA 1D3AA 3LLSA 2BHSA 1PO7A 3VOAA 1JEYB 4EJSC 5DTJA 1AY0A 1CCWA 1SUBA 4EKYA 1J9EA 1D2AA 2R7LA 1XTQA 2NO0A 5CA1A 3AVWA 1Z0SA 2AB0A 5CM9C 1GTSA 1HE8B 3NRJA 2H6EA 2ZE8A 1ZY2A 3KPJA 1CLEA 4IRMA 2BAGA 2CDAA 1F8UA 1YL5A 4RL6A 4RKQA 4G8DA 2PKRA 3VI3B 4CDNA 4DC1A 3B48A 5C1OA 5KEIA 2D1SA 4H7IA 4UDYX 3ZOZA 1NX9A 5LB2A 5B3LA 1U0OC 1RWXA 4IDFA 1ZMRA 621PA 4BPBA 2FP4B 2RHWA 2XA2A 4IIXA 2IQ5A 4ZVMA 1QF9A 1H2YA 1P4JA 1VI5A 2JZOA 4A0HA 1ID8A 3QU5A 2QTGA 3CWZA 2EFDB 3SP1A 2GBLC 5EWLB 5A4DA 3O1IC 2X5JO 2HBRA 4E2ZA 3W05A 1UWKA 4RAOA 4CI0B 4UAVA 5I7VA 1QPZA 1YUNA 1TTQB 1U7OA 1BOFA 2C5HA 2DPYA 3PICA 3ROEA 3UH0A 4M0MA 3PFKA 4E3WA 1Q0UA 4BN0A 3CUWA 3WB9A 3F73A 1PNVA 3N0XA 1EA5A 5HF9A 2C03A 1IBMB 3Q3HA 1H66A 1TLTA 1F5NA 3EGOA 1VIDA 3EH1A 2HSWA 1L5YA 3ZE6A 4CQMA 1EINA 1KL7A 1PTJC 1NVDA 1PS8A 1QIEA 2X4LA 3SIRA 3PUJA 4B87A 4BFVA 5DX1A 3CX8A 3UT6A 5HRAA 3T5BA 3OX4A 3HCDA 3W5AA 1MBZA 3MOIA 5ALLA 1GGFA 1O94D 1G6Q1 1WUJS 4K9MA 2DSNA 2RONA 1H2RS 2Y1EA 2ZQYA 1M6NA 3MQ2A 4QFMA 2FR8A 3KQMA 1X0VA 3OFKA 2XE7A 1HFKA 5IH3A 3HYRA 1NUQA 5U4XA 1AQNA 3C14C 4IEEA 2PUVA 4RBNA 5JAHA 5KZMB 1ZVQA 4DJJA 4I9HA 1L1QA 1XIVA 1FUEA 2XNKA 4IG4A 3F74A 4IUDS 2C3YA 3L0IB 1KMQA 2IPOA 4QO7A 1TGYA 2IOQA 5FTMA 2UU9B 2PWZA 4RHEA 1ULHA 1W4LA 4ED9A 4Q4HB 1OLXA 2YHIB 3IVMA 5JD5A 2P78A 3WYBA 1E4EB 4NZNA 3L02A 1Y33E 1O08A 5ERYA 3NTRA 5HTOA 3JY6A 1SOMA 2OXRA 2PRYA 1ZK2A 4YRDA 2C0QA 4W5TA 2IS6A 3GOHA 1Y5MA 4FDUA 4RTOA 1U80A 4MEAA 3IEPA 3ACDA 3LUCA 4NENA 1O5IA 4IX9A 1H6BA 3GHHA 4FIDA 3VDRA 1H69A 2XCRB 1SRQA 1F48A 2NOAA 3G49A 4ZZ3A 3A28A 3FVTA 3RGWS 4TS3A 3EG9A 3FUVA 1Q6YA 1ZMBA 2JFBA 2YUIA 3IJEB 4P4NA 1F8GA 1P9RA 5EUBA 3TX2A 4PC7A 2BT4A 3L6DA 3N5CA 4RIEA 3RTDA 3DTTA 1JEQA 2H9IA 4FN4A 2OUKA 4V0QA 4YRJA 1OXVA 4MB2A 1XVUA 3IUQA 1SY7A 4NCNA 2KPOA 5F1PA 4U6QA 3NEYA 1TQDA 2A94A 3GT4A 1UBNA 2AG6A 1YS4A 1SQFA 1JU3A 1KI6A 1A5BB 1U7XA 2VDOB 3AP2A 4W7IA 4WMLA 5AJZA 4LFCB 4G09A 5AESA 3HO6A 3DLAA 3FB1A 5DBGA 2ZOSA 4G9EA 4MLDA 4S35A 4PZDA 5JANA 1WCYA 1GPH1 2KB0A 2ZJ6A 5IARA 1DI0A 4GZMA 1SVIA 1Z5UA 2YZ2A 5H83A 3GV0A 1XQVA 4PPNA 3EGEA 1FDOA 1Q14A 4QBFA 3IUMA 1C7QA 3BB1A 1VJGA 3A1CA 3ZVNA 2H54A 3D2LA 1DJOA 2IYAA 1IEQA 2PVPA 3MJCA 4MV0A 4RCYA 4WVFA 5A71A 3SDBA 3CH4B 2OHJA 2QN7A 3MTQA 4ZQGA 2IUUA 3TK1A 2FR8C 1ZUWA 3WB2A 2VJQA 5I4BA 1SXPA 1AK9A 1YASA 3KYJB 1LI4A 1LUAA 1KJZA 3QHQA 1CUIA 5GZ1A 2YQ5A 5IASA 3FF1A 5J40A 2WICA 2X2FA 1ZH4A 3S1AA 4E1BA 4F4FA 2R0QC 1KJWA 3IBTA 2JBAA 1NSTA 2ZCUA 1QNLA 2RI6A 4DNPA 3NDRA 1I01A 1VBMA 4DCJA 4QXAA 1O2DA 4KO4S 4E5SA 1GGJA 5IC6A 2C3OA 4KO3S 