4CUAA

Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
178
Chain Sequence
QGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRSNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGNEDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAIRIRMVKADNKRGTSITEVQIFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unravelling the Multiple Functions of the Architecturally Intricate Streptococcus Pneumoniae Beta-Galactosidase, Bgaa.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 43
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4cuaA00
3C7GA 4JX0A 4OZOA 3T2QA 4A4AA 3C7FA 1JHJA 1W8NA 2X09A 1UYXA 3PUHA 3IAQA 2DDUA 1NUKA 2W9XA 4LHSA 2EICA 5F7UA 3SKJE 1KGYA 4IUGA 2DCKA 4M4RA 2E26A 2J1UA 2J7MA 4XZUG 4XUNA 1NX9A 3NRUA 3ACFA 2RVAA 1GOHA 2JE8A 2XQXA 3T2PA 3WF0A 2VZRA 2VCAA 2JKXA 3T08A 4LPLA 1UXZA 1JYVA 1SG3A 3CDZB 1GOFA 1TVGA 3J7HA 1JU4A 3I2GA 3UESA 2C26A 2WUHA 1UYZA 1UMIA 4M4PA 1WCQA 2W87A 1IQDC 3WNNA 1PX3A 4TXWA 2DCJA 5JXJA 3LE0A 3LEIA 3A23A 2R7EB 1JYXA 3P1IA 3FN9A 3LPGA 2YFUA 3BGAA 2V5DA 4MGSA 3I97A 2QQMA 1K45A 2VZSA 2J1TA 5EJZB 1OT5A 3C8XA 1O8SA 2J1SA 2WBKA 4RN5A 3MUY1 3HN3A 2RJ2A 3WF1A 3UNPA 1XPWA 1D7PM 4ZZ5A 3A22A 1F4HA 5C70A 3DYOA 1UZ0A 1JZ5A 2RV9A 4XUTA 4CU6A 2WQ8A 5JR2A 1WKYA 1GQPA 3E1F1 3MV01 3SEEA 4XUQA 5IHRA 4P02B 3WSOA 3GM8A 4GWIA 2VR4A 2EIDA 3VD3A 1GUIA 4OMCA 4BDVB 2ZEZA 4P08A 3FL7A 4OMDA 3VD4A 4QDQA 4ZZ8A 2HYXA 2QQNA 2VO5A 2LW8A 2WN2A 1MPXA 2VM9A 1L7QA 5DPNA 5EJ1B 3WNKA 2XHNA 2J1AA 1GU3A 3I2HA 5LA2A 2QQKA 3SEPA 3OB8A 4CU9A 5JXGA 1JZ2A 2C4XA 5CZKA 1W9WA 2J22A 2W91A 3ZM8A 4QB6A 1GNYA 1W9SA 3HNBM 4CUBA 3FHQA 5LCWL 5B4XA 3I3DA 3C7EA 4UI9L 4A41A 2ZEXA 4UAPA 3I2KA 1CZVA 2W92A 1CX1A 2VQTA 4QX1A 2WDBA 3P6BA 3OEBA 2OKXA 3VDAA 4DUVA 1O59A 2Y64A 4MO3M 4Z2AA 2VZPA 2VOTA 1UX7A 1NAEA 1H6XA 4CU8A 3W5MA 2YG0A 4JKMA 2VC9A 2EIEA 3CIHA 4XVHA 3NQHA 5DMYA 3WQBA 3WF2A 1SHWB 3A21A 2XONA 3ACGA 4MOAA 4OUEA 2VZ3A 2XOMA 2VCBA 1W0NA 2J1EA 2QBXA 1CZTA 4P00B 4ARXA 4QB1A 2ZEYA 4BJ0A 3VDBA 1DP0A 4QX2A 3THCA 5FUIA 4TTGA 3IDAA 5JXHA 5EIYB 4KMQA 1T2XA 3U37A 2W1SA 3UETA 4BK4A 2V72A 2W94A 5JXIA 1HN1A 3JXSA 1CIYA 5JUVA 1NKGA 2J1RA 1JYNA 3ETPA 1UMHA 2YFZA 3K75B 1JZ6A 4QPWA 1BHGA 1TG7A 1DYOA 3T0BA 1LNSA 2Y6KA 3WF4A 3BN6A 2VMCA 2VMFA 1CZSA 4A3ZA 2WZEA 4GZ9A 2Y6LA 4DUXA 2QQIA 4BK5A 1XNAA 1US3A 1OH4A 2KD7A 4PT6A 1EUTA 5G04L 4ZXEA 3HPNA 3K77A 4D0QA 3ECQA 4PF1A 1ULPA 4QDSA 2YC2A 2X05A 1JZ3A 4CUCA 4DEVA 2W1QA 4CVUA 3C7HA 4A44A 4AAXA 5A1AA 4RYDA 2Y6JA 4JKKA 3LPFA 4DXSA 2E31A 1OF4A 3WNOA 1K12A 2Z4FA 1P8JA 2CDOA 1SDDB 3MBWA 5HXMA 3HJRA 4MGQA 2PQSA 2B4KA 2C9KA 4MADA 3HNMA 4L0PA 5DQ0A 2VZOA 2WO1A 4XUOA 4A6OA 3SKVA 4DUWA 3PUIA 4JKLA 4A42A 1J84A 1UY4A 1JZ4A 4A45A 4XURA 4KI5M 3T0AA 4JHZA 3CKHA 3OG2A 4YPJA 4DXTA 1PMHX 1EUUA 3NJVA 4XUPA 1W99A 5J1XA 3OEAA 1L7RA 2ZXQA 3VD9A 3HEIA 3VD7A 3MV11 2VZTA 1O8PA 3T0DA 2W3JA 3CZJA 5C71A 1OD3A 1KEXA 2WO3A 2VZUA 3AC0A 3OBAA 3EYPA 1UY3A 3NNGA 3I3BA 4W8JA 5C7GA 2WZ8A 4QAWA 5LA1A 2W47A 2WYSA 2VMDA 3T09A 3W5NA 2VL4A 4CUAA 2W1UA 2WABA 4HG6B 3D3AA 1PX4A 5IFPA 1DLCA 2BZDA 4DEQA 4QDRA 2ORZA 2ZEWA 3C7OA 1UYYA 1ULOA 2ID4A 1W8OA 1JZ7A 4GWJA 3WF3A 2VMEA 4BXSV 5IYYA 5IFTA 3GGLA 3WNMA 2CDPA 2VTFA 1UWWA 3THDA 3I2JA 4QX0A 3K4AA 2J1VA 3F2ZA 4OYUA 2JDAA 1UXXX 4D8MA 1F4AA 3K4ZA 2BBAA 2VCCA 1JYWA 2E32A 2VZ1A 3CQOA 3NJXA 4E8DA 4ZY9A 1R64A 1K42A 3HOBA 3WNLA 2QQOA 3CZUA 1XNTA 1GMMA 2QQLA 2BERA 2L9LA 4ARYA 4DXRA 2Y8KA 3DECA 2HLEA 4FI9A 1OF3A 1GOGA 5JMOA 2VJXA 4KWUA 1K3IA 4E8CA 2BGOA 2YC4A 3FHAA 2ORXA 3OGVA 3IAPA 4AG4A 5DN2A 5I0DA 2Y6HA 3MUZ1 5CYYA 2E33A 4ET7A 1XC6A 3ABZA 3VDCA 2EIBA 4W4ZA 5B4NA 3IIIA 4UOJA 2VZQA 1UY0A 2VQUA 1PMJX 3K4DA 2WN3A 3DYPA 1H6YA 5IJRA 4W50A 2W46A 1RYYA 2Y6GA 3HNYM 2BGPA 1JU3A 1YQ2A 3LEKA 3IB3A 4LQRA 3MO4A 1US2A 1W9TA 3EB7A 3I2IA 5G05L 1JZ8A 3LQCA 3ACHA 2W1WA 4QX3A 2W95A 2VZVA 3T2OA 2YB7A 1J83A 1UY2A 2B9VA 2WAAA 1JI6A 4QB2A 3OGRA 3GXUA 2JD9A 2V4VA 1UY1A 5LA0A 2W5FA 2LS6A 3GDBA 4P5YA 3WEZA 3WNPA 3DYMA 4LKSA 3I3EA 3VD5A 3I2FA 3OGSA 4PQQA 1I5PA 3CMGA 2WO2A 2X10A 3K46A 3LEGA 2WAOA 3A7QA 5HPOA 3ACIA 2QQJA 4CU7A
chains in the Genus database with same CATH superfamily
