4CU2A

C-terminal domain of ctp1l endolysin mutant v195p that reduces autoproteolysis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
PENLVVYNDGADQRAAEYLADRLACPTINNARKFDYSNVKNVYAVGGNKEQYTSYLTTLIAGSTRYTTMQAVLDYIKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDOLYSIN
publication title The Cd27L and Ctp1L Endolysins Targeting Clostridia Contain a Built-in Trigger and Release Factor.
pubmed doi rcsb
source organism Clostridium phage phictp1
molecule tags Hydrolase
total genus 26
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cu2A00
4CU2A 4CU5A 5A6SA 5A6SB
chains in the Genus database with same CATH superfamily
5H4HA 1GRCA 1UAGA 3IV6A 3DTVD 3K5WA 3PYXA 1II0A 2X0KA 3L8YA 4DMMA 1XA3A 4Q9AA 2NU6B 5CAEB 3NJRA 4FPXA 2ZJ7A 1IHXA 4QWWA 3DT6A 1U2DC 2BEVA 1U0RA 3I6IA 5JYEA 2H7XA 3PGJA 1NOJA 5ECGC 4O8ZA 5TLSA 4FK8A 3I76A 3URMA 2CVHA 1QQBA 1LGYA 7YASA 3BIOA 3HXTA 2PXAA 4RF5A 1WMFA 5KX5F 4IXWA 1U0OC 4ICIA 2B61A 2QD5A 2WICA 3R3WA 1ZKMA 3C98A 5E7QA 5THXA 4F2HA 1BDHA 3OX2A 2UXCB 3D9QX 1ZK4A 3L7KA 3LUHA 1H1DA 4ZOQI 2QLFA 1XV5A 1CLUA 3OPNA 4G0VA 1RYFA 4MV4A 4PGFA 5ALDA 4JI0B 3GI1A 3LHFA 4A2PA 1IYZA 1M1ZA 1Y8QB 1JBQA 4WZAA 4YCMA 5LFAA 4WAUA 4KN6A 1DE0A 3WY9A 4CCWA 1XDBA 2QJWA 2DKOA 2RGNC 4CI0B 5JC8A 1SOAA 2WYVA 5CEEA 2W71A 1D4FA 2HH9A 5DIZA 2WJ6A 3O47A 2EJBA 1VL1A 3EGVA 5IC5A 5TE9A 4RTLA 4OX9B 2AMJA 2ZJAA 4LX8A 2BJWA 5HZMA 2DAPA 4XQ0A 1K6JA 3IKMB 3EH1A 2JCXA 3MTQA 4CDRA 1N2EA 3RRXA 3CLSC 2JNWA 5EL0A 1FPMA 2APJA 2QM3A 3TJRA 1L5HA 4JBHA 3O84A 3L4EA 1PJAA 2HA3A 2Q7OE 2WU4A 4FCWA 4WNAB 2HKIA 2XPCA 4Q12A 4OLFA 4UHHA 3HKEA 4WCFB 4X3OA 3VTZA 4QYWA 1SM4A 2XTJA 3GH1A 3ADPA 3BIWA 1V7QA 3PKIA 3O8LA 2CJYA 1J09A 1VXRA 5GOTA 5TQ0B 4CCSA 3ASZA 1KMHB 1XKQA 2Q3BA 3GEHA 4Q00A 5CHEA 2A5DA 3ZWCA 2ZRIA 2R87A 3EISA 3DV9A 1BW9A 2BKXA 4LDZA 1P77A 4GLJA 1QAQA 2VBFA 3A4VA 5CDTA 2G36A 3UJDA 4BN0A 3OQOA 1CXZA 2UZ4A 3VMMA 4KXMA 5JCZA 4QGAA 4QDUA 5AM1A 1RW4A 5KAMA 2DULA 3RIXA 3S4YA 5FCDA 3PRKE 3WGKA 1DO8A 3I73A 4AWBA 1E1CA 4B9EA 1E6EA 5H3HA 4R01A 5JWHA 3PRJA 4D9GA 1S7GA 3ZE6A 4Q6BA 2A9RA 3QVXA 2A92A 3KJGA 4I7EA 3GLIB 5DTIA 4FBGA 4G8JA 4IV0A 5ARDA 1X1BA 1LPPA 1Z0JA 2D59A 2ZTMA 3AEQA 3FCUB 3GNSA 3LWZA 3NV7A 1GRVA 1TJ5A 4IX1A 2I99A 3RFFA 3H99A 3KJXA 1W6UA 3PP8A 3M1LA 5J4HA 3CVVA 1FXWA 4CR6A 2M9MA 1N9GA 3S7ZA 2QMQA 2AVNA 5IJ9A 5BY2A 1WZUA 5BW8A 1Q7RA 3BL6A 2OZEA 1IRXA 2DQKA 1S01A 3M4XA 3CRQA 1UBTS 3QIAA 3U26A 1NN0A 3FHOA 2WYIA 2ZXFA 1NPDA 1P6UA 2OAEA 4F4FA 3QPBA 5BSGA 5CB4B 1CZKA 1JIIA 1RZRA 3GLGE 2ZJ8A 3RVNA 1A9TA 2Y0DA 4IPTA 2V6JA 3RIMA 3I9OA 1OASA 2VT3A 3A2NA 4DG8A 2FYTA 2GLXA 5B2ZA 5CW1A 3BMOA 4LOJA 3FXAA 4KUEA 3F3MA 3TZEA 1GT6A 3W7VA 5IEJA 2GLUA 3IDOA 1MX5A 2VNHA 2ZQ5A 3BXOA 1ID1A 1H4QA 2JFOA 2Z09A 2VBIA 1JALA 3ZDQA 4E5DA 4ZKDA 3WNCA 3WAKA 1EIZA 5I7FA 2JFGA 2Q5IA 2XWJI 3GJRA 5BW4A 5IT9A 1OIWA 1BWRA 1DZIA 2QRGA 5HTOA 4IDOA 2Q1YA 1SMKA 1Y7HA 3D8UA 3JW8A 2FP4A 1WXDA 3KB1A 4KKXB 3F8WA 4RIFA 5D5QA 2IZ6A 3C6ZA 4ZMRA 5ALEA 1WSBA 4IJUA 4N48A 3VPFA 4D9KA 3NTLA 3O6VA 3UMRA 4U2EA 4KZKA 3RS4A 1EFLA 1NASA 3NETA 4TXHA 1ZR2A 1RJFA 3DVSX 4G1FA 1YRWA 3A9TA 2V7VA 2AJCA 4U2DA 1Y7TA 4RZUA 3UYLA 1BTOA 3I62A 3MJEA 3KX2A 4W9NC 1XJ5A 3OQHA 4CTOA 1RS0A 4GU5A 1INLA 2RHLA 4FMPA 2LW7A 1WABA 2JAUA 3BG5A 3BWBA 4NZPA 3K1YA 3FLMA 2R65A 3SLGA 3L6OO 5ALQA 2VDVE 3LRTA 5JZVA 3PUKA 2QRQA 1KYQA 5JMTA 1DAGA 4O8CA 5C8XA 1EQ2A 3HWRA 4UVDA 3T15A 1WMBA 2O8VA 3I37X 4UCFA 5CYPA 3C15C 3UHAA 3GCXA 3WLOA 3UT0A 1PLLA 2EATA 1VIYA 2XNDD 3LZ6A 4BBAA 4DIOA 2M98A 1AHNA 3R3XA 5IFKA 4MINA 5K99A 1ZKDA 1UF9A 4PYIA 4A15A 1GQQA 1WCWA 3NOOA 2CL5A 1GGVA 1DRUA 5CM2Z 1GG8A 4KVGA 3FGPA 5IEBA 5GVSA 1GPMA 4I1UA 4G5FA 5LOVF 1SQ6A 2AFHA 2R7KA 2WQZA 3GEMA 5FR1A 2W6PA 1MJ5A 1YRQA 1HQDA 3JD4A 3U17A 1KBZA 3H11A 4WN9B 5FOTA 1J25A 1PG2A 3OZXA 5ITVA 1TW2A 3A6LA 1C8KA 2I1WA 3EGXB 1FNBA 1SXJE 1OIVA 2FRXA 1ZIDA 4B4KA 3NCHA 4AS1A 4CW7A 1T1SA 4RKQA 1DBWA 5DP2A 4LWZA 1L5LA 4DSAA 1RIFA 2EV9A 2YZNA 5CH3A 1X1DA 1MMFB 2ZRJA 2NZUG 1NL3A 3GPDG 1TJ3A 3C87A 3WK5A 5JROA 4N9QA 1O08A 3DTVA 1KSJA 3HL4A 1FRVA 2ZUBA 5K8IA 1Z6XA 2AJLI 3N7TA 1NNUA 3EXFA 1TC1A 1T6ZA 3V8EA 4CV0A 3HCCA 1KJIA 5FNVA 4TL6A 1JKMA 1V8ZA 2Q1WA 1BZYA 5HIMA 3IP3A 1AQJA 1W29A 3ICEA 1VJ0A 4KVZA 4BC1A 2GF0A 4D7AA 3B52X 1QGOA 3I30X 4LBVA 3OPYA 1ACLA 3ESXA 4CIVA 4AJ4A 2RHDA 5ESDA 1A2BA 2CLFB 2GQ0A 5GM2A 1WXXA 2XUHA 4BMVA 1GTRA 5EJ7A 3UWSA 4MR9A 3U7RA 1KMCA 2DFVA 1IL0A 3IP9A 2XMDA 4LXGA 2FWIA 3RPEA 3DCIA 4BCBA 2HK6A 4E22A 4IVQA 2FZGA 4L0DA 5FOXA 3VDQA 1U3DA 2Q5HA 4OAQA 4JBXA 5AI6A 4MVJP 1D8TA 3LNTA 4F45A 6GPBA 5KDOA 4I8XA 4YMTA 1L7PA 4UFOA 2GYUA 3V3KA 4U02A 1O9HA 4HRAA 1VBMA 6ADHA 5DSZA 1A8SA 5FTJA 3T0IA 4M38A 3LG2A 2GILA 2H48A 3FUVA 3HGMA 3PXXA 4Q1VA 5E4TA 3VR6D 1UKYA 1XZCA 3PPWA 4JT8A 2OPHA 4EG0A 1X13A 4YXWD 5FQNA 4YT5A 4YQEA 1GNRA 3OIFA 4GKKB 1E3EA 4IQ0A 5CDFA 3CNNA 1NQAO 3NIWA 2I7DA 1J8FA 1SVLA 4TYMA 2MU1A 3X44A 3PHHA 4UMEA 5SICE 3NR2A 4ZZ2A 1SUIA 2JIPA 4HGQA 4CUZA 3K6SB 2Y1EA 2YHIA 4DB2A 2C03A 1YBMA 2A5LA 2H8GA 4M1QA 2OXCA 4W6ZA 3O38A 4PM4A 2EZ4A 3ZYCA 1BS1A 4BWVA 3RB8A 2XZOA 1JG4A 3CJTA 3IVAA 1FFGA 2A57A 