3CPJB 4AJPA 1J8MF 3CW8X 2J7KA 3KZKA 1GAEO 1E7MA 3S5UA 1DKUA 5AJYA 3UUGA 2XT0A 2NG1A 3TSOA 3HLKA 1Q0TA 3OZRA 3ZK7A 5IXJA 3MPUA 1L3BA 2FZCA 1RJFA 4LWPA 4YUAA 1RKQA 4KH1A 1VE3A 2HCTA 4W63A 4XM1A 1POWA 3JPWA 4PFJA 1PE0A 2YWBA 3QLUA 3ZYCA 2OBYA 4FHCA 2FSFA 3SGLA 1ORRA 4K6FA 2JLUA 5FXMA 3ESXA 4P86A 3VUFA 2XYQA 3FB4A 4CKEB 3DAHA 4EVIA 2X14A 3DB1A 4QGSA 4JNCA 3SSAA 3HB7A 4QT0A 2FSHA 2ZETA 2AYZA 3SS9X 3PNQA 1Q21A 4JL5A 1DO0A 5LU8A 2WILA 3V8PA 1VJCA 3O4GA 1A7JA 1Z18A 1HNWB 3L79A 1UM9A 1GGKA 1HQKA 1JSCA 1BXGB 1HM5A 3M4XA 4P4UA 5CLIA 1T8WA 1EP2B 3PE3A 3QLJA 4FD3A 5TQ0A 5BWLA 4BXOB 3P26A 3ADCA 4Q1CA 4EI8A 4TV9A 1N6IA 2C84A 4M54A 3RFUA 4EEXA 5KWEA 5K3DA 2B8NA 3C8DA 3TBKA 5AM3A 3DR5A 2IH2A 3EZ9A 5BR4A 1GYPA 1SBIA 2ONCA 2XOEA 1LNQA 2HX1A 2QWXA 4LEIA 3WO1A 4B75A 3I1YA 3F5DA 5KMGB 4F04A 3NS7A 1SIWA 3RS8A 5E4TA 4OFZA 3U7QA 4C7OB 2GMWA 4N40A 3T0GA 5IT0A 5JVDF 3D3NA 1MB0A 2IQIA 3N2GA 1D4ZA 1IWOA 2OYSA 3BJEA 3TLKA 1R4MA 4EHBA 2NZWA 3SR4A 2XRFA 2XQKA 2YJNA 2HPVA 4RVOA 3CH5A 4J2OA 3RTAA 4TWJA 1SIOA 2O3SA 1ENOA 5AWFC 2GPBA 2D1QA 5K2MA 3K6JA 1U2TA 4UM5A 2X0DA 5IC4A 2PCJA 3H11A 3DOUA 3FMPB 4J9VA 5EINA 3ITEA 4IQFA 2NACA 2JDIA 1YJBA 1CY1A 1GT6A 3A9CA 4F5YA 3D8BA 3RSGA 4ASUA 4KUGA 2DY0A 3NTOA 3BH6A 1U2DC 3K0AA 4KXFB 4ZCSA 4CMKA 1MKYA 1S96A 3LC7O 5CK5A 2H51A 3AJ9A 3CXUA 3QLUC 3WI7A 1TRHA 3GG2A 5ENVA 1FTGA 3K9NA 2JIBA 4ZC1A 5MFZA 4B7ZA 2OBNA 1HH4A 4Q9AA 3I9KA 4HXYA 4XR9A 1UJCA 1FSPA 4KSYA 3ZQ4A 1IBCA 3G59A 2G7ZA 1DLIA 1CS4C 4YECA 2BGJA 1SXIA 2J0UB 4MKHA 1IN1A 5MGBA 4QDZA 3ZWDA 2NVOA 3K6SA 2E4XA 1W6RA 1Q1BA 1RT9A 1ZNZA 3AY3A 3NHUA 4FZVA 4AY3A 1AUOA 2EKQA 4BBJA 3PR3A 5ECYA 5K2OA 4FFBA 3TZKA 2MWMA 3QE2A 2ZSKA 3U7QB 3P9KA 1QK3A 3HN6A 4IOLA 2Z8ZA 5H70A 3EC1A 2MSCB 3UHJA 1T36B 2X9QA 3E1SA 3GT0A 1I14A 3M6WA 3C6YA 4G63A 1WCXA 2FWPA 2HIMA 4HDKA 4MWBA 4RF4A 2BFPA 1ONNA 1R15A 4JDUA 3VZPA 3RSCA 3F9CA 2C3UA 3VPDA 1I0IA 1KEWA 2FN3A 4M98A 3KAJA 1X8XA 5LWHA 5FPTA 1HDEA 4X6UA 2JGEA 3BB4A 3LL7A 4CR6A 3BK2A 2QRGA 2A0FA 4YCMA 3ANTA 5E95A 2O1SA 1QXSA 3E5HA 4AS2A 5EVCA 5L4LA 4NKRA 1T2NA 2F3PA 1XZHA 4OQLA 5H02A 3EA0A 3ZW8A 2XE8A 3VR4H 4G41A 5HIKA 2HPZA 3I2GA 2VT3A 3NP9A 1G2OA 5LM3A 5CITA 1RS0A 1CR2A 4ZAVA 9ABPA 4QZVA 4FZJA 4MRRA 5A4IS 1M73E 4WD3A 3BC1A 5EY5B 4RZSA 1MD9A 1WKCA 3M1IA 4Y2UA 3AKZA 2VXOA 1VHTA 4BP3A 3X44A 3L7KA 3LP8A 1L8OA 1JXOA 4OHZA 3LJKA 1CUUA 3PDWA 4HQOA 4OQXA 2A59A 3L0PA 4YRLA 3AR6A 3D3WB 1NR1A 3NIDB 1M74A 4YUXA 2HAEA 2V5AA 4ZCMA 4Z4FA 2YW2A 1ZD2P 3IBFA 4S04A 4JYAB 2O2DA 4D3FA 1NHGA 3O9ZA 2OK8A 2M6LA 3EW7A 4Q4DA 