4A2UA 3VV1A 4KNCA 4JGZC 4LBQD 4OZOA 3HT1A 2Y26A 3OGGA 2A3WA 1IS5A 4P9WA 3O1PA 1G86A 4A4AA 4KG8A 4BQ5A 1QH7A 3AYCA 1C1FA 1JHJA 3O7OA 3OY8B 5L7OB 5CFDA 2WA4A 1HKDA 3OF1A 1VRBA 1ONAA 2ZGPA 4XW3A 1HDKA 3PUHA 4NHMA 3IAQA 5FY1A 2WNUC 2WZR2 1XSQA 3GJBA 2DDUA 3LA2A 3NL1A 5FY5A 4EROA 1NUKA 1RGSA 2CU5A 4LHSA 4FTBA 1IKPA 4FP3A 4GH4B 1AR71 1GSLA 1KGYA 1AJOA 5A3MA 3CJXA 2JB4A 3K3OA 1D4VB 4K8FA 3PNAA 3N9OA 3PUQA 4YG0A 4M4RA 1QOSA 5C5UA 1AR63 2J1UA 2J7MA 4YZ2A 4XHXA 3JB8A 2CGOA 4XUNA 5J37A 1NQJA 5JZGC 4CDQA 3BTAA 5DAVA 1GWMA 4AI3A 4XAEA 4S2DA 5HCBA 2XQXA 5ABJA 2VCMA 1O3SA 2VCAA 1POQA 2JKXA 4OLLA 3D8CA 1RUD2 3T08A 3WINE 2BOJA 2BW8A 1UXZA 1NG0A 4ASMB 2DUOA 4P9XA 3M3IA 1ZZBA 2YGMA 2ZGOA 4YW3A 1WCSA 2HWE1 2YYOA 3J7HA 5KHJA 3N36A 1JU4A 4KWKA 2XJPA 2PLV3 2C26A 1UKRA 2WUHA 4XJ9A 4MGIE 1WCQA 3HVDA 4J1XA 3VB9A 3KWVA 5F3EA 2RR12 2P6CA 5FOJB 1PX3A 2DCJA 1O3TA 1UL9A 5JMCA 4ZPIA 3O1UA 4YLZA 4BWOA 3LEIA 3VKLA 1RUNA 2R7EB 4BE3A 3M2MA 1C28A 1GP5A 3H1MA 2P5BA 3LPGA 4XCAA 4WVZA 3MIGA 3ZYRA 4LR4A 5EFUA 3WW3A 3I97A 4G3YC 2OVUA 2W52A 3PJYA 4MG2A 1K45A 1HRV3 1N3PA 1OT5A 1RHI2 2IWGB 4JCKA 2E7AA 5FMOS 3MUY1 3OUJA 5C4WB 1ENRA 1MEC1 4DB5A 1YUDA 1T6BX 4KL1A 1ULDA 5LBEA 3TNPB 1FOD1 1D7PM 4ZZ5A 5AFEA 2VOKA 4KU7A 2VVFA 5C70A 3V0AA 3DYOA 1T6GC 2RV9A 4TSVA 5C9AB 1ACCA 4Q0PA 5CFCB 4XUTA 5E6HA 1BBT1 2W0XA 2ZACA 3OJBA 4UFHA 3VZOA 5JR2A 1WKYA 4AGVA 1GQPA 4LKEA 4HKLA 1WZXA 3SEEA 4IV1C 3NV4A 4P02B 5JOYA 4LA3A 2DCTA 2WSUA 1PM4A 3ZFEC 4K20A 2EIDA 2RS51 5T54A 1ZRDA 1MZ6A 2Q8DA 2G9GA 1GUIA 4LITA 4YW2A 1MZEA 1PMIA 4W6WA 5IK4A 3RI9A 1EP0A 1BLZA 1MQTC 4BMEA 1UPIA 5FZ9A 4CCCA 3AKQA 4BA6A 2XBO1 1MEC3 4PLNA 4Q29A 3WR0A 4BZ4A 1YQCA 4G4FA 2V4AA 1TME1 2VO5A 3FX3A 2VM9A 3WNKA 2R073 2R30A 1BVP1 3RYPA 5LA2A 1E57A 3I2HA 4UF0A 5A7PA 3VBFA 1AYM3 4CCJA 2PQQA 3NNMA 5FXZA 3SEPA 4Y1UA 3RZGA 4AHXA 3ASIA 1FMD3 1STMA 4CU9A 4I09A 4UF0B 4AI8A 1D4M1 1E5SA 2C4XA 2JECA 2WNUB 3AB0A 2QDRA 4PIYA 1W9WA 3OPWA 4HVRA 1SPPB 4Q4X2 2JE9A 2W91A 1QXJA 1W9SA 4CUBA 2YROA 3FHQA 4TLFA 2E7TA 5CADA 2D6KA 3PVNA 1LECA 2BDRA 4Q4W2 1WLWA 3B3QE 2QDNA 5JIUA 2WR9A 4UI9L 4OHZA 3SH5A 3WG3A 4A41A 5BNOC 3BPSA 5L9VA 5FDBA 1WA6X 1ZVFA 1RXFA 2BOIA 5CIRA 1S0CA 1CX1A 1ALYA 2XBO3 1OVSA 2VW0A 2D6NA 2OQ6A 2ZX0A 1REEA 4H2AA 4O7XA 4NIAA 3OEBA 3ZSLA 1TME3 4DUVA 1ODNA 4C1WA 5ISLA 2WFF3 3LAGA 4Q0QA 4Z2AA 4GAZA 5LB6A 2VZPA 4DMIA 1S0FA 1YFWA 3IN9A 3WDUA 1NAEA 5FKCA 3I2DA 3B00A 4FPKA 4LBKA 1KS4A 4A7KA 3POIA 5HCFA 2XB6C 3V0AB 1W0PA 2XR4A 5T5OA 3O1VA 2OZJA 2B9UA 4HVQA 5IVBA 3H1WA 5JZGA 3WCSA 3AJZA 1QJU2 4CEWA 1Q8PA 3USUB 1JS9A 1O91A 4I0BA 2JG8C 2C24A 2IVIB 3WF2A 5CB7A 1CWPA 3A21A 2V09A 3JCIA 4XTPA 1TMF3 1KQRA 1FPN3 1CONA 2RM21 5F2SA 5FO7B 2QBXA 5FBZA 3MEPA 2HWE2 1PGSA 1VALA 4RS5B 3ZYGA 3ZSMA 5FO8B 4N8MA 4OZXA 5DZEA 2P3YA 2VQAA 1MZFA 2ZCWA 2ZEYA 5C3SA 4BJ0A 3EHKA 3PL0A 4CEYB 3O12A 5CFDC 3NV1A 3UKTA 5IVEA 5FUIA 2DBNA 3GBGA 1JOPA 1PK6B 3ZSKA 3ZYFA 3POBA 4QGLA 4Z82A 2EA7A 1PGL2 4R52A 3MIBA 4PDWB 4BOWA 4M00A 3IPVA 4AWDA 3LZZA 4H7MA 4E2GA 1RUI1 1DGRN 5T50A 1ND3C 2DF7A 3CBNA 3ZR6A 2KM2A 3ZYJB 5JXIA 4PI0A 3RWKX 4C0BA 4CDQC 1CIYA 3OCPA 5T52A 3N7JA 3F95A 1ENQA 1FOD2 3ETPA 3QLQA 1UOGA 4FPFA 2YFZA 1FV2A 4R9BA 3GBFA 5CU1A 2RG4A 3OYWA 1JZ6A 4OVEA 1A78A 1Y9MA 4LO4B 4QPWA 5FYYA 4V2WA 4Q0UA 4DOUA 4D6QA 1OVPA 2XDVA 1BBT2 1W90A 3T0BA 4RFRB 1W6OB 3MICA 1CAUB 3BN6A 5FTTC 1KDMA 1JN2P 3U1XA 4CDXA 2GMPA 4UBHA 2RS33 3ME2A 4QHOA 4BXFA 4DUXA 4D6RA 2IZWA 3VBHA 3ZIWA 1DQ2A 1KS5A 1XNAA 3OY8A 5FZGA 1US3A 4AGRA 1LHNA 1GP4A 3ZYIB 4TWTA 4H55A 5G04L 5F37A 1JYCA 4Q26A 4V2VA 1IHMA 1LHWA 2IXLA 1REDA 3K77A 1VMFA 1W6QB 4D0QA 1G8WA 1DIWA 1EAH2 1G9DA 1ULPA 1V00A 3KV9A 4QDSA 1M06G 4A7ZA 3HBZA 2X05A 1RUOA 2W1QA 4XABA 3AVRA 3C7HA 4N43C 1CAWA 4CP9A 2CV6A 2PHWA 4RYDA 2Y6JA 3PLQA 1V6JA 5FZ1A 1N47A 3WUDA 1DBNA 4Q0SA 1LGNA 1OOPC 1VBE3 1GR3A 2XH6A 3LPFA 3AZYA 4LXLA 4Q4Y3 2Z4FA 5FZ0A 4LT5A 2BGCA 3X29B 1QJFA 5HXMA 5CG8A 2ZHKA 5GLTA 3MW4A 1LODA 2JKBA 1UW8A 2PQSA 4CYDA 2B7YA 4MADA 4L99A 2BNMA 1J3QA 4L0PA 5HV0A 2Q1MA 5DQ0A 2EXHA 2VZOA 3VDDA 5KXBA 3OUHA 3SKVA 3MFAA 4CDWA 4GXLA 3R0RA 2TNFA 4GALA 4GMP0 4ZU5A 1XSRA 2R071 3KS7A 4DUWA 4QU2A 1Z7S2 2JG9B 5DABA 4CCKA 1I6XA 2YDEA 4N7IA 5JIAA 4CDWC 4CXYA 2W2IA 1RUG3 4UFJA 1KFXL 2UURA 4FPLA 2RR13 1EPWA 4XURA 3VLBB 4KI5M 2HWD2 3WDTA 4NO4A 5C8WA 3H8XA 3MGUA 3CKHA 2HWB3 4IEXA 4CCEA 3S0MA 2W39A 5GM0A 1IPSA 3DPRC 1H4GA 3WV6A 4DFSA 4CP0A 3THTA 3WG1A 5EQUA 1HX6A 1RJ7A 2DFCA 2UWBA 4QQOA 2AGSA 1W99A 1I5ZA 2VUCA 3ZN6A 2EIGA 2YU2A 3MV11 3ZFFA 4XAAA 5FAXA 1MS5A 3T0DA 1W8UA 1RUJ2 1DZTA 5KXEA 4P9GA 2ADEA 2QZ2A 4IV3C 1W6NB 2X5IB 5JSOA 1KD7A 3AC0A 1ZZ9A 3EYPA 3I3BA 3NSTA 1ODMA 2B39A 4W8JA 4YFZA 3FLRA 4P5HA 3KV6A 5FYZA 5IVFA 3MPBA 5J09A 4OQ8A 4HPKA 1YWKA 3KB5A 1AR92 4CEWC 1OQEA 3GNEA 2W47A 2WYSA 3ZDSA 1C8M3 2RJKA 5JVVA 1PVC2 3DPRB 3LB9A 4YVSA 4XC9A 1A8DA 2HWF1 1KXGA 5FYTA 3T3YA 3BYWA 5ANNA 1AL23 3J7LA 3ZXEA 5I8TA 3GHNA 1L7LA 3Q9OA 4NWWA 4QDRA 3VGIA 1N1TA 4UWDA 4NHLA 4MUVA 3S6PA 2A6XA 5ACA1 5FZOB 4EWDA 5DXDA 2ID4A 5E1RA 3I54A 2DU1A 4Z92B 2A73B 2JG9C 5FQ0B 4BXSV 3U0ZA 2GP5A 2X53S 4Y24A 4A3XA 3DKWA 2PHUA 3TEXA 2VTXA 3CJIB 3N9LA 4K1YA 4QX0A 3F2ZA 1RUI3 5I93A 3ITQA 1UXXX 3K48A 4RGAA 1IS3A 4UFMA 2BBAA 1JHNA 1SLLA 2I45A 2A6WA 4COUA 2XWJB 4NIGA 4Q8KA 1K5MB 3B94A 3ZXDA 4U36A 3BKZA 1PO22 2R1BA 4CDUC 2E53A 1DG6A 4PIZA 5JI9A 3CJIA 1FV3A 5HCHA 3MYXA 1NZIA 4ARYA 5AC91 2JE7A 3DECA 2YZ4A 2BPA2 3ILNA 1OF3A 2FDHA 2VJXA 5KWRA 1K3IA 3RZZA 2BGOA 3ACLA 1FX5A 5FUPA 2XXZA 4AFDA 3V0BA 2UU8A 3FHAA 1W3XA 3M3QA 3H50A 3ZYHA 5FMBA 2E9QA 3I59B 3R4UA 4FOYA 