3EBLA 1I33A 2NZYA 3FWPA 3MYYA 4KKVA 3ZJTA 2CSXA 2P40A 4PVDA 3HVRA 1QBKC 2P9HA 4PWZA 1X1CA 3K4HA 4XJSA 4I1VA 2WUDA 1YZYA 3EFHA 1HZJA 3KV1A 4RKWA 2JEYA 2EX4A 4KAAA 3X1JA 2SKCA 3DPUA 4MRAA 1FSZA 3E9NA 3GOHA 1BDJA 1NU8A 2YVLA 3GVPA 3SR4A 3W2GA 4Z4QA 1OA1A 2CNDA 2Q7XA 3RC1A 2J6HA 4H17A 4JASB 4LWOA 1PO7A 5I7HA 1UOQA 2HRRA 1KEEB 3QVUA 5KWIA 2QTNA 2O1XA 4B87A 3VSEA 1DCKA 4DCPA 4XGNA 1JWAB 2IW1A 2WJJA 3WLEA 4DDUA 4MVJI 2QORA 3WNBA 3ZJUA 5EIHA 1ZJYA 1WF6A 3HUUA 3T7AA 2AYYA 2UZIR 3GDHA 4ARUA 3EY9A 2ZSFA 4QODA 3ANYB 4TROA 3G6WA 4B40A 4QDJA 1G5TA 4CFSA 4EHJA 5HS4A 3ZCRA 4LNHA 3MOGA 2FLKA 2P6UA 2R6GA 5T8KA 4A6XA 4BMOB 3N58A 5F9HA 4TZ0A 3N87A 4LXXA 1UIRA 3D7NA 3FBWA 4I9HA 4CXMA 1RJGA 3VBEA 3QUSA 1R9GA 2IZ1A 4KIUA 1WSDA 4P82A 1TGVA 2ACEA 3I58A 4M0EA 4OP1A 1E1QD 1OKKD 1GPH1 3FYCA 3W9SA 3VNBA 2YWRA 2W2NA 3WDMA 2YVQA 4C1NA 4MRSA 4BUJA 3WLMA 2YXNA 3W1WA 1LWNA 4S1VA 1EUZA 2ZS7A 2A9FA 4LYHA 1PQWA 5KI6A 4FMCF 1IY0A 2PWBA 1ZQ9A 3ZY2A 1KQ3A 1PZGA 4YDSA 1ZJWA 3Q1LA 3LQ4A 1GCOA 2C95A 4IJVA 1D1QA 3R3ZA 3QHAA 2C78A 4R84A 4C03A 3BCUA 5C8ZA 5T7BA 4EBBA 2QR5A 1TD9A 2R6R1 1H2EA 4EPTA 1HZZA 4NBNA 4OP3A 2JD2A 4ZPJA 2I9KA 2VPYA 4CIWA 2HJGA 4ARZA 1W47A 3L40A 4KR2A 3LXUX 3IODA 1GXSA 3VDMA 1W0CA 5HM8A 3DXXA 2CCKA 1MAVA 2IK8A 4FYHA 1W85B 4L0MA 4CM1A 4ZAXA 1JUDA 1HURA 3B6JA 1T9AA 3VPGA 1BCRA 1CT9A 3D59A 3WK8A 4Y67A 4DSTA 4GZ6A 1P1RA 5L7WA 1SEVA 2Y6UA 4RPIA 3RFUA 1AVTA 1Z17A 4XQCA 3RWOA 2YWBA 4D4LA 2R7NA 1ZNWA 2HCRA 2P8JA 4N6GA 1VKJA 2OCYC 1H65A 4IL5A 1G2PA 4JJIA 4QPDA 5CR9A 2JHCA 3AVTA 1TX4B 4M0PA 1B43A 4LF5B 3N2GB 4NEHB 3ETNA 5DU2A 4NFSA 1VDMA 2C9YA 1G8HA 1Z3CA 4YXFA 5IM4A 3HKDB 4ZEWA 2VJLA 4LG1A 1K3UB 3HO6A 5HOEA 2O7QA 5LUAA 2ZTHA 2QTTA 2H18A 2A3RA 3PXBA 4MVJF 4MYTA 5KWVA 5HNKA 1I7DA 2Y71A 1X6VA 1I94B 1SKYB 4RJLA 1F4LA 1KNXA 3AONB 3GEPA 5IAOA 5DTJA 1UK7A 4ZJZA 3SFTA 4ERNA 4YVFA 2GESA 3CZAA 4G4SP 4RELA 1L1EA 3ZVLA 2C1EA 3SX4A 3CEPB 4RHXA 4E13A 1XRNA 4IFEA 4MWTA 2OP0A 3MWFA 3OKFA 3S1AB 5JBIA 3NALA 5E8JA 2G09A 2CXPA 2NZXA 4HWTA 4F84A 1JFTA 4NFHA 3PXDA 5AM3A 2Q3HA 5AW6A 1N4AA 1YV9A 4UDYX 3BWVA 3VKFA 1WP9A 2XNDA 4X6LA 3G8AA 1TUBB 2EDAA 2HQBA 3G5AA 4IRUB 3RRBA 4NZYA 3WMFA 1PSZA 1YBAA 1FQKA 2DPGA 3PE3A 3HUEA 1AKQA 1JHOA 2FKAA 4KQXA 1A3CA 1SVKA 4M54A 1PBNA 3ZE9A 4ENPA 1KZYC 3N5CA 3IDFA 3TW8B 5FX2A 1I2MA 1XZIA 1V9LA 1W4AA 2BEJA 4LRXA 3CPEA 3U48A 2DECA 4WZBA 4F86A 2TRSB 1G0NA 3QQ5A 4F5WA 2W2XA 1OWOA 1OH6A 1QZUA 2OCPA 2ZLBA 2NYRA 2QW8A 2YZGA 1YQ9A 3DG9A 4R05A 2FZWA 1RCFA 1Y9DA 4AC9A 4WFQA 2E85A 4GZ5A 1Y5NA 1X9GA 2FXVA 5EE5B 5F2OA 1FPQA 2FPRA 3W5JA 3ZG6A 3A7EA 3G1WA 3OE4A 2DZDA 2W8BB 2XUQA 4EA6A 2C84A 1XP5A 4IOMA 1WXFA 1J9EA 1P1FA 2EJTA 1J2EA 1RPNA 1YZLA 1EFVA 5EJIA 4F3NA 1M83A 3ZGXA 721PA 3O0TA 2JFYA 4Y8VA 2HQSA 3BTSA 4P6VF 4TV8B 5HILA 5I7UA 4EENA 3AH8A 3D4NA 4LIPD 4KXFB 5DZSA 1YFJA 2YXBA 4DJ5X 1HDZA 4MA4A 4RIIA 4DLAA 1TECE 3A9SA 4KXUA 3U56A 4V0LA 3CN7A 1D4AA 4FEGA 3CCCA 4IMPA 2NU6A 4R9UC 4Y2GA 3CGGA 1O95D 4ZQBA 4D8XA 1ODFA 4G5YA 5CAEA 1FUUA 4PLTA 3WWZA 3KQUA 3NBAA 1H22A 4LVOA 3HLYA 2VF5X 1NVKA 1GGJA 5AD1A 4Y6RA 3AC0A 1Y8RB 2IGTA 3DAFA 3B60A 1HE1C 4QQRA 5K0TA 3DMTC 1I1HA 1DRWA 2HY7A 4OHOA 5JAHA 1B15A 3BXEA 3O9ZA 2J46A 2KX7A 3R74A 1TB4A 2JPDA 1RR6A 3E7DA 2C4MA 3W2EA 2JI8A 2O50A 3FDJA 3QVJA 4JOQA 2A4KA 3M5CA 3PEVA 4M9XA 1GAEO 3DXFA 3HKBB 4FMDF 4L8YA 1AZLA 1PYOA 5EE9A 3IQWA 2RHBA 3MT0A 2JFQA 4H59A 4S0ZA 2QVXX 3ISJA 1I4TD 1N4DA 4KAFA 1L7NA 1CY2A 4MS4B 1M6EX 1TKBA 3EC7A 4J4HA 1NVWQ 1NP7A 5JD6A 2V03A 1Y8QA 3STXA 1A9OA 1T6XA 3ZK8A 1JFVA 7AT1A 1KJ8A 3PLNA 3RYIB 2ON6A 5F33A 3FNIA 5DGTA 2ZB2A 4G8CA 4S04A 2AW3A 5BYBA 2GVNA 1LPNA 1TOAA 2GZDA 3VR6A 3P9ZA 5BW5A 1M8FA 5CW2A 1NYTA 4FZ3A 3BUSA 3PA8A 3N8NA 3R4CA 4ZANA 3N2KB 3U0BA 3OEHD 1L1FA 2IUEA 3F7TA 4I6GA 1LNQA 4DA9A 4OGKA 2ZCVA 1VFPA 4Q3EA 3SGLA 1S8NA 3EDOA 4ZHQB 2ZDHA 3R6GA 4B09A 4ROSA 3MT8A 4RQBA 1AF4A 4R6WA 5CVTA 4OQMA 2HN9A 2ERCA 3F67A 3THOA 1XD8A 2Z30A 3GA5A 4WNAA 2FSSA 1N7HA 2G04A 2GVDC 3BWCA 3ZEIA 1MHTA 2JGDB 2BL4A 2JGFA 3DMDA 3CT6A 3CEMA 2F00A 2V5AA 4K8RB 3BQMB 3ENVA 1RPAA 3VYRB 4BFYA 5LJLA 4JLVA 3KEMA 4V1CA 3WGVA 4CM9D 1YHZA 1DUSA 1KMHA 2C2XA 4RK7A 4G9BA 4KGVA 4QOGA 4BFTA 3O8RA 3KT8A 4B3JA 2BR3A 2VF8A 2BPOA 1XD2B 1N8KA 3HCFA 1HE3A 3O95A 3P9KA 1FTGA 2CDRA 4JLUA 2PSDA 1ZXBA 2HWYA 3H75A 4LZWA 3LQKA 1MBZA 4LMBA 4TTQA 3DE4X 3KYBA 1IQ0A 4Q3BA 1IMOA 2CV1A 3FCCA 3L8DA 3ZLVA 4JUFA 2WM8A 4FR0A 1WCV1 3H6GA 3DXYA 3VU1A 3OD1A 3PR3A 5DISB 3UAOA 1XPRA 4YUZA 4A6DA 4EVSA 1O9BA 3EGIA 4CHGA 2GO7A 3NATA 2HZ7A 1XI2A 2X4LA 2G72A 3LHDA 2RHMA 1CDZA 3GLIA 4EZBA 3GVXA 1OJLA 3RE1A 4YRAA 4BNMA 1HDYA 1Q1EA 1MR3F 3OQJA 4H3VA 1OKKA 2IKQA 3LOPA 3VKHA 3IB6A 3ZHYA 2W00A 2ZJYA 2HA4A 2WDZA 2DUUA 2AEFA 1OUMA 3GV0A 4MWBA 1N77A 1VHJA 3D6AA 3L8FA 4AUKA 4CT4B 1EHYA 1KO8A 3WL3A 2O8DB 1QZZA 1LI7A 3ZWMA 2W93A 1TKCA 4PSCA 4H1HA 3G5MA 2CCJA 3N5KA 3K0SA 1OXTA 2VO1A 5DLEA 4V0ME 4P3OA 4WBXC 3KEGA 5TPZD 3MJFA 5B7PA 4ZZ0A 2D00A 3D2BA 1CUVA 3V1YA 3G5TA 3DJYA 4DLLA 2AEMA 3QNWA 5EXXA 2XVMA 2BOVA 5CB4A 2AHOA 3BH0A 4HR7A 1HGXA 1H23A 2J3KA 5TS2A 3V1LA 1KJQA 1FNDA 1VLLA 5CGZA 3SEAA 4C4YA 4ZJUA 4YYZA 4N5NA 