1W5AA 3K6RA 3EXG1 2O9JA 1HMPA 3X2SA 2CNKA 1XQYA 3B9QA 5BQXA 4YA6A 1JBQA 5EJGA 1WW3A 2QVGA 1SPBS 1QBKC 3HSYA 4GRAA 1UBCA 4HDMB 4IJQA 5EE9A 3W2FA 5HJ5A 3M6AA 3SFTA 2QI9C 1YKGA 2J07A 4L5JA 1DUIA 1WMDA 2EFCB 2IEYA 1AGNA 4L0DA 1ZQ1A 1ZD9A 3TDNA 4NE9A 3JQEA 2IY9A 2ZSFA 1DAFA 1R6AA 1GU0A 5L3QA 3SHTA 1X0XA 4OLBA 5FI5A 4DE5A 5CXQA 3VXKA 4ZK2A 1F20A 2RAVA 1VQ1A 2PRSA 2Z3ZA 2J3JA 4G2TA 4YGXB 2CFSA 5BT9A 3OKCA 1K5HA 1UBOS 3A4LA 3IAHA 1KE2A 2ZXUA 3KVYA 2ZAYA 1QH0A 3RFXA 4ZYXA 1GQ2A 1EE9A 1T6BY 1U7DA 3CB4A 3S7ZA 5LKRA 1W4CA 2QE6A 3CG4A 3ACCA 2OPHA 1QHNA 1PU2A 2I62A 1P1FA 4J7CA 4JVNA 4Y2QA 5B37A 1H23A 1Z6ZA 4YAIA 5JFTA 4MQ6A 2EFJA 4CE6A 4E94A 4O2LA 3GJ7A 4DF3A 1J1UA 4EO9A 1CVIA 3IVXA 5IAEA 4EITA 2VUUA 3D1JA 3L8ZA 3D4LA 4I19A 4XJXA 3TCKA 4YLYA 5ALSA 1QZTA 1P3JA 1TA4A 2P9JA 2PMFA 3LUGA 2OP0A 3ESYA 4KLZA 4TLDA 2WY2D 5GIOE 1SZJG 2PZMA 5HOQA 2LIPA 2WVHA 3V1MA 2JLYA 1TKRA 2H8KA 2HJHA 1UFQA 4XWWA 2QYHA 1O94C 1SXJD 1EGMB 1A9OA 1KE1A 1NJGA 2REOA 1ISIA 2WSIA 5K03A 4HDAA 2GVDC 4IM7A 1KQFA 4IWNA 4Q3NA 3IDSA 2RAUA 4AG6A 5KNDA 3I83A 1WLYA 5BN5A 1CF2O 3B8HA 4EDFA 2BSQA 3SBXA 4KIUA 3WSTA 2AZ4A 2NVUA 3JQBA 3QENA 3W2TA 3LYAA 3TVYA 4XX0A 1W0JA 5F5XA 4YY3B 3HWWA 3IKMB 4IXWA 2ORIA 5K6TA 2CL6X 3D8RA 3OIYA 3IUJA 1VKHA 1RIIA 5JY6A 1ZGBA 3ERCA 2OD2A 1E1KA 1D0SA 2IOFK 2XDWA 3L06A 1M7HA 1ZI8A 2C9YA 3QQPA 3FZNA 2ZXEA 2BF7A 2GCPA 5DCLA 2A3NA 1T4CA 1Y3BE 3GXBA 3IV9A 3S6JA 2XD4A 1CS0A 3A6LA 1UBGA 2WU0A 3DC7A 4MV4A 2A2ZA 2C78A 2D7JA 2LNDA 2WZBA 5CVVA 3WYDA 3L1VA 1GUZA 1HT2E 1V5EA 3EEYA 3W6OA 1JEDA 5HF5A 4JWTA 1YIAA 4BC0A 1J33A 1RADA 3D4IA 5K3SA 3BIJA 3EG5A 4KVFA 1NXTA 1XVAA 2BFDA 4Q1EA 2IIVA 1VDZA 1FMLA 1A4XA 5LOVB 4DBLE 1N0UA 1A9TA 1GTMA 2FDRA 3WTCA 3OD5A 3RVBA 4BQSA 2VLBA 1MA3A 5HMLA 1MT0A 1GKYA 1W2GA 5L3RA 4LZPA 4I1PA 1YTLA 3KE9A 3PU6A 3GJ0A 3QEOA 5A9RA 2TS1A 1LK0A 3NBZC 3T3NA 4BO1A 4B84A 3AJAA 4EUSA 1I94B 3VJLA 2H2HA 1J49A 4ZVSA 3LGAA 3AIIA 4NS1A 3KPYA 4CUJA 5LP6B 4KV7A 3OAAA 3ONFA 2X9LA 1K6IA 2PX5A 3QW2A 5AJXA 1TF7A 5SY4A 2V74B 1MO2A 1E96A 1R5OA 5AIBA 2WF9A 3F98A 1F2UA 3H9JA 2A30A 2QN3A 3OU7A 3PNSA 1SU6A 4HXFB 4J1NA 3QBTA 4NE7A 4DLRA 1VKZA 1A8PA 4PLHA 3U17A 4ZQIA 3AQIA 2IY8A 2Q3HA 2YY6A 3M2TA 4QYIA 2QUIA 2GA8A 3QEBZ 1U8UA 3LXMA 2NN3C 3NG1A 4R2KA 3P45A 4OSPA 2H00A 4I8XA 4Z7QB 5JAUA 2GSWA 3JD4A 4R05A 2F55A 1Z6GA 2ZRIA 4DDVA 3H05A 3M1LA 5IS2A 1SK9A 1VYHA 4PVDA 1TZCA 1ZO8A 1CX9B 3JQBC 1Y4AE 4H59A 4I36A 3AVTA 3DZJA 5L7YA 2KBFA 4DMUB 2XMPA 4GBGA 5ELLA 5EIHA 2HV9A 5KVCA 2D0IA 2IKSA 3PRYA 4UE3S 1GVHA 2Z95A 2WUWE 3ZQJA 4DZZA 2EU8A 