4PBOA 5K8SA 1W6OA 3UK9A 4AFAA 2WWSA 3WDYA 3LGRA 4EYUA 1GZCA 4XQ4A 1SQ4A 2Y6HA 5FP9A 4Q0VA 4AVVA 3IPVB 1RUF2 2HEVF 2WKKA 3I2OA 3RWNA 1Q56A 2JENA 4NAOA 1KFUL 3N9QA 5BXXA 1F9KA 3BVCA 2HYKA 2WWJA 5BYNA 1SLAA 4MGKE 4CCNA 4CCDA 4X6RB 4LBMA 3HWJA 2ENRA 2YV8A 4BQ1A 1SLTA 4C91A 2VNOA 4FOWA 2HWE3 1VBC3 1RXGA 3N9PA 3VBOA 2QQUA 1ULGA 2QE3A 3D5OA 3PUSA 1HRI3 4GA9A 4NOTA 4AW7A 2BGPA 1J3RA 4UXAA 2GU9A 3LEKA 2HWD1 1W3VA 3PUAA 4HSJA 4DRVA 4COWA 4N9IA 2IXCA 1UCXA 3EB7A 5CA6A 4XFHA 3ZFFB 3R05A 5JOZA 5FREA 4IESA 4PDWC 1SFYA 5G05L 5LEJA 3T1LA 2FQPA 5FPUA 1ZBE1 3VBHC 1HXS1 4RS5A 2RJLA 1X36A 2UYAA 1F31A 2JDPA 1YI9A 3HBKA 1UY2A 1XYPA 1RMU3 4QWNA 1RUJ1 3E6CC 4BB3A 5A1LA 4QB2A 3ZFGC 4PHZA 1V9U3 1VAMA 4OUMA 5EPAA 5LBBA 1QJX3 2O8QA 4Y5SA 5DUWA 1RUG2 2I07B 5HV4A 1BXHA 4YW7A 1ULEA 2LROA 4LHNA 4AI0A 3VD5A 4FPOB 4XCBA 3OGSA 4MHUA 1AYM1 1HW5A 1U0AA 3OBRA 1I5PA 4MLOA 4GIQA 1X33A 1D2QA 4PQQA 1QOOA 2VQ0A 1Y4WA 3LEGA 3I4IA 3WHUA 2Y60A 5E16A 4LBQB 4RQPA 2RS53 3THPA 5C5TA 2QQJA 2VVEA 4C90A 3WW1A 2WS91 4HZFA 2NQYA 4IE5A 4HKWA 2CTVA 1RUJ3 3LF7A 2OZ6A 1OH3A 1YCIA 3VHPA 2AYHA 2R32A 4HSLA 1YLLA 1JMUB 1BKZA 1JW6A 4HK8A 5JCTA 1HB1A 4HETA 3W9AA 2ZABA 1PVC1 1CAWB 5IAXA 3AMNA 1J1TA 2WQZC 4MVTA 4Y4RA 3VBFC 2HEWF 2WFF1 3IIAA 2H6CA 4I3PA 5CKQA 2HBTA 2ZKNA 4D7SA 1VP6A 3NVCA 2W9XA 4NN0A 4XFAA 1RJ8A 4NMIA 3QACA 2EICA 1ND2B 1IG3A 4YM0A 5DUXA 1COV3 1WMXA 3OBZA 1O5UA 5LASA 4IUGA 2I74A 4GJYA 2E26A 1OLQA 1WGPA 3FLTA 4WM7A 4Y22B 3SQOA 4ZKTB 4IGPA 3RI8A 2QQPA 1WCDJ 5T55A 3VBHB 1PHMA 4K3UA 1S55A 4XZPA 3T4HB 2FCUA 3O1RA 4LBQA 4RQPB 2JE8A 3WF0A 4S2GA 5AVPA 4YVWA 4EQVA 3NNLA 1PO21 1H2KA 3KV4A 4Q4X3 2N7GA 1IPKA 1VPHA 3ALQA 4XOGA 1Q8QA 1SG3A 4J6GA 2D5FA 5FZMA 5FY9A 4GB31 1W2TA 3VBRC 1TVGA 4DZGA 3SXWA 3BI3A 3I2GA 4QXKA 1C5IA 4AZZA 2YMZA 1WLCA 1W0OA 1CPMA 1IGOA 1UYZA 4YYOA 1UMIA 2CWSA 3GZAA 4I2OA 2W87A 5E8AA 1UKGA 1W03A 3BALA 1QF3A 4XHBA 4J25A 4TXWA 1RUH1 4FQ4A 1VJ2A 2ZHLA 5JXJA 4JZRA 2F4PA 3NNFA 2E6VA 3PMSA 2JIJA 1JYXA 4L2NA 3ZFEB 3P1IA 1R081 3VBOB 2XJRA 3FFQA 4LHLA 5FY4A 2XG3A 3BGAA 2V5DA 2GH8A 1YXWA 3ZMNA 4BMBA 2QQMA 1NA1A 2DUQA 2YUEA 1QJY1 2J1TA 2NMNA 2Y0OA 4Q1PA 4RHV2 4JRLA 5D1IA 4Z07A 3AXEA 4N43B 2GMMA 3LIGA 4ZU4A 4WVVA 4XJ8A 3P3NA 2VW1A 1B35A 4D69A 5BNOB 1VIWB 3BODA 5A3PA 1CN1A 5FPZA 3KMHA 1VLNA 3KT7A 2JG9A 3IMMA 3NMBA 5FBJA 4CEYA 4MX3A 4AFCA 3FUQA 2HH9A 1NCRC 3I49A 3WY6A 4AVSA 1JZ5A 4CZSA 3WCRA 4JV4A 4Y20B 3VDDB 4N53C 1KITA 4AVTA 4XJWA 5A70A 1V6LA 2QUOA 4CU6A 2WQ8A 1G9CA 4OULA 1DHKB 5ABJB 1YRZA 3WG4A 3AZVA 1TMF2 4KWJA 4CDUB 4KBBA 3ATGA 4URTA 5F1RA 3TEZA 2AACA 2GNTA 1UPSA 3WSOA 4IEUA 1TNRA 4GWIA 2VMGA 1WMEA 2VR4A 2JDZA 4KGGA 3NAPA 3RGBA 1Y9GA 1I3HA 3WLUA 1V9U2 2WLPA 2PLV2 5FZDA 1Z7S1 3NV2A 3VD4A 3M3CA 4QDQA 2DFBA 3B02A 4HLTA 4AEKA 4URAA 3KV5A 4XJZA 5ANQA 5DAWA 1MS4A 1UZWA 1WMDA 2GN7A 2DU0A 1VAVA 2WN2A 3AKRA 1MPXA 1N1YA 3PHMA 4PLOA 5DPNA 3B5LB 5EJ3A 1LU1A 4ZONA 4FBFA 1HJFA 1GU3A 2J1AA 5DDJ1 1GBGA 2QQKA 2GP3A 5J3UA 4GKXA 2GNMA 5JPMB 4NHXA 4RS5C 1HRV2 4W6YA 1C57A 2D98A 3RVHA 5HBAA 5JXGA 3AK0A 5JR7B 1XNDA 1OOPA 1ZRRA 2OT7A 4QKFA 1G9BA 4QB6A 4B4RA 1GNYA 3CLPA 1VBE2 1BYHA 1R1A3 1ASJ3 1U5IA 2WWUA 1F35A 5LCWL 1AX0A 5B4XA 4Z1VA 4XJUA 2ZTNA 3I3DA 3KLSA 2NM1A 4GH4C 1AR82 1EV12 3ES1A 2HEYF 3WVJA 3AP6A 1ZA4A 1O4YA 4P9YA 1CZVA 3S5AA 3NAPC 3R6SA 2VQTA 1BQPA 1QJEA 4UFLA 5F39A 3RQ0A 5A32A 2B8MA 2RDQA 1NCQB 4NUBA 4M3CA 4QKNA 4QM8A 3VDAA 4MO3M 3LWCA 5FZEA 1GYKA 3VBRA 5EXOA 1NY71 1ZRCA 2VOTA 4PJYA 2WS92 1H6XA 2RR11 4XIKA 5FZOA 1Q43A 4JKMA 3VKNA 2VC9A 3A0NA 2EIEA 2QZ3A 3LSEA 1LOFA 1S2EA 2AZ5A 2X5IA 3ILFA 4KWLA 5D2AA 5FK8A 4MXWA 5C3OA 3U14A 3ZFGB 2BFUS 2WO7A 2D7FA 4B4PA 3VBUA 1G9AA 1XQNA 3WZ1A 3KCYA 3PTRB 1NOVA 1SHWB 1RUE1 3ZVXA 4HOOA 3I3QA 2ZGRA 2JB8A 3ACGA 1QQP2 4MOAA 4OUEA 1V0AA 1H2LA 2VZ3A 1OUXA 1CD3G 3H3LA 4FFHA 4QQHA 2NZ9A 1RUC3 3RRDA 4IETA 1W0NA 2J1EA 2WT0A 2XVKA 3E5UA 5LZ6A 3O0VA 4YZ3A 4NHKA 3KSCA 3TRSB 1V6NA 4P9IA 1MS3A 2PXJA 4YZ5A 4Q5OA 3VN4A 2OPKA 3GBWA 3THCA 3VL8A 1QNWA 1GZ9A 2PAMA 5FLHA 2OYZA 1CGPA 1F8VA 1MACA 2ZPXA 4NROA 2Q1ZB 4LKFA 1LAJA 2VULA 3IDAA 5EIYB 3LCPA 2WNEA 3AYAA 4IDZA 4KMQA 4XXAA 4Y33A 3IZOA 2R6QA 1CAXA 2NLRA 2HWF3 4WM8A 1F5JA 2CWMA 1LOEA 1MEC2 3EJKA 2W1SA 3FBYA 5FLJA 1X82A 4XJAA 4HVOA 3ZLIA 2WFPA 3O5SA 4B8EA 3JXSA 1X50A 4WZFA 1AL22 2YBSA 1LULA 5FP8A 5JUVA 2A7AA 1GANA 1JYNA 3B93A 1VBA1 2BU9A 4BQYA 1UMHA 2VOWA 3K75B 4LJHA 3O1SA 1SEFA 2D5HA 1LEMA 2A75A 3J7NA 1GQGA 5B2GB 5I0SA 1I1EA 2QQWA 3MIDA 2EVXA 3ZOIA 3QOPA 5CAZA 1OSGA 4CP9B 3LSDA 4S2HA 4BQ3A 2VMCA 1CESA 2XWBB 3MW3A 3H9AA 1H2MA 1VAKA 3ZYPA 2QQIA 2VVDA 2YGLA 3GZUC 2VD7A 2FDIA 1YJKA 1WBLA 1D4M2 1G6NA 1OH4A 1CJDA 1WD4A 2JDNA 2GC1A 3UV9A 1TME2 1EUTA 4XETA 5KHHA 4BM8A 2WYFA 3Q8EA 4ES9A 4HK9A 5FP3A 4XEZA 5L9BA 1VBA3 3DXUA 3FFZA 5AC93 1B09A 1H1MA 1ASJ1 2IFRA 2X29A 2YC2A 2HWC3 4LEJA 4QPIA 4UFIA 5CNAA 5EWSA 1AZDA 3W21A 4AAXA 4AQ2A 