2G9ZA 1XTZA 3I1IA 2AVDA 5DULA 1LCIA 5KYTA 2B3DA 1XDUA 3AHDA 1P2VA 2RGUA 2VBGA 3HA7A 3L04A 3GD7A 2VXBA 3WOHA 2E5WA 3BN3A 2P2ZA 3GNTA 4CKWB 5IAAA 5AHXA 1TAUA 1CTQA 4BO1A 5KTMA 2ATEA 4OU4A 2X4IA 1RRPA 3LBHA 4G4IA 3ZLJA 2Q1UA 2E4AA 1GGKA 4NEGA 4UZEA 5G0UA 1T1RA 1E3DA 3RC9A 1T3HA 3LWBA 3IKVA 2NU8B 3R3JA 4KWCA 1CEEA 1IVNA 1ZN8A 4LJYA 1Z16A 2F2TA 3BD9A 3KS9A 4ED9A 5I9NA 2A5YB 4B3GA 2K5UA 5LNK6 3E7XA 1TD1A 1XMXA 4WXPA 1NJ1A 1YE3A 3SXPA 2ZWAA 3ICPA 4K9SA 1PV1A 1JEEA 1QAMA 5A0VA 4RF4A 1MX1A 1R4NA 1E77A 3AUUA 3KJFA 4DUGA 2ZJ0A 1BA3A 3AUJB 1J39A 3CUWA 3TGPA 1B0PA 3S8EA 2QMEA 2BFCA 3PNYA 3TN7A 2FG7C 4UU1A 3L5OA 2FNAA 3UKDA 4W7SA 4B4UA 4EITA 1SUEA 1T0UA 2R751 3WRWA 5IULC 1DKQA 5H59A 3LPLA 4D79A 1VIDA 2GARA 3WRXC 2AZ4A 1ISHA 1NX9A 4N82A 4U9IS 4BWYA 2TECE 1ZHHA 2OFWA 2R62A 4LZAA 2AF4C 5ESRA 2ZM6B 5CLGA 3AL2A 2PT5A 2G1JA 1EUCB 1TMOA 3EVCA 2VAMA 5I6DA 1B8OA 4MYRA 5A62A 1IN8A 2FU5C 2PXCA 1XL1A 3ILVA 3D2CA 3T8YA 1PLKA 3H1BA 3LUBA 2YFQA 5CFQA 1D6JA 3OPVA 4Q4LA 4R3NA 2ZUVA 3DBOB 4C4ZA 3W5DA 4O2AB 2CVPA 4LDPA 1BFDA 1KPIA 2XUKA 4DV3B 2OC4A 4JT4A 4DBZA 1L4FA 1NX6A 4R8MA 2H6EA 1D2GA 1JHUA 4WN9A 4ZRNA 4PC3A 4C7VA 1JIUA 2D8MA 5JH7B 1KI7A 3EGXA 4XOUA 1PKEA 4Q4AB 3LLCA 5LQSA 4WY5A 2J0VA 5I9IA 2PZ8A 3DFMA 2Q2QA 1UJ5A 1E63A 3DAOA 2I4MA 4E88A 2OWEA 3ELWA 4L8FA 4CMJA 1NE2A 5JQGF 1UXHA 2XY4A 3KDPA 1TTHA 2E21A 1VMKA 1ZVQA 2GEFA 2A0XA 4AXXA 4HDKB 1RYBA 3R5KA 3T35A 3K9QO 1VL0A 2WFAA 1BU5A 4RZQA 5YASA 3F46A 5THQA 1Y6JA 5A4MS 1O95A 3RVMA 2ZR0A 521PA 4QU9A 4OU5A 2B7BA 3CUEF 5IVKA 4DQDA 3R7AA 2PXHA 3DHNA 1Z0SA 1H4TA 1F14A 4HDRA 1DQPA 1M76A 5FH9A 1KQOA 4Y6OA 1PI3A 4CV2A 1KA9H 4ZCRA 3KVRA 2X5XA 1YCDA 2O7VA 3DLHA 3RKSA 4K6HA 4QXQA 3U6BA 1VLMA 4TMFA 3UT5B 4AS3A 2BAGA 2WUGA 3HB4X 3KYIB 3VNRA 2VJYA 4BIMA 1QQ7A 4RJ2A 4CM5A 4C07A 4D96A 1HNWB 2YH2A 1GM5A 5J40A 4BO9A 2OHGA 4GR4A 2BGNA 4EDFA 1Q92A 3A9VA 5EIBD 2I0FA 3QHQA 1DIGA 4IV5A 5TNXA 4B82A 3FNFA 3PWSA 1ODKA 4I9GA 5FKJA 3MGBA 3UOWA 3C70A 2H63A 4IZ6A 3PJRA 2PUJA 4BRSA 4GMFA 1RXWA 4ZPXA 2QK4A 1U9IC 1TCCA 3R20A 4MYUA 4AZWA 1RYNA 2XCQA 1M2GA 2W6MA 1F51E 3LNCA 5G1NA 2XT9A 1FRFS 1D2EA 3B1KA 1NE7A 3BRQA 4X20B 1PUXA 1U0BB 3RAJA 5JCOC 4WE3A 3W3AD 1DL5A 2VJCA 3K53A 2C5LA 4Z1MD 2XQFA 1F17A 2WP0A 2C3YA 3AG6A 1SXJB 1QMGA 2D13A 2EKDA 1OFVA 4KE7A 3G2NA 3TRIA 2WYHA 3K6SA 3SVTA 4M9RA 4P0TA 1JDPA 3ROPA 4WFJA 4K6OA 3MT9A 2L18A 1YCFA 3G7SA 2A78A 2CJXA 3W5VA 2GJ4A 3LUFA 4BVEA 1UJBA 2D4AA 5DHFA 3R8XA 2P4HX 4B5KA 4CM9A 3PDUA 5KQGA 4JQZA 4JK3A 2H1IA 4R7ZA 1QFJA 3WYAA 4H15A 5K8UA 4IINA 5EZQA 3UWOA 3A2KA 3DOEA 1KI1A 2PTHA 4U7DA 1AUOA 4RJTA 1R5OA 2WKRA 1OZGA 4G67A 4MWDA 1JAYA 1N5DA 1YAJA 4K03A 1IY8A 3K9CA 5IVHA 1U4SA 5TGZA 3O26A 4MQUA 4AF6A 4EJFA 1N3YA 1XTKA 1FS6A 1B14A 2F1IA 1KEEA 2WG1A 1D1SA 1DLJA 5LLDA 2Q8NA 3RUIA 1W59A 5PGMA 1YVDA 1O4VA 1KAEA 3NTUA 1M2OA 4BDSA 1CWUA 2WTXA 4ZGWA 4M2LA 1EFKA 4AF8A 2VNIA 1N3IA 1URPA 1U8YA 2RG1A 2Q46A 3JR3A 1NVDA 3NFRA 4QGFA 2X0DA 3TFWA 4XWAA 3WICA 2ZU6A 3NX4A 4CF7A 1G8YA 3IMEA 1ZCJA 1Z5VA 3PFWO 4ZAYA 1WDWB 2YJ5A 3AY7A 4FWBA 3WIBA 1S2DA 4FYVA 1K2VN 3HQ4O 3KZNA 3I04M 1G20A 5C32A 5J4VA 1XHFA 5B3AA 2HHLA 3G0OA 1T3TA 4YLYA 1XZBA 3IUPA 4B46A 5A4JA 1TRKA 4RDXA 3R23A 2R00C 2ZE7A 1UADA 2FGKA 5KCZA 2FSIA 3ZY3A 1XC7A 1RJ9B 4OXKA 4KC0A 1JBEA 3FFXA 1F38A 1YR8A 4B4DA 1QIGA 1Y80A 3M4JA 2GETA 1X7WB 3E1GA 4BLRA 4KN5A 4DG9A 3B3JA 3MSCA 5AVTA 3WBBA 3WXMA 1JG2A 1NSFA 5DNWA 3UAYA 2NQTA 4E5UA 3KKLA 2HMSA 1JQLB 1TLLA 5D1NA 4AYWA 4X9XA 3VKUA 5HWSA 3BX1A 2CK3D 3H7IA 5LBIA 3AVOA 4GNKA 2J0QA 4II3A 2BFBB 3KCNA 1KVQA 1V3TA 3DTNA 3DZ8A 1TADA 2OD9A 4INZA 1Q7GA 3QWFA 3RREA 3BM5A 4Y2QA 4MZXA 4CMHA 2E4UA 1ZH8A 1W85A 2F8MA 2TS1A 5LN1A 3P19A 3SZUA 5HJ5A 1OLOA 1GFIA 4I4TB 3AKDA 1Q0LA 4ZGGA 5EUMA 2VDNB 4JOCA 2XQVA 4JOBA 1E4VA 3PYMA 3T3NA 4D3SA 3IV7A 3E5NA 1MABA 1XMVA 2B83A 3N2GA 1KHHA 3HVIA 2BWJA 4NFYA 4F9FA 4TYNA 1J7JA 1PJBA 2ROQA 2XHEA 2LDBA 3H17A 1V4VA 1SUCA 1V7ZA 2HNKA 4M9ZA 3HLTA 4H3HB 1E7WA 5CNKA 3SE7A 2ZS9A 3HKDA 4AFNA 1NMXA 4MAMA 1AGPA 1DOHA 3DKRA 3EIEA 3M70A 1ZO8A 4ZT7A 9LDTA 3GX1A 4Q7MB 3M83A 2P4SA 2OKGA 2AXEA 4IFBA 1IPFA 1Y1KE 1NBME 1SD2A 4BRZA 4PYLA 1H8EA 3WSVA 4DE5A 3ZDFA 4E1AA 1E9CA 1OLSB 4JC5A 4LC0A 5DWQA 4I1SA 2EW2A 2XMQA 3QWHA 3FGNA 3LXMA 1WOYA 4F21A 3S1AA 3BGVA 3BB4A 2WJYA 3CINA 2VNAA 4I4IA 5E4YA 3WE7A 1ZX1A 5IPFA 2H7VA 4A8JA 3OLZA 3Q2OA 5EPOA 4BBZA 3CF0A 2I80A 2WJZB 3IMCA 4FR5A 4JFRA 3T1YB 1KZ7B 1U6JA 2PANA 3R3HA 1TUBA 5A5GA 3IEKA 5U1PA 2HA0A 4RQUA 4C7JA 3PC4A 3JQGB 1TW3A 4Q7JB 3B1ZA 4MW1A 2CJWB 4OQNA 3TW8A 4C0HA 2IYUA 1L6IA 4ZCIA 4KQ1A 4FNMA 1P2UA 3GZ4A 3B3GA 5DX0A 3OTGA 1C2YA 4NY1A 2VPWA 3H13A 1XVAA 2C4KA 1VI6A 2ANCA 5JSZB 1Q77A 4N7RA 2XMSA 4KMMA 5EKSA 3WRYA 1DHTA 2VZ8A 1OROA 3PYLA 3GDWA 5D51S 1S7CA 4ER0A 2YOHA 2GCNA 1O5OA 1MENA 1NKVA 2W8BA 3KSAC 4K88A 3KL2A 3G8YA 1BMQA 1KYYA 3GHHA 1ZSYA 2GEUA 5HTKA 1S1MA 3ENKA 4Q1DA 4EMUA 1JQAA 2C2GA 5H16A 4KQJA 3ZGYA 4CF3A 4K1XA 2P5TB 1QGED 2GPYA 4GZMA 4RHFA 4IUYA 1T6BY 2JJ1D 3UVEA 3S0JA 4NZNA 1QQTA 1ZLYA 5EKDA 4A2WA 3KTAB 3JV7A 3LDFA 1H3FA 2H2WA 2XNHA 3IUQA 5DHSA 2RHWA 1U2EA 3LS2A 2PR7A 1S02A 1SBIA 3UJAA 3V8PA 