4XD7A 4EY5A 1PWEA 5BMOA 2IHYA 1WO8A 4O2AB 3ANMA 1OXBB 3IMCA 5TRTA 2H7XA 3G9QA 1SD5A 3ZHTA 2ZVPX 1KVUA 4TM7A 3T4UA 2BBSA 1PYOA 1ADFA 4YWJA 4D45A 3T52A 1Q84A 4XD2A 2B2XA 4MUXA 3MWYW 1BH6A 2VPTA 3ESZA 1P5JA 3X1MA 3BWCA 1OHHA 2C4VA 2DTXA 4LMPA 5JBNA 1GG8A 1TAGA 2PS1A 1M2OA 3NH6A 5BSGA 2WMNB 3INYA 3L7BA 5FLXA 5KYYA 5EP3A 4AKGA 2COEA 5EFZA 1W96A 1QZ3A 1WCIA 1IY8A 1R0KA 4L5YA 2R6ZA 3ZN2A 3T1YB 1T6YA 4TZKA 5B36A 5K99A 3U16A 1KTVA 1ZI9A 2F6RA 2CLOB 2QYOA 3JU3A 1DBVO 2G8NA 3CZCA 4WOCA 3ZGXA 4M49A 4QDTA 4DWWA 2M6RA 4LSZA 1N2IA 2W93A 3IEXA 3R9XB 5F52A 4KLCA 3SYNA 3LNCA 3BM5A 4C7JA 3QE0A 3G5AA 2G71A 5D51S 5C8YB 5HSGA 1EBBA 2FSPA 4Y2GA 1FPQA 4X45A 1FQWA 3O38A 5ALKA 1IQPA 1RQGA 4GRDA 4JP2A 1TECE 3OA0A 2YZKA 2OCGA 2AN5A 2IXGA 3A4NA 3U44A 5EHZA 2ZPTX 4MIYA 7REQA 4IR7A 3JRXA 5KNBH 1CR6A 1TF2A 2WV9A 2PZAA 3BICA 4JD5A 1ZN7A 3OLXA 4X63A 1CUCA 3QU4A 4ZOLA 4DYDA 3KUCA 5I01A 4Z0HO 1M76A 4ZHQF 4MV8A 1I32A 1P1RA 4L8WB 4JOBA 4CDGA 4AD8A 1P2DA 2R6HA 2VJYA 2OCBA 3UGTA 3OURA 2OCLA 1L7XA 1GAJA 3WTBA 5JZSA 3SM3A 3HBJA 2V9PA 3QTTA 5DX0A 4DLYA 1S8AA 3B2NA 1C7IA 2ECOA 4GFDA 3W4KA 4YAGA 4NL4H 3KQUA 3TF5A 1P8JA 4GMHA 4LE2A 4NI5A 1XMJA 4KFRA 5EMJA 5A4AA 2HRCA 2B7LA 4RPCA 5BSRA 2ZSHA 1XXLA 2OY0A 1CKEA 4JLUA 3ZGYA 1PBTA 4Y7CA 5IVKA 4JI4B 4B0OA 1IONA 4IIJF 5CVUA 5EMKA 2FCRA 1GTL1 3RBZA 5GV7A 4E46A 4GZ6A 1QZZA 2YXLA 4Z8YA 2HHLA 2OHVA 3T41A 3U1TA 3EC7A 3MA0A 2VHCA 3UB4A 4NYIQ 1P9NA 3L7IA 4NZMA 2MSWA 2W48A 3LIIA 3WJ1A 3ESDA 1ST2A 3LM8A 2OCKA 1IHUA 2ZIFA 3NOOA 3H2SA 3NANA 1IHPA 2EQAA 3I52A 3QXXA 5BV8A 1OGJA 1XZ8A 3LVBA 1SUFA 2V9CA 3DBOB 4DV5B 1WXFA 2WFAA 1TQ2A 1ZX1A 2NU9A 3DA8A 1AKUA 3NM5A 7REQB 3U44B 4OAOA 3CZ9A 4P4SB 2NTEA 1PFUA 4I5DA 4MB0A 1XHFA 3KYIB 2QTRA 5LQCA 3OE7D 3T35A 7ADHA 4ZYYA 3F7TA 1PL7A 3UWDA 3ZDFA 1TQ8A 3OTWA 1IOVA 1O8CA 2F59A 4MOWA 4Q0MA 1J90A 2VFAA 5JADA 3ZQUA 4H6XA 1Q1EA 1I2MA 3QX8A 1MG5A 5IKPA 2RHCA 2HA7A 3KALA 4LYYA 4UPVA 4WK2B 2HLDA 2PIAA 2YTZA 5D87A 2CMFA 2OGUA 5KKNB 2PX3A 4MINA 2PUBA 5LZ7A 2I1LA 3DTNA 1TPZA 1HORA 1HF3A 3RVQA 2YKGA 4PRZA 3T15A 3RB8A 4BX2A 4BHTA 1VPEA 2P6UA 3OEYA 1XELA 3BRSA 3MTEA 3UV3A 5FADA 4F9EA 1ISHA 2J7PA 1WLSA 3EFBA 3F8SA 3PRJA 1DJNA 2O0LA 2SCUA 1S8OA 2BF4A 4RVNA 3CFYA 5A2QA 4N7MA 1T8SA 4BTEA 1SA0A 4EW2A 4DCPA 3ZHQA 2GN4A 2EZ9A 3QHAA 4FBGA 3WIEA 1I5OA 2J08A 3T3EA 3E18A 5EYPB 3AEUA 4YQFA 5MN4A 3NVKI 2E5FA 4GHWA 1NBEA 4TLBA 3AFIA 2DPMA 3GY0A 5F2EA 4ZANA 4HSGA 1FBNA 3E9DA 3R2JA 1U8AA 1IY9A 3FKSA 3INNA 4FQ8A 4D8TA 3QXSA 1RM0A 4FKMA 2BJHA 5KWJA 2JL1A 2Q2NA 3A6ZA 3TRKA 3U80A 4J0DA 3O2NA 