5FZ7A 1UF2C 5FZFA 3KHCA 5T5PA 2SLIA 3FMGA 1XJAA 4JKKA 1DQ4A 4O9GA 1RINA 2A3YA 2XLGA 1ZBE2 3ZSJA 2Q8CA 3VBSB 1K12A 5K0UA 4AE2A 2E51A 4QGMA 2VNGA 3HJRA 1C8M2 3N9NA 3TOJA 4BU2A 2BV4A 5A1FA 1X8MA 1OMIA 3LFIA 2C9KA 5BNPA 5BNNA 2OPWA 2YBPA 1RB8G 4AOCA 3M7AA 2WO1A 1RUG1 4XUOA 1PIV1 5C9AA 1SLIA 4E9KA 2CAVA 1SFPA 3POYA 4LUKA 4W6XA 2HWC1 2PHDA 5IVJA 2JWPA 3EMRA 5BNQA 5FZ3A 4D6SA 4Z8BA 4G9SB 1U5ZA 4W65A 1OLME 4L8QA 3T0AA 1QJU1 3GZEA 4JHZA 4NRPA 3LDKA 1PM7A 4BISA 4WV8A 2J42A 4YPJA 4AVCA 5J48A 4AVBA 1PMHX 1EUUA 2XHKA 2DUPA 4Y1ZA 2WZPP 3NJVA 4XYXA 1YIFA 4MZUA 4XUPA 5DAQA 3KQ4B 5J1XA 4JGYB 3AP4A 1VBB2 2ZHMA 3VZLA 1RUE2 2ZXQA 3VD7A 2R063 3RDIA 2RMU2 2WFF2 4N43A 3E5XA 1S0DA 3N7LA 2Q30A 1W2AX 3B7MA 3CZJA 1OD3A 3O0XA 2ES3A 3PURA 4AHWA 5T5JA 5FV3A 3MDPA 3PIJA 1QXPA 5E89A 1UY3A 1YC61 2PHLA 3NNGA 3VKMA 1CX4A 2JG8A 2WZ8A 1MQTA 1AR61 3JD73 4ES8A 2ETEA 1FXZA 2IXHA 2XL9A 1WUVA 4FPJA 5EYXA 3ZXLA 2DTWA 2VMDA 4FFIA 3H3ZA 4IXLA 3PU3A 1ZM1A 3H42B 5CKMA 2NN8A 5FYSA 1HV0A 2JDYA 1QQP1 2VL4A 3BB6A 1H8VA 4LBNA 4AEMA 2VE1A 4R8HA 1NE4A 4MH0E 1YJLA 4QXHA 1OC1A 2HKXA 3BPZA 2IXKA 4Y1XA 1PX4A 1LOAA 4E4ZA 3LOIA 2CAUA 1OA4A 2BZDA 4IGOA 4DEQA 4QKBA 3MF9A 2XKPA 1JH5A 1W6PA 5FYCA 1FPN1 1YIPA 2OS2A 2ZEWA 5DUUA 5A6ZA 1JZ7A 1O3RA 1LJ7A 1OFSA 2ADDA 4YVWC 4RGKA 5BNPB 1RUH2 3WF3A 5BNNB 5IYYA 5IK5A 1BK0A 4F8AA 2XUEA 1LOCA 3MLJA 1QGLA 3ELNA 1OFNA 4MSVA 4EZHA 2CDPA 4ORFA 3JQXA 3SLIA 1NXD1 1POV3 3MZHA 3AP7A 3AKSA 3KT1A 3RS6A 5K0UB 4Q2FA 4YFWA 3VBFB 3VBSA 2R062 2R041 1WCKA 5JOXA 3UKNA 2LALA 3AM2A 1BCXA 2WJSA 4QXBA 4D8MA 1FT9A 4E4HA 5FQ0A 5F32A 4HXCA 2HWB1 3URFA 1AVBA 3SCFA 1ZBA1 4Q4W1 4CE8A 1TNFA 2E32A 3KZ4C 4AEDB 1O5LA 3POWA 5J96B 3CQOA 5A33B 1GNZA 1LOGA 4AL9A 3WNLA 3MHZA 2QQOA 2GC2A 2YU1A 5FZCA 2QQLA 3U11A 4R9CA 3FC0A 1BEV3 1PVC3 2DWRA 2VGDA 3DN7A 5JMOA 4KWUA 2AH2A 4C8DA 4E8CA 1RUC1 2WNVC 3I8TA 4Q1RA 3RMXA 2GDFA 4XF0A 1K5JA 4L9BA 3OGVA 1XE7A 2XJTA 3IAPA 4N7UA 5F6LB 2DCZA 4AG4A 2RDRA 5KXDA 1SBFA 5FXWA 1NT0A 2E33A 4DINB 4IV3A 5LBCA 4SBVA 1XC6A 2AREA 3ABZA 2RDSA 3VDCA 1VBC1 4W4ZA 1H1IA 3J9SA 5FLIA 2ILMA 3NW4A 3QCWA 3W20A 1UY0A 2ZHNA 3PVOA 1PMJX 1U5YA 1CR7A 2ZX2A 3RSJA 1DGWA 4YARA 3AX4A 4FQZA 3DYPA 5DG1A 4INDA 4K40A 5D8AA 1H6YA 2ZX3A 3H7YA 3O1MA 1AR93 2HWC2 1YFYA 2Q5TA 3LA3A 3LIHA 4WM8B 3USSA 3UJQA 5L9RA 5CKNA 4CPBA 2KXLA 3AP5A 2B46X 3DUIA 2BWAA 4MV2A 4LQRA 4R9DA 1OXCA 1PVXA 5A7OA 1SCRA 4CUGA 4DY3A 3V65A 1DZRA 1RUD1 4WVWA 2ZAHA 4NRMA 3SNMA 3ACHA 2JDHA 2XUMA 2YBKA 3J8F2 2VBDA 2HWF2 4FXGB 1RTVA 3T2OA 2W68A 1XYOA 3BUCA 1H9PA 2RMU1 1BZWA 5ACA2 4AI9A 3S57A 1LOBA 4KU8A 5GZDA 5A7QA 3GXUA 5LA0A 2ET7A 4NRQA 2FDKA 4F3JA 1HQNA 3GDBA 3MI8A 3W59A 4FVVA 4P5YA 4N53B 2K9ZA 4YZ1A 1N1VA 4TZDA 5A6QA 4WVMA 3DYMA 4LKSA 2WQ4A 2FDFA 4K8RB 4O61A 2WO2A 2PYTA 5JI7A 3UGGA 4YM3A 4A6SA 4MHRA 1WA4A 2WAOA 3IKWA 3H8OA 1OKOA 2DVAA 4BCUA 3V0BB 3UL2A 5C8CC 2F6BA 1GZTA 4RD7A 3WW2A 4JTOA 1H8TB 4EV0A 5IW0A 4FSJA 1VBD3 3C7GA 3AYEA 4JX0A 3OUIA 1NCQA 5LW9A 2ATFA 2BRTA 5A32B 1O6UA 1FAYA 2RMU3 5FWEA 3VUOA 2IVJA 4RR3A 1AXKA 3C7FA 5F3GA 1S0IA 4PLMA 4AEJA 4AHZA 4CTEA 1LKNA 5FPLA 5K9YA 4ONUA 1UYXA 1TEIA 3KHBA 4QPIB 1CAUA 1HN0A 1GWLA 3TYJA 4CXXA 1FATA 2LM3A 2Y34A 3GJAA 4LORA 4FFFA 5L7OA 3POFA 3SKJE 5F7UA 3FUOA 5IATA 5FFOC 3FE5A 3VZNA 1ULFA 2HWD3 5IVYA 2CYFA 4HMZA 1RL3A 5A3WA 3I7DA 3NJYA 2DCKA 1QIQA 1MS0A 1ND3B 2MNGA 4CCLA 5IVCA 4OHYA 4RSUA 4IEOA 4XZUG 3FWEA 2JJ6A 1UU4A 3NRUA 1ZBA2 3ACFA 1DQ1A 2RVAA 4HONA 1AL21 2A3XA 2LUWA 1GOHA 2IXIA 1JUHA 3WD5A 4GULA 1QKQA 3TN91 3T2PA 1U12A 5GZFA 5IAVA 1PK6C 3FJSA 2OUHA 5FPXA 1FNZA 1JYVA 3PMEA 3OGJA 2C0ZA 2R061 1YNAA 3R4SA 1GOFA 4S2FA 1ZRIA 3GHMA 2PHXA 2BNOA 4XPVA 2F4LA 5GJ6A 4N53A 1LGBA 1B35B 2PHRA 1F5FA 1RHI3 4NE9A 4XE9A 4B29A 2ZKLA 4H3WA 1PK6A 4M4PA 4Q4V1 4COYA 4DS0A 1C4RA 3WNNA 2CHHA 2XJUA 1X9PA 3HMYA 2OX0A 2QQVA 4KGQA 3AMHA 4LLFA 2ZAAA 1UOFA 1SMVA 1JUIA 4HKOA 1R1ZA 3FHIB 1HB2A 5FR3A 2YFUA 4YM2A 4OI4A 3FBMA 4GWMA 4MGSA 3ZKYA 3U75A 1KRIA 1OI6A 2XPJA 2VZSA 5EJZB 3UT0A 3C8XA 1O8SA 2WBKA 1EY2A 1PZ7A 2TBVA 2QJVA 1NCRB 3HN3A 2VXRA 1C5HA 2RJ2A 4NIHA 4XBLA 3ORJA 3Q8BA 2G9FA 2DCYA 2HBUA 2UWAA 4LO7A 5FZ4A 1DQ6A 1UZ0A 5F9TA 1PGW2 4UW4A 4TLGA 5JLVA 1YQ5A 3AFGA 3AZWA 5IK8A 5T5LA 4QU1A 3MV01 1CQ9A 4XUQA 3LEMA 5FYHA 1PO13 3GM8A 5K4LA 2MEV2 4E27A 2C9AA 4BQXA 5I0TA 1FMD2 1AR72 2ZMLA 3BOPA 2ZEZA 1SBDA 2VECA 4J1WA 3AZZA 4LE4A 4P08A 3FL7A 4N90A 5F5AA 1UN1A 2D93A 5LK5A 4R9AA 3U07A 5L36A 2HYXA 4LK7A 5FXVA 3N4MA 1H4HA 1RITA 4H7LA 3VBRB 4CXWA 2QQNA 5FYUA 2AEZA 2BTVC 5EJ1B 1HRI1 1LGCA 4FFGA 1HLCA 3TEYA 3WQ0A 3BU7A 2BQPA 2WNUA 2XHNA 4B3NA 1AF9A 1O7FA 4YW6A 1VBD2 3OB8A 1JZ2A 4XQDA 5CZKA 4LIVA 5DAPA 3HAGA 2J22A 2EAKA 3ZM8A 1Q8OA 3HNBM 1ZBE3 2PN5A 5FMDA 3G7DA 4YGBA 5ERLA 2H0BA 4X8NA 3WDXA 1XXNA 4JGZA 4B7KA 5A6XA 1J1LA 2BUKA 4I0AA 2CSGA 4MGTA 2D44A 3C7EA 2MPFA 1CAVB 2A1XA 2ZEXA 3E97A 1OOPB 2DV9A 3I2KA 4H14A 