4CU2A

C-terminal domain of ctp1l endolysin mutant v195p that reduces autoproteolysis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
PENLVVYNDGADQRAAEYLADRLACPTINNARKFDYSNVKNVYAVGGNKEQYTSYLTTLIAGSTRYTTMQAVLDYIKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Cd27L and Ctp1L Endolysins Targeting Clostridia Contain a Built-in Trigger and Release Factor.
pubmed doi rcsb
source organism Clostridium phage phictp1
molecule tags Hydrolase
molecule keywords ENDOLYSIN
total genus 26
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cu2A00
4CU5A 5A6SB 5A6SA 4CU2A
chains in the Genus database with same CATH superfamily
5FBLB 1O8BA 1RW4A 3D54D 2OB2A 1YTLA 1XZDA 4MROA 2PX6A 4UJ3A 1IQPA 1T8TA 4QTTB 3OT5A 1LC0A 3KYIB 1Q77A 5IRCD 1UM8A 2GAIA 2NN3C 3CH5A 3CPEA 4IH9A 4RE6A 1ABEA 5IAKA 4DV2B 1Z5PA 4TTQA 3O73A 3ZDEA 1ZBDA 2VLBA 4D42A 1WOMA 2XNJA 2ZUSA 3W3ZB 4ASUD 3WGIA 5ALDA 3K2EA 4MVJG 4JLNA 1AMOA 1PSZA 3C43A 2JZCA 2PS0A 4C4XA 3IQHX 3LUJA 5HUHA 4LWZA 4TMZA 4KYUA 3TSCA 4WD3A 3STHA 2JIOA 3A1CA 2YQZA 1G4UR 2CV0A 1W5AA 1G41A 1QJ4A 1VE6A 4LBYA 4AY3A 3O6VA 1DQNA 1ZPDA 3Q7TA 4EB8A 3I2YX 3M1YA 3KX2A 3VU8A 3ZCSA 4RTSA 2ZT7A 3PXAA 1FFYA 3GJ8A 3WC4A 4FS8A 4DB2A 1OXUA 4YT8A 1GZ3A 3QJGA 4BNIA 3DHWC 3DL4A 1Z6GA 3FCYA 3PYLA 4R8SA 2Z6UA 2E37A 3F4BA 2J4DA 3NWJA 1RVDA 3E05A 2XWJI 2QG6A 2ZAOA 1XEFA 4U6NA 5BRAA 3RYFB 2YQ5A 3E0XA 4QQNA 2I1WA 1UP7A 3NB0A 4PW0A 3A4YA 5T67A 4MW9A 3SDZA 1IOLA 4CKWB 3LWDA 1E96A 3CB2A 1ZR2A 3UAWA 4MWOA 4RPLA 3U9LA 3N2IA 1YBAA 3DF7A 2D2XA 1VZ3A 1NF8A 4HGOA 3K70B 2JIZA 4KN9S 2DF8A 3QXSA 2QN3A 2C7RA 3LFUA 4UNNA 1WXQA 4E0BA 5KSWB 1BG6A 4IUBS 4EA6A 3MRVA 4CU5A 2ZR8A 2XOEA 3HFJA 4XSHA 4MJLA 2HIHA 2ZK7A 5AUOB 1DBQA 4QULA 3WGQA 1Z4OA 1Q6YA 1UJ4A 3AL2A 3D6NB 1KMNA 2DGDA 1OAAA 3EAFA 4A6DA 3M1LA 1PFQA 2JW5A 4FYKA 3HY3A 5K0EA 1NJGA 1PS0A 3AYZB 4ZU1X 1GPUA 1XEWX 2I5PO 4OXRA 2LCQA 3V1KA 2WMNB 4N5LA 1N5OX 4LYDA 4DJJA 4BPRA 4DIOA 2Q1UA 4A36A 1X38A 1KF0A 3OU6A 3ZHUA 1TNDA 4CMIA 1T25A 5LQSA 5LYYA 4UVEA 5LZ5A 4H1VA 1EPUA 1Y98A 4E1AA 5G2OA 3TZHA 4UD2A 1LF0A 2ACWA 1CJBA 4IIBA 1DLIA 3FMIA 4HV4A 1UBUS 4KQMA 4UMDA 1VBMA 4ERXA 5F7OA 3TTWA 3WZ2A 3EEOA 1DXHA 5LUAA 2BGRA 2CFIA 2CFRA 2X8JB 3HGQA 2LCFA 2HPHA 2Y1CA 3DW3X 1WUJS 2HSZA 2Q3DA 5AM5A 2XAUA 3GK3A 5HBGA 2ZZNA 2JIMA 1NG9A 2DG2A 5LP6A 2XUOA 4XEHA 2QUIA 1DPGA 4G0XA 3HJHA 1CZNA 1OZFA 1T13A 4EMBA 3IUMA 4RH0A 4BKQA 4RXTA 4U7PB 3NBXX 1H2RS 3BQMB 1RIIA 3IDAA 2Y1LA 3W8DA 2FE1A 1RYMA 3QV1A 4K3UA 2AL7A 4NK5A 1XDWA 1YUNA 3F6SA 4XUEA 2ZIGA 2YOGA 2Z30A 1EBBA 5HTOA 3SICE 4C21A 2HH9A 4UDOA 1LDMA 5L3SA 3CYFA 2A0KA 3DDNA 1XPUA 1F9AA 1WUKS 1Z6XA 3URKA 1I32A 3H3JA 2A88A 2D4HA 3ORYA 5C8YA 4TTVA 3FHOA 3OZVA 3NTXA 4RJTA 4LZWA 1P2FA 3TJRA 3KQOA 4JMLA 2QKYA 5JS1A 5BR8B 3AV0B 1A9SA 1JHDA 3QLEA 5CR9A 2HHAA 1DKNA 1OGYA 5ALMA 4E4YA 5F5XA 3MOGA 1LPOA 3K0AA 3QNUA 4P4NA 4JEMA 3T35A 2DPXA 4P08A 2DH6A 4NZNA 1TJ5A 5A7FA 3AUAA 1W19A 4YALA 5GM2A 3OOSA 4B32A 1MP0A 3EEFA 4Q34A 2A9JA 1OZGA 2AUTA 5KC9A 3L41A 5AJTA 4EMTA 1K3TA 3DS8A 4IDEA 1ZK0A 1P7ZA 2PNFA 4M6WB 4A5SA 4ND3A 2C9ZA 4FQ8A 4LNHA 3LDFA 3TQQA 3ZNOA 3U4QB 3K1JA 2RH9B 1UC4B 3FWZA 3LUKA 1E89A 1R64A 1EX6A 4AURA 2R5FA 3KAPA 4M88A 4IHJB 3PITA 2E9SA 1JU9A 4X6UA 3MXOA 3HGMA 4G9BA 4BX3A 4D43A 5BN5B 2JFZA 3PQ6A 5EWLA 3BD6A 4PGMA 4XYEA 4OGLA 3GQBB 3W04A 1LDEA 4HDKB 4RHTA 4G4GA 1W49A 2QRZA 4GPZA 4U7DA 1HR0B 5SZHB 4FHDA 5HVNA 4H4EA 1AH2A 2XNSA 2BFPA 4QQRA 3SCZA 4C3ZA 2FX5A 4JV5B 1DWOA 5L7WA 5B3AA 4EEKA 4J2TA 1K8ZB 3RABA 1FSPA 1MJ5A 2W6QA 3LYHA 3CLRC 1SA0A 2TYSB 2PYIA 3UAVA 2HYDA 3N86A 2IV3A 3O8OB 4JT4A 4M55A 1YI8A 1JA9A 2CUTA 2MSWA 4DC9A 4AROA 4MICA 4FFBB 1JEQA 2D54A 3FAZA 1K3FA 2QX4A 4EUNA 3PF8A 3H42B 4LDRA 4QLOA 2X40A 4FXOA 4N0PA 1G6KA 2C4VA 5CX1B 1YMUA 5JALA 1YKFA 2I7VA 3OEED 3OFNA 2GZ1A 2CJWA 2EKQA 1PW7A 3E15A 2F1HA 3NTRA 4OSEA 1ZAYA 2VJBA 3PHJA 4GP7A 2EJBA 5H80A 1GRVA 4D3XA 3CLTC 5L7YA 2JA1A 5HGJA 4UUMA 5A3SA 1I5RA 4IW3B 4DCUA 1TF5A 1M1XB 3S3TA 4XFDA 3LBFA 4D46A 2GXQA 1X7WB 2O3SA 4AIRA 3G5AA 1XWFA 2W58A 5E6RB 1TIKA 1SXQA 1TTPB 2R8YA 4OHBA 2FPXA 2H4HA 1XA3A 1MIHA 1EA5A 4CWAA 4MARA 1WCXA 1H1LB 2XW6A 3R74A 4DW8A 3ER8A 3OE4A 1Q0HA 2XZPA 4G5OA 4HAYA 1SUFA 5JDIA 3EQ9A 4BWFB 1XQ6A 3DM5A 4RA6B 4H7HA 4ZV9A 2I34A 2ZYUX 3W2HA 2C3OA 4ZO9A 1JH8A 4HMPA 2ZIXA 4R9NA 1R00A 3MYYA 3ONFA 1O95A 3ZKWB 2VHVA 3CE9A 2HHCA 4MB0A 3VR2D 1AMNA 2J9GA 3DG9A 4CMKA 2CV1A 2C83A 4IICA 1E6WA 2VUUA 4RK4A 1CUAA 4LHZA 2B8TA 4H3VA 4V3CA 1THGA 4YUXA 3D8UA 1ODFA 4XQ9A 2YOFA 2WAXA 4MB2A 5A1JA 2X5KO 4R9RA 1S4QA 4D0LB 1ATIA 3PKJA 1PLJA 3IB3A 5BOSA 1KWGA 3JQAD 2O54A 3RRYA 3IP8A 3LYUA 1KFBB 2V6FA 3N2NA 3NBQA 5DLPA 5CAEA 5KYUB 2PUBA 3EVZA 1NLYA 3CN9A 4UD6A 4Z2AA 4BB9A 2C94A 3ZS8A 4WPGA 1S2OA 3CBGA 2VJCA 1B15A 4L3VA 2ZWVA 3GV0A 4OF4A 1N6LA 4PEVA 4BNUA 1DJPA 3KALA 3SF8B 3S2FA 5L95A 4DHEA 4LY9A 5CIQA 4JFRA 5AI9A 4GLJA 1PHPA 4ARAA 1USUA 3T3MB 5CJ2A 1ILWA 2ZZMA 4IIJA 3G5LA 4CQLB 4N5HX 1Z5GA 3PR2B 3QEJA 2GARA 3Q3VA 4KE6A 3Q7RA 1SQ6A 4ZVTA 4HH0A 4P82A 2CXOA 2EQ5A 3GOHA 3IHWA 3VYSB 2H5JA 5EJGA 5JAUA 1CR4A 5IBCA 1QPBA 1HNWB 1QQBA 2DPGA 1GKKA 1OV4A 1VHDA 2FF5A 