2MR6A 2NU9B 4RCZA 4C7BA 4LI0A 5BQPA 1UPUA 1WBJB 5AVVA 2QZ4A 3GPDG 1IEXA 2H4YA 4S0XA 4F9GA 1MZVA 4OF4A 3MCVA 1BCRB 3TPCA 3GI1A 3QPDA 4RVGA 3H4TA 4OSOA 1XD8A 2WTEA 4JKYA 4K6MA 4Y67A 6LDHA 4CLOA 3O0DA 2IYZA 3VKGA 4Q4AA 3WP1B 1PJZA 4JASB 3ET4A 1R4ZA 4FX2A 2CJXA 3IP7A 3E22A 3IP6A 4UUNA 1XMQB 4JXJA 2OBBA 2YZMA 1OX4B 5AMXA 2ZSAA 3CZMA 1NQWA 4EGQA 4UU1A 1N4AA 2VAMA 3IJRA 3MFQA 3NBFA 4HGYA 2JAOA 2NP6A 4HB2A 3LQ2A 1BGWA 1C1XB 5KU1A 3DZFA 2VK1A 2NV0A 1COWD 1D2CA 1T5HX 2OP1A 2SKDA 2WHPB 5EE3A 1JHMA 4OB8A 4PYOA 1XZLA 3UUFA 4KQFA 4ILKA 1SXJB 5T4EA 1LPAB 4FYVA 5DIFA 5LNK6 1KMNA 1X9GA 3VNBA 4F06A 1IK6A 3BCSA 1GCOA 4OM7A 1ECFA 3IT1A 4JQCA 2II6A 4PX3A 5C8ZA 2W70A 2Z6UA 1U8EA 3R5FA 4DVGA 2OTCA 1FS6A 4BAUA 4J75A 3ILSA 4CRWB 1ABBA 2J9FB 3TG8A 3QVJA 4L2IA 4C6HA 1TM4E 2BEUB 5JPCA 2OD9A 1A5SB 2AFHB 3F6EX 2WU3A 2A7QA 4HV4A 4CV2A 5IT9A 2IOYA 2IS1A 2GZRA 3U56A 3FNBA 1IPFA 5BYJA 5KVVA 5LYJB 2ZTUA 1G66A 3G2PA 2ZRNA 1EZZA 2CLEB 3EVZA 1XZMA 4E2XA 2VPWA 2BD0A 1NATA 1WNTA 3QITA 5FORA 1LJLA 2FWJA 5CURA 5HIJA 4OGKA 5SICE 4J0HA 1SXJC 5L4NA 2ERXA 3ASUA 3WK8A 5TPZD 1AOXA 2VDNB 3A04A 2WWHA 2SBTA 4XEUA 2BH9A 1CVLA 2COUA 4KWIA 1GZ7A 2IHBA 1XA3A 1W8DA 4FMCF 2WE7A 3JCZA 4BQNA 5DV9A 5L3VA 4UHEA 2GKSA 2ZUVA 1FFSA 3L18A 4HVLA 1OUMA 2C9CA 1HEIA 1Z2DA 5TR9A 1V8OA 3IVRA 2VAPA 4X6XA 1AURA 3MWKA 3O2SB 5E7IA 3SZLA 3SOZA 5AVZA 3KTAA 2GYWA 2HDWA 4A26A 3ELYA 1N2CB 2VQ3A 4MEJA 4BB5A 3SF8B 1I2DA 2O8DA 3I9JA 4RTMA 3AZOA 1IOZA 3TOCA 4F96A 3ECCA 1XZKA 3VKVA 1A1SA 3CB2A 2NU6B 4KIGA 5FD8A 4M9XA 4NU8X 4IDDA 4ZO9A 4DIBA 3GWGA 4MVXA 4A6PA 2XB2A 3G5UA 3JALB 4YBRA 4LOIA 2ZJ5A 2PMBA 4WFJA 3LV8A 1QIGA 1O96A 3I4LA 3ZV7A 1QQBA 4IH9A 2FSIA 4M0LA 4OCZA 3GFRA 2R1TB 3ZGVA 4PPGA 5E3IA 5G1OA 4U9UA 4O02B 4ZI7B 4RMHA 2P41A 2ZWMA 4L2IB 3SC2B 2XCTB 1QPBA 4H0CA 4Q3KA 5IZCA 3F3KA 3OY2A 2K6GA 4FI3C 4INPA 4B7AA 2XYHA 2KW5A 4PLCA 5BV7A 5HJEA 1YCDA 3KQVA 1Y1LA 3F90A 3GMDA 4MHSA 3HYTA 3V8VA 1BDIA 3IBYA 2IYFA 5IUKC 3V1NA 2HSGA 4BVEA 3VNRA 1DTEA 5BYBA 4CT5A 1X42A 4LJ5A 1EXMA 4XLTA 4PRYA 4ZYTA 1TL7C 4IHJB 2QT9A 2BMEA 3QRWA 4OGFA 3UUEA 3P94A 1XAJA 3MG9A 4NARA 4CKCA 4L5IA 3D0OA 1YBHA 2ZQZA 1VLLA 2HJGA 1CY4A 3HCEA 2D5AA 2PV7A 2ZTLA 4LYGA 3VFDA 5LQJA 1F8YA 1U9JA 4OJNA 4ETNA 4AJKA 4MR7A 2XZLA 2RAFA 2KBEA 5LVAA 4WKGA 3LS2A 5JMWA 2W0SA 1B7GO 3EIWA 4AX8A 1UXOA 4G07A 1CRQA 1CQXA 1PG5A 4TLCA 3VKFA 1JTVA 4CM5A 1JDPA 3RYTC 1BQ4A 4BE9A 2I2AA 4D43A 1AMUA 3WOVA 4QTTB 3SG0A 1ZXBA 1H65A 4YRIA 1QR2A 3C3MA 1ACLA 4H6WA 4O2RA 4UBIA 1PL0A 1KRWA 4I55B 1DRWA 2Q3DA 4L4ZA 1YCHA 5HJ7A 1KFJB 3UT0A 