1YYNA 3FLPA 1QJX2 4ZS3A 5EYYA 4JC1A 2WDBA 2FMYA 4HN1A 1IKQA 1KJLA 3P6BA 2OKXA 1S2KA 3LKJA 1AX1A 1LESA 2Y64A 5C6CA 1D4M3 1VB4A 3VKFC 1YI7A 1Q5OA 1MVQA 1UX7A 1S0JA 2RS52 1S0GA 3INAA 2P3IA 2B42B 4AF9A 3J7MA 1H30A 4RL7A 2Y33A 3CIHA 4YW1A 3WDVA 3ZXKA 4FPYA 4OQ9A 3ZPYA 2QKDA 4OI2A 4QHZA 1W6MB 1QDOA 1S2BA 3CHXA 4DY5A 2RHPA 3NQHA 1WCUA 1QHDA 2KA3A 2XVLA 1W8WA 3ZPOA 1QJY2 2FHRA 2XONA 5A7NA 2IFWA 2XOMA 3VHOA 2VCBA 1OD5A 3L2YA 4FOVA 1QU0A 3RZHA 1O3QA 1MQTB 4ISQA 3MF6A 4M01A 1CZTA 4XMAA 4ZU7A 4EN0A 2WL1A 4A7YA 4BH9A 1R1A2 1CVNA 3CJIC 1UZYA 2A6YA 4QB1A 4XIOA 3WOGA 4ARXA 1QOTA 4DQAA 3NKGA 2C5DA 3POGA 1DP0A 4PBPA 5GKAC 4XDPA 4QX2A 4CP2A 1JYTA 4GQ7A 2VTXJ 4U2AA 5DDJ3 4TTGA 3TN92 1KDKA 4YGDA 4UT5A 2DBIA 4R4ZA 5H9QA 4IE4A 3PDQA 4I3GA 5GZCA 4OCTA 4OUSA 4XMIA 1W05A 4BQWA 4LULA 4FPHA 4B7EA 4XF4A 1ZZ7A 1TMF1 2RM23 3H0OA 1DLLA 3U37A 5GZGA 3UETA 1CJPA 2D3RA 4Q4X1 1LHVA 1N3QA 2JX9A 2P3JA 1HN1A 1F2NA 4QXCA 1SLBA 3Q8FA 1MVEA 1NKGA 1UOBA 2J1RA 2ARXA 4I02A 1HXS3 4WM7C 5FP7A 1Y3TA 4M3CB 3TBDA 2CNAA 1W6MA 4IEVA 4SLIA 2FD8A 4LHKA 4UW6A 1BHGA 1TG7A 1ST8A 2QNKA 1DYOA 3K2OA 5LBFA 3I3MA 2C6SA 1POV1 4EN9B 1UIJA 2TUNA 3U4SA 2Z69A 3E5QA 3ILRA 3SCGA 1OBNA 3WF4A 5CEHA 4EN6B 1DF0A 3QBQA 4WZCA 4BPZA 1ZRFA 1R093 1W06A 1VBE1 2BP6A 2Y6LA 4FO9A 5FKBA 3VHNA 3T4VA 1QXRA 1XOYA 4PT6A 4YGCA 3HIFA 2BVVA 4ZXKA 4ATEA 4P9JA 1QJZA 4Q27A 2EXIA 2WSVA 3A0KA 1DDLA 3O0WA 1E5RA 3B01A 4ZXEA 4BIFA 3HPNA 1KJRA 2Z42A 5DDJ2 2PTMA 4UFKA 4QHBA 2D3PA 2ZBJA 4GKYA 4PF1A 2WT1A 2WS93 5DZFA 2PELA 1HRV1 1WLDA 4DEVA 4JGZB 5FZBA 5LEKA 1OUSA 5GZEA 4A44A 5A1AA 2A6VA 5CVRA 5LK7B 4LNVA 4AQTA 2VY0A 1APNA 3OBTA 4QX7A 2RM22 4IEQA 4D7TA 2E31A 1OF4A 1P8JA 4ATFA 5JOWA 3G6JB 2CDOA 1SDDB 1REFA 3ST7A 2AENA 2OQ7A 1UU6A 3MBWA 1DGWX 3DPRA 4YVSB 5BNNC 5BNPC 3WQ7A 5LY1A 5APAA 3WP3A 1Y7BA 5KBFA 1J3PA 5LRRA 5C33A 1QH6A 5FXXA 2B4KA 4C0HA 5SV8A 1DYPA 1QJX1 3QD6A 2Q0AA 4PIXA 5JDBA 1PGL1 1F15A 2CGNA 1BMV1 4L97A 4OI1A 4Y1YA 1UZZA 3PUIA 5A3TA 2WNVA 4LBOA 1W6NA 2JDKA 3MW2A 3ENRA 2AEYA 2XL7A 4A42A 1J84A 3WX5A 5BV6A 3WP5A 1POV0 1UY4A 3LFMA 1VBB3 2ZMKA 1RUE3 1OQ1A 3OSDA 4LA2A 3WT3A 4B4QA 2FCTA 2YY1A 5DG2A 3U10A 1Q3EA 2BVBA 2MHFA 2LRPA 4R4XA 2JEMA 3VZMA 4CA9A 5A3UA 3D4KA 2Y0IA 1DU3D 5C4WC 4LBLA 5I91A 5AC92 3RZLA 1XE8A 1NLRA 2Y38A 2EXKA 2ET1A 5FO9B 5FIXA 1WW6A 3VD9A 2VZTA 1O8PA 2DTYA 5C4WA 3RJ2X 2W3JA 2RS12 5FZAA 5C71A 2PHTA 4EZ4A 4LIUA 3PVBB 2ZGLA 4ASKA 2VZUA 3IWZA 3ZN6B 2XLAA 3ETQA 4IV3B 3OBAA 1FNYA 2WLQA 1W2NA 4LMFA 4MGYE 4COVA 2P17A 4GJZA 4DNYA 2XJQA 5FZHA 5HXVA 1LRHA 1S4CA 4QAWA 5LA1A 3S7IA 5FZ8A 1W8FA 3T09A 1VB2A 4BYYA 1HB4A 4IE7A 3W5NA 4CUAA 1OQDA 5AVAA 1VR3A 4DXZA 5GLZA 2MEV3 3DKQA 4AVAA 4HG6B 4XFCA 1GNHA 4XFBA 4YW5A 3IMNA 4MXWB 4I0WB 4FPGA 3IM0A 3GALA 3SC7X 4EN7B 2FZ2A 2GNDA 1AYN3 4QQLA 5A3NA 3LDRA 2ORZA 2VMIA 3DEMA 3AMQA 2BEOA 3C7OA 2VOVA 1UYYA 3I59A 1W8OA 3Q8AA 2ARBA 4GWJA 5DAXA 3AL6A 2R16A 4GD4A 1VMJA 3PVEA 4IE0A 1UMZA 3GGLA 3NWKA 3WNMA 3VBSC 1IS4A 2Q1FA 2VTFA 1LR5A 4OI0A 3GCXA 2GH2A 5FZLA 5F3CA 2R072 3THDA 3I2JA 4RGGA 3ZXAC 3ROUA 3AJYA 3W58A 1H1AA 2JDAA 2C1FA 1NYWA 1K5MA 1WW5A 3KQRA 1HIXA 2ZX4A 2FZ1A 4FCAA 2P1BA 1QWRA 4L92A 2FCVA 4YZ4A 4K21A 4ASLA 4PI2A 2IXJA 1V6KA 4YWAA 5FK7A 3NJXA 4E8DA 2JDMA 4GMP1 1K42A 2PAKA 4AXOA 3CZUA 4IL7A 1RVF1 1XNTA 1HXS2 3OTFA 4COZA 3ES4A 4DXRA 3ZXGA 1W8TA 4MYEA 2D6MA 5GLVA 5KHKA 1NLQA 3AFKA 4P14A 4E2QA 3MLLA 5JAXA 3BIWE 5FZIA 2YC4A 2K46A 1ULCA 2O1QA 5FZ6A 5KHIA 3WNXA 4CDXB 4IV1B 5IUQA 1C1LA 1MS9A 2ORXA 1OLMA 4Y20A 5C3QA 4QKDA 3JBG1 5A6YA 2P4EA 5T3NA 4PCRA 5I0DA 2QTWB 3EQEA 1DFQA 3JD71 3MUZ1 2ZGSA 4IW3A 1W39A 4QPGB 3RZJA 3OYWB 1C3HA 1AR91 1BK1A 1VRH2 1NE6A 4HN0A 4ZS2A 5DUVA 3GYDA 4UOJA 2VZQA 1QJU3 1DQ0A 1AR83 1EV13 5LA9A 3ZIXA 1RVF3 2DVGA 2WN3A 1OA2A 4QGNA 4BIOA 2UY8A 2OW4A 3WDWA 3A4UA 2ZZQA 4PF5A 5FPBA 1QEXA 2G9ZA 5IJRA 1RHI1 4W50A 4JGYC 1RUD3 2O8OA 2Y6GA 3APBA 5FOBB 4OFGA 1DQ5A 1JU3A 2NYYA 4F83A 3ZX7A 1YO8A 5BNOA 3KF5A 3S7EA 1WWYA 3JBG3 4YNIA 5CG9A 2IC1A 4IEYA 2VBPA 1US2A 1W9TA 4Y4YA 3H8RA 3H8UA 1Y9QA 5A7SA 2W1WA 4RQPC 3ZMOA 2TEPA 2W95A 3KCXA 3VBUC 5IK7A 2YB7A 2DVDA 3ZFEA 4AEDC 4IERA 3V64A 4IV1A 2RS11 3BOWA 2A71A 1FPN2 2B9VA 1UQXA 1JI6A 1E5HA 1AR62 1ND2C 1VMHA 5AFBA 2V4VA 1QQP3 4EN8B 4XFIA 2ZA9A 3AMPA 4CEWB 4AHYA 3RJRA 2QVSB 2E63A 4KG0A 5K0UC 1A6CA 5JZGB 3HR9A 4M0HA 3WEZA 1BEV1 2UWCA 3P3PA 1RUF1 3RNSA 1JBCA 1C8NA 2WNVB 3HD8B 4Z2WA 4QQ2A 3H7JA 3KT4A 3K46A 4DRRA 2K0GA 4YVWB 3A7QA 1UD1A 3ZN5A 1PNGA 4BQ4A 5IVVA 4UBGA 2ZOEB 2GAUA 3SMHA 2ZGTA 3HN1A 2VOXA 2R042 4WM7B 3B9CA 3T2QA 1NXMA 2YHJA 4Y5TA 3KM5A 5KC5A 2RS13 1GWKA 4ISRA 3ZXJA 5A3LA 3SCHA 4YM1A 5FY8A 2YXSA 1LB2A 1W8NA 2X09A 4I30A 1FOD3 3D6EA 1IQAA 1PO12 1DYKA 2PAEA 4BHPA 1HQLA 3H3UA 4M3CE 4XFGA 1D0HA 1S1AA 1OA3A 1YHFA 5KR7A 4AGGA 2A5ZA 1BBT3 3M70A 4JQTA 2HWB2 2G1MA 5F6KA 5FYMA 1H2NA 4N9HA 3NV3A 5C8CA 3RG0A 5FYIA 1XNKA 4MGZE 1EYBA 5FCCA 