2W4IA 3KKKA 4O08A 5EWJB 3ZV4A 4KUHA 4P8RA 2QE7D 4AQ7A 4AY2A 1C7QA 3CX4A 4BNJA 1VZ2A 1YU9A 3OO0A 3U19A 2LGJA 1BXGA 1V4NA 1CY7A 1N0HA 3SJCA 1LLQA 2WIKA 1KO7A 4N9WA 4XW2A 1VA5A 1TCCA 1C2YA 1E7YA 2FUKA 4V03A 1KZ9A 4FE3A 1IHDA 5TXGA 1Z63A 1M72A 3KYCB 1EGVB 3I37X 2ZANA 2H1VA 3DONA 4XE5A 3GCWA 2CCJA 1IOVA 5F73A 3WIVA 4KNYA 1VIDA 3NHPA 4JI3B 4YP5A 1PL8A 3TBFA 5ALXA 2OGWA 2GJAA 1CQJA 1O7JA 4DJDC 4DQXA 4G1VA 1JGTA 2HTEA 3DDOA 2YHSA 4QDJA 1NN3A 1FNBA 5BNFA 3FNEA 1Y81A 1QHHB 1DKQA 4ZHQB 4GXNA 3OEWA 5I5GA 1Z4MA 2WUGA 3RCBA 3VX4A 4N54A 4KWTA 4M1YA 5THXA 4YY3B 3BH0A 3A37A 1SKAA 2QD3A 3AEUB 3II6X 4TS4A 3SQNA 3FNFA 4E1VA 2OD2A 3GNSA 3N6RA 2EJUA 3LCUA 4UTVA 1R3UA 3JQDA 3T0GA 3WBFA 1MB3A 5MF6A 3A1UA 2PUWA 1FY2A 3VPCA 4ID9A 2PRIA 3ICOA 1RHMA 4C4RA 4YQFA 3WLAA 4P0QB 3T95A 2ZFUA 4OJNA 2PH7A 4OJKA 1O6GA 3OZXA 2B37A 4XRRA 5FI5A 1AS0A 1GRCA 1PLLA 3JPYA 4Y6QA 1OXSC 5EZYA 4PN3A 1TF7A 1RI2A 3ND6A 4RLSA 1RM5A 1CVIA 2O2DA 1BU8A 2F2TA 4JODA 5BN3A 1DAIA 3QMMA 3TKLA 1ZAKA 4IO1A 2ONKA 3W90A 3O9VA 1D7AA 4JROA 1LNQA 1ULBA 3LF1A 3JV7A 1PV4A 1J25A 1M66A 3K9BA 4CKEA 1TI7A 1JZTA 2Z57A 4RTLA 3UZUA 5DYNA 1C2TA 3SBXA 1DI0A 1QNLA 2IXFA 4OBBA 3S8YA 1WWKA 4YN3A 4LWQA 2BFDB 2R6CA 3FFTA 5COQA 3U3MA 4KPUB 2VHWA 4YP0A 4I4TA 2FLKA 2ETXA 2ZBVA 4RTPA 3OHPA 4ENSA 2GN4A 1YVPA 2ZBDA 2RBKA 2PU5A 1LWNA 1H2XA 3FOEC 1RYYA 3ZWAA 1RQNA 2ZIXB 3BB4A 2C3UA 2CKMA 4PQEA 4EVRA 3FTFA 2NSHA 1S2MA 1H23A 2IUYA 2JI7A 4I66A 1IVYA 1L5GB 3ROXA 3UNXA 4RQTA 4N3AA 5REQA 4XLZA 3LXRA 3OFND 1P7CA 3V8RA 5A4MS 2B0CA 2WLSA 4MW2A 3CZPA 1KDPA 4UVHA 3TOVA 1YS1X 1Y9AA 3TGWA 1AHNA 1RE0A 2BKEA 4GKVA 5ALTA 4LHEA 3VU1A 1Z29A 4GUAA 3PDCA 4QOEA 4DVJA 1U04A 2GK3A 3L7BA 4JJ6A 1U2DA 3LBNA 3R3YA 2ZRNA 3KU4A 3OLYA 1SBZA 4D9KA 1YE5A 1R74A 4X93A 2C7PA 2V7TA 1FP4A 4GPAA 1T5LA 2QI9C 4YRRA 4G1FA 2A7QA 4XIIA 1ZMXA 4R8RA 2X0NA 3L1HA 2PUJA 4L6IA 1VXRA 5CVTA 3L93A 1K2VN 1MIOA 2GBGA 4MYTA 2R5WA 5EE5B 2P79A 4YRJA 3OX2A 4TKUB 1RC8A 3WG9A 1NOKA 1GU1A 4DWVA 4MKIA 4BVHA 1XWWA 4L7VA 1YZHA 4LV6A 2AD1A 1EGMB 2BJVA 3C5HA 4RBNA 3IA7A 3T4UA 1VL8A 3HY4A 2Q3LA 4A8JB 5IG2A 4ZJZA 5KJFA 4ZEWA 2XJ9A 1GPYA 1MQ9A 1YVRA 4PVCA 3IPYA 4AUMA 4F3YA 1T6YA 5K8UA 3IQIX 1ZOOA 4U9UA 2MSNA 3H75A 4GDFA 3UEOA 2C2GA 2I2CA 2WJ3A 3Q7PA 4L4XA 5SYMA 4O2AA 2R87A 1HDYA 2QSUA 2VSOA 2BFWA 3L82B 3UYLA 5BN3B 3CSDA 5ERGB 1GT6A 2AN4A 1FX1A 2XYGA 4HPWA 3R9KA 5GTDA 2LNDA 4NCIA 3PQDA 2D5BA 3WHKA 5DM2A 3ZVRA 1OWOA 4DQLA 3T94A 4E32A 2H1OA 4MH0R 2KSQA 1J23A 3OJOA 2QJWA 3W3AA 3WGJA 3JQ8B 1W5BA 4Q47A 4DRZA 1UBJS 5ENVA 3DZ8A 2DHQA 4PGHA 5LA6A 4ZYUA 1SCAA 3K35A 3KXIA 3GEIA 4H59A 4KBFA 5C46F 4O6VA 3DE6X 1EVZA 1Q19A 3AJ8A 1B00A 1T0BA 3FCEA 3IURA 4IS2A 4WZBA 1A2BA 1YRBA 2IZ1A 4LCJA 3REQB 5BV8A 1D3AA 3U4QA 4EJMA 1M0SA 1T6BY 1WHTA 1US8A 2GF9A 4K1LA 5J47A 2V7UA 4KN8A 1V35A 5CM8B 5AT1A 3T5TA 4EFDA 3B9BA 1WS6A 1RAIA 2DCUA 3GRCA 4YBRA 4CXMA 2NU6B 3MIZA 3VH1A 2BFBB 4EGSA 2OWDA 4P7BA 1THTA 3KHTA 3I2KA 2QZ9A 2G0TA 3S81A 1GSIA 3WL5A 2A14A 4K9SA 4F46A 3UJ3X 1GG5A 1HT1E 1NQOA 1X1BA 3KXPA 4FOSA 1BKSB 3JAKB 1L7BA 1UBEA 1ULUA 1BOOA 2VDVE 3IJEB 4DCSA 5A9SB 1QU2A 3A1SA 4FU0A 2C42A 1W0KD 4BE9A 2Z1NA 3A4TA 1C30A 1VG0B 4KR9A 4XXHA 2IP1A 3UJ6A 4JEUA 1LBTA 3AI3A 5DDIP 3OJCA 3QFCA 3ICWA 1AV7A 3M4ZA 5H3HA 4U7FA 2IXTA 3AY6A 3H17A 4CUJA 4QOSA 4H6WA 2YV2A 2BZGA 1K0FA 2A1UA 5F7JA 4YRPA 4ENQA 5I7SA 4U8HA 5DI3B 1F48A 3AHCA 3CLRD 3P2KA 4ZPJA 3ROZA 3G88A 4W1PA 2QP9X 5TEVA 4L22A 3HZRA 2F4NA 1GTZA 4CIXA 2HLDA 4HDSA 1QB8A 2XMZA 4AP5A 1IK4A 3SJZA 2ONCA 1ZN2A 2HBRA 3D8RA 1Q7RA 3PT5A 1CXZA 2A33A 1P5RA 1Z17A 3IAM1 4TLCA 2PL5A 4UBOA 5A5VA 5L3SB 4BL5A 1WDLA 5A6SB 4IH1A 4WY8A 4RZIA 4RXUA 5DBIA 1GQFA 1QGED 3AUJB 3GJ5A 3HRHA 1PUJA 5WRFA 3IQWA 5BOVA 5A71A 4F3CA 2Q99A 3KFVA 1WPQA 3E1SA 4IIJB 2W6MA 2RK3A 2FW8A 4QARA 3USCS 1MH9A 4YP7A 5AIBA 2WHPA 1QOQB 4MVJA 1EBUA 2E48A 4K2AA 4ETWA 3QE9Y 3EIUA 1Z5NA 4LUCA 4MRMB 2NAFA 3I1IA 3ZZNA 5ECDA 1P19A 3RSQA 4NYMR 3U7HB 2BTQA 2NXEA 4ATNA 2AG8A 2LVBA 2X23A 1EYZA 1PK8A 1B8NA 3ZLUA 4BLRA 4CT5A 1RMQA 3EIWA 2KPOA 3H5AA 4HWOA 3ZKAA 2FTKE 2D1SA 4J91A 1C4KA 3GT0A 4PAWA 3DP7A 4WNIA 5IF3A 5TQVA 3ABOB 4EUFA 4Z2YA 1KYIA 2QMOA 4Q12A 5KREA 3LTEA 1L8QA 2RKOA 4J2HA 4ENRA 4UTRA 3FVRA 4HADA 4WOJA 3F71A 4JKIA 4POOA 3F2VA 3I05A 3DYBA 2DQSA 2PD3A 1Z4LA 3EXFB 4Q82A 2BGWA 4ENPA 3HA5A 3A1WA 1TQ6A 1O89A 3K9NA 3VPAA 4EKDA 3VNSA 2BZ0A 1QVRA 1MC1A 2W0SA 1ZMTA 2FRDC 2ZRFA 5HGXA 4WKCA 2CEKA 2A3RA 4J76A 1BKYA 3HLYA 2ZE6A 4CMCA 5FOTA 4YRAA 1CD5A 2GVNA 3RJ9A 4OG2A 3MUOA 2REOA 4RZQA 4PYNA 3CWQA 1C9MA 4X63A 5TMDA 5TS3A 2CXPA 1JYFA 3C3JA 3R5SA 3RGWS 1E5TA 4WN3A 1L7RA 6REQB 4NNJA 1MG0A 3MMSA 2Q3EA 1S3SA 4JVNA 1HFWA 4M9ZA 4LQCA 3MTJA 4HBGA 4MI6A 1E1LA 3RVMA 1C4XA 4BATA 4RORA 5EINA 1BH6A 2AQHA 3A6JA 4FX5A 5LDDC 3QELB 4EG0A 5JMTA 3OZUA 1WD7A 1P4JA 1LTHR 4CQLA 2JLWA 2VJPA 3KKLA 5AOCA 4W5OA 2WEKA 5EHXA 3ZHYA 1OAOC 1MX5A 1Z74A 2OZPA 3JYLA 2D0IA 4K88A 1PJSA 3MOSA 4H2DA 2JGEA 3T4EA 1N5IA 3JALB 1N6PA 1T4GA 3WGLA 2WD9A 1R9NA 3FNQA 2JI9A 3IP6A 2LD4A 4OM8A 5EG5A 1RJGA 2HU2A 2OMEA 1M1YE 4X71A 5DFAA 5DLQC 5DT2A 1PL7A 2W70A 4D92A 4URHA 1HE3A 1YC2A 3IEXA 4DAEA 3GCZA 1M2KA 