1S9HA 2YN4A 3TOVA 3PUVA 5E1MA 4J90A 3T7DA 1CU1A 3GP5A 4Z53A 2XSZD 3DG9A 3UV6A 2EX0A 5C1IA 3EFHA 3WKDA 4MCHA 3GUCA 1O95D 2J87A 4HNAB 2VDMB 3WJAA 4J29A 4F3YA 4YP0A 4RZIA 1GZHB 3AOEA 2ZBDA 3KFVA 4GC5A 2FPRA 1WB4A 2YMMA 3A6HA 5K1ZA 5A04A 4B48A 3FCCA 3HUTA 1O57A 4MV9A 4O6VA 2LBPA 2X6TA 1RM3A 1P29A 2O50A 2ECKA 3VSCA 2CHGA 1DJQA 3DP7A 3N39C 1E18A 5DE3A 1ARZA 3A9UA 1TZMA 2XGJA 1LQTA 2GGSA 4R2IA 1FNSA 1Z5GA 2FUG6 4OI2A 5HIMA 1QBGA 1UBJS 1L7PA 1Z08A 2YCLA 3IQIX 1EFRD 3QXHA 4KU4A 5DULA 3B1FA 5IDVA 5K0LA 5IZCC 2CNWA 5FULA 5BT8A 3W5UA 2WQZA 4LXIA 3WGUA 4A16A 1PZMA 1IXSB 1FZQA 2WWFA 3KV3O 3OZXA 3SYRA 3RRYA 3RVPA 4UNPA 3U4CA 4JP3A 4R54A 4UBLA 3IPYA 4BYMA 1QYXA 8LDHA 1Q3HA 2EOAA 2X5OA 5K3OA 3FHTA 1ZRNA 1SQ5A 5FBRB 3VTKA 4OP2A 1J0CA 3GUYA 3HMQA 3NHWA 2D3TA 5B7NA 4ENQA 1PZXA 3ZCQA 4BO7A 3Q2OA 1OMOA 1VE9A 3UXHA 2CVOA 4CMIB 3QPWA 4S1NA 5DGHA 1KTIA 2I80A 2CMKA 2H2DA 1NRIA 3C74A 4PPFA 4RC9A 4RDXA 2VTBB 4HLQB 1QP0A 2ZYUX 1QTRA 5CFRA 2H2WA 3C3DA 2GM9A 2O57A 3N2LA 4EGCB 5MF6A 1JQKA 4PC6A 1BFDA 2DUJA 5EMLA 2V7VA 2OMKA 4RAQA 3WSWA 4FMDB 4PLTA 2CEKA 3GR6A 3P20A 4XUEA 5AOVA 5JSQA 4YRQA 4WLOA 2O2SA 2ZS7A 4K6KA 3X0DA 4D4GA 3TYXA 3DCIA 2IPNA 2HJSA 1FDSA 5D3KA 4M22A 3K8YA 2X7JA 1J07A 1L0BA 5C9ZA 1HX7A 1SKYE 2OWEA 5BYKA 4XOIA 3WRWA 4E5VA 3JAMA 1BDBA 3VSEA 1J39A 3BXXA 1CZLA 2A35A 1ADGA 4W7SA 3AUKA 3SKVA 1MEEA 3DWIA 3ILHA 4C01A 3DMRA 4KH0A 3EFOA 3U7JA 1X8JA 1YVPA 1T8RA 1BX3A 4JXKA 4MH0R 4PX9A 1EXVA 3QX9A 5CBPA 1C4KA 4KQMA 1OWMA 1RWQA 2F8SA 3PCTA 4CIXA 3F97A 4TTPA 2X3UA 3AOEC 3DFMA 2HH9A 1YB5A 3DOEA 4LI3X 4LISA 3SSNA 4B73A 2C9ZA 3JZAA 5G1PA 1Z4MA 3R8CA 2CXRA 4DSUA 3OSUA 1JHAA 1XVTA 4LK3A 1KYZA 1II8B 3AIKA 2ZB3A 4E08A 4TM8A 2PSEA 5TNXA 3MS2A 4L7QA 3AMVA 3E5RA 5KAMA 1CTQA 1C30B 6GPBA 5A4FS 2R84A 2JPDA 4MPDA 5JI3E 4WERA 6NULA 4X8HA 4G9GA 4KB5A 4YRFA 4LK2A 2QSJA 2Z6VA 1Z2EA 1G1AA 1B43A 1FFDA 3HJFA 1L4KA 1RWMA 1COWA 1GKLA 4NDZA 3C3CA 1A8QA 3CKKA 1QGUB 5EHGA 3SMQA 2H1FA 9GPBA 5FOXA 2JFFA 1UL1X 1Z39A 2QY9A 3SLGA 3SVTA 1ZXLA 3W6UA 4KZPA 1N34B 1B8VA 1J8VA 3AJDA 2FR1A 4HPJB 4ALLA 3M6LA 4PYLA 3LO8A 4TLMB 4ZEVA 2X5XA 2Z08A 1G8JA 5ENDA 4BN5A 4H4EA 1EFUA 4RIGA 4TXJA 1ZNXA 2IU3A 4DCOA 2HT6A 2W4QA 4I3HA 2QAJA 1Z0FA 2QZ9A 2O5EA 3L0DA 4I1OA 5IVPA 5HNKA 2OC9A 3FYDA 3PC3A 1FUIA 3I23A 1X38A 4OXNA 4YP1A 1JA9A 3CUKA 3HB4X 3GROA 5FNVF 3DC2A 4Q12A 1R5JA 4ESHA 4TMXA 5FNZA 3V55A 5A2GA 2CFCA 3ICEA 1AF7A 1O54A 3TD9A 4NIMA 4NNJA 5JQGF 1FXUA 1EA7A 3D81A 4L57A 5GAJA 4AKHA 2IEDA 2QRHA 4NY1A 3L8EA 3KL4A 1GG9A 3PHIA 2NAFA 4ND4A 1VECA 2JKVA 3S2UA 5HRCA 