4U6NA 1SAYA 4EL5A 2AXQA 2C0QA 4QXAA 2ZSKA 3IQIX 1IDN1 1A96A 3OUTA 3ZHVA 4JBWA 4IDFA 4PO9A 2HU7A 2EKQA 4EHDA 1BMFD 5G1OA 1VKHA 5A4DA 1PSWA 1FA9A 1VP3A 3F5MA 1N32B 1T3ZA 3AP1A 3P2YA 1QB8A 1E5DA 4EUNA 3PXUA 3GLFE 1UOEA 3A6HA 3WR5A 4LSMA 2PN1A 3KQSA 4L6CA 3GFVA 3HKBA 3L6CA 4AB1A 3KAQA 2HNBA 3L7NA 2P2SA 4MQBA 4MW4A 4YH1A 2I78A 1JA1A 1ZRNA 1EJ2A 2CZCA 3FYHA 4KIWA 2Q6OA 4MS4A 3NONA 4R16A 5HQJA 4BMPB 3KZXA 1J06A 4ALIA 1XALA 1ZL2A 2IUSA 5EZ6B 5BUQA 3ZXUB 3DCNA 3INGA 3VPSA 4GOXA 4ZCTA 1M8JA 3DZHA 2Q99A 2Z2XA 5JPCA 3H4MA 2GZRA 1NOKA 4N7JA 2IQIA 2P4EA 4DA4A 3UK6A 3WLPA 2C2WA 3QX7A 2GBFA 4IYJA 2I71A 3W5HA 4G0WA 1J0AA 4PAMA 5DFAA 3B13B 2BFPA 5LKAA 1LK7A 2ADOA 2MYUA 2V0CA 3QLJA 4QG3A 4IM7A 3OLVA 3N2KA 3W3AA 2H29A 3FPBA 5DJ5A 1UZMA 1DIBA 3L8CA 5ALPA 1JU9A 5AHWA 3QEBZ 4JC0A 4G0XA 4CLDA 1H1LA 2GTHA 4ND5A 2X2EA 4QQ8A 2Y3IA 1K75A 1QNLA 3I9V6 3NHYA 4CF5A 3R0IA 4ZHQA 3EH2A 5KCMA 1BE8A 5CDGA 3Q8KA 3ICOA 2B99A 3ASUA 4GRDA 1MB2A 5CK5A 1GTL1 3TUZC 5ED4A 2FX5A 4Z4IA 4WK0B 1N7GA 3AI1A 2JGDA 1W4ZA 1JLKA 2BCJQ 1KPGA 5HUQA 3K6RA 4YGXB 4R2JA 2R47A 3AWIA 3W7BA 3LRPA 5B1DA 2XUPA 3ESDA 2CHEA 2IXAA 1IE3A 2QA5A 1XDZA 1M33A 4PYRA 4ZAWA 1XD2A 1IH8A 2H5IA 3U4HA 2KJQA 4J3NA 3JQFA 2PUGA 3R0VA 1EM8B 4M7WA 1J99A 2PUTA 2VLBA 1TEHA 1SO8A 1AQIA 3M6IA 4G8DA 5MGBA 4IDEA 2CXHA 2HPHA 2PZEA 3FYUA 1PNQA 3GAMA 2QPTA 3JTEA 3N05A 1P0QA 2RONA 4RADA 2WOOA 3OF3A 2BCEA 2TYSB 1RAHA 1K4YA 3AXSA 4TTIA 4WBNB 1SKQA 1HE5A 3R24A 3MIZA 2BD0A 3RFTA 5F64A 3EPRA 2I4OA 3LWNA 1RXSA 4ODIA 1XDSA 4RANA 3E9EA 4PG5A 3W1VA 1V5WA 4DLXA 2H92A 2GUWA 1RAIA 3WP1B 2MMGA 3I1YA 2JGJA 3TKAA 4XYEA 1BX0A 7MDHA 1Q1ZA 3KBOA 3NW9A 4L8GA 4RAQA 3WLLA 1MA0A 1WMSA 1ZHFA 2O8DA 3RABA 1P7VA 2OGUA 2LCIA 1A5BB 4MKHA 4J4BA 1Y1PA 1YS1X 2XLCA 4YFYA 5KNCD 1T9GR 4NARA 1Z4KA 1FY2A 4FWIB 4XB2A 3TRHA 4ZTUB 1W36B 1CR1A 3BE5A 4MRMB 1KDPA 4E03A 2RGGA 5DNAA 2J6CA 1OC2A 3AUKA 1YA6A 3D4BA 2VYQA 3P2OA 1YJ5A 2GPSA 4HLUA 4J0GA 5J59A 1V41E 2VJOA 5LZ8A 2GXUA 5A2QA 2BEWB 4I2NA 1JJVA 5E6RB 4BAZA 5LL6P 1FJXA 3SR3A 4HRVA 4M0UA 5ALLA 2VYNA 2ISQA 1LX7A 4HEA6 2R0QC 3QOYA 3CZQA 2AJTA 5TC4A 2V98A 1I7PA 1Z37A 2VQSA 3DYIA 4UU0A 3HN7A 3SBOA 3DKKA 3ZGNA 2A94A 4BAUA 2FW1A 4PZCA 4C2UA 1CIPA 4OB6A 1NJSA 1RSZA 5FWYB 2C00A 2NU8A 3ZDAA 3VH2A 4CLOB 3FCYA 3RVLA 3ETCA 4PV7A 3C6KA 5H02A 1ZJ4A 1E1MA 1GQSA 3G85A 3TRFA 3WGOA 1HYBA 3JU3A 2VCEA 3K9GA 3P94A 4JSTA 3WIEA 4EA9A 3H1FA 3KEOA 2R6JA 3L05A 1IXRC 2V7QD 3N75A 3GROA 1M34E 4NOJA 4P53A 3I01M 1KY2A 1LV7A 4U2CA 4QVIA 5DXJA 1Z5GA 5EXTA 2CLDX 4HEHA 4GVPA 3K4QA 3ZS9A 3MSXA 4MQ4A 4BNKA 3L0SA 3QKRB 1WXWA 3JYQA 4P5PA 1OVGA 3W4KA 3H2JA 5JASA 3K32A 2RI1A 4ENUA 3B9QA 4GBED 4MA5A 4KX3A 4W99A 4P0QB 2QW0X 4K8OA 4PVCA 1WZIA 2LWIA 2NACA 2WKWA 4AN0A 1US8B 3OZGA 1DJNA 1NYQA 1PT8A 2R2GA 4EELA 3JZIA 2VKTA 5K9ZA 3R3VA 1UBGA 4M1TA 2JL1A 3BCHA 5CX4A 1EUCA 3KG2A 3K5PA 3CVWA 4WNYA 3Q7RA 4W8OA 3AYZB 1HRDA 2JLCA 1ZJZA 3F9RA 1BMTA 1E1KA 3Q3IA 3SXUB 2IF0A 4HLNA 5I3ZA 5CT6A 5H8WA 2MINB 5BT9A 1EXDA 2YWCA 2VZLA 2Z83A 4O2AA 3CW2A 1ULZA 3IP8A 4QUHA 4R9NA 1Z08A 5DV9A 2Q7DA 3RBXA 1EE9A 5JW6A 2AC4A 4IXTA 4MYSA 3FSJX 1ZOSA 1WX1A 3PUHA 2QVBA 1ELOA 3GMSA 5B4VA 5ELXA 4H7IA 2R4UA 2XA2A 4HN9A 1HO3A 4D5GA 5G4KB 5JH7A 3EPHA 4IUDS 4MVJH 4ARCA 1OFUX 2H5LA 2J5QA 3DAPA 4MPJA 4Q4AA 4R54A 2AX4A 4UZSA 4XQGA 1XTPA 2DCMA 1C9DB 4J75A 4MGZR 1YNSA 2FSUA 3W2FA 4L22A 1K92A 5I9SA 1SU7A 4LHVA 2DJ5A 2DHEA 3UBMA 4EX7A 1JGTA 1XNHA 1AO3A 1E2NA 2N42A 1OQAA 2ZTVA 4GDMA 4C3UA 2Q4BA 3HCEA 3RD5A 1R8SA 4ZQFA 1CY4A 4EKYA 1OC4A 5EXEA 1CHDA 2VTDA 3DMGA 4L5JA 5H0IA 3BZWA 3UM9A 4FN4A 1HRKA 2RH8A 4UW9A 3GEEA 1GLGA 4XPIB 3LC1O 1GSAA 4PZPA 3U7IA 1R7RA 4CTKA 4DILA 3FTDA 1X1QA 2YMMA 3R9KA 1XSEA 3TDNA 1M66A 1BMFA 2C5GA 5COQA 1JAXA 5AXAA 5CFMA 4C7MA 1ZOOA 4LRYA 1JDNA 2Z2IA 1RABA 2ZAMA 3JYPA 4KN9S 4HUJA 2NO4A 3G2HA 1IXZA 3PCRB 3UT5A 2O8NA 1FFBA 1ZA2A 2MDTA 3D1JA 1DDGA 2ATIA 2FHPA 2PRSA 4FHZA 5K01A 1WCIB 3JQDA 1KHTA 3VKVA 1WBBA 1V8DA 1YAHA 2QZZA 3B51X 1UT6A 3N2EA 4I9FA 3DV0B 1E6KA 3ED1A 4M8KA 4RVUA 4Y0AA 4ZVSA 3ULKA 1ZCZA 4A7PA 1DQRA 4NX2A 2R1UA 3WB0A 1HOTA 1A9QA 4YQYA 5IARA 3EZXA 1H5NA 4DM3A 1U0FA 1KKLA 2P9ZA 2XOXA 4YRDA 2WPDD 3KXIA 1WV0A 4JENA 4LS3A 5FV7A 3GT0A 3M0EA 1QHFA 3H4VA 1BA2A 1L8XA 3RJ9A 5DN6D 3LECA 2GZAA 1TYZA 2FB9A 4LWQA 4O4JB 4X20A 2IDKA 1N57A 4WA8A 3AUTA 3P4XA 4ZVUA 1PK9A 2OKCA 4URFA 1V8BA 4NZMA 1LLFA 3HXOA 3W4IA 3DKPA 3KXDA 1GNSA 4EUFA 1J2RA 1SXJA 1RRKA 1BJKA 1TCVA 1GAWA 3EHDA 4OG2A 2BKAA 5KJ1A 3FDIA 3O73A 2HA2A 3E22A 1U8ZA 3C3YA 821PA 2OT3B 1YH3A 1KYVA 4ZOBA 4JKYA 1LSSA 3ZCUA 3OMXA 3KWFA 1G8FA 1OBHA 2GKSA 3MAGA 3WYDA 1B4DA 1E9RA 4TWAA 1K7EB 2XYQA 4OMDA 3WKEA 3OKAA 1JYSA 4OQFA 3CZMA 3O4RA 3VOTA 1V11B 2ODQA 3CG4A 3QU7A 4G9GA 1P8AA 4TLAA 1DG3A 2GVZC 2FUG1 2HDNB 3WWEA 1I4EB 2WHYA 3FHLA 1FXWF 2HNAA 4MSUA 3UFBA 3ID6C 1Q83A 3WWOA 3ET5A 4ZVTA 5AVOA 3AF1A 5CT4A 4YFVA 5EMNA 2V3VA 3V9AA 2OV4A 5AVZA 3I0ZA 1AHIA 1SKAA 2QLNA 2XVXA 4NE2A 4TT3A 1E7YA 1YA4A 2XB9A 3OT5A 3K3PA 3QA3E 2G28A 1C9KA 3RARA 1DJMA 4ZO4A 2C2KA 4U4AA 4JLBA 3CUVA 3IUBA 1SY7A 4ZO9A 3OC6A 5IF3A 1NZFA 1FDTA 4F92B 1C7EA 1FYFA 2HCJB 4O4HA 1VSQA 2AI1A 5J63A 