2RGBA 1QYDA 3LNTA 4KMMA 3VOBA 1JTEA 3NYRA 1KDOA 1E2JA 2H48A 1K3UB 4ND4A 2ZJYA 3JD2A 1NQXA 2O20A 3FZEA 3U0BA 1ZA2A 4FN5A 3UJHA 3ZQ4A 4E5PA 1AD2A 4UTPA 3IAS1 3D3QA 4KV9A 1VI6A 1ECBA 1SUIA 2DLDA 2Z3VA 2ZYWX 5K3BA 3UAOA 4M38A 3TE7A 5CPBA 3R5KA 4W8HA 1ZD5A 4HBZA 4DGSA 3VR6D 4CV3A 1Z5VA 2EG5A 2XYVA 4A8JC 1RWOA 3ESCA 1REQB 4HUQA 1FSGA 1OASA 1LDBA 3QFRA 2CBGA 3VFDA 4DG9A 1NNUA 1C80A 1JIVA 3KEGA 3UHFA 1W59A 3LL4A 4E5UA 4JI0B 3QVJA 3GPBA 1RIFA 5CCDA 5DMXA 4BQPA 1BCSB 4WVLA 2HO5A 4MYCA 4PYOA 4BNMA 4HAIA 3BL6A 4RQUA 5IDWA 3EGCA 3RAGA 2ADOA 2WZBA 1CUDA 4RL6A 2WTXA 2V0NA 1BU5A 3D1LA 2R11A 3KFLA 1QJCA 4QECA 5CYOA 5JAPA 1E3WB 2D1FA 4RF2A 3KHSA 5FFFA 2B35A 2BMJA 2WUFA 4UU7A 5AKGA 2BBOA 1BS9A 1ECPA 2IE8A 1ZGCA 3TIXB 5CFNA 3WMXA 2ZI5A 5JXJA 3A4IA 3O1LA 5DHRA 1RI5A 3W5CA 3E3LA 3CVJA 4MUYA 4KPUA 3HDJA 5TARA 4C7MA 5TGDA 3PPVA 5DT9A 4E70A 4QZVA 4QUIA 2JA2A 2DETA 4OXNA 5BV1A 4W9MC 5CXXA 4DR7B 3QE0A 1TU3A 5JJKA 3J81k 5IC4A 1UT8A 2QE7A 4ZZ0A 1TKCA 1PL6A 3Q10A 4M60A 3RT1A 2JKZA 4C7VA 2ZJ0A 2WFLA 2P2YA 3I83A 2OVBA 1ZXXA 1WW8A 2WE7A 2ZVQX 5C32A 1HLGA 2PV7A 1M8GA 1CF4A 5CH5A 1Z75A 2Z1DA 4ZO4A 4CIWA 5KNBA 4OGKA 5I9BA 4BV2A 2ATXA 1ZX1A 5F23A 5KTKA 2GO1A 1T9AA 1CEEA 2CVQA 1ODSA 4QA9A 1EKXA 3V4OA 1NASA 2BHSA 4R2XA 4FGUA 3F3SA 1JSZA 3PEUA 2YZGA 4IHJF 5GAJA 5BUSA 2QMHA 1FFXA 2I6FA 1GUFA 3QIAA 3ZLVA 3UK6A 1C0PA 4FFRA 2QN9A 2TMKA 1P7VA 2G36A 2WT9A 4F85A 4RZXA 4Z1MD 2WYUA 3H4IA 4Y67A 1A8PA 2P3LA 3MTGA 1IPFA 4ZVKA 5EAIA 4Q3DA 4X0EA 4AF8A 1UFQA 4QX6A 1DQRA 4Q1VA 4KB5A 1X1CA 3BZBA 3CIFA 4NOLA 3DFMA 3EZGA 2IHJA 3GGCA 4R6XA 4YJHA 4IJUA 4ZOCA 6NULA 1XLTA 4R05A 3RS5A 4K9RA 4O2RA 1H94A 2PZAA 5FA6A 1BHJA 1KJWA 3HHPA 2HHJA 3QELA 2G1KA 1GN8A 2CW5A 3DB2A 1U8ZA 4IXDA 1QDUA 1BTOA 4KIFA 4FMCB 1QFXA 2WIDA 1FS4A 4IIDA 4LTDA 4N0MA 1NULA 2JS7A 1P2BA 1BH2A 3P5BA 4QFCA 2IYUA 2NVWA 3WXMA 2HJRA 2PU7A 4FOOA 4KVFA 3ROTA 3TLAA 3AB3A 5AW6A 4MVXA 1PSWA 4PM4A 4QUBA 1KJ8A 2M2IA 3T9BA 2HCRA 2H4FA 1BDJA 3VC7A 3CEAA 4Y2SA 1KKUA 4FMDB 4E5MA 4OLJA 4QXPA 3N6VA 4EYOA 4YR7A 2ZUBA 3L7DA 1C3VA 4RESA 4XD7A 4Q9JA 1PNOA 5CB0A 1NQWA 3KR0A 3MWYW 4MRVA 5FA5A 4U7GA 3ZI0A 4V0SA 2NSJA 4WWHA 3W9UA 2XYHA 5E7MA 3K9WA 4HSEA 1WHSB 2OXCA 1UZAA 3ZJ5A 1K5HA 5PGMA 3GLFA 2GNOA 4N41A 4YA6A 2VRNA 2HMVA 3FNHA 3PDIA 1PWXA 3KETA 1NNEA 2RK6A 3OE1A 2Z43A 4TMWA 2A5YB 4UEWA 2XHEA 2R47A 5JJIA 3ANNA 3PDUA 1P0MA 1XMQB 1GTJ1 4DREA 4OM7A 3ZWOA 3HKCB 5C80A 2CVZA 5E1MA 3BE6A 3TQIA 1MTOA 1ZINA 2CFSA 4OQNA 3I1YA 3NAZA 1YB6A 3DMTA 5U4QA 1QVZA 4JYCA 4Y9UA 4DVGA 1RXWA 1IL0A 1U8CB 2A5JA 1PNQA 5CITA 3MJEA 2C5AA 4HDAA 3VPGA 3OWXA 4MRAA 4J0CA 1NPDA 2NMVA 1V7PC 4AY6A 1PTJA 2NIPA 5BWLA 3J7AC 3TM4A 3NORA 3G2LA 2UZ0A 4L15A 1HI9A 3H65A 4ZJPA 1NJ5A 1L1EA 1MAHA 1MRSA 2GILA 2A9PA 1W8IA 2HM7A 2QM0A 1I30A 1MABA 2BMVA 3NKVA 4OY3A 5DEIA 5KCZA 1I6MA 2Y6VA 2FUNB 1X94A 3KT3A 1N2GA 3R9WA 3K1AB 2QRNA 3AHHA 3K6RA 4XOUA 3E3OA 1CG6A 1TUGA 3EUAA 1SXJC 3B1JA 2H1CA 3D1JA 3LV8A 3NV7A 3EF1A 5FFNA 2AJDA 2RBGA 2EP5A 1VRVA 4FOPA 1K8YB 1EJBA 4IIEA 3HSKA 4WOCA 1WOYA 4URVR 2PG3A 1EZZA 2PS3A 4FM9A 5I3ZA 1S2LA 1RKXA 1VGQA 3BK1A 3U3JA 1SQ5A 3U4CA 2OFWA 3L7AA 3PJGA 1VJGA 3QQ5A 2H4WA 4MUAA 3D8HA 3BHMA 1DJNA 3FTCA 1P4AA 1ZLYA 1Q0QA 4UBMA 4BNKA 4HDNA 3KT8A 5CFOA 3B2NA 2JCGA 3R6TA 5JNVA 2B25A 2H5EA 4D9JA 2DHCA 3HO1A 5E1DA 6Q21A 3AIOA 2R66A 1SRQA 5TQ0A 5B1HA 1Z7GA 5LB4A 2R4QA 3VBCA 3FUXA 2CF6A 3T9CA 2VG8A 3W6ZA 4RCYA 3L7JA 1J42A 2PRYA 2CNWA 4RAQA 4OHVA 4YDRA 5DGIA 1Q84A 3AQIA 4ZANA 1CFJA 2QQEA 4BU0A 1BS2A 4BKUA 2I7XA 4XFJA 3GJ6A 5F1YA 2J67A 1LH0A 2WWIA 5KX5B 3UC9A 1VIVA 2EKPA 4X20B 3EIEA 2MU1A 3BYZA 4DE5A 1R0ZA 1IEWA 1FVXA 5IN4A 3SNKA 2EP8A 4U3JB 4MV3A 2XD4A 1FUYB 2EFCB 1GCIA 1W0JD 3BL5A 3ADOA 4OD0A 4B7ZA 4BFLA 3SDSA 4QDKA 4QJIA 3WA6A 3FFWA 2JD0A 1ZW6A 3DWFA 1M67A 3KTOA 4DWWA 3SIPA 1MO2A 1Z5OA 1N2OA 5E38A 1XTTA 2P4QA 2C54A 3CW9A 3EY4A 1ISIA 1WVGA 1L8XA 1B41A 2QW8A 3FKJA 1J1UA 3EXG1 3P32A 1FU7A 4Q37A 3S1LA 2ZI7A 3WK7A 4DDVA 1IXRC 1NVTA 1NVBA 1PYDA 1ZS9A 2EYQA 1S2IA 1DUSA 1W2HA 3RKRA 5DCUA 5LMNB 1QQAA 4EKYA 1OVMA 3JARB 3BWDD 3U80A 4DLUA 3WAGA 2R8BA 2XRFA 5HIMA 4DNQA 2VSXA 5AVRA 4EZEA 4TYNA 3RIMA 1WCWA 3AVUA 1WDTA 3MWDA 5CDFE 4II7A 1WZNA 4DV4B 2ZJ4A 3FN4A 1AC5A 2W2PA 1P5HA 1AF7A 1RAGA 3E53A 3WWYA 3PLRA 1QVAA 1RS0A 1WQ1R 1XRPA 4AMVA 5LN1A 4H4CA 4JY7A 2P1DA 1L6IA 3IUSA 4ACAA 2EXXA 1XRNA 4HEA6 2PJDA 4ZAZA 5BW8A 1J5XA 3LUCA 3EXHA 3F3KA 1TYAE 2DBZA 1H93A 4M8SA 3U39A 3VYRB 3PJRA 2HQOA 1AQUA 3TMKA 4HGZA 4Q4CA 2OCKA 3EXIB 1OAOA 4COOA 1JALA 2VVTA 3PX3A 5EGNA 3TIFA 3I6BA 3NGXA 5CVCA 3L0YA 4CCAA 3WI7A 5BV0A 5K0NA 3G2OA 9ATCA 5C9ZA 3IKJA 1U2QA 1A27A 2AF4C 4JQZA 2OD7A 3SYTA 1F2VA 1P9LA 2BR3A 2QRLA 5BUQA 3EC2A 3GWZA 5LQRA 1RLMA 2RJOA 5D8DA 1F1JA 2D3TA 3BIXA 2Y6UA 2HHHB 1VPDA 1YZTA 1LPBB 1D6NA 2IL1A 1FMLA 4KE9A 3O8CA 4J9UE 3HY6A 4I9HA 4MCJA 2I99A 1WUIS 2PL3A 1ZUNA 3KJZA 3QU4A 3PGLA 1G9XA 1MKYA 3HDYA 3E9EA 3I2HA 5F9MA 3FHJA 4L73A 5DCYA 4JT9A 4GH5A 2ODTX 1DJMA 4XWTA 4G9EA 1XYGA 1HZZA 4FIZA 1SXJE 1PR3A 1SBIA 221PA 4ZARA 3W2GA 1E2UA 1I6WA 4OGGA 3M9XA 3CKKA 2FRDA 4WQMA 4C4AA 1PU2A 4D9BA 2WWHA 3HUFA 2CE7A 4A7PA 1G8FA 3UN1A 4JOSA 