1V70A 5TSWA 4EWEA 1NX9A 4QT6A 1IZ3A 4GWNA 5J98B 5JSRA 1SBEA 4X6QB 2VZRA 4X8PA 1AXZA 4OHVA 2Z79A 3AZXA 4BLIA 4LPLA 3AKTA 1W6PB 2BJSA 4CCMA 3IBMA 4KH9A 5C3RA 3CDZB 3VHRA 2UYBA 5KXCA 4FAGA 4XDOA 3UESA 2H0VA 3NKTA 1HB3A 1QNYA 1OKQA 1NCRA 1PZ8A 2E7QA 2VMHA 3CU7A 4M3CF 4CPBD 1IQDC 5KHGA 3SH3A 2EF6A 1SACA 1GZWA 2YPDA 3AP9A 3CO2A 3D0SA 2NP0A 1AR81 1EV11 3POSA 4HL0A 2VNRA 3LE0A 4XBQA 3AL5A 5L19A 3A23A 4CP1A 1AX2A 1RMU2 1ZA7A 4K6BA 1HQWA 3FN9A 1RVF2 1RC6A 3ON7A 4HT1T 4TN7A 4LO5B 5F5CA 4RFT0 1JOBA 1VRH1 2XVGA 4XBNA 1LHOA 5CISA 4CSWA 1H8TC 3VL9A 3H1YA 2J1SA 3SH4A 1PIV3 3J8F1 4RN5A 1NY72 4IEPA 3WF1A 1Z7S3 3JBG2 2G4IA 5GLWA 3UNPA 2VUAA 5M0TA 3JD72 1XPWA 3TWIA 3FZ3A 1RUH3 4QPGA 3A22A 1F4HA 5H9PA 4V1PA 4L11A 4AI1A 3L2HA 4ZHNA 4B1LA 4C1XA 2I2SA 3E1F1 1O4ZA 4CDQB 5IHRA 1X7NA 1OHFA 5C3PA 4RA0A 2D97A 1YFXA 3VZJA 4Q4Y2 4JTNA 1VRH3 3VD3A 3RYKA 1H0BA 3WP4A 3V56A 4OMCA 4BDVB 1UO9A 2D6LX 3OD0A 4GH4A 4JDNA 3AXDA 4O9EA 4QX8A 2GNBA 4OMDA 5FWJA 1OLRA 4ZZ8A 1G9FA 4NIDA 3KGLA 3DL3A 4FPCA 5J7MA 2HJIA 4LKDA 3UGFA 4GMP3 4KQ7A 1A34A 2LW8A 1L7QA 3E6BA 2RDNA 3AMMA 2ZMNA 1XYNA 4OHWA 3ZR5A 4CEYC 2OXBA 2JDUA 4I01A 3GZTB 1EAH1 3S30A 3T30A 4K7JA 4XF1A 2PFWA 3O1OA 1H8TA 4XACA 4Y26A 1SZBA 2CY6A 3RFRA 1MS8A 4LBJA 5BUVA 3CEWA 1V6IA 3JUUA 4Y1VA 3S5QA 2VH9A 1ZYBA 5JPNB 4QX5A 1HJGA 3OPTA 5E88A 5CFDB 4UAPA 1SPPA 2RE9A 4WBBA 2V73A 1BEV2 2ARAA 4LO6B 1AXYA 4RR3B 1O4TA 1NZCA 2UY9A 2W92A 3MIHA 4QX1A 3NAPB 4YRDA 1OPOA 4BQ2A 1O59A 5BPXA 1RIRA 2V5YA 3LOBA 3ZXFA 3SISA 5F3IA 3ZO0B 1X9TA 1EAH3 4HPKB 1VBA2 5F2WA 5J36A 1DGLA 4XXPA 4CU8A 1MR5A 2YG0A 3W5MA 1DGRA 2D43A 2AR6A 2KR2A 2DVFA 1XU1A 1WD3A 4NAMA 4QPGC 3DXTA 5DZGA 1GFF2 3AYDA 3M1HA 3R4DB 4XVHA 5BY5A 1B35C 5I0UA 2XQRA 3NJZA 1PO11 4K1ZA 3TNQA 4HANA 3P5BA 4AFBA 1MZ5A 1SFNA 4FOQA 5A80A 3WQBA 5DMYA 3BIEA 1NA1C 1YEWA 1W8ZA 2JD4A 1JYIA 3MLKA 4Q4V2 2BNNA 2Q8OA 5ACA3 1BVVA 3UKVA 2A6ZA 4LO8A 2AC1A 1V9U1 2B5HA 3K3NA 2PLV1 4P00B 1ZNPA 5FY7A 1UOJA 1AL0G 3ZFFC 1XRUA 3VDBA 1XBFA 3MIEA 1A8MA 4E4SA 5FJKA 4D3WA 2ZX1A 3PTYA 3VBOC 3OOXA 4XTMA 5HCAA 5D8AC 3BU0A 3USUA 1ZBA3 2WNOA 4Q4W3 4FP2A 5JXHA 1RUF3 2WZR1 1NCQC 1RMU1 1X8EA 1PIV2 3CNAA 1PGW1 4NR1A 1H9WA 2P34A 5FPAA 3SITA 2MEV1 2VUJA 1E5IA 2VAUA 2QFEA 1T2XA 3OD4A 3DF0A 4DPNA 4FAHA 1JTZX 3PU8A 4YVSC 4F7ZA 5D8AB 1XNBA 4BK4A 4ITCA 2V72A 2BWCA 4JAAA 3LDBA 4JVAA 3T1MA 2W94A 1C8M1 1GP6A 3DCQA 5FPVA 1GV9A 4YW4A 1WW4A 2Q8EA 5FYVA 1GICA 2SBAA 5CFCC 4Y22A 3N7KA 1PO23 1Z78A 4EWAA 1N3OA 5C9AC 1HRI2 1TZOA 4AR2A 4XF3A 2EAAA 5C8CB 1LU2A 5LWBA 3OPZA 2BBVA 1ND2A 1LOFC 1W2OA 1LNSA 1UAIA 2EXJA 1SCSA 2R1DA 1QDCA 2Y6KA 3EBRA 1V6OA 1FMD1 4Y3OA 1TQ5A 3B69A 2GN3A 2VU9A 3U78A 4JRAA 2VMFA 1CZSA 2ZGNA 4A3ZA 2WZEA 4GZ9A 4FPEA 5A7WA 1HV1A 5GLUA 1DCSA 2FMDA 2GZWA 4QMAA 4RR3C 3J8F3 1IPJA 3RMYA 4BK5A 2KD7A 4LOSA 3LD8A 3N9MA 2CGPA 1FI2A 3WQ1A 2WC2A 2WA3A 5IT6A 2W08A 3WG2A 3UYJA 1XU2A 3RYRA 3TAYA 1SLCA 3M8LA 4NIIA 3WXPA 3HT2A 2YPJA 3ECQA 5A33A 1VBD1 1JZ3A 4CUCA 5GALA 3KVBA 2WIIB 4CVUA 3AKPA 2WZR3 2X8KA 3CF6E 1AYN2 2ZGQA 1W6QA 3WUCA 2XMLA 4DXSA 3WNOA 3U4XA 2WINB 3VKOA 4BLJA 4NPLA 1EPZA 3ZN4A 1MS1A 2GC0A 5CBLA 3T2TA 2XJSA 4MGQA 2WT2A 3KD4A 1QMJA 4RHV3 5JWPA 3NO8A 1UU5A 3HNMA 2ERFA 3KGZA 2JICA 2PHFA 3HQXA 2ZZJA 4A6OA 4NVPA 5A3OA 1AJKA 1A3KA 1JODA 2O14A 2GMEA 4E4DX 1L3JA 3DGTA 4JKLA 4PDWA 5FUNA 3TN93 4CRQA 4AYUA 1XNCA 2D6PA 2JXAA 2FDJA 1R083 4QPIC 4JQRA 2GALA 3VDDC 1AUYA 4FTSA 1NLSA 1JZ4A 3IDEA 1U5XA 4A45A 1COV2 4CDUA 1LENA 1IOAA 5FYBA 4JGYA 3ZSEA 2NMOA 1SDWA 1GLHA 4E2SA 4O65A 3OG2A 4DXTA 1G7YA 2JG8B 4Q4V3 5H9SA 2O0OA 1Q8SA 1R091 1UZVA 1ZREA 3POJA 2VXJA 2R49A 3WW4A 1L7RA 3OEAA 3IDCB 3HEIA 1V6MA 1R1A1 5F5QA 4JHTA 4D94A 1W04A 5LY2A 3PJQA 4FT8A 1VE0A 1I9RA 1KEXA 1LCLA 1NA1B 2VPVA 2WO3A 3KF3A 2QCSB 2PMWB 3N7MA 4LE3A 4AFMA 5I0RA 4B1MA 4IE6A 2G19A 4P9LA 4HBNA 3QH6A 3J26N 4KBZA 1CIWA 1ZZ6A 4AI2A 5C7GA 3TEWA 3UJOA 1IG0A 5K7PA 1VBC2 1UX6A 2Q4SA 5FMOL 4QD2A 2GC3A 1GZWB 3TB0A 1ASJ2 2CL2A 1ZZ8A 2W1UA 2WABA 4NPRA 2RS31 4Q8LA 4CDXC 1ND3A 4LUMA 1N1SA 4XF9A 3GCWA 3D3AA 5IFPA 1UNBA 1DLCA 2XLFA 4XDQA 4DO0A 4TYSA 3BTYA 1W9YA 1CAVA 1NQDA 2DVBA 4IEWA 1ULOA 4LTAA 2BYVE 4D7YA 2VMEA 3L9JT 1K5MC 1YQ8A 3MIFA 2H6BA 2ARCA 5EV7A 4GB33 2FDGA 1OPMA 5IFTA 5I8SA 1AYM2 1WLTA 3IDBB 1ENXA 1UWWA 5FJHA 4JDOA 3K4AA 2J1VA 4AK3A 3VZKA 3JU9A 4OYUA 1JXNA 1VBB1 5FP4A 1M4WA 5F5IA 4CCOA 2ZGUA 1Y43B 1DZQA 1GKBA 5A7WB 4EJRA 5EZWA 3ZYBA 4HFSA 1OURA 1F4AA 3K4ZA 3D0JA 3KCCA 2VCCA 1JYWA 2VZ1A 1Q8VA 2D6OX 1AR73 3WP6A 1Z0HA 5FY0A 1QY4A 1R64A 4ZY9A 1UYPA 3HOBA 1QJY3 4WVMB 2R0HA 2DYCA 4K9SA 1RUI2 1BMV2 1GMMA 4LOTA 2P2KA 2BERA 5LRSA 1D0GA 2L9LA 2Y8KA 2HLEA 4FI9A 4NHYA 1GOGA 4XILA 1LTEA 5SV5A 4XFFA 4META 2BFUL 2R043 1FYUA 2XKOA 3IT8A 2XJVA 2XGXA 4IGQA 1XB9A 3GF6A 5CFCA 4Q4Y1 1JOJA 1GQHA 4NPMA 1YQ6A 4AAPA 2DURA 1S0EA 2OA2A 2Z2SB 2VW2A 3BCWA 3JB4C 3M3OA 3EXUA 5DN2A 5ABJC 1CAXB 5H9RA 5CYYA 