4AZ3B 1DBVO 2EZ9A 1QVWA 2H17A 3QF4B 5EWLB 3O4HA 3S70A 4G0OA 5C8YF 1DCMA 4F3KA 3B38A 4F85A 3IQDB 4UUBA 2R79A 4FD2A 5CU7A 1AN0A 1BXGB 2PH7A 1T9ZA 2IELA 3UAVA 4Z3OA 3Q8LA 5ER9A 1WLYA 1AUVA 1N6NA 1OE0A 1Q74A 2VJAA 3IESA 5C0OE 3WV5A 3CVOA 1J2UA 2PGXA 4LXUA 4YRSA 2BHSA 2FSFA 2GSDA 2RC6A 1RJ9A 2X9NA 2AN1A 3I04A 4G4GA 3TUJC 5KNCA 4D98A 4A3SA 1X7WA 5FTKA 4H7JA 4KLNA 4YUVA 1XTIA 2OZVA 1ZSVA 2C42A 5K6AA 2A59A 1SCIA 1MQ9A 1EFRD 1JVNA 1WUTA 2JBAB 3FR8A 3T94A 3TIIA 4EVIA 1IJFA 2XAUA 1CY8A 1U3FA 3DQQA 3JQ8B 5HXAA 3OJLA 2P78A 2W43A 3OP1A 4Y2TA 4MKGA 3I32A 1HFWA 5F35A 2PZMA 4GOLD 3RS5A 2LPMA 3AXTA 4BS9A 4E08A 1OD6A 5LKRA 4AZTA 2BFBA 3OPYI 5LU9A 2F1JA 2HJSA 1FFXB 4WHMA 5K3DA 1WMAA 4OQZA 5HZHA 3M49A 16PKA 4HAWA 2DWOA 3OZAA 3KKQA 4IUBS 2WWWA 3N70A 2MSNA 3NBQA 2F1KA 3OQ6A 1RJEA 1IY9A 2FWMX 3ANTA 2OYRA 4JHLA 4I4TA 4U3JB 5FEMA 4Q1AA 3COJA 1CJKC 1M2WA 1VHWA 2A33A 4U9HS 4EG6A 5EJ5A 1UKEA 2VUTA 1F5NA 2YBDA 5ICMA 1GOTA 3VHXA 4D46A 1V7PC 4P7FA 1B74A 5SYMA 4ZP1A 3SI7A 2GN9A 3UHJA 1Q12A 1ZQ1A 3PBKA 2V7QA 1IMJA 2AS0A 2H52A 2G6TA 4LV6A 3T12A 1Y1RA 4CFYA 1CEQA 4RNDB 5JNUA 4OY3A 5MDHA 3VA7A 2FP3A 1HYHA 1YS2X 1U3VA 2W2LD 4KXWA 2R44A 3MWEB 3AUSA 4KPUB 1XCBA 3L7MA 4JELA 4N40A 3Q3VA 1A95A 4PZLA 3KLMX 3ZY5A 3FSEA 5FI3A 5K4AA 1F5SA 3UFXA 3OICA 1UFQA 2C61A 2NVWA 4OGGA 3I2FA 4KFUA 1OLSA 1QCYA 4BX2A 2YJGA 2M2IA 1JG3A 3CS3A 5A3VA 1PWYE 5DO9A 2PD3A 1F0PA 5LP6B 5LWQA 5IYZA 2HJWA 4JI8B 1U8EA 5BWNA 4H7PA 3ZI4A 2G82A 2V7GA 2WK1A 2FR1A 4YJ2F 4V2UA 3BF7A 3QYPA 1ZLXA 1ZRSA 2FG6C 3VV2A 3G9TA 1UL1X 4O6VA 4ZCQA 2ZQZA 2OENG 3J81k 1W75A 5G0TA 2QYTA 2OMEA 1SZCA 3PHCA 4FSXA 5KKCA 1CDOA 5G3YA 2K2WA 3N9IA 4JI3B 3K9WA 4A2CA 4D80A 4EG5A 2CJWA 3VQTA 4F91B 2L17A 1X42A 4YJKA 4AO8A 4A0RA 5C1BA 4UCXA 5FNVF 4CDMA 1DEKA 1H2BA 2C4UA 4RNCA 1A8QA 5EXDA 3VR4H 4IMRA 5HQ3A 1W8IA 2P11A 2WQ6A 3PR2B 4PWYA 1SHJA 5FB3A 2OBNA 5E6SB 1HSZA 2FE4A 5KOJB 1UR5A 3H5VA 1IULA 2G4LA 3L8ZA 4EW3A 4HD8A 1A76A 3DT9A 5K45A 2WRZA 3MOIA 4WOPA 5U4QA 1Y8AA 2H9YA 3DMNA 3LHSA 4FU0A 5AVQA 5I7RA 5C51B 1II9A 1Z0DA 2ZS8A 5J2TA 5GAJA 5K09A 1IJBA 5B6JA 5LYJB 4KLZA 2IY7A 3WL4A 3DSRA 3I2GA 1I3LA 2YY5A 1SFRA 4QO7A 4DIBA 1UXGA 5AH0A 2M6LA 5K8TA 3LLSA 2QW1A 4FDTA 4UTRA 3ORYA 4YCAA 1JJIA 2V6BA 2DR0A 1ZIXA 3KTAA 3IBSA 4PYKA 3U7GA 4WACA 1J4AA 2KQUA 4W9RA 2BMJA 2GZHA 3MRSA 1EKXA 2Z3ZA 4TKZA 1T36A 1QGAA 4PC6A 4UCWA 2IE0A 4FB4A 1CJTC 1A7UA 4HBZA 3DMFA 5EHIA 4C30A 2BW0A 2IWHA 3C97A 2YV1A 1TYCA 3ONEA 4D8YA 2JK0A 3C3KA 3QKSB 1SXIA 2GPWA 3ZR4B 3U44B 4JNCA 1I3MA 1DKPA 3J7TA 4XM2A 2FLVA 2QTAA 1G4HA 4C7OB 3H7AA 2OORA 3O0DA 1OBFO 1GNVA 1DO2A 1UKAA 2E4WA 2JCVA 4IHJB 3X1YA 1V43A 2VDRB 3EG5A 1I10A 1R8XA 1Y4AE 3EGOA 2P9JA 4UVEA 2DFDA 3AM1A 1EUQA 5I47A 1CETA 4Q1EA 1RLIA 2C4TA 2GFHA 2WT8A 1Q95A 3L0YA 3NWEA 4U9UA 5ITZB 5LM3A 4K3VA 2WQ7A 2WPDA 3NTRA 3X2EA 7GPBA 3ETDA 3KPYA 3FKQA 5SZJA 5AI8A 5DN6A 4BTLA 1KFKB 4NESA 3BD7A 4EEZA 1JEYB 5K6RA 4RY9A 3V7FA 5BP7A 1WKCA 4N0DA 4OQYA 3VO1A 2J3JA 3AV3A 3PJDA 4ALNA 3IBFA 3CWCA 4IDGA 4O1IA 3PICA 1AB6A 5FHRA 1PR5A 1VRWA 2R6HA 1CP2A 2PSFA 4X1IB 1R1DA 3JX9A 1MV8A 3WRVA 2FEWB 1FRZA 1USGA 2UYGA 2X8AA 4NZOA 3N2ZB 4M87A 4P4NA 3CB4A 3HA5A 2MTBA 4BN5A 2FOIA 1QO9A 4F5EA 4TMKA 2GTPA 4TVOA 2F3PA 1BE0A 1H2FA 3LU1A 4L0QA 5B30A 2QWXA 5EQJB 4MQMA 3A6JA 3VGPA 3MJCA 4QFCA 3FPEA 4XB6B 4EG1A 1XNGA 1VBNA 4C4TA 1L8LA 1NVVR 3MQ4A 3E5RA 3JAKA 3MCZA 3VO8A 3DE7X 5AW2A 1EK0A 1PJQA 1SBQA 3GIDA 4AZ0B 2WVHA 2YVUA 2B4AA 1RWMA 3H2YA 3ND9A 4RK6A 1ZW6A 1AS2A 2IYXA 3GJTA 4DIKA 3IV9A 5P8WA 1EM8A 1L5WA 3CC8A 4YA6A 3WGJA 2PU7A 1ZWKA 4JP3A 4WRRA 3LGXA 2CDBA 3V42A 3NBKA 3OWXA 5HF9A 3V9PA 4ZQIA 3P0FA 5BV2P 2V0GA 1A9SA 2VQDA 3CEJA 1LSJA 1QHXA 1NKTA 2ET6A 5CVVA 4RU1A 4DREA 2GN8A 1CB7A 2X6QA 3R7WB 4WBNA 2CB9A 2JK1A 5JMOA 5JHHB 4UPEA 3OHSX 2KPOA 1CV2A 1UZAA 4KOAA 4YP0A 5KQPA 5AKEA 4ZO7A 3LF1A 4J16C 1DFGA 5JZSA 2BGKA 1IOVA 3GRKA 3UJNA 1DWPA 4IOLA 1M1YA 2ZB4A 5EIFA 2HCBA 4Q05A 1XMSA 4FC7A 2H1LA 1A9ZA 2Z57A 3FTPA 3JQ7B 1Y5MA 4B3BA 3HXMA 1XRQA 5F7XA 5EKXA 3OX1A 2B4RO 2Z9BA 3ITEA 4K9KA 2XWBF 4Y98A 2J7KA 3NHWA 2QRUA 1XLVA 3MJSA 2QI9F 2IZ7A 3Q0IA 4FJ1A 4XR4A 4DV4B 1N1MA 1FP2A 3TG8A 4KQ9A 4ETIA 1MO6A 2ADFA 3RWBA 1TQHA 4NHEA 1MT0A 1FLDA 1EFRA 2O7SA 2PGJA 4LE0A 3DWFA 4LJ9A 1W30A 4MRMA 4C0QC 2FI1A 2YC4C 2PL5A 1I3NA 2Z2KA 2LP4Y 3N1UA 4ESEA 5CX1B 4URYR 2ZI4A 4Q39A 1NW9B 1HV8A 3RDPA 4RPGA 1EFCA 2DFKB 4AUNA 2BEWA 1ND6A 4R40A 2XB6A 5AHRA 3IDZA 1HEIA 3USES 5E6RA 4UC0A 5CEFA 3BREA 4LHXA 3V8MA 2J6BA 4YK7A 1KTVA 3DBRB 1JHXA 3IOMA 3K6JA 3KRTA 4S2EA 4AJ2A 5ENZA 1GCIA 1TDJA 2FEOA 3CF6R 3GYGA 2O14A 3QPWA 1RYYA 4I3GA 2X8BA 3MC1A 3U13A 3F7OA 5TIIA 1QORA 4L3OA 3L84A 2XMBA 3UG6A 1M1UA 3JARB 5FWYA 1SZDA 1FSGA 3QE0A 1WCYA 1KPHA 2ZJ2A 5I51A 1HXHA 4A92A 9MHTA 4CLOA 1C29B 1VMAA 2G6BA 3A4TA 3H87A 3RH0A 1MDFA 3I6BA 3LO8A 1DBSA 3LW7A 4GPZA 4GSKA 4YBZA 4ND7A 1SU4A 1UBHS 4C88A 2JEOA 4MI9A 1KJYA 2OCGA 1J8YF 1G6OA 2O0HA 2E89A 5ITWA 3A6FA 1TK3A 1KS9A 1U8UA 4KMSA 1T0JB 3N74A 1X7ZB 4S24A 3RJMA 5J58A 1ESZA 3QKRA 3A26A 3GJQA 4P83A 4TWBA 1JHVA 3AEKB 1OW3B 5DM70 3VDNB 5JCPA 2BEKA 1W4BA 1TI7A 4CDNA 5AXDA 1QH9A 1OV6A 1N0HA 1WTAA 4GYJA 