2XKJE 4K6FA 4NULA 2B3DA 4HVTA 3LT1A 4MW7A 4QYWA 5BQFA 4BO7A 1JQJC 1UBMS 4CV2A 2C2ZA 3RRFA 4TROA 2GVDC 3D5QA 1IUOA 3HNPA 5JASA 4QBHA 5JNWA 2Y71A 3TNYA 5FF9A 3T7KA 4LK2A 4WBXC 4X1KB 3GROA 2CNNA 4IJMA 1XKLA 2FPPB 1OX5A 1ZEJA 4M98A 4AZWA 3PFBA 1U9IA 2JPDA 1EFDN 4E7OA 1F1BA 1R6UA 2XY4A 5IEBA 2R7LA 3G2MA 4FWIB 3ZVKA 2BGMA 5JBNA 3E3NA 2JCBA 4PPYA 5LD2C 3QKSA 2PUEA 2C98A 1IZ0A 5FWYB 2B0JA 1FQWA 2F62A 3T61A 1SEVA 3ZQKA 3ODGA 4UAJA 3SFZA 2FOIA 1GUYA 1P60A 4D5GA 1I10A 4QRDA 3OPVA 3HR7A 3KO8A 3OUUA 3QU7A 4QLAA 4FB5A 2OK7A 4GMFA 3T9DA 1C7RA 3LG2A 3P20A 3QITA 3KYBA 2ON6A 3CURA 3ROKA 1A04A 4M7PA 4HDSB 1EUQA 4FE7A 1T9BA 1SUBA 1UMDA 2G9RA 4MV1A 1PK9A 3S99A 1XCJA 1E77A 2DULA 4PFQA 4HVCA 5HBRA 4JZYA 1KQFA 3KBBA 3HCWA 4R51A 2PUVA 4RU1A 4OEHA 3SNHA 3D8BA 3IIJA 3NM4A 3DZJA 4H0CA 2GAOA 2YY7A 3AFMA 4HRYA 4PC1A 2GBLA 3QTLA 2O8BA 1EQUA 3AVQA 4QYSA 4ZCLA 1CVLA 4KAAA 2X4DA 3O1JC 5AVXA 4O63O 3GXBA 3PYMA 2HT1A 3AHFA 4CM5A 1C9EA 2QJOA 2R2AA 1PJCA 2X13A 3V1YA 3TZBA 2ZXEA 4O0LA 3ZC3A 4QVKA 4CUZA 3SP1A 2JIDA 2NU7B 3UPDA 2ZYAA 4ND8A 4CM4A 1TQDA 1T1EA 4YLGA 3RYHA 3I8OA 3EVEA 1Y8QA 4FBLA 4N6NA 5JU6A 2WJYA 2C00A 1BW9B 1DWPA 3O7MA 1YOBA 1R1DA 3C41J 5BSMA 3PXUA 4B6PA 3B12A 3FDXA 3LC2O 1U2GC 3ZD6A 1A72A 4YUWA 1O97D 2VPXA 3T41A 5BNTA 1BMTA 4QUEA 3P9IA 1T6NA 2Z4SA 2PPVA 2IU4A 4R7GA 3D4BA 4UZSA 2W0MA 3S7ZA 1SCUA 2O8FB 1R2QA 2FSFA 1ES9A 3PQ8A 2WILA 2DEUA 2VSFA 3Q3EA 1JS1X 2H06A 2WM3A 2X3UA 4IZOA 1WNFA 4TSRA 1QH1A 1L5ZA 2F90A 1ISFA 2W6JD 2H29A 3IDQA 4NV3A 4IOJA 2CF5A 1XMPA 3AB8A 1CSEE 3AVPA 3K8QA 5JWHA 1USGA 1WZEA 2X19A 4JGBA 3WIBA 2AMFA 1QC5A 3EVDA 2CLFB 3AEXA 1SC6A 2MMGA 4Q4JA 3AOEA 1T5IA 2HI0A 3CNOA 5LNK1 2YOHA 4OQLA 2NUAB 4ND5A 3VAZA 3I0MA 1SFRA 4ETNA 4LZAA 5BT9A 1NUHA 3VR1A 3CHYA 3QTTA 3T7RA 4YDQA 2LUOA 2FQYA 1IFXA 4WGFA 1AKVA 3T1YB 3ILYA 4D26A 4EUHA 4MVJE 4OLAA 3KNZA 1JAIA 3PDIB 5G0SA 2ID4A 3BTUA 5COAA 2WJZB 1U2GA 4LOKA 3WKCA 1J5EB 4AKEA 2Q5HA 1UOEA 1RCFA 3G89A 5ALLA 1TKAA 1NVVQ 4U1RA 3BWEA 1ZUNB 4ON9A 1XZHA 1IAVA 5AKXA 4F3NA 2VBIA 3IE1A 2H2GA 2ZRAA 1SUCA 2Y27A 1RFGE 2ZETA 4PRZA 4E15A 2OCGA 3RO7A 1GGKA 1Y0BA 2OESA 3A0RB 3MS7A 4KN5A 4L75A 2H8KA 1Y8RA 2HOQA 1H85A 5B53A 3RVOA 3WDMA 4AWBA 4Z49A 2CLCX 4JI7B 3H87A 2LWIA 4PO8A 3GEDA 4TXHA 1EG7A 1TK2A 1TAGA 3K5HA 4OL0A 3T3EA 1VCIA 3HDHA 2V45A 2WMOB 1ZH8A 2Q4DA 3P9KA 1P7WA 4TV9F 4N4AA 4AJ9A 2R8ZA 1JR3E 1FFEA 4YV2A 5JR3A 4JYZA 1GNTA 4B48A 2HX1A 5BNIA 1VMEA 4GECA 2YXNA 1OX6A 3U7RA 1I9CA 3U3RA 1YU6A 4AZ0B 1Q22A 3K9CA 3KHKA 3BA1A 5HWSA 1W75A 3CSSA 1J2EA 3L4SO 2VDRB 3VO9A 4RHXA 1E0JA 1TM1E 2P9QA 1VMAA 5FUVA 2WSLA 4EELA 4NBWA 3GFRA 4RQBA 3Q0TA 1X7XB 2GEKA 4JMPA 3CZMA 3UF0A 1C8KA 4YHBA 5IULC 3QU2A 5AHRA 3JYQA 4KDFA 2VWHA 4HLNA 4II3A 3IP5A 3O8OA 3PD1A 2ZKIA 5IDYA 4BVBA 1DXQA 1L5HB 5CLQA 1JHUA 4IL5A 4WOPA 7REQA 4ND1A 4WV3A 4GZMA 4IVRA 3F96A 1QXSA 5COBA 2MOKA 3K05A 4DLAA 5IJ0A 3L0OA 3WQBA 3I42A 4NAHA 3C3MA 4FZVA 1APBA 2EC5A 3WLPA 1JSRA 4ZREA 2EZTA 6ADHA 1H8ED 1HYGA 1UBTS 2OQVA 2MSEB 3QP9A 2ZBGA 3KVNA 4GRAA 1ZCBA 5E1BA 3CF4G 3AK4A 4BEBA 1G9TA 3ZDDA 4F4DA 5JNLA 2PFSA 5EEHA 4ECEA 2IU6A 2NTYC 2V59A 1R9JA 2WWFA 2EHDA 1D2NA 1DV2A 2H18A 1B74A 1OFUA 2J0UA 3MWLA 4GZLA 4HEA1 3V2UA 2HEGA 3KU1A 4K9KA 4UNQA 4DDWA 4U7JA 3C7TA 4ZGWA 4QELA 1Q3HA 4R41A 4UCQA 3FJOA 5LOVF 2D62A 3TOCA 3ESRA 2XWBF 2IYWA 5BQPA 3OMXA 1PIWA 4ZAWA 1RKBA 3EIOA 1U8YA 3AF4A 3HI6A 2MJLA 4RGBA 3D3WA 4C4TA 3HN6A 2I29A 4NKRA 3IALA 2O1SA 4H60A 2WINI 4UDNA 3R6DA 1EHCA 2GPTA 3B6IA 3GL9A 3KLMX 3R3SA 2FPSA 3WICA 1B0PA 1FNNA 2J3LA 4X7BA 5DTQA 3ZXUB 4P38A 4PWZA 3WMFA 4R16A 2GMWA 4REQA 1YZGA 3RVNA 2YVAA 3HP4A 1YDMA 4R0NA 1R0SA 4ZAXA 4ER3A 1TMGE 3SJ7A 1TJYA 2FZCA 2I4OA 4KMSA 2DWPA 4US2R 2D5LA 1E3DA 1JV2B 1KDZA 1RP1A 4TLBA 2QTBA 3SN6A 1YTUA 1BHO1 1U0JA 2YWEA 5KHLB 1SWWA 4MP6A 2HJGA 1OFHA 4OKNA 5EXTA 2QEQA 1Z6AA 4W7SA 5TMPA 4YV0A 3TEJA 1HG0A 4RTKA 3GGOA 3O95A 3Q7IA 2C57A 1I0IA 4YDSA 1T5BA 3I9FA 3MJCA 2BGTA 2PKWA 4IJVA 4MRSA 1S0UA 4QC2A 3EGOA 5LP6B 2QJTA 2P5TB 3GZNB 3TQHA 2FK8A 1G5HA 1SKYB 2W83A 3EASA 5IKEA 1IN1A 4IGAA 1FDSA 2G3YA 2XYPA 3LPLA 5KVSA 2J31A 3OH8A 3MT9A 4LRUA 4FYMA 1B1CA 2IYAA 3RC8A 2QN2A 2XQFA 2WUVA 5JVDF 1JMYA 1E3IA 2P6RA 3QG1A 4PO1A 2R00C 3DV2A 5THQA 2FPPA 3U9TA 4HQRA 1ZD9A 2YW2A 4IVPA 4MQFB 4U00A 1QRUA 4HD8A 2UUPA 4A1OA 4NJOA 3DLCA 5CA1A 1WAMA 4GQIA 4F3KA 2PYZA 1VCNA 5A3VA 1Y3CE 1JEDA 2GEBA 2NTNA 3FVTA 4Y2UA 1K9SA 4RGQA 4C2UA 2OHVA 4LWOA 4K9QA 3ADCA 1HDIA 2QP3A 3EQ2A 3VA7A 4QL3A 1I3OA 1E69A 3C7DB 1I6LA 3JWGA 3CIOA 1CIJA 1NQAO 1R0CA 1J8QA 5FPYA 5C1IA 4U4AA 3ZHXA 1ZD1A 3NO4A 2WWTA 3VHLB 1QG0A 1U2EA 1Z2OX 2VCYA 1MC4A 1R4MA 4MI9A 4DCCA 3TKAA 1BMDA 3PYXA 3ZEAA 4IYJA 4ZT2A 3K0SA 2EX4A 3NONA 2QZSA 3SX0A 1FPMA 2BF7A 2E82A 2ZPTX 1R5JA 5AIAA 4D9FA 2XQIA 4G41A 2WF5A 2BSAA 2GZ3A 2CJXA 3PUJA 1GV1A 3WNDA 3JQRA 5ADWA 1GGMA 5CK5A 5I8WA 3OZRA 3NLLA 1FVOA 1DX6A 1QDEA 1MJGA 4INPA 2G8LA 2X0FA 3IXLA 2OFOA 1FU4A 2WUWE 3D5EA 2NU7A 2W93A 5HRAA 2RHOA 2RAFA 4MKRA 1X14A 4GSYA 3O1IC 2YH2A 3O75A 4KVZA 1OTXA 2JHGA 1XPJA 2WKSA 4LJAA 3CX8A 1RYFA 3E84A 3NHBA 3OLWA 1EE1A 1DIGA 4WCDA 1UBNA 4Z7JA 4QFMA 1JBQA 1LNSA 4FCTA 4DIEA 