3M3EA 4UYBA 1WMFA 3ZDVA 3RZKA 4AQSA 4ET7A 2VUDA 4QQPA 4CU7A 2Z5WA 1YFUA 2P6HA 2VBBA 2EIBA 1TE1B 4GB32 5B4NA 3IIIA 1CPNA 2R0FA 5LATA 2VQUA 3MFCA 2LTNA 1XE0A 1R082 1URXA 4QPYA 1AYN1 2D3SA 5FMCA 3O1TA 3K4DA 1W2UA 2ZGKA 2FBEA 5L73A 1W9FA 3DV8A 1ENSA 3QH7A 3M4FA 2VNVA 4EE2A 2W46A 1RYYA 3HNYM 3N3HA 1S0BA 4MXVA 4PQ9A 1YQ2A 2AUYA 2ZGMA 1COV1 3IB3A 2P3KA 3MO4A 4YSFA 4OHXA 1UIKA 2ZS6B 3Q8CA 5EHDA 2A70A 5FRAA 5IWFA 3VBUB 3C2UA 3I2IA 1ZZCA 2GSYA 1J58A 3JZVA 1LHUA 3PIGA 4RHV1 1JZ8A 3LQCA 4FXKB 2JIGA 3WHTA 3NNJA 2NPIA 3C3VA 4QX3A 4DIQA 1R092 1WBFA 1IS6A 4IQPA 4NJ4A 1ZX5A 2D40A 2VZVA 1PZ9A 4IEZA 4CDWB 4QM9A 2VG9A 3MPPG 3UGHA 4Y5Z0 1J83A 3ZKUA 3LA7A 2X5IC 2IUWA 4FTEA 3BTZA 3K51A 1W28A 3RZMA 2EALA 4YG3A 1RUC2 2WAAA 3JQWA 4NWVA 2WRAA 3OGRA 3KVAA 2F17A 2JD9A 3E6DA 4AQ6A 2XBO2 3AVSA 4UW3A 1UY1A 3B9IA 4LK6A 1LEDA 1WW7A 2LS6A 2W5FA 3O14A 4UW5A 5F8PA 5KC6A 3ZFGA 1BJQA 3WNPA 3BTXA 5L7OC 5JSPA 3I3EA 3HQRA 3I2FA 5I8YA 3HQUA 2Y6FA 3CMGA 1D2SA 2YC0A 4JDMA 2X10A 5D21A 4AEDA 4XQWA 4YG6A 4LLOA 1AHSA 2B45X 1PNFA 2P37A 5EP9A 3SHRA 5HPOA 2PA7A 2OIIA 4YGEA 2RS32 2ZJCA 3ACIA 3CL1A 3J4UH 2OUJA 3D82A 3N35A 2K2SA 4WM8C 5FZKA 3RPQA 5HI0A 1W8HA 1J59A 3POEA 3EO6A 4M0NA
chains in the Genus database with same CATH topology
3C7GA 4JX0A 4OZOA 3T2QA 4A4AA 3C7FA 1JHJA 1W8NA 2X09A 1UYXA 3PUHA 3IAQA 2DDUA 1NUKA 2W9XA 4LHSA 2EICA 5F7UA 3SKJE 1KGYA 4IUGA 2DCKA 4M4RA 2E26A 2J1UA 2J7MA 4XZUG 4XUNA 1NX9A 3NRUA 3ACFA 2RVAA 1GOHA 2JE8A 2XQXA 3T2PA 3WF0A 2VZRA 2VCAA 2JKXA 3T08A 4LPLA 1UXZA 1JYVA 1SG3A 3CDZB 1GOFA 1TVGA 3J7HA 1JU4A 3I2GA 3UESA 2C26A 2WUHA 1UYZA 1UMIA 4M4PA 1WCQA 2W87A 1IQDC 3WNNA 1PX3A 4TXWA 2DCJA 5JXJA 3LE0A 3LEIA 3A23A 2R7EB 1JYXA 3P1IA 3FN9A 3LPGA 2YFUA 3BGAA 2V5DA 4MGSA 3I97A 2QQMA 1K45A 2VZSA 2J1TA 5EJZB 1OT5A 3C8XA 1O8SA 2J1SA 2WBKA 4RN5A 3MUY1 3HN3A 2RJ2A 3WF1A 3UNPA 1XPWA 1D7PM 4ZZ5A 3A22A 1F4HA 5C70A 3DYOA 1UZ0A 1JZ5A 2RV9A 4XUTA 4CU6A 2WQ8A 5JR2A 1WKYA 1GQPA 3E1F1 3MV01 3SEEA 4XUQA 5IHRA 4P02B 3WSOA 3GM8A 4GWIA 2VR4A 2EIDA 3VD3A 1GUIA 4OMCA 4BDVB 2ZEZA 4P08A 3FL7A 4OMDA 3VD4A 4QDQA 4ZZ8A 2HYXA 2QQNA 2VO5A 2LW8A 2WN2A 1MPXA 2VM9A 1L7QA 5DPNA 5EJ1B 3WNKA 2XHNA 2J1AA 1GU3A 3I2HA 5LA2A 2QQKA 3SEPA 3OB8A 4CU9A 5JXGA 1JZ2A 2C4XA 5CZKA 1W9WA 2J22A 2W91A 3ZM8A 4QB6A 1GNYA 1W9SA 3HNBM 4CUBA 3FHQA 5LCWL 5B4XA 3I3DA 3C7EA 4UI9L 4A41A 2ZEXA 4UAPA 3I2KA 1CZVA 2W92A 1CX1A 2VQTA 4QX1A 2WDBA 3P6BA 3OEBA 2OKXA 3VDAA 4DUVA 1O59A 2Y64A 4MO3M 4Z2AA 2VZPA 2VOTA 1UX7A 1NAEA 1H6XA 4CU8A 3W5MA 2YG0A 4JKMA 2VC9A 2EIEA 3CIHA 4XVHA 3NQHA 5DMYA 3WQBA 3WF2A 1SHWB 3A21A 2XONA 3ACGA 4MOAA 4OUEA 2VZ3A 2XOMA 2VCBA 1W0NA 2J1EA 2QBXA 1CZTA 4P00B 4ARXA 4QB1A 2ZEYA 4BJ0A 3VDBA 1DP0A 4QX2A 3THCA 5FUIA 4TTGA 3IDAA 5JXHA 5EIYB 4KMQA 1T2XA 3U37A 2W1SA 3UETA 4BK4A 2V72A 2W94A 5JXIA 1HN1A 3JXSA 1CIYA 5JUVA 1NKGA 2J1RA 1JYNA 3ETPA 1UMHA 2YFZA 3K75B 1JZ6A 4QPWA 1BHGA 1TG7A 1DYOA 3T0BA 1LNSA 2Y6KA 3WF4A 3BN6A 2VMCA 2VMFA 1CZSA 4A3ZA 2WZEA 4GZ9A 2Y6LA 4DUXA 2QQIA 4BK5A 1XNAA 1US3A 1OH4A 2KD7A 4PT6A 1EUTA 5G04L 4ZXEA 3HPNA 3K77A 4D0QA 3ECQA 4PF1A 1ULPA 4QDSA 2YC2A 2X05A 1JZ3A 4CUCA 4DEVA 2W1QA 4CVUA 3C7HA 4A44A 4AAXA 5A1AA 4RYDA 2Y6JA 4JKKA 3LPFA 4DXSA 2E31A 1OF4A 3WNOA 1K12A 2Z4FA 1P8JA 2CDOA 1SDDB 3MBWA 5HXMA 3HJRA 4MGQA 2PQSA 2B4KA 2C9KA 4MADA 3HNMA 4L0PA 5DQ0A 2VZOA 2WO1A 4XUOA 4A6OA 3SKVA 4DUWA 3PUIA 4JKLA 4A42A 1J84A 1UY4A 1JZ4A 4A45A 4XURA 4KI5M 3T0AA 4JHZA 3CKHA 3OG2A 4YPJA 4DXTA 1PMHX 1EUUA 3NJVA 4XUPA 1W99A 5J1XA 3OEAA 1L7RA 2ZXQA 3VD9A 3HEIA 3VD7A 3MV11 2VZTA 1O8PA 3T0DA 2W3JA 3CZJA 5C71A 1OD3A 1KEXA 2WO3A 2VZUA 3AC0A 3OBAA 3EYPA 1UY3A 3NNGA 3I3BA 4W8JA 5C7GA 2WZ8A 4QAWA 5LA1A 2W47A 2WYSA 2VMDA 3T09A 3W5NA 2VL4A 4CUAA 2W1UA 2WABA 4HG6B 3D3AA 1PX4A 5IFPA 1DLCA 2BZDA 4DEQA 4QDRA 2ORZA 2ZEWA 3C7OA 1UYYA 1ULOA 2ID4A 1W8OA 1JZ7A 4GWJA 3WF3A 2VMEA 4BXSV 5IYYA 5IFTA 3GGLA 3WNMA 2CDPA 2VTFA 1UWWA 3THDA 3I2JA 4QX0A 3K4AA 2J1VA 3F2ZA 4OYUA 2JDAA 1UXXX 4D8MA 1F4AA 3K4ZA 2BBAA 2VCCA 1JYWA 2E32A 2VZ1A 3CQOA 3NJXA 4E8DA 4ZY9A 1R64A 1K42A 3HOBA 3WNLA 2QQOA 3CZUA 1XNTA 1GMMA 2QQLA 2BERA 2L9LA 4ARYA 4DXRA 2Y8KA 3DECA 2HLEA 4FI9A 1OF3A 1GOGA 5JMOA 2VJXA 4KWUA 1K3IA 4E8CA 2BGOA 2YC4A 3FHAA 2ORXA 3OGVA 3IAPA 4AG4A 5DN2A 5I0DA 2Y6HA 3MUZ1 5CYYA 2E33A 4ET7A 1XC6A 3ABZA 3VDCA 2EIBA 4W4ZA 5B4NA 3IIIA 4UOJA 2VZQA 1UY0A 2VQUA 1PMJX 3K4DA 2WN3A 3DYPA 1H6YA 5IJRA 4W50A 2W46A 1RYYA 2Y6GA 3HNYM 2BGPA 1JU3A 1YQ2A 3LEKA 3IB3A 4LQRA 3MO4A 1US2A 1W9TA 3EB7A 3I2IA 5G05L 1JZ8A 3LQCA 3ACHA 2W1WA 4QX3A 2W95A 2VZVA 3T2OA 2YB7A 1J83A 1UY2A 2B9VA 2WAAA 1JI6A 4QB2A 3OGRA 3GXUA 2JD9A 2V4VA 1UY1A 5LA0A 2W5FA 2LS6A 3GDBA 4P5YA 3WEZA 3WNPA 3DYMA 4LKSA 3I3EA 3VD5A 3I2FA 3OGSA 4PQQA 1I5PA 3CMGA 2WO2A 2X10A 3K46A 3LEGA 2WAOA 3A7QA 5HPOA 3ACIA 2QQJA 4CU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7G A;  4JX0 A;  4OZO A;  