1AKTA 3CN9A 3GGPA 4II7A 5TV2A 5BUCA 3IVCA 4J0EA 3EMVA 3EZNA 2H0RA 2I87A 3QEAZ 5F77A 4PGMA 3GJ0A 3WNVA 4IIYA 4V0MA 1UKCA 3DYVA 5H5JA 5B58C 3DKIA 1N5MA 3L1HA 1OX4B 2PMKA 3OPQA 1SC3A 1ADCA 2HB6A 1PK7A 4IHAA 4URWR 1RLJA 3GP8A 3SQXA 4S0XA 3SXUA 1H8HA 1XFAA 1DWOA 4K1LA 2VYFA 2Y1KA 1JQDA 3FLBA 3W2HA 1Y82A 4P7BA 2QSUA 2V65A 4Q82A 3PENA 1E69A 1SVIA 1QZTA 1XAGA 3VU9B 4CM8B 2GT1A 2PRIA 5IWAB 5G4KA 2R6DA 1QHYA 5DHQA 5I8WA 4PLYA 5JECA 2FRDC 3P9QA 1L7XA 3SDZA 3VI3B 1Z9BA 5IKEA 4XPZA 2O9JA 3TR6A 2W6ID 5DCLA 3ZYZA 2G76A 3RQIA 4NWIA 3IGFA 2A0UA 1KDYA 3PTAA 4TRRA 4B4VA 2O2EA 2ECQA 2GM9A 3QLVC 4QYXA 1YI1A 5AJHA 2XDQB 4V1CB 1I9GA 3QPAA 4AJEA 4QUBA 5IDQA 5CA0A 5J3JA 1ANKA 3QTLA 4PX5A 1VP9A 2ZI5A 3O82A 5FTLA 3ILSA 4PPYA 3NJ4A 2JAPA 3CE9A 2XBMA 5AK3A 1BVUA 5CTJA 4JCCA 3ZDRA 1M34B 3L4BA 4Q4DA 4XPIA 3IVGA 2EYUA 2WAXA 3KHSA 4GGPA 3JZAA 4PBSA 1XTQA 4PLWA 4WUTA 1ZUWA 3B7GA 2WG0A 1TJ4A 2X14A 4CQJA 1PJCA 1KO7A 1U2QA 2EP8A 3NCTA 4WLEA 3WK4A 4BZPA 3DVQX 1RWXA 5BVGA 3ICCA 3TIVA 3C3XA 3QXSA 1NBMD 1DQYA 4W5RA 5F12A 2OB2A 1E89A 1W4LA 2EC5A 2FOLA 2FPWA 4J4TA 1U0GA 1E3TA 3LYAA 5K3BA 2VNJA 3R09A 4L75A 3VOAA 3C3DA 5B1IA 2CHFA 3T7JA 3JWJA 3EYWA 1ORTA 3KDAA 4BVGA 3T99A 1PTKA 3SF0A 1O94C 1RWOA 4S1NA 4WV3A 2HUPA 1Q7CA 3Q7QA 3ADBA 3CVUA 1IJKA 1VPWA 3DV0A 2WAMA 1L7RA 1VMDA 1YRHA 3FUWA 4XH9B 4QFDA 5FOUA 2NUTA 2CVOA 2R7AA 1WXIA 4NH4A 4PAWA 4O3MA 1XVVA 5EC8A 8AT1A 4O02B 2GH1A 4EYOA 4RJJA 5EMLA 3RR2A 1RAFA 3WZ2A 1XLTC 3F7NA 1Z0ZA 4DV6B 3GG9A 1MF7A 1VBFA 3KR2A 1QU3A 3C5HA 1QRRA 3OZUA 3WB9A 1MA3A 3GUCA 3ODGA 1UKZA 1EM6A 2EFHB 2FSVA 4PC2A 1EXWA 1VMEA 2DTDA 4ZAGA 1S2MA 2NMVA 4AN1A 1IUOA 1G8PA 4WVLA 3RHTA 1ECCA 3AUYA 3DW1X 2ILTA 3LE8A 1ZK3A 4TM8A 5IAJA 1GNLA 2BMFA 2C59A 3TPFA 3TOXA 4B3HA 4Z7NB 1QWOA 3SHWA 2BRUC 2G17A 3EARA 1JQBA 1CUDA 2FN9A 1E32A 1GTG1 2J30A 2JFHA 3HCBA 4OAPA 4X44A 2GFQA 5JD5A 2E5LB 3GEIA 3RK1A 5AKXA 3BULA 4W1PA 2PGDA 3EUFA 4GI5A 1C7FA 3K7EA 2O59A 3QUTA 1QXSA 2PUEA 4C0JA 1EJ0A 1G2OA 1W9MA 2C2YA 1G41A 3HFSA 4JLWA 1GL7A 1QWSA 2RGCA 1RRFA 5AK4A 1KK3A 3KKKA 3QV1A 1IC6A 3HJAA 4WKCA 3STUA 1AA6A 4B33A 3ENZA 2BFOA 4UBIA 1C8BA 1G60A 2IYZA 2C9OA 3CLUD 1QYIA 3FB4A 1V25A 2V9ZA 3GVHA 4HLDA 2WV9A 4DZZA 4EO4A 1MAHA 1SK8A 1J1IA 2VDMB 2LV8A 4G5SA 4PAQA 2ZK7A 3BMCB 3TEFA 1ZVJA 4BLQA 3FTFA 1XRPA 1N6IA 1PE0A 2RKWA 2XCLA 4IY1A 4JJZA 2QL5A 2GR9A 2Z4TA 4NPCA 2NNWB 4TTTS 4I81A 1TVKB 4XIGS 3U9TA 4D3XA 4R1LA 5B64A 3EGEA 4EM6A 3MCAA 3R0QA 5CB4F 4KQ6A 2PO5A 2OB1A 4JGGA 1GY8A 1YQWA 2PPLA 2HK7A 3AF5A 3RTGA 5T64A 2D7DA 4KQGA 5EWLA 2E37A 4G84A 4MI1A 1XEWX 4H7DA 2MSKA 3BTVA 2FUCA 1SC9A 4JFAA 4N39A 2WYWA 4C4OA 2PFGA 5TMPA 5HK9A 1BXGA 3JATB 3QIVA 4E5NA 4QXPA 3U0VA 2ZUWA 2MYNA 4WBSA 4JLPA 4DYDA 3BJRA 4NOLA 3KKZA 3U9LA 1NAIA 4R2HA 4BWGA 1ADJA 4QOHA 4QJ3A 4QJBA 2AC7A 1ZGAA 3Q72A 4QZVA 1S2OA 3ETLA 4WT7A 4BNUA 4D81A 3A1UA 4R9VA 1N2XA 3D7RA 1KE2A 1RQ7A 4BMCA 3COZA 5LMCA 1W76A 4RPHA 3BOSA 3DBIA 3ZXYA 4BFSA 4MAAA 3WYEA 2JBAA 1KZHA 4FGKA 1CEXA 3E8XA 3JQ8A 1ZONA 4K9LA 2WIGA 4R31A 2V7XA 3TH5A 5EJFA 4DMRA 2IEYA 4R69A 4D9IA 1P6QA 1FS5A 4GKAA 2CV0A 1I7LA 1W88B 2A3NA 3QFHA 4Q34A 1O0CA 1GRQA 1KORA 2F9FA 4H6WA 4MQEB 5FO0A 2IV7A 3E5HA 3DEIA 2G3YA 1DP4A 3WK6A 4ZJPA 1UJNA 1FU4A 3GW8A 1PTJA 4ID3A 3R7DA 2DP4E 3C39A 4GI7A 1ULHA 3T9DA 1QQ6A 3AR4A 5G40A 3EVFA 1PBTA 4XVHA 3LKZA 2RHCA 2RAFA 4FW9A 3CGWA 4IWNA 2V8OA 2NN3C 3AIMA 4PF1A 4NE7A 1UOOA 2ONCA 5KWEA 5HGXA 4B7ZA 1I3OA 1ODTC 3GRPA 3CKMA 4MW5A 5B58T 3UJBA 3PUYA 5WRFA 4BMXA 3AI3A 5C8DA 4KFCA 3IH5A 2IODA 1NQOA 2AFIE 4JBLA 3WNZA 1YVPA 4P4GA 1NI5A 1N6RA 3H5WA 2QLJA 1ZCFA 4ATNA 1H1TA 2XDYA 1V8PA 4F06A 3JQAD 3PJFA 1CRQA 4QYTA 4FLFA 1Z0FA 2IHZA 1KSHA 3MWEA 4KFTA 4KPUA 4TMXA 1BEZA 2VH1A 3HG7A 2W7TA 8ADHA 1TYBE 3DDSA 3PGMA 4P5DA 4RQAA 4HDSB 4X84A 3D8BA 4NYJR 3FM9A 1AQYA 4YCCA 1RDFA 3V4PB 1NVGA 2SNIE 1J23A 4OUKX 1QP0A 1E3MA 1C7ZA 5LP6A 2YIJA 3P9SA 3UHPA 3W5CA 1HNNA 3KU4A 3IKTA 3PDJA 2JJ8A 4ADSG 2VFAA 1AHPA 1ZHOA 3ZOKA 5JXWA 2F7SA 2H9AA 5BQ3A 4EI8A 2AZTA 1U8XX 1M8KA 3GBSA 1A1SA 2EKPA 4MYCA 5CJPA 2WHQA 3WL7A 1QKKA 4ON9A 1FCJA 3MQFA 3REOA 3WHLA 3QPDA 4XJXA 1KXZA 3U49A 3E2PA 3FF1A 4KQ2A 2E87A 4PG7A 5FT9A 2OA0A 2JH9A 1T8UA 4BQPA 3LX4A 2WIJA 3D6JA 1GG2A 4HFJA 1S3SA 4F6LA 4ZVQA 1L5MA 2LKCA 2ZRNA 3C14C 1WHSA 4TLDA 4CI9A 5HPYB 1BCSB 3OCCA 3UB4A 3P7MA 3R9WA 1WS6A 4Q3DA 4V39A 1PJ4A 3QVOA 1ZJ6A 2C7BA 4Q18A 1GVNB 5A03A 5BMVB 1YRAA 5BXYA 4Z0HO 5EUCA 3TLGA 1VCOA 5KOJA 3U61B 2OHXA 3ZX5A 5A2GA 3QG1A 1K68A 3TS1A 5JNWA 3Q87B 2W6IA 3UJ3X 3LMKA 4Z99A 4K28A 2HOQA 3I9LA 4RGVA 1ZMBA 3CIOA 5MN6A 1PL8A 5LYJA 1KZ9A 1N1GA 3UNXA 2Y27A 2A67A 3E9MA 1GGMA 1DSSG 2FDRA 3W8NA 2PV7A 2AN5A 4WJZA 3V33A 6Q21A 1V1MB 4MQLA 1T4BA 1R6TA 4O63O 4HSGA 3GGCA 3FKSD 4YC7A 5AFSA 2LD4A 1NULA 4N03A 4GMHA 3PPVA 5CPFA 3UMSA 4C5AA 5ADWA 1OI7A 2XYHA 3AJDA 5I5GA 1U31A 3NPMA 1GQ2A 2BGJA 1X38A 3CR8A 1MC1A 1NBMA 2GJ9A 2V58A 1J1ZA 3LQQA 4TTJA 5ECYA 3S7TA 3QKSA 4F1KA 5DASA 2YRFA 3U44A 1T9KA 5BT8A 3KJEA 2VK2A 4K6GA 4FYWA 4H7FA 3CNEA 3OOJA 5HRUA 3ZIAA 2AEEA 2YOFA 2AOVA 4C7OA 5K05A 1SJ9A 4MITA 2IRWA 2QTZA 3IAM1 4WESB 1W1IA 4IHJA 2CL7X 4JI4B 1WO8A 2RKBA 1JTVA 3LT5A 