2QRHA 2FFJA 1LVGA 3I73A 1QGYA 4R68A 2M6KA 3VZCA 3MB8A 1L4UA 5JRDS 4P54A 2XNDD 4HLCA 3BGSA 1JL3A 2DHRA 1AK2A 4M0DA 4X85A 4NZPA 4BV3A 3K0HA 4NABA 4AJJA 1U2PA 2DUJA 4DJ5X 2YV3A 3QMVA 2QV0A 1CRLA 1ORRA 3QKIA 4FMCF 2D1TA 4Y1RA 3C39A 2M1XA 4BCCA 1AUPA 3DNMA 4Q3LA 5FTMA 5H9WA 5F64A 3UHOA 4XJTA 5J4HA 4O4LB 4JJFA 1QX3A 5JO9A 1LRLA 1RT9A 3PDHA 1W47A 4L5CA 2BKUA 3RYHB 4IINA 4BLSA 1VKHA 4MYHA 4RANA 4X61A 4EBFA 4QGFA 5LLSA 4E07A 3D4PA 1WKBA 5EZQA 1SVSA 2ISCA 1A98A 2PCJA 3I4FA 2BFDA 4I9NA 3WP1B 3RS4A 1VFPA 1Z73A 2ACVA 2FJ0A 1ECCA 1U7UA 3NFRA 4TTIA 2V98A 1ZU4A 1VCOA 3ZWPA 1G8JA 4XWOA 4C0BA 1B0AA 3JZMA 2E49A 8LDHA 1ZH6A 3ZZTA 1PTJC 1BFKA 3MAAC 3WS7A 1GGHA 4KFSA 1Q3KA 3LY9A 4D25A 4ZT4A 1ZK3A 2VBCA 3IFSA 1D8AA 1WU7A 3DDCA 1YAJA 2JFOA 2R8OA 3TMAA 3W8RA 3FMOB 1Y9DA 3USES 2QX8A 4TWZA 3T7DA 5B64A 4TLMB 2JHCA 1EXVA 2QMQA 1JE1A 4Q1EA 5JZVA 2OZLA 3LDGA 2HPAA 2I7TA 1PRYA 2XVZA 1V37A 1QH0A 1KK0A 1UBGA 3J81A 2GXAA 2G71A 3QHQA 5JJBA 1T91A 1JJBA 2HWUA 1I7SB 2O48X 4GI3A 1GTSA 1D1PA 1UK6A 4BQRA 4YS6A 4ROSA 2O05A 3TL2A 1Q1NA 3A1EA 5BVHA 1IWPB 2YWJA 3F8WA 1RRMA 4ZYXA 3MWJA 3VDMA 4RABA 3WRXC 3UWKA 1D6SA 1GFWA 3WK5A 3GT4A 3UOGA 1YJAA 4E2ZA 4Z0PA 1G1AA 3ROPA 1LCIA 1QIGA 4RK7A 5LSAA 4TYQA 2F9MA 3O3MB 4QFDA 2AEFA 3RROA 2QRVA 1O3YA 4F9GA 2FWRA 4O1HA 3M6VA 4WFIA 1D6MA 1A82A 2BGKA 1WDMA 3UMSA 3TUJC 2XDAA 2P3OA 2YIVX 5CNIA 5AW3A 4BXOB 4EMUA 5HRCA 1NE2A 2ZJ7A 4UBNA 1TT7A 4OK6A 1MO3A 3U4HA 5J2TF 3TJMA 4WFKA 4YP1A 3JQFC 1ZD3A 4GW3A 1SUEA 1YJQA 3ZW9A 1S4MA 1FTGA 3ELBA 3KKNA 3NC0C 2Z09A 3IAUA 2JI8A 4G2TA 2VH2A 2VHJA 1Z07A 4N5DA 4O5AA 3O4HA 2WHPB 2X8AA 3RG8A 3H04A 3VPXA 5JFGA 1QKIA 2F7SA 2PFGA 5DULA 1XI2A 4P86A 2BP7A 4U6SA 1N8NA 2IT1A 1OY1A 2EL9A 4E1BA 4JJ4A 4F0JA 4REMA 4MKFA 4G5XA 2XUIA 2A1TR 2FQ1A 4Q7EA 1YNSA 4JBIA 3RVRA 4U2BA 4NWIA 3LC7O 3O90A 4BFZA 2P75A 1Z62A 2PQ6A 2RFLA 3C3KA 1ZH4A 1WKVA 3N8IA 1R3DA 1U7OA 1FYEA 1YHYA 2GPWA 1E1QD 1WIWA 3LVBA 4IMJB 4TMYA 3TL6A 5K3EA 5KJCA 3CUUA 5L9AA 3LUDA 4FWBA 2ZWOA 1GEGA 3F4LA 4P35A 4RVNA 1Y82A 3OECA 4M9UA 2RD2A 3OQ1A 4D74A 1QX4A 3BRQA 2Q7DA 1T6XA 5A4AA 2VYNA 4O02B 2RHRA 3FVVA 3NTLA 4HAZA 3V34A 4EENA 2GLTA 4F84A 4K1XA 4PLPA 4UTOA 1E7RA 2PTGA 4HATA 4MA5A 4OYLA 1QRDA 3GEHA 3NWEA 1ZZGA 4HGNA 4GP9A 1W96A 3OM1A 1J0DA 1P7YA 5AJYA 2DB3A 4L3WA 2Q3HA 3B3QA 1B3RA 1C3OB 2NSYA 4CMIB 5KSOA 3AUUA 1MORA 4QGAA 5BPHA 5KYGA 5L4SA 4LJKA 3TINA 2GVZC 1DRUA 4K8RB 4NPCA 1UBKS 5T7BA 3HLKA 3KAQA 4QGHA 3QUAA 4MP3A 2QU8A 3KUKA 1TVKA 3HFRA 3OOHA 3OWHA 1QRSA 1R8JA 3OJFA 1E7WA 3SAJA 2DBQA 3WR5A 1LD3A 4PSDA 5JYCA 5ED0A 1E1CB 3IX7A 1XL0A 2NU8A 1SVUA 2KYRA 4DMRA 2GN8A 3JQQA 2X2FA 1ZN7A 4AJNA 1GLNA 1K7SN 2KWIA 1X9GA 4GT1A 4K6KA 1KYZA 2B6HA 2XGMA 3B13B 4KDCA 2DERA 3LKVA 2MT9A 3ACCA 3LQ1A 3UAXA 3E81A 4BO8A 5JCJD 2FA9A 3U09A 4BTLA 3ZK7A 1LJUA 4Q7LA 2MSLA 2P6MA 2ALJA 2VP9A 4EB0A 1QS0A 4LBWA 3WY9A 1A9YA 1JU3A 3KDAA 4H3KB 1VFNA 4AZSA 1QIIA 1QO0D 2MYNA 3ENVA 3MT7A 3QBDA 4RACA 2QG4A 4RVGA 5LQAA 4Y6OA 2QTNA 2ZRIA 4BIMA 4L8FA 3DW1X 2NZXA 4JS0A 4A8JA 1OH6A 4PZYA 3AUFA 2VS1A 5AKYA 4FZJA 3VHQA 1U3WA 3PQ4A 2IZ6A 2JFBA 5GPBA 1XJ0A 2ZP1A 4DCGA 1ZOIA 1HT0A 3AIKA 4MMZB 1BFUA 4AJKA 4M9QA 4EB6B 3K1YA 5AFSA 3H97A 5FQNA 2HIGA 1Y6ZA 3PC8C 4Z99A 5D3KA 2AG0A 3FF4A 1SZDA 4OXKA 4XLLA 2J7PA 4C0XA 5KX5F 4Q05A 2XX3A 2EW1A 1OIXA 2EFEB 3A4VA 2OCAA 3FWYA 1HRKA 1I0ZA 2GFQA 2IEAA 4ENTA 3O1HB 1JKIA 1R66A 4MV6A 5FJIA 2OA0A 3OE7A 3UMBA 5IEJA 3Q2KA 4JLBA 5LKAA 2XODA 2NZJA 2WQ6A 3A1VA 2B92A 1NIPA 3WXBA 1PJ3A 1FNMA 2NNWB 3DPIA 1O6FA 3N0RA 5G1PA 3PUZA 5PNTA 1SOWA 1NRWA 2QLJA 3HG7A 4F9FA 3U7FB 1PFUA 4YXWA 3RPEA 5FBRB 2ARKA 3IVCA 2IIQA 2BDUA 5JZBA 2C96A 5LXTA 4CL8A 1GSAA 3GMIA 4GZ3A 4NI5A 4PINA 2PKEA 2XA9A 1JBEA 3S2ZA 3SQOA 4CMHA 1TGVA 2QUHA 3W8FA 4F04A 4M46A 1JW9B 2ZITA 2QR5A 3CW2A 3RK0A 3R7WA 2NAPA 1C7FA 2DTXA 1D1TA 4KLCA 5H3LA 4Z54A 5IDQA 4QGSA 3G49A 2IFTA 1V3UA 1HKHA 3U1BA 4UMEA 1UZLA 4Z4GA 3E7WA 4EHIA 5KHAA 4NH0A 2ZATA 4D1YA 5F98A 4GM0A 1XTBA 1OGIA 3TR0A 5CTJA 2PL9A 1YOVB 2NTVA 3FGZA 2IF2A 3HBFA 2APJA 1R0RE 1WU8A 1X1EA 3DULA 4U2CA 5EJFA 1WUTA 1U28C 3DF9A 2RARA 4RSGA 4YX9A 5K4HA 4IHJA 3IR5A 3TDMA 5DM1A 5AM0A 1N2EA 3VR5H 4QTXA 5AUQA 1VTKA 2PHZA 2ZRQA 3PQ3A 4FEYA 4UASA 1QE0A 3KS9A 4BO0A 5KTTA 2WKWA 2ZE7A 3QF4B 3QXGA 2BI7A 1E79D 4QU0A 4TTJA 4KIJA 5JTUA 2BTQB 3HO6A 4BQIA 3FDFA 4IZ6A 4UE3S 4NBUA 1C1XA 1NWCA 4YP6A 3K31A 2E55A 1KYVA 1YR8A 1P0PA 1P39A 1NX6A 2C59A 2RHDA 3AJRA 3HBMA 3TD9A 3FNRA 5KEIA 3GLHA 1JIQA 4G4JA 2FH5B 2VPYA 3TTSA 3RYCB 3AVWA 3C8ZA 2BEWB 4BGEA 4MA0A 2P67A 4GI2A 1J00A 2PKCA 1E66A 3D9QX 5T3YA 1UZMA 5SZKB 5KO2A 1SBTA 3KLBA 2B8WA 4JSRA 5A9TA 1OHHA 2HQ1A 3CE6A 1L5HA 3GDOA 3WBJA 2Q4RA 1JLLA 1V1RB 2JDIA 3H5IA 1Y4AE 4UQOA 3MMNA 4X3CA 3Q9LA 4K6HA 4XD2A 2BPOA 1VI5A 1NYQA 4BNNA 2YW9A 1QLHA 2NG1A 3SX2A 3QEBZ 3QWHA 1Q0TA 5JCPA 1FMJA 3RWOA 4UULA 2GS9A 3K0KA 4EZBA 4MDHA 6AT1A 2XJ4A 1FFCA 5AP9A 2PR7A 5BYBA 4IIGA 3RT7A 1X86B 4YI3A 1U7WA 2YRXA 3EFOA 3N2GA 5A5GA 1L5YA 2VUSA 3MLAA 2H54A 3R24A 4W5HA 4ZT3A 4ZI3A 2V9ZA 3OCWA 4DV6B 3ESDA 2OAQ1 3RVPA 2FR0A 3RTBA 2FQQA 2C2BA 5EPUA 3AEYA 3AG5A 2CUKA 2FEMA 2HD4A 4AYXA 1K06A 1LWOA 4KQ6A 3IVXA 