1KKLA 3RRMA 1SCBA 1NVVQ 2YXBA 3AZPA 1EUDA 4HH0A 5CLHA 5GJVC 5J58A 1JT9A 1LZLA 1ZN8A 2FWMX 4IJWA 2WIDA 1OA0A 1OLOA 2XOKD 4EI7A 1R4NB 1ULSA 1ZGJA 2IYXA 2ZULA 3PFHA 4FHZA 2B1QA 4OI1A 5C7LO 2CFOA 2FHSA 1LK7A 1GPLA 1RI5A 1TU4A 2ZJBA 4RK6A 1JMKC 4LWZA 4EKNB 2TYSB 1U0FA 4IUYA 2OO5A 2QM3A 4M8SA 1ZKDA 2FPXA 2CXXA 2ZWOA 2R6R1 3K1YA 4U0KA 2CJWA 1T1GA 2GN6A 3I6IA 4J2HA 2ZP1A 5L40A 3B7GA 5AW4A 5IFLA 1SBNE 1ZOSA 1GKUB 3OZ7A 2AQKA 3SX2A 3CRVA 3MSCA 4UHKA 1B6GA 3ICCA 1IRXA 3S8YA 5F78A 1P4AA 3BH7A 1NF8A 3OT1A 4QATA 3U3ZA 1IM5A 3LTEA 1P2VA 3DD1A 2FOLA 3PC8C 1IJKA 1LBSA 1FFWA 5JVDB 3S99A 5ALIA 2G25A 1FQOA 3Q88A 1DMSA 2GK3A 1JN0A 3P9YA 1LVHA 1YTUA 4N3GA 5K3FA 4X3CA 2R6FA 4FCWA 5BVGB 5K0BA 1YZNA 4B32A 3BMQB 3IUPA 3CNBA 3B78A 4OK5A 1KJIA 3LPCA 3TRHA 3VPFA 4KXLA 3KM0A 4NK4A 1QH8A 1SKQA 5AXAA 3ZU5A 1MEOA 4IXNA 1E1CA 1HLFA 4C0QC 5FFNA 4YMTA 5HIAA 2W2KA 1HQCA 3LKZA 3OHMA 3LQYA 4G0PA 2JK0A 3R75A 2P4QA 1SCUB 4UVGA 1B0AA 3V4VB 1XVLA 3TIFA 1R6TA 4B7XA 5HKBA 5KNDH 3STVA 2OLKA 3SK0A 4DJ5X 1ZSYA 2VJCA 1FMFA 3ZE8A 2YHBA 3OJXA 1E60A 1WBDA 2VEOA 5FWYB 2EDCA 4NOMA 2ZE6A 1CJTC 5SV2A 5GTDA 4BQRA 2NU8A 5DLPA 3ST7A 3WFJA 2BEWA 2NNLD 3ZH9B 1LDBA 5KCZA 5G0UA 3QE9Y 2IUEA 4MYUA 4OH7A 1JI3A 1Z16A 2ZI5A 4PBRA 2HMTA 5CEEA 3S28A 3FN4A 3NOQA 1EQ2A 1JVNA 1E0JA 1U1IA 2ODNA 2PGXA 3KB8A 3LQRA 4MGKR 4L1KA 4QUAA 1G8KA 5FBWB 2UUOA 4Q37A 1NVVR 1DT3A 3L8CA 1LTQA 2WIFA 3DXFA 4WDQA 3EXAA 2G9QA 2BR3A 1QM5A 1KAMA 2V7TA 4LBYA 1XDUA 2CDBA 1ISFA 1I2CA 1GNLA 3ABIA 4NP6A 5F76A 1ZJYA 1I2ZA 1RC0A 3DM9B 5ITVA 5TSDA 4AK9A 2HGSA 4DG9A 1ODFA 3NM6B 3QSYA 4KN5A 3MMPA 4PIMA 3PRHA 4AIRA 1MA0A 3TBHA 3ZY3A 5IJ0B 3JQRA 4BX3A 1ZJZA 1AN0A 4HDRA 4RHYA 4MYDA 1KMMA 5KVSA 3N59A 2WYWA 2X6QA 2XSZA 1JEEA 1VJTA 2OO5C 3HBLA 4A10A 3J80A 3U3DA 1XZNA 5DNVA 3T3IA 3P2KA 4BLUA 3L4BA 2GPWA 2Z4TA 3FSGA 1KC1A 1X1QA 4I9GA 4OKSA 1ZI6A 1CG6A 4PFKA 3WWCA 4B33A 4UTPA 4ZDKA 1TCCA 4D9HA 4EL0A 4DQKA 4Z1MD 2VQFB 4UEJA 3VNQA 1M34E 2IEAA 3PGVA 3VYRB 1PJBA 1XZDA 2FRDA 1S2MA 4AIIA 1R8YA 5AKZA 3R0JA 4Q4CA 4IXMA 1TYCA 2O3UA 4Z54A 3BZBA 2LCQA 5B64A 3QEJA 1DG3A 2JF0A 3PUIA 4KYUA 4LKOA 1KZ6A 3C3XA 3R3YA 3RT9A 2IH5A 3R7DA 4WECA 1RWPA 3I32A 5BP7A 1S3GA 2GM4A 3VBEA 3I2KA 4C4XA 4WVLA 2BFMA 1X9IA 3AIOA 3IHTA 3J7TA 1Y3FE 5I7SA 1AB6A 5AKGA 1Q50A 3TDMA 2Q4BA 4B31A 3C7DB 2AOXA 2QD4A 2R7AA 3R3JA 4NFYA 3FZGA 3Q7PA 5F2KA 1NYQA 3I5AA 1NRJB 4B7CA 3GLVA 3CRNA 4P54A 1WP9A 3FDFA 1IBKB 2ZB8A 4PHHA 1P45A 2YMQA 3F9IA 4GZ3A 1SOVA 5ALXA 2CE2X 5KTMA 1U1FA 4R8KA 2IU0A 3E7DA 3X2EA 5AH0A 4C7VA 4GLJA 1UH5A 1YRAA 1BMTA 2X4IA 