3NFYA 3REGA 4EG4A 1R9NA 4JR2A 4HTFB 4TLEA 2W4QA 1X7DA 5FEUA 3DWIA 2IDJA 1ZY2A 3PITA 4YV7A 5ITZA 1NTOA 5EVCA 1VIAA 2O7RA 4J7UA 4D4HA 1C4KA 2XW6A 1SGWA 4NOMA 3TXYA 1N36B 4LOLA 2EEZA 4D6XA 2D7CA 3TECE 3UA4A 1P61B 4R2WA 2BHLA 4CE6A 5ISMA 4OGWA 3EA0A 4Z4GA 2XE6A 2P6MA 1W4RA 4TS3A 3S1SA 4NYMQ 3ZHOA 2YZ2A 4DRXA 1VKZA 2TMGA 3W5IA 3A3PA 4L07A 4P58A 2KWIA 4X1IA 1ZL0A 2OBLA 2OHOA 1GT91 2ZBDA 3BC1A 3JZFA 2VHQA 4NQZA 4GMGA 5HF6A 5BO5A 5BVHB 3EPLA 2HJRA 3AT1A 4WH0A 4F3TA 4F6CA 3DNPA 3M33A 4FDLA 2ZBGA 1PV4A 5DH9A 4ZTZB 3EAFA 1HYEA 3ER6A 1DX4A 4OA8A 3WVNA 1L2TA 2H4WA 4PHGA 5DGCA 5ADVA 5KUTA 4LMPA 2AV6A 2Z2JA 3DLCA 2EFYA 4KQEA 4A0GA 2CD7A 1WRBA 1D9XA 5EE1A 4RGQA 5GY7A 1Q0UA 4B5LA 5JNLA 4MCAA 4DM7A 3GUHA 2A0WA 4IILA 1W2GA 4FXOA 1LBIA 3AOEC 1TZKA 4Y9SA 1UBEA 4FT2A 4AZ0A 4OJQA 5A4KA 3EEBA 3LLVA 2YMQA 2GD6A 3BDVA 3EZLA 4YUAA 3ZCSA 2OV3A 2I3BA 1W48A 2GDZA 4PY2A 2OWDA 3QF7A 4D57A 2ZUSA 3H1EA 1P4SA 3ORFA 2RJNA 2QTLA 2NQ2C 3S44A 1Z0IA 3HMQA 3ZE0B 4C4XA 1HDOA 2ZIGA 4REOA 3BICA 1D6NA 2XUGA 3WQSB 2D5CA 3AP3A 4G85A 4WDRA 4FGUA 4OKNA 5AOVA 1AMNA 1B2LA 1A7AA 1IB6A 2J07A 1KVRA 2P3SA 3R7WA 1ZEJA 4JC4A 2QKYA 1Q19A 3IBCA 1BKSB 1I4DD 1KMMA 2QTRA 3O2NA 4RLHA 2FR8A 5BMOA 5ADUS 2A1TR 2BM8A 3PD1A 1O58A 3U7JA 4GKVA 4K7JA 4YY3B 5FR2A 4UD2A 1X15A 4HEQA 2QX8A 4YRBA 1X1SA 1Z4OA 1W0KD 2EL9A 2YZKA 1I7SB 1VPDA 3JQ7A 5L3QA 2OCKA 2WTNA 1RP1A 1N8SA 2DKNA 2O2GA 3UOAB 2XWQA 2OLKA 2JVKA 2YINC 4B6PA 1CQJB 1BXKA 2X19A 4JXZA 4U39A 2Y92A 3C7KA 4MWGA 3B9RA 2BM9A 3HJGA 1JIKA 2PCJA 4JX9A 4LKRA 1Y1TA 3HV2A 2GAOA 4RW0A 4J1TC 3LP8A 4JN6B 1I24A 4UDOA 3BK7A 5A7GA 3SJZA 3NWPA 3IIIA 2YUTA 4AECA 1ESNA 1SELA 2Q3DA 3BGDA 4R8LA 3D4OA 4R51A 3RHZA 3HZOA 4S1WA 3MJTA 3C1UA 5EOVA 1CRLA 1BXRA 2PVSA 4P4LA 4KQKA 1H4VB 1PYGA 2R8BA 2YWEA 3DBRA 3EMKA 3HXKA 3OU7A 1TVEA 2QD1A 2W2PA 5F51A 3KOMA 3UB2A 4BNIA 2JRLA 4IGFA 1A82A 4IHKA 4F1JA 2H1VA 4HZGA 3KELA 2WUVA 1JDBC 1WD7A 3T7RA 1R6AA 2YRXA 1H94A 3BXXA 3GOQA 4CQNA 1TKAA 2SICE 2D62A 4UAGA 4FYPA 1TKRA 5F3DA 3UHOA 1U1CA 2IYYA 1ONOA 2R5WA 5AUPB 3SN6A 5H3CA 1YTUA 3AZQA 3CW8X 3PF8A 4UBOA 3T0GA 5J1TB 1QCZA 3GYBA 3CVXA 2WU3A 2PLAA 3JQAA 5KDLA 4PAOA 4J7XA 1GCGA 1RLMA 4G5XA 1TCUA 3GFQA 4RSRA 4YPVA 4YN3A 4HNSA 2OCLA 2XODA 4XDHA 1X7ZA 4KQIA 1CY7A 1QK3A 1UK8A 2RFLA 2Q8QA 3DXZA 1ZJ5A 4NK5A 4L2IB 3I9KA 2AT1A 1X1EA 3AEKA 3OM1A 4MQFB 1XXHA 1ZW1A 2H31A 4YB8A 1T9CA 1OXUA 1VJDA 3O31A 4BO2A 2QZ9A 3RGGA 4TZ6A 2WFLB 4V0RA 2OOSA 3FD8A 1RTTA 1DQZA 1JLLB 4BRWA 1QNFA 3DKVA 4GPAA 2HCTA 4COOA 4MVJM 1DKNA 2EVWX 3KSBC 4XQEA 1NATA 3S1LA 4EY8A 4LDNA 4MI6A 5HIAA 3JRXA 4JZYA 3HU3A 4TV8F 2OG1A 1L7AA 2QRHA 1N6PA 5BWBA 1Y9AA 4BGEA 2ZI6A 1PNOA 3DTYA 3ANXA 5K8VA 2FN8A 2PUBA 2I2WA 3A31A 3K92A 1T91A 5DGIA 2OFPA 1DCFA 3T5GA 4XM1A 1F4PA 1SUWA 3TM5A 1BHSA 4N3BA 2VF4X 3BYZA 3TNYA 2VJQA 4YHHB 4XRGA 1R3UA 1YZTA 1O3YA 3VU9A 4CM8A 2WU0A 1TZ2A 3ZV6A 1JH9A 3OTIA 1ONNA 3KFXA 5HMLA 3VJMA 2EIXA 4MB0A 1NDHA 1AKRA 3OC0A 1U7OA 3OO0A 4AX4A 2R68A 3B82A 4F4CA 4IFTA 4Q02A 4AQDA 3BE4A 3AY6A 1N2ZA 4P34A 1U1FA 1GSHA 5FQOA 3FZQA 1N7JA 5TPWB 4GICA 2FPGA 2XDQA 1O97C 3MWYW 3C8ZA 2ZYVX 4IS3A 3L9WA 4KR0A 5TQ2B 4L8LA 3WDSA 5JWRA 2WAAA 2G9UA 2GBIA 5C8VA 2HHHB 1AURA 1L5FA 3IKJA 4JP8A 1GILA 5BNFA 1JWLA 4KQFA 1VL2A 1GYQA 1IZZA 4I4NA 4X00A 1M34A 4DDWA 4Z2AA 2NIPA 4HVTA 1K8ZB 3QXCA 3RK4A 4IVNA 5IKOA 4ZI2A 1V45E 1GTZA 1XPJA 5AKJA 5ALOA 3PXAA 1ZM9A 4JZKA 4JT9A 3UCEA 1T3GA 1XBTA 4I1RA 1YQXA 4BLPA 3FWKA 5BR7A 4IXDA 1NMYA 4K81B 3AJRA 2PIDA 2LNDA 3U3OA 1JG6A 1T8YA 3EJ6A 5ECDA 4H1WA 4ZHQF 3AY0A 2E1RA 2AA3A 1IUNA 1FL9A 2RCYA 3G2LA 4L9WA 4TOIA 5JT1A 4LVCA 4YCDA 1WPGA 2Z5FA 1XZEA 3U4AA 3W6UA 1MW8X 3RU2A 5JSZA 2Y67A 5B7QA 2QJFA 4OBWA 5T57A 1FNSA 4LY6A 1QHGA 3QEMA 4RHCA 1LC3A 5I9MA 1T29A 1XR3A 4GI2A 1PD1A 2ZJ6A 2Q21A 1UEXC 4WSOA 4B43A 1XL0A 1GYRA 4JLAA 5T4HA 4OHCA 2PAFA 2ZT5A 4XXHA 3UG7A 2QX9A 2G9QA 3U2QA 1NBEA 2PWAA 2AC2A 4EHAA 2WI8A 5EJ4A 2R8PA 1AKUA 5JDCA 2ZIFA 1SBNE 4EG8A 4C0XA 3P9IA 2ZQYA 4IJMA 4DIFA 2KMLA 3KSDO 1SCBA 2ZUUA 1CJMA 1EE2A 1MAUA 3AGPA 3ILHA 3KZMA 1YNOA 1UEJA 3AHJA 3DVRX 1NMSA 3L0DA 3IA2A 5AM4A 5IK2A 2XTMA 3AEUB 1FFWA 2B1RA 1GLVA 5DYGA 4KH0A 4E32A 3NBXX 1ZFNA 3FSGD 3CSUA 1H2AS 2XJ9A 1OGYA 4LPKA 4LV5B 1QTRA 4ZRMA 1RYMA 4YP1A 4R1MA 3TSCA 1YHNA 3FJYA 5FPSA 1CNEA 2CJPA 3DDCA 1SD5A 4TL8A 4AZVA 1V35A 2IUUA 1XRRA 2FETA 4Q9KA 1KAHA 2IH4A 3VU0A 1CQWA 1LBHA 1AGNA 1X8LA 4EFKA 3KJHA 2C04A 3MWJA 3OIDA 1PR4A 4OXRA 1GUFA 2UVPB 2X77A 1OYVA 2WOJA 3N8HA 2R11A 4RS4A 4LCBA 3T3PB 2XMGA 3D8HA 1NNI1 1YGYA 1TVKA 2QIOA 3K94A 3K73O 4TS9A 4UBKA 3NNNA 1P33A 3QU9A 3TLKA 3AJ8A 4AWXA 2HRQA 2I67A 4RKRA 3O8QB 4H0FA 3C3WA 1UPBA 5AWFC 4G4JA 3RBZA 2BC9A 4QDTA 4TVKA 3ZWVA 3TNLA 1QTNA 2I7CA 2VJKA 3ONVA 4ITVA 3UUFA 1SN7A 4F6RB 5A1JA 3OHMA 3P2JA 3I92A 3KLOA 5BNIA 1KQFA 2A5GA 1BQ3A 3JATA 4BZWA 4WY8A 5IZCC 2JAXA 4HN4B 4DLUA 4LHEA 5AMXA 3KKNA 2E1PA 3LA6A 3TQTA 1JNXX 3TSAA 1OF1A 1G6Q1 3HP4A 3N3AC 2R4TA 1J90A 4O2BB 3AESA 4ZVVA 4RDIA 3CR3C 1TM1E 5TSDA 3H18A 3H1PA 2ID7A 4HGZA 2WM3A 5AVXA 5DPMA 4U5QA 4L7QA 1A5AB 2LCFA 4FFSA 3O8CA 1MU0A 3NGLA 4HB4A 1IHDA 4HUQB 4OKSA 3O2QB 2HBQA 4R2IA 5CTAA 4BNGA 4CQMB 