1VGVA 2O1EA 3CLTD 4UMFA 1Q17A 3CVXA 2FMUA 4XUCA 1LDNA 2IODA 2MDTA 3HKEB 3RG2A 2P4SA 2JGDA 2O52A 5EC8A 3RK1A 3L0DA 1FDOA 3T6KA 2W6IA 2YVLA 3A1TA 4BTEA 4DNFA 2OHIA 2OV2A 4B6GA 3CTPA 5EP4A 2Z6QA 1IY1A 2E4AA 1M2GA 4YQZA 4NVRA 1S1CA 4O3FA 5HR5A 3SLGA 3UQZA 2COUA 4A2CA 1EEXB 4N18A 1NF2A 1K7EB 1TPYA 1HQYE 4UAGA 1RI1A 3TCKA 1JR3A 4EG5A 3WK8A 4B3IA 5ALIA 1MVNA 1O6CA 2OZLB 3ZQUA 2QVCA 5CXQA 2Z8YM 3W2EA 3GEEA 2HRRA 2CY0A 3P19A 3U37A 3HCNA 2JZOA 3ILSA 3QM1A 4WXHA 4N5NA 4JUFA 2JLQA 2NXJA 1PS8A 1VP9A 4UNIA 1B93A 1KAEA 1EX9A 1AUQA 4GYJA 3CUYA 4HTAA 3IP3A 3IDFA 4DSOA 3K6SA 4AZ3A 1QWOA 1D2RA 3SHOA 3KAJA 4L4SA 3WGGA 5AKEA 1WF3A 3CINA 3VYUB 1PJAA 2H4XA 3R4VA 2AB0A 3Q3CA 4C1BA 2ZAIA 4X8LA 5JXIA 4NLLA 3K2QA 1W2WB 3DOJA 2P30A 3GIWA 4C0QC 1E4VA 2FE4A 2R6GA 4BJ6A 1BQ3A 1JKJA 4OHYA 3ONWA 3GG2A 3S2UA 3BRCA 1R6XA 5CDTA 2Q6TA 4EJ2A 1RRCA 3T1VA 3QSGA 4RIHA 1CLUA 4HPXB 2Q1WA 1CLEA 3N0WA 2XV1A 4GOXA 4EHDA 1XXLA 3M6XA 4OB6A 4C0LA 5DSXA 2VPTA 4F1WA 1IPEA 2G25A 4BMDA 2P6OA 2A0WA 4Z7OB 4GOMD 3ITKA 4NJMB 3FOFC 1QQ6A 2VF8A 2ES4A 4FNMA 1KEVA 5IJ9A 4LF9B 2F64A 4PNZA 3TLBA 3OPYB 1E2KA 3CZAA 4II2A 3QLUA 1H2WA 3DB1A 2YIDA 4ZTZB 1KE1A 3V46A 4HDNB 4R7TA 3Q6MA 1DCKA 2Q5OA 4TYPA 2YYYA 2J9RA 4BZXA 1RMTA 3ZIUA 1T0HB 1Y1TA 1ISHA 1H1LA 2OHGA 5L4NA 1WVIA 2JVKA 3R3XA 4Z1OA 5CT6A 4C76A 2V7QA 2I2AA 3GZ4A 4M22A 2WWYA 2KBEA 3WGKA 2QY6A 1W34A 5T5QA 3EISA 3UUEA 4C4SA 5IUNC 4INJA 4Q9AA 4CPDA 1D2EA 3THYA 2O23A 1ZNQO 2B7CA 3OQVA 4HGRA 4XPIA 1NI4B 4Y2PA 2C7GA 3JYOA 2VJLA 1P74A 9ABPA 1YE8A 1T0PA 4JL5A 3ZBPA 2VQSA 4MO2A 5L4LA 2HDHA 3KJEA 3WKAA 1XNRB 2VJKA 3T34A 2DR2A 4KI0A 4K3VA 3IUJA 1JSLA 4OATA 3B5IA 1X0VA 3A25A 4JBYA 4NE2A 5BMVB 1Y3IA 1X7YB 3R20A 1YF3A 4ARUA 4G23A 2QAGB 3KZCA 4ML3A 3V4FA 2B61A 4UXJA 3TS1A 2IS6A 2GWRA 3L1JA 1VLLA 3UJDA 2KW5A 3C3EA 1EWRA 4QNMA 1RRGA 3CEJA 3K94A 1LVHA 2EERA 2QORA 5EE3A 1ONPA 3BCRA 3KSDO 1TAQA 1K98A 3NDRA 4I55B 4QBGB 1OPRA 2RONA 4H4DA 2PT9A 4D8TA 2F43B 1XMJA 4HLDA 3WJ2A 1ZMBA 4LVNA 4XPZA 1KGDA 4FQ5A 1NJ8A 1G8PA 3PD7A 3VI4B 5I9LA 4AYTA 2JJ1D 4JOCA 2ZYTX 5A5FA 3BMOB 3HL0A 4NTZA 4JB3A 1IUNA 3ZQJA 3GLKA 3G9TA 2AD5A 3FZGA 3E8XA 5EL0A 1MHPA 2XVYA 4QE3A 1BJTA 4CM8B 3WLTA 4KU4A 4G07A 2HMAA 3ZHVA 1KU0A 3BAFA 1JLRA 3H86A 3Q2IA 2DWCA 1QTQA 3V4LA 3AKZA 1CJVC 2JBWA 4RLQA 1W4ZA 2PRJA 1V6SA 4D6YA 2FRVA 4MV0A 5C7OO 1UIRA 1YKGA 4QEDA 1E2PA 1QF7A 5IBRA 2GN2A 2HK9A 4YJFB 2JCXA 2ZJ3A 4FYPA 1GAEO 3DLIA 3E2IA 3RHSA 4BGDA 1KJQA 3EZYA 1ECFA 3OPYA 4XASA 2A4MA 5JS2A 1QFYA 2ZSHA 5CVVA 4C14A 4E12A 2PUDA 5G1OA 4Q4AB 3DCIA 3HYLA 1UP6A 3MGCA 3O9MA 3PRKE 2R25B 3SF0A 3VU3A 4DDMA 4I46A 3F5MA 4ALJA 2QS9A 3H13A 1R37A 1ZVKA 3U7QA 3QGMA 2QUBA 2OO3A 1PF7E 2JJ8A 3IT2A 3SZLA 2FPIA 3EMKA 5DCLA 4W5TA 4EUSA 2ZW9A 1W1IA 1R0LA 1YVEI 4XTCS 5HZKA 2XKKA 4P1ZA 3ZW8A 2CCKA 4V2UA 1NPTO 4NFYA 2EKZA 4MI3A 3LQQA 1XXHB 3L0PA 2V8BA 1ZL0A 1ZGZA 1CFZA 1I24A 2I1LA 2MYPA 3NTVA 3OIYA 4PWYA 4V1CA 3KQNA 4BQQA 2C77A 1XCMA 4B4OA 1GLGA 3NRBA 4OAOA 4TTRA 3N2ZB 2WSBA 4ARCA 3QW4B 4ZO6A 3GNQA 3AF6A 4H7FA 2V9PA 3F5SA 2ZQ5A 1O94D 1Q1ZA 4KN6A 2A92A 3KPUA 4B2YA 2L0XA 1X8KA 4HG2A 5JXWA 5EIBD 1FTWA 3T54A 1KDVA 2Z6AA 2X2PA 3K2BA 1I0LA 4S24A 4D79A 3VDRA 4HNUA 1P1RA 1KZ6A 2I3ZA 5IVIA 1MC5A 5H8WA 2F17A 3AL0C 4X95A 3A05A 1GZ7A 3DTVB 1U4NA 1QANA 2WKPA 4CEJB 3DLBA 4OHOA 3W79A 2YWCA 5FR2A 1MA3A 1U1CA 4IGKA 3SHVA 5FBVB 2W2XA 3UB4A 1HDOA 1GGJA 5L3ZA 1W9MA 5HP4A 3G7UA 3HWSA 1JQLB 2K7ZA 1MZPA 1E7MA 2Y0PA 1RYBA 1NURA 3FYHA 4R1MA 5CNMA 5DNUA 4P34A 3A9RA 5BWNA 1E9AA 1KY3A 2GZ2A 1USIA 2YJ4A 4LXXA 4MRPA 3U81A 3H6KA 3RWMB 1S2DA 1ADJA 4HQ6A 2IWHA 1U2RA 1NV9A 1U7HA 2AS0A 1K86A 2BDTA 4CTKA 5JJLA 2PZFA 4U3JA 5KWSA 2JK0A 3FIJA 3ETEA 1DBPA 3G79A 2ACKA 2VPIA 4KACA 4RV4A 2NZUG 2R97A 5F5LA 5KNLA 5ERXA 3QVMA 1MHTA 1XRJA 3UKOA 1A77A 2FZGA 2IYRA 3ADKA 4RADA 3D0OA 4ABYA 4HYYA 2GYWA 4EIWA 4HF7A 1AZWA 1Z22A 4OHZA 3QHPA 2DQZA 2JGAA 4PG7A 1K63A 5CUQA 1NWHA 1X7GA 4QVIA 5B1SA 3OFSA 1OXBB 1XDBA 2EL7A 1EAMA 3PNKA 1L5SA 2IXBA 5HDQA 1X0XA 2TECE 3WDLA 3KZXA 4IGFA 4LMPA 1BCRA 2JJQA 2PGNA 2FP4A 2D2FA 4QPJC 2E3JA 2Q2OA 3B3JA 3UFXB 1SPXA 4KPFC 3W5AA 4MS1A 2G1PA 5DOZA 4F6CA 5IC6A 4I5FA 5GOZA 1Z68A 4RHFA 2VAMA 4QJ5A 3RVLA 2QM8A 4CG1A 2GCGA 1IVSA 4FXPA 1MLDA 1X3LA 1JFRA 2ZDHA 4BB6A 2GEDA 3DJFA 4PR0A 2M9MA 3K5WA 4Y6RA 5ECWA 1T0UA 3EXEA 5SY9A 1VJDA 4RELA 2RCNA 1UFRA 3FMVA 5AK0A 3L5OA 4TSFA 1TE2A 1ZD4A 1R4AA 1XZ8A 3O74A 4Y8VA 2JAXA 4QKQA 2GI4A 1QOPB 1JQEA 3HH8A 3KEOA 3CUSA 2CNDA 4O29A 4LX0A 1L7DA 1OR8A 2Q6KA 3RS2A 3ZW7A 2QG9A 5DXFA 2CK3A 3Q3HA 1I2CA 3TRFA 2W43A 1S96A 3G1WA 2XSZA 4TXNA 1ESDA 2C1EA 3H11B 5C1PA 5GVSA 1CK4A 1N9KA 2QE6A 2BGIA 2P78A 2W11A 3GW8A 2O59A 3MLEA 2XDQA 5L3RA 1P5ZB 1G55A 1HQCA 5AYVA 2V5AA 1SVMA 4ESOA 4EYQA 2CB9A 5JAIA 1S8OA 4IFIA 1DAHA 2E6KA 1XD8A 4WAUA 9LDTA 1R6DA 1NRJB 2XSZD 1T2VA 4EJSC 1DCTA 5J9FA 1J5PA 3GVIA 2HK6A 2J41A 1N6KA 2FETA 4KNWA 5ARCA 4HH1A 2VK2A 1N5KA 1AQYA 1F4PA 1GZVA 1UFVA 3K6SB 2QPOA 1UOPA 4NBRA 4F2GA 4UHJA 2J09A 2ZG6A 3NHUA 5GP1A 3OLVA 4LYYA 2QHXA 4LV5B 5B5SA 5I8ZA 4YO7A 2OGTA 3OPYI 4GD3Q 3F73A 3NAMA 2JLUA 1CEQA 5HM8A 3OP4A 4UHHA 1TFRA 2VHQA 5CDYA 1PZXA 3THWB 3HJRA 