4O0LA 3ZJTA 1AHHA 5IEJA 1VLZA 1GLNA 5FBLB 3EGVA 3AJRA 3L0YA 4QXRA 1AJEA 1XWFA 1NA5A 1PWZA 1TYAE 4NBRA 5E2BA 2WR8A 1WVIA 3U4AA 2O07A 2XRZA 2C7RA 3M6MD 4D9JA 3DL4A 1P3Y1 1XDGA 1XCPA 2DMRA 2N47A 3E58A 4AP5A 1M2KA 4N41A 1KOLA 3BF7A 1NXVA 1W49A 1YDFA 4EA7A 4F4HA 3S8EA 2CK3A 5BWMA 1XRSB 5CNJA 4ZVQA 4PGGA 3RAEC 3TZBA 4JSRA 4CCYB 2QJOA 5LA6F 2W6ID 3IMGA 4UW9A 3UPUA 1O95C 1UXGA 2P9QA 1TM7E 3LX6A 2J9GA 5IDQA 1NVAA 1U3WA 3PZBA 1QG4A 3L4BC 3O1LA 3C97A 4XJTA 3ZXYA 1IULA 1VJ0A 2PMDA 3UYLA 4DXAA 4WHMA 4IGIA 5HWSA 3LTNC 2NO6A 4P58A 4O1MA 4AUNA 2PUFA 4G36A 2PFSA 4MSUA 5C2JB 1RM5A 1T0IA 2FRDC 2RGUA 1MDFA 3FH0A 3KZVA 1PN3A 1ZP6A 1HETA 2TSYB 3NHSA 4G85A 4H7PA 4L7VA 5EZ6B 1ZAKA 2GWHA 4JFAA 1X7YB 3P4UA 4D5EA 3T34A 3GRAA 3DZBA 1NDHA 4XVQA 5CW1A 2GD1O 1Y4SA 3I6YA 3MILA 2NTNA 3QVGB 4QUDA 1C41A 1TB4A 3K9QO 3QJGA 4A36A 1E2UA 4U7JA 3KAKA 1N7GA 4BOYA 1NW8A 3DDUA 3H6KA 1VIAA 1FLNA 3HB1A 1LB1B 2KLHA 4RK4A 3DYIA 4R41A 2UAGA 2XAAA 1DXOA 2P40A 2FJUA 2VPQA 5BR8B 1GM5A 3ZLJA 2P30A 2VC2B 3NEJA 1DSSG 4DN6A 1WMSA 3WYGA 2G88A 4Z9YA 4LXXA 3CUTA 4K8RB 3GPCA 4TMWA 1DX6A 1V2GA 2AQ8A 3GG9A 4N8SA 3AW8A 4H7HA 1B93A 4U1RA 1AKWA 4TTTS 4BUJA 5AHRA 4PCAA 1ZW1A 4DLAA 3HCPA 3MT7A 5T4BA 3NHMA 3QBVA 4N54A 1K97A 1VLJA 4UVDA 1RXWA 3ZGLA 4Y2RA 4XB1A 2Q9BA 1G7SA 3RRXA 1RLOA 3JPYA 3Q7SA 1OE0A 2B78A 4PZ9A 3Q5GA 1WXGA 4L5AA 3OUZA 4KK4A 3S7TA 4AL4A 4BV2A 1DC5A 2YYYA 4WLFA 2R47A 3A0RB 2FZKA 2DPLA 5HUQA 1TZKA 1XQ1A 3G1WA 3P2YA 5ERXA 3GVHA 2A9JA 2QU7A 5JALA 6REQA 2XADA 3EWNA 2DQZA 1F60A 1J8FA 2CLDX 2XOKA 4O5OA 5A0VA 5K0CA 5EXEA 5AUPB 1QORA 4UHHA 2NMVA 3JYNA 2JAWA 3JR3A 3L1HA 3H0EA 5L9AA 3OPNA 4YP7A 4WXPA 3HHPA 2QW8A 5H82A 3I1FA 4C88A 4PNEA 5KTRA 3UK0A 3VDQA 1TVKB 3RI3A 2D7CA 16PKA 3AEYA 3OQPA 1GZ5A 4IKOA 1SVKA 1QIIA 4TRJA 5J5VA 3UJ8A 3ZKAA 4MTCA 3WWEA 2AF3C 1VTKA 3A06A 4FYXA 5ALOA 2XVAA 3QWIA 4QXQA 1VCOA 4TKUB 4DANA 1CRWG 3GJRA 1ZJ6A 3M6XA 4GBED 5CA0A 3TIIA 4TXLA 2PEYA 4MS3B 3FCEA 4LRYA 3UJ7A 1Z4LA 4UE2A 1QR6A 1SCDA 2RKBA 3NYRA 1N8NA 3GJZA 1ZXXA 1QHEA 2YXEA 3OZWA 2JIRA 4FLMA 2LE0A 5AM5A 3TLAA 1JNYA 2FPUA 2QMOA 5DT9A 3AFGA 5DOZA 1GZSA 2YJTD 3OIDA 3R4CA 4I50A 1IVNA 3NRCA 3N2EA 3W77A 5F7XA 4GOMD 3L1KA 2W37A 2HU7A 1V37A 2C4HA 4KRXA 4P5PA 1ENZA 1JFRA 1R0ZA 1RHUA 3R5SA 4WBNF 1XRRA 2PQMA 6AT1A 3PXCX 4E33A 3R0VA 4HDCA 3EWSA 1AKMA 3PK0A 5G02A 4DLXA 4X5OA 1KVRA 1Y9EA 5FUQA 3OA2A 3BULA 3VR6A 3EXG2 2I1VB 5HGXA 1VKOA 2B25A 4TZTA 4BKUA 1T9GR 4JBHA 5JAPA 2O8FB 4RD1A 5K0JA 3IAEA 2P2LA 5J59A 1QFYA 2JJQA 2X8WA 2ZYDA 2PL5A 1SXHA 4MX8A 4WJKB 1SRRA 2Y93A 3ROMA 4F6CA