1IBRA 3W7AA 3I5XA 1O0BA 3KALA 4AVYA 1XG5A 3BGIA 1XQWA 4JEMA 1VCMA 4CT5A 4IDCA 3HUDA 4C04A 4QT4A 1W88A 1QVAA 1SCUB 1WVMA 2A58A 4MQEA 1N2GA 5CURA 2JHGA 4W63A 2D2VA 4K87A 4KODA 4M0DA 1W25A 4Y6QA 1EK1A 5KTOA 5C52B 2FW8A 4B75A 3FBGA 1NURA 1WB9A 1SOVA 3SSMA 4XRRA 2RGWA 4L5BA 3WFZA 4H7HA 3TAXA 4KMOA 5DE3A 1XXLA 3EZ2A 2VHXA 3BHIA 3EW9A 4N7MA 4QOJA 3OBBA 4UUQA 2ZUTA 1BG6A 3SZMA 4QOEA 2Z6UA 2B2XA 3SP1A 2G7MC 4B9AA 1PZMA 3IIJA 4Q9NA 2BZGA 1P73A 2XD4A 4OHKA 4AMBA 3B1VA 2GNOA 2HREA 2L2QA 1T35A 5JFOA 3F78A 5LDDC 2P3OA 1PX2A 2CJFA 3NHLA 4B34A 1R0XA 1H0KA 3KSZO 3EOAI 5F1KA 4L27A 4EY6A 3I8OA 3GO4A 1PS8A 3HEMA 1NPTO 4KU4A 1RLTA 3IO5A 4O2AF 1G1MA 2KHZA 5IMBA 1NMZA 1SWVA 4MOWA 1L5NA 3WMXA 3RVOA 4EK9A 4Q7KA 4HDSA 2B9EA 3A70A 2X3FA 5HHTA 5L3SB 3E3OA 2F4VB 1VI2A 5JH7F 3HB9A 3MUNA 5E4JA 2WUFA 4QDXA 5EQDA 5FYDA 5IRCD 3E81A 1CNMA 1TM3E 3TSOA 5AI9A 3ITNA 4X54A 2QGZA 2DPXA 1IQUA 3QLTA 1LNSA 3HFRA 5EWJB 3ZLBA 4LYGA 2ZRMA 3KT6A 4UVGA 5EERA 2BMDA 4YRFA 5TT0A 1E2PA 1ZXXA 2X9GA 2ZYHA 3TZBA 4L73A 4FTWA 3WGLA 3LPCA 5A6SB 2W48A 1J0DA 1VBKA 3S2FA 3UB3A 4XCVA 3FOWA 1GUBA 2QUAA 2UDPA 2I6XA 1BCSA 3U62A 1FDIA 1AGRA 3P1JA 3A1EA 3ZDCA 5BMVA 3A36A 3I52A 4HNUA 2HSWA 1T8RA 5L53A 3VH1A 2FZ4A 2O5VA 1SHKA 3H8WA 5FWXA 3AW9A 3N2YA 1WD5A 3TYXA 1DADA 2QG9A 4X24A 3S2UA 4DWWA 2HEIA 3DFUA 1KQNA 4LJ6A 3U40A 1QYRA 2A14A 5ICCA 3WGTA 2DLCX 3M5DA 2QTCA 2P4UA 1Y63A 4Y2SA 4F46A 1PJ2A 2AR0A 1DFIA 1FX0B 4XB1A 3RANA 3BBLA 3TVTA 3DMRA 3WLFA 5KJFA 1I7NA 2EX1A 2G67A 3GARA 4Y1GA 5TJHA 3NEYA 1QVRA 5FUWA 3D4LA 1G5QA 1XKXA 5B5SA 2BTEA 1V1MA 1STOA 4BQOA 4NENB 5LOVA 10MHA 1ECPA 1QIDA 1Q0QA 2AFIB 3KUUA 3RKRA 4JODA 1Y7PA 4ZT5A 1BX3A 1PJZA 1WQ1R 1XDGA 1SVSA 1IEWA 2I76A 3A1WA 3IQHX 4YECA 4DDHA 3O7WA 1WY5A 2YJ6A 4LQDA 4QXMA 1MG5A 1YRYE 2IPMA 3B1JA 4LDRA 2FFBA 4W1SA 4CMCA 2DE0X 4PO1A 3G8BA 5DNUA 4C3VA 1EE1A 1MTZA 2IVZA 2Z2YA 3ROXA 5JI2E 2YUIA 2MR6A 3PTZA 1Y5RA 2HQRA 4AKIA 1YIOA 4H4EA 4KOEC 3QKTA 1IIRA 3DZGA 3G2IA 1NSYA 4O5OA 4WESA 1GWNA 1ONBA 4URHA 4Q24A 4XYBA 1S9HA 1N2JA 5FPTA 2B20A 3RS8A 3C8DA 3X1DA 2ORWA 4BNNA 2ACWA 3OHPA 4HTFA 4DLPA 4PTLA 3V8QA 1FC0A 3L07A 4K86A 1M1XB 1MG0A 3ZHZA 2CXQA 3HDVA 4R8SA 2BDEA 1K8QA 3WTBA 3IQGX 4RSHA 2Y2UA 1MQSA 4Q03A 1OFUA 3MJVA 5H70A 1GNTA 1J8VA 1YDEA 3GAFA 1PQUA 4BEVA 2O0KA 4FHEA 3LUAA 1R16A 4YALA 5BYJA 3KQVA 5JYCA 3E9YA 2YTZA 1E8NA 4M37A 3VR6H 3ZIAD 3ZV5A 4DCJA 2V6FA 5DM1A 5ALFA 4Z7OB 1RQNA 5JSQA 3BFKA 3NVMB 2Q3CA 2H4FA 3KTDA 1R88A 4UVIA 4R83A 2ZSUA 3FCAA 1GV1A 4PINA 1W7AA 3FTEA 5IU6A 3G8CA 1KEVA 1DEAA 3C5EA 2JH3A 1T8WA 3RV3A 2K7FA 2F43A 3BCRA 3FSGA 4AW9A 1T1EA 1EUYA 4FFOA 4DV5B 2I3AA 5AUQA 3SC3A 3D0KA 5LSAA 5I4BA 4F7WA 1EZZA 3SJUA 3IBYA 2Z6VA 2ZT8A 4H6VA 4RPJA 3ICWA 4LRWA 1JHDA 3IJPA 3OCXA 3EG9B 3K2IA 3ISVA 5HX7A 4ZT3A 4ZREA 4JI1B 5BWLA 1HNZB 2GAIA 3I6QA 4N5LA 4QBTA 3ZHUA 2QTWB 1MPTA 3A4LA 4FKZA 5EHZA 3ZE7A 3ND7A 4M9CA 5HIIA 5CEJA 1XX6A 4KO2S 3D3WB 5K8CA 4POAA 3X1XA 3BBPA 2ZJ4A 1SQ5A 3HP7A 1SPXA 1J8QA 3E23A 4GQBA 3QI7A 3RTDA 2IS4A 3LF2A 1UXJA 2W37A 2YHBA 1CUYA 5L4SA 4TT8A 5EJEA 4DA8A 2QE7A 1ZD9A 2NVOA 1OTYA 3VTFA 2OMKA 1KIFA 1EP3B 3OZEA 5BSEA 2Z3WA 2VYCA 1R18A 3OJFA 4N5DA 1EYZA 3LQFA 1B3RA 4CM6A 4CVNA 1AD2A 5AM2A 3A58B 3DWGA 4UXIA 3NUGA 1MX9A 1U5BB 1ZJJA 5FIUA 1QIFA 4MJ7A 2JHAA 4OI2A 2NOAA 4ALJA 4Z8XA 1JMKC 1LH0A 1U0LA 3AP2A 4I4TF 1CQJA 3NOXA 4PXAA 3H1AA 3K9LA 3FPCA 3WSTA 5I9LA 3O8NA 4FFPA 4NS4A 4BY9E 2PUFA 5H81A 1V4BA 3FOZA 2CWWA 2WB4A 2AOTB 3MUOA 3OLXA 3DOIA 3PR1A 4J3FA 4TM7A 2E3JA 3AR3A 5ALSA 4ZYYA 2R2AA 1E6WA 2I2XB 3QFSA 2Q27A 1CFZA 4ZWNA 1GFSA 5BQFA 3RSGA 4MDEA 3IBTA 4NULA 4KSBA 3I12A 4CQMD 4NU8X 1NVVQ 1WZNA 2HIMA 2XBLA 1RTKA 1HR0B 3TSZA 1Y6ZA 1UCFA 3FGZA 2J45A 5EEGA 4ZAVA 4OLAA 2PO7A 4K9RA 4TUYB 1R8JA 4NCXA 3IUEA 3FLEA 3P9XA 5CVEA 2J9GA 1F9EA 4KBYA 2HGZA 1TQ4A 4DYVA 1PZEA 2GN0A 3NI2A 3GPIA 1R5NA 1Z74A 4LNAA 1G8MA 2GEDA 1TM5E 1PX0A 1Z6YA 2FMHA 3CVYA 1JN0A 3EUAA 3BD6A 3F49S 1WVIA 3AHGA 9ATCA 1Q6YA 1QV6A 5IYZF 4E70A 1MIOA 2YCLA 3R3YA 5CDYA 3MK31 4FI3F 1OVMA 3F6CA 3M6XA 4X85A 5COAA 2Q4OA 4Y2UA 3TLXA 2IZOA 4LQLA 5L51A 3NHUA 4Q21A 2P27A 3FOBA 4JLJA 1U8AA 1J22A 4GZ3A 5IW8A 1RZUA 3ZBQA 2DU8A 4ZGBA 4NABA 3IR6A 4NMHA 1YZVA 2RHJA 2HRCA 5ALMA 2VT2A 5E7JA 1AUPA 3ZWXA 2G63A 2CMFA 4TMWA 3P27A 1P60A 1YSCA 4ZV9A 1ADYA 2OBXA 2YVKA 3I3OA 4F4JA 1HL7A 3K6KA 3VO2A 2Q1TA 2AG0A 1GGNA 1A9XB 4G5QA 1EWTA 1I2CA 1E9EA 4MQFA 2DCUA 3EDCA 1MJGA 1TGYA 1P39A 1C0KA 2X3UA 4HDOB 1JLLA 4YROA 4OK3A 5ALYA 3T54A 3H6HA 2ZJ5A 4UUAA 4BUZA 4C0KA 2JKYA 4GRIA 3BIFA 2JFZA 5J2TF 1KYWA 5IC4A 4BNFA 4RYDA 5IABA 1ECFA 3ZDBA 2BF7A 1QYXA 3PC8C 4ZT2A 5H68A 1DXYA 4XGIA 5HW0A 2DFNA 1P0MA 1I9CA 2G4CA 2JGKA 3LC0A 4QO8A 2XCOA 4M60A 2HA5A 2A30A 2E82A 4P33A 1LDYA 2EFDB 4HNTA 4QBGB 4GVLA 2V4MA 4DY6A 3GLKA 2FZCA 3AM4A 1MAAA 1VB5A 2Y1DA 3IPYA 2GAAA 1S6YA 3U4QB 1JLRA 1MVOA 3GUZA 2PY6A 3IHKA 4BP1A 5FORA 2JAWA 2ZVPX 3FWHA 4U7WA 5LIPA 4NMXB 4I6EA 1ISFA 4WKPA 1JQJC 4WK2B 3GQVA 4KN8A 2VT7A 4IP0A 3VSDA 1D6MA 1QYVA 5K20A 1P9LA 3PFBA 4RVNA 3UGKA 4BO7A 4BEBA 2Q5LA 4M0FA 4P54A 2BFNA 4F7DA 5KYWA 4L9SA 4B4WA 4ZZ1A 3IHLA 2DOKA 2VQ3A 3GLSA 5KVCA 4HH4A 4BFVA 1YUMA