4M8NE 3H4TA 3LSYA 4Y2GA 2ZR9A 1OWPA 2W2KB 5LDGA 3HYNA 4RMGA 4XEUA 4GZ6A 3TOZA 3NJ8A 2QA5A 4KHZA 4HO1X 1T8WA 1UT6A 3X1DA 4PPFA 3A1NA 3DVQX 3OICA 2JFUA 3I2JA 4Q1FA 2X1HA 2O2CA 4NYIR 3F0TA 3WYGA 5JYBA 2HMWA 3T5AA 4ERNA 5A2QA 1IIRA 1HYEA 2Y05A 4RMHA 4JXXA 1OH7A 5DM4A 1WPXA 4PQRA 3WV5A 1V5EA 2IZ5A 2GPSA 2C3YA 4P3OA 5YASA 2QTMA 4ZYTA 4E2YA 1B16A 3HDTA 4ER6A 1G59A 1TZ2A 1IM2A 1S02A 4QPZA 4YREA 5GGXA 1F12A 2BY4A 4XJVA 3VNUA 1O5IA 4QWMA 3VR0A 4Y2HA 1BWQA 2VF4X 3TZQA 3VTKA 5JT1A 4RVSA 5IZ4A 4KX5A 1W52X 1WZCA 1B8PA 5HE8A 1CHNA 2Q9CA 3ZD7A 1MPTA 2JFXA 4N7JA 2JGLA 4JDUA 2J6IA 4LSWA 3SYLA 4YUAA 3S40A 1ZWKA 4Q1AA 5C8ZA 2VFAA 4Z1MA 4HLUC 1U2DC 1GPDG 4LGCA 4TRMA 4IX1A 3RUCA 4N0EA 3LQRA 5LQCA 1UDXA 3IV7A 1VSTA 4C7KA 4N49A 4G1MB 5ALUA 1CZLA 5ED4A 2C8VA 2JGRA 1KPHA 5JSKA 3KJNA 2VSQA 5AVJA 2BMEA 3D43A 4MITA 4M8KA 2D0PB 4J0HA 1NOJA 2WPDD 1IATA 2XBUA 6LDHA 4ITRC 3RFTA 5SYAA 1Z4QA 4YJDA 4EI2A 1K97A 1KFJB 5JZSA 1OI4A 1IYZA 1E9VA 1KIMA 1PEYA 2BKXA 3MTIA 3RYIB 1IEVA 4IXNA 5JMPA 1WB5A 5FLEX 1SM4A 3AU8A 3RS7A 1C3LA 1GDHA 2YZNA 4HH3C 3LKDA 3FGOA 1VCHA 1SKBA 2B30A 3PC3A 2G9UA 4ND2A 4YJ2B 4G1UC 4N7MA 3LH5A 5H0IA 4NOKA 4ZZ2A 3ORSA 4BB0A 4MHSA 3ROGA 4ZYYA 1TECE 2EJWA 3ITNA 1GZ4A 1LU9A 3TD6A 3F49S 2OT3B 5BRJA 4EECA 5IHXA 4BUZA 3CVYA 4KR0A 1WDWB 3VC3A 3TG8A 2F9LA 4OLFA 2ZULA 2RK4A 16PKA 3AJAA 5JAQA 1YQDA 2NO7A 3FMGA 1Q74A 4NH4A 4XPIB 2X0KA 1ZESA 1CUUA 1TZBA 4XIGS 2HJWA 4Z53A 2HY7A 4NYJR 5JIBA 1UAYA 3SYRA 4JI2B 5DI9A 4HYEA 1PQYA 5ENDA 3UOAB 3ND8A 2LDBA 1EK6A 1LQUA 4GM4A 3LOQA 1O4VA 1UKAA 2VAPA 4MQEA 4ZIRB 1Y5MA 1Y3BE 1HFKA 3IUPA 3OU2A 4QRHA 2WRZA 5J1TB 3GJQA 3FYSA 1U5AA 3GJ7A 1RQ2A 2PAAA 3BE8A 1XRMA 4KBYA 5HEKA 3H8SA 4PR3A 1S7GA 1U3GA 1JA1A 2FSPA 3EXG2 5G02A 1VG8A 3O0TA 5JECA 2NV6A 3ZNPA 1N2CB 3A9SA 1DG1G 3KT0A 1PZNA 4AW9A 3RAEC 2IH4A 1SKMA 3TB4A 3ZXSA 4HUTA 2BM9A 2I6TA 2WTBA 4MWEA 4HAXA 3QBVA 4MLDA 4C3VA 1SG0A 2DYKA 5BSVA 1H1TA 2YC4C 3HI4A 3MPUA 4H3HB 2HRQA 4L74A 4R0VA 4CIDA 1XPRA 5HKAA 1Q7GA 1BGWA 1ZGJA 3C6MA 4NAUA 4PYMA 4MUEA 3SBOA 1II8A 4F21A 2ATCA 2JJ2D 5KWIA 2XBMA 4BZPA 2UV8A 3HZOA 2A58A 3PICA 3M6FA 3S2IA 4B0PA 3VOTA 1AN0A 1WM1A 3P2MA 4GPTA 4ZTBA 1EHIA 1B26A 3L2OB 4YMHA 5J23A 1X9HA 4AF7A 1H42A 2FPRA 2Q3FA 4N0QA 5DHFA 3Q5EA 4LXHA 4LXIA 4IUCS 3TWOA 2ZXUA 3AR7A 3MVEA 4E51A 2OQIA 4YLYA 2PMKA 1RKQA 3C1AA 2OYCA 4X1YB 2IXGA 3EYWA 3KELA 4M0EA 1JEYA 3U31A 3OD5A 2XTNA 2YY5A 4EUKA 1WMEA 2FEPA 2TSYB 4D0GA 4RJKA 3GGGA 2BKLA 3CMCO 4Q4AA 1YZLA 5M3BA 2HR1A 4V0LA 4IV0A 5EJ9A 3L8GA 1G3QA 5BV7A 5IYZB 5K45A 3RBVA 2PUAA 3A6HA 5FPTA 4WBNA 1GWNA 5IAOA 3R8XA 2IKSA 1U2ZA 3STXA 3HXPA 4BTVA 3I8XA 2OECA 3QFSA 3UH0A 1T10A 3P94A 5EMNA 1CP2A 1MV5A 1JQ3A 5BQ3A 3FLMA 3NIDB 2RGAA 1NW3A 2VPPA 4Z4IA 1NVEA 2FPGA 3UB2A 1KAGA 2VK4A 2QVZX 3LL7A 3QPAA 5I48A 5FA8A 1R50A 4RDHA 5E1OA 2ZIWB 1XMSA 1XZBA 4KQIA 1TCVA 2J3MA 3OBBA 4TXMA 3WMWA 1A7AA 1SBCA 4CF3A 3F90A 4XYGA 3T7EA 3RUAA 2Q3JA 3A7DA 3CG4A 1QHFA 2D6FA 3BXEA 3DSRA 4ZA2A 3NHFA 3TEFA 2DQKA 3IHLA 1FZQA 4KVAA 2Y1GA 4DBLE 3RYFA 1UPTA 2W2QA 3IXQA 4HYQA 4FWTA 4RIIA 1G21E 5DSZA 3L0BA 1TDJA 2CN1A 2XDWA 3HXLA 2Q3MA 3KJXA 3NPAA 3PNBA 4LPKA 1RXVA 5I7EA 4DA8A 3QXXA 3AFGA 3MTDA 1Z12A 4H18A 2VHUA 5EJ5A 1JDVA 2XZDA 5AOBA 8OHMA 1RTTA 4IKEA 2XRYA 5EIWA 3WBBA 1M1NB 2IU3A 5LPNA 2HF9A 1BOFA 2UZ1A 3EA4A 2IYSA 2BL4A 3IS3A 3JQCA 4TUYB 5HFNA 3DE0X 3HXKA 2XUGA 3FCOA 3ZZMA 1PT9A 1NBMA 2Z56A 4MKZA 4R83A 3FDJA 2ZRBA 1NXSA 4H1HA 1E2HA 2E6UX 1RPAA 2BIFA 4X00A 2NXCA 2C2WA 2GM9A 5BVGA 3GLIA 5JYDA 2C4HA 1YZFA 2YZ7A 3OLQA 3QWIA 1TVMA 4JUAA 1USWA 4AJOA 2YZMA 5F3RA 1A5TA 1VE5A 3HVJA 4UE2A 1DO0A 1PZGA 3DBRB 3EDOA 1WEHA 2PX4A 1RPNA 2C4WA 3H4MA 3ISVA 4JBNA 2FPLA 4OHFA 5TMBA 1XHEA 3B1WA 1SXJD 1VM6A 3B5EA 3FETA 2XD9A 2ZVJA 1COZA 2OHFA 1Z33A 2ZRDA 5E6SB 5K01A 3V2GA 5DCWA 3CVOA 3PWKA 1P1IA 2C9MA 2O2IA 4HN2A 4BJ1A 4BNDA 3L8HA 3FM9A 1A50B 4YV1A 1V39A 4IV8A 4MLZA 2NTEA 1EUDA 4M1MA 4TLDA 2H8GA 1XROA 5ANRB 2RGNA 5KI6A 2PL1A 4YRNA 2V6IA 1JSCA 2DPMA 2HPVA 3GRZA 3M5PA 1QH8A 3PUIA 2EJCA 1U8FO 4IQFA 5FTJA 4QOIA 1BDBA 1USKA 3AFIA 3GMDA 2Q8NA 3M6LA 3SJAA 4F12A 4KR3A 2RH4A 3K1ZA 4B3JA 2LP4Y 4BLTA 4OXXA 4QRIA 1DBRA 2WBLC 2VXCA 2GK6A 1PR9A 1BDMA 4NCJA 2BR5A 3BN3A 2FPGB 3FVQA 4DC1A 4YMVA 2J32A 1JPNA 4N47A 2ASEA 1CE8A 1EQAA 1H8HD 5EESA 1Q44A 5T8KC 1PN3A 2AW5A 4X64B 1YQEA 3LXXA 1Z7WA 3LHDA 1VG9B 1Z39A 3PFHA 4ZAGA 2VNSA 2ERXA 3GEGA 4LC9A 5K8IA 2G4VA 2R8EA 4B2IA 1JLHA 2IYEA 4Z7QB 4C06A 1JH9A 3HDVA 4TKMA 2DTDA 2FWNA 2NZWA 4XGQA 5AK3A 1XIVA 4JI4B 1RQGA 1ST3A 1U0RA 2AKAB 4D98A 1M10A 1F8YA 5M34A 3J80A 1VRCA 3ZU5A 3DO6A 3A06A 1VKZA 1VOTA 3NHLA 2IOFK 2YN4A 2R68A 3JD3A 5AM1A 1KQPA 2EDAA 1J0BA 2CFOA 2P3SA 3I04M 1EFVA 2F8LA 3PNLA 5JSZA 4AT1A 1AT1A 1J1IA 1Q14A 4EHNA 4MWGA 1IOWA 4IDNA 4WEQA 3KXKA 2I6GA 3JWPA 1PKXA 1G3UA 1XU4A 4GC5A 1KH3A 4C08A 2ZAMA 3JQGA 3LUHA 4NRDA 3L7YA 4X94A 3UICA 4PN7A 1SVIA 2FEXA 3L18A 4FC6A 4B3BA 5C51B 5EE0A 1GNSA 3GRFA 2O2ZA 2I2WA 4HDMA 3KFXA 5GY7A 3ZX5A 1C9YA 1U8EA 3N2YA 5AW0A 4D8YA 4C5AA 4LYAA 4DWOA 2P9JA 3B52X 3BORA 1N2SA 3QBTA 4RIEA 3SVLA 4Y18A 4HXEB 1OWNA 5F76A 2NVOA 4OV6B 1KXZA 2JHAA 3O4VA 1Y7LA 1EXWA 3VOSA 5JVDA 2YKGA 1HMYA 3WB2A 3H1AA 1PWZA 1ZXLA 4BMXA 3KKMA 4LNUB 2JBAB 2GK4A 4CZ2A 1PR6A 1CQPA 4WK6A 4BXOA 4N76A 4BJ5A 4FEAA 4GU5A 1UEJA 3ELDA 4MAFA 4EY5A 5EQDA 3K6KA 2E4YA 3ETLA 4HFMA 4CLOB 4JIMA 4YAEA 3E61A 1FQKA 1O1YA 1Q16A 2IY7A 3EE6A 4UEQA 3ZK9A 4F2HA 2I3GA 3LC0A 1YFJA 3L0ZA 5AI4A 3G8AA 4CM9D 5B30A 3N8GA 4R2KA 5AKHA 5EPEA 2ZJOA 3FXAA 1XLUA 5KYTA 3QJ5A 5DTJA 5E6RA 1ONSA 3K4QA 3BGIA 3R75A 4DXAA 4M86A 1ELOA 3L6CA 4PS1A 3UAYA 3PFGA 1NT2A 3IMKA 1M5UA 1E7SA 4L5YA 4KYTA 1VLJA 2H2IA 2PRKA 2HKIA 3ZR4B 1QAMA 4WADA 1W73A 1G20E 1XAJA 2YMMA 3LLCA 2XXAB 2X5NA 3JX9A 3OG9A 5JD4A 1QRTA 4MWZA 2PX0A 3GO4A 4C05A 2R7KA 3AUSA 3V1TC 4YJ2A 2JGNA 2R1ZA 1QP8A 2WP0A 3I6YA 2DCMA 2BBWA 4Y6LA 5ULLA 2WAYA 3S4YA 2B4YA 3CH7A 5FTKA 3V7UA 9MHTA 2FPMA 5C37A 1TZMA 1E9RA 4EH1A 3S44A 2IXEA 1F17A 1VE3A 1M8FA 2PT5A 4BVFA 2R751 4UHKA 4PV7A 3I5AA 1V43A 2A2ZA 2JBHA 3F78A 4FGSA 4EO9A 1MJHA 1EP2B 3MINA 4N6OA 5KQRA 3W77A 2JIPA 2N75A 3A3PA 5KOIA 2PPLA 2H4JA 2Q1XA 1I2BA 4G01B 1G2PA 1R0KA 1FRQA 2ZWAA 4Q9IA 2XRMA 5H70A 3QXJA 5GOTA 2DFTA 1VBKA 4DMCA 5DN6A 3ITDA 3CQ9A 3HU1A 4CLXA 2FZEA 2OFFA 4K6GA 4W5RA 2Z2IA 4QT0A 2ECKA 5HDBB 1E98A 2YYAA 1IK6A 3GP8A 4UHDA 1NBHA 3R23A 1EUYA 2GFIA 1U0GA 1UPCA 4QDXA 1JHRA 1XV5A 2FSSA 1XDGA 2P4UA 1K68A 5TB5A 1OBOA 3UHAA 3NDPA 4OJTA 3NVMB 4LY6A 2VHYA 3LBYA 1AOXA 3HFGA 4OMCA 4J03A 1GSOA 2Z9CA 2I03A 3HWRA 1ZG3A 1NYRA 1PG2A 1RWMA 5EZ6B 2P9BA 2VHXA 3RSOA 3VVBA 5EP3A 2LKCA 3RQSA 1YZVA 1UBRS 5LBUA 2GD2A 3Q3JB 2XLCA 3CNHA 2YIJA 2GKGA 5FBKA 3ABZA 4BX2A 2H1IA 5A2GA 2H4YA 1EZ4A 1XHFA 1W5TA 1M5RA 5ILQA 3SSOA 4KQXA 4CQNA 2AYYA 4H08A 4OH1A 1ZI8A 4TQGA 1A8IA 3EVGA 3OKAA 4HHEA 1UXOA 1N78A 2QD5A 4RXMA 3O82A 5BN5A 1RJEA 5G3ZA 3W4JA 2GF0A 4WASA 1LPNA 3FI9A 5FTNA 2WWGA 4U7TB 1E2NA 4I14A 1E3TA 2WSMA 3EEBA 1QNFA 5GADl 10MHA 1EMDA 4WESA 2EKBA 4GGOA 4R31A 3PPXA 4CLOA 1ZM3A 4J0FA 2II6A 2B7LA 2FYTA 3UJPA 5C7YA 2XOXA 5JQWA 1L4BA 1V1JA 2ZTVA 4GPBA 5FD8A 3VGPA 1RQPA 2DJIA 3CT6A 1IBMB 1TW2A 2G07A 2X42A 4JWTA 5ALWA 2A30A 2FPOA 1J22A 1V96A 3NX4A 1S8NA 3EUEA 3LBIA 1JJIA 4DNOA 4YRZA 4R2MA 4X7PA 1JDUA 4M1TA 3OA2A 5F12A 5IZCA 3IJ5A 4RWZA 3F3MA 4V0RA 3FA2A 4JVOA 2G4CA 4WUTA 4C2BA 5AHKA 5CIWA 2ODWA 2VNIA 5BQ5A 4C78A 4EF6A 1C0EA 3PG5A 4CTMA 1IC6A 4PFSA 3FX2A 4RH3A 5C34B 1KL7A 3PV0A 4YCMA 5ALVA 1TAUA 2HRCA 5I6DA 2FI1A 3FTPA 4QREA 4GVLA 2FDXA 4GVPA 3VR2A 2CBXA 3RVQA 2PVSA 3HSSA 4JLPA 3TNLA 1OXVA 1NM5A 2O7RA 2RIPA 4JUIA 3WLIA 1T9GS 1T5TA 1RKUA 3F47A 4DT1B 2YCBA 4LY0A 2QV7A 3ZK8A 4RCVA 4A6PA 1Z5ZA 2WZDA 3N0VA 2OQRA 4B4WA 4ZK6A 3ECAA 3LHIA 1QF9A 1LSUA 4QSHA 5AI8A 3V8QA 2GRUA 4DLKA 3JASA 3PUYA 3U4IA 1ZLXA 3H1TA 1N3YA 4P3XA 1TEVA 3QE3A 5JPDA 3PZRA 3FDZA 3ZEIA 4ZWNA 1QHYA 1HTBA 1QMPA 2JFNA 1DE0A 3CC8A 3ZIAA 1CUXA 2HT6A 3ZYZA 1V2GA 1BWSA 4PGAA 4A23A 3KKQA 2L82A 1FL9A 2ZCVA 2ZBFA 2MMCA 3QH4A 1NVKA 4DCVA 5BN4B 1EQ2A 2H6EA 4ND7A 1UK8A 1XRSB 3HL4A 2WKQA 4XB1A 5HCIA 1LDGA 1WXIA 2H08A 3U17A 5SICE 3U7JA 3LHSA 3COYA 3MCAA 4N7BA 4LRSB 3ONNA 3HJGA 1QP0A 4E13A 4HNAA 1TMOA 2CMHA 2ZTUA 1R27A 4P6VF 1X7WA 2QQ5A 4R4JA 4BNXA 4U39A 5AW4A 5G0UA 2C5SA 3GLHE 3H9CA 4JH0A 1E1KA 4XFKA 1FSZA 3W1EA 3T5BA 3WYCA 1R4NB 1Y4UA 1SKQA 2BD0A 4M87A 5KSPA 1O08A 3G2IA 3TQCA 1NUUA 3SSMA 4OIFA 5IKXA 2F3PA 2BMWA 5IW8A 4DILA 4AZ3B 4ESEA 5EXDA 3IMFA 2QVXX 3GQVA 4WFJA 3X1XA 1AO0A 2CNKA 3NM6B 2ZOSA 3HDGA 2ZI6A 2Q8PA 4PZPA 4BP1A 1FXUA 1CCWA 5ESXA 2BRUC 3D64A 3NBYC 4BMZA 4MW0A 1RJFA 2GA8A 2H3HA 3QVOA 2I8LA 2VDQB 2VPQA 3FSRA 3JPWA 4MV7A 3O3OB 2P2CA 2QY9A 3GARA 4J1TC 4QBTA 2ZB8A 4MJ3A 4ZVQA 5MFPA 1AF4A 1JG2A 2QN1A 3D7KA 1KYWA 1XK6A 4F6RB 1E18A 3RSHA 5E8RA 1NT4A 1A9QA 2FW7A 2YX1A 4BZWA 2CNWD 1P5JA 4M0UA 3DE1X 4RDIA 4DA9A 4ZK2A 4OTZA 3PNYA 5DIZA 3WLFA 3MXTA 4UOEA 1MB0A 3ETDA 2DTEA 1NXOA 3DEAA 5EJMA 1U0LA 1Y8QB 2IY8A 3STWA 2W42A 1R4ZA 4FCCA 5FO1A 1DMSA 2PBFA 4PYQA 1NI4A 4TV8F 4X6XA 3RDPA 3SQMA 2X4LA 4FBGA 4RLFA 4BQFA 4KIGA 4KP7A 2FLVA 4PYKA 4TPKA 1JZQA 1Q2UA 1KJNA 2NYVA 3GX1A 3I58A 4FHEA 4JQYA 4XTRA 4BX9A 1NUQA 2W6ZA 3AFNA 5K3CA 4X24A 4AG3A 1O9HA 4XGNA 1UAAA 4KWIA 3TAHA 5DI3A 5AO9A 3STTA 1P2GA 1TQ4A 1MOPA 4Y30A 4N65A 2RHWA 5EP1A 3FIUA 2WYOA 2ZB4A 2ZBEA 4YCLA 2HZBA 2GJKA 2BM1A 2J6CA 2Y1KA 4HWTA 3NIGB 1QTIA 1UL1X 1XTPA 2BM0A 1YA4A 4EY6A 1V2HE 5IJXA 1ULHA 4C6HA 4DS3A 3CXRA 3ONEA 3TCNA 3UV3A 4EF5A 1MJGM 1Y8RB 3DBRA 4YEDA 1BE1A 1UBSB 3ZDZB 2O50A 3V2IA 4QUAA 5DZSA 3VTFA 4AULA 5ISMA 3K1TA 1XPOA 4BQEA 4ZQGA 2HEIA 3L8YA 3GVPA 4LHYA 3GJ4A 2LZ0A 1DKRA 1UKCA 1E9CA 4MVJF 4B7UA 3AO0B 4ESVA 1F06A 5CH8A 1Z25A 2F3QA 5AW5A 4LN1A 2OCPA 2B5OA 1G2OA 1FXWF 2DR0A 2HK8A 3BMQB 3V4RA 4OLHA 3V1MA 4LF6B 2HRDA 4U02A 3OCJA 3SXUA 3MWGA 3M6IA 2QTLA 4P7JA 4QPCA 3SU8A 5LVAA 3TSWA 3L6DA 5B2EA 1NTRA 1IJKA 1WP4A 2FFQA 3L07A 2PSSA 3RYCA 2XQKA 2DBYA 2E87A 2CJFA 1JQ5A 1T2DA 2AN1A 2F67A 3LP6A 3NKFA 5EY5B 2JAHA 1Z47A 2FFAA 2JB9A 2MSCB 2QJFA 3R5XA 1JNYA 3NHZA 2I71A 5ESRA 2IGBA 1JT9A 5CT4A 4KWCA 3S2GA 3DFUA 1C9NA 4E30A 3AVOA 3M6MD 5CT8A 2E7ZA 5AM4A 4YT4A 1ISPA 3CRZA 3R0JA 3IPAA 1I5OA 2G40A 1MENA 2PMDA 2SKEA 4ZAYA 4CM1A 1BX3A 5FKJA 3RANA 2YJ6A 3O2QB 1Z26A 2ZTMA 4ARZA 4LRWA 5LYJF 7GPBA 2QTWB 3PBKA 1KMHA 1R88A