3T2Q A;  4A4A A;  3C7F A;  1JHJ A;  1W8N A;  2X09 A;  1UYX A;  3PUH A;  3IAQ A;  2DDU A;  1NUK A;  2W9X A;  4LHS A;  2EIC A;  5F7U A;  3SKJ E;  1KGY A;  4IUG A;  2DCK A;  4M4R A;  2E26 A;  2J1U A;  2J7M A;  4XZU G;  4XUN A;  1NX9 A;  3NRU A;  3ACF A;  2RVA A;  1GOH A;  2JE8 A;  2XQX A;  3T2P A;  3WF0 A;  2VZR A;  2VCA A;  2JKX A;  3T08 A;  4LPL A;  1UXZ A;  1JYV A;  1SG3 A;  3CDZ B;  1GOF A;  1TVG A;  3J7H A;  1JU4 A;  3I2G A;  3UES A;  2C26 A;  2WUH A;  1UYZ A;  1UMI A;  4M4P A;  1WCQ A;  2W87 A;  1IQD C;  3WNN A;  1PX3 A;  4TXW A;  2DCJ A;  5JXJ A;  3LE0 A;  3LEI A;  3A23 A;  2R7E B;  1JYX A;  3P1I A;  3FN9 A;  3LPG A;  2YFU A;  3BGA A;  2V5D A;  4MGS A;  3I97 A;  2QQM A;  1K45 A;  2VZS A;  2J1T A;  5EJZ B;  1OT5 A;  3C8X A;  1O8S A;  2J1S A;  2WBK A;  4RN5 A;  3MUY 1;  3HN3 A;  2RJ2 A;  3WF1 A;  3UNP A;  1XPW A;  1D7P M;  4ZZ5 A;  3A22 A;  1F4H A;  5C70 A;  3DYO A;  1UZ0 A;  1JZ5 A;  2RV9 A;  4XUT A;  4CU6 A;  2WQ8 A;  5JR2 A;  1WKY A;  1GQP A;  3E1F 1;  3MV0 1;  3SEE A;  4XUQ A;  5IHR A;  4P02 B;  3WSO A;  3GM8 A;  4GWI A;  2VR4 A;  2EID A;  3VD3 A;  1GUI A;  4OMC A;  4BDV B;  2ZEZ A;  4P08 A;  3FL7 A;  4OMD A;  3VD4 A;  4QDQ A;  4ZZ8 A;  2HYX A;  2QQN A;  2VO5 A;  2LW8 A;  2WN2 A;  1MPX A;  2VM9 A;  1L7Q A;  5DPN A;  5EJ1 B;  3WNK A;  2XHN A;  2J1A A;  1GU3 A;  3I2H A;  5LA2 A;  2QQK A;  3SEP A;  3OB8 A;  4CU9 A;  5JXG A;  1JZ2 A;  2C4X A;  5CZK A;  1W9W A;  2J22 A;  2W91 A;  3ZM8 A;  4QB6 A;  1GNY A;  1W9S A;  3HNB M;  4CUB A;  3FHQ A;  5LCW L;  5B4X A;  3I3D A;  3C7E A;  4UI9 L;  4A41 A;  2ZEX A;  4UAP A;  3I2K A;  1CZV A;  2W92 A;  1CX1 A;  2VQT A;  4QX1 A;  2WDB A;  3P6B A;  3OEB A;  2OKX A;  3VDA A;  4DUV A;  1O59 A;  2Y64 A;  4MO3 M;  4Z2A A;  2VZP A;  2VOT A;  1UX7 A;  1NAE A;  1H6X A;  4CU8 A;  3W5M A;  2YG0 A;  4JKM A;  2VC9 A;  2EIE A;  3CIH A;  4XVH A;  3NQH A;  5DMY A;  3WQB A;  3WF2 A;  1SHW B;  3A21 A;  2XON A;  3ACG A;  4MOA A;  4OUE A;  2VZ3 A;  2XOM A;  2VCB A;  1W0N A;  2J1E A;  2QBX A;  1CZT A;  4P00 B;  4ARX A;  4QB1 A;  2ZEY A;  4BJ0 A;  3VDB A;  1DP0 A;  4QX2 A;  3THC A;  5FUI A;  4TTG A;  3IDA A;  5JXH A;  5EIY B;  4KMQ A;  1T2X A;  3U37 A;  2W1S A;  3UET A;  4BK4 A;  2V72 A;  2W94 A;  5JXI A;  1HN1 A;  3JXS A;  1CIY A;  5JUV A;  1NKG A;  2J1R A;  1JYN A;  3ETP A;  1UMH A;  2YFZ A;  3K75 B;  1JZ6 A;  4QPW A;  1BHG A;  1TG7 A;  1DYO A;  3T0B A;  1LNS A;  2Y6K A;  3WF4 A;  3BN6 A;  2VMC A;  2VMF A;  1CZS A;  4A3Z A;  2WZE A;  4GZ9 A;  2Y6L A;  4DUX A;  2QQI A;  4BK5 A;  1XNA A;  1US3 A;  1OH4 A;  2KD7 A;  4PT6 A;  1EUT A;  5G04 L;  4ZXE A;  3HPN A;  3K77 A;  4D0Q A;  3ECQ A;  4PF1 A;  1ULP A;  4QDS A;  2YC2 A;  2X05 A;  1JZ3 A;  4CUC A;  4DEV A;  2W1Q A;  4CVU A;  3C7H A;  4A44 A;  4AAX A;  5A1A A;  4RYD A;  2Y6J A;  4JKK A;  3LPF A;  4DXS A;  2E31 A;  1OF4 A;  3WNO A;  1K12 A;  2Z4F A;  1P8J A;  2CDO A;  1SDD B;  3MBW A;  5HXM A;  3HJR A;  4MGQ A;  2PQS A;  2B4K A;  2C9K A;  4MAD A;  3HNM A;  4L0P A;  5DQ0 A;  2VZO A;  2WO1 A;  4XUO A;  4A6O A;  3SKV A;  4DUW A;  3PUI A;  4JKL A;  4A42 A;  1J84 A;  1UY4 A;  1JZ4 A;  4A45 A;  4XUR A;  4KI5 M;  3T0A A;  4JHZ A;  3CKH A;  3OG2 A;  4YPJ A;  4DXT A;  1PMH X;  1EUU A;  3NJV A;  4XUP A;  1W99 A;  5J1X A;  3OEA A;  1L7R A;  2ZXQ A;  3VD9 A;  3HEI A;  3VD7 A;  3MV1 1;  2VZT A;  1O8P A;  3T0D A;  2W3J A;  3CZJ A;  5C71 A;  1OD3 A;  1KEX A;  2WO3 A;  2VZU A;  3AC0 A;  3OBA A;  3EYP A;  1UY3 A;  3NNG A;  3I3B A;  4W8J A;  5C7G A;  2WZ8 A;  4QAW A;  5LA1 A;  2W47 A;  2WYS A;  2VMD A;  3T09 A;  3W5N A;  2VL4 A;  4CUA A;  2W1U A;  2WAB A;  4HG6 B;  3D3A A;  1PX4 A;  5IFP A;  1DLC A;  2BZD A;  4DEQ A;  4QDR A;  2ORZ A;  2ZEW A;  3C7O A;  1UYY A;  1ULO A;  2ID4 A;  1W8O A;  1JZ7 A;  4GWJ A;  3WF3 A;  2VME A;  4BXS V;  5IYY A;  5IFT A;  3GGL A;  3WNM A;  2CDP A;  2VTF A;  1UWW A;  3THD A;  3I2J A;  4QX0 A;  3K4A A;  2J1V A;  3F2Z A;  4OYU A;  2JDA A;  1UXX X;  4D8M A;  1F4A A;  3K4Z A;  2BBA A;  2VCC A;  1JYW A;  2E32 A;  2VZ1 A;  3CQO A;  3NJX A;  4E8D A;  4ZY9 A;  1R64 A;  1K42 A;  3HOB A;  3WNL A;  2QQO A;  3CZU A;  1XNT A;  1GMM A;  2QQL A;  2BER A;  2L9L A;  4ARY A;  4DXR A;  2Y8K A;  3DEC A;  2HLE A;  4FI9 A;  1OF3 A;  1GOG A;  5JMO A;  2VJX A;  4KWU A;  1K3I A;  4E8C A;  2BGO A;  2YC4 A;  3FHA A;  2ORX A;  3OGV A;  3IAP A;  4AG4 A;  5DN2 A;  5I0D A;  2Y6H A;  3MUZ 1;  5CYY A;  2E33 A;  4ET7 A;  1XC6 A;  3ABZ A;  3VDC A;  2EIB A;  4W4Z A;  5B4N A;  3III A;  4UOJ A;  2VZQ A;  1UY0 A;  2VQU A;  1PMJ X;  3K4D A;  2WN3 A;  3DYP A;  1H6Y A;  5IJR A;  4W50 A;  2W46 A;  1RYY A;  2Y6G A;  3HNY M;  2BGP A;  1JU3 A;  1YQ2 A;  3LEK A;  3IB3 A;  4LQR A;  3MO4 A;  1US2 A;  1W9T A;  3EB7 A;  3I2I A;  5G05 L;  1JZ8 A;  3LQC A;  3ACH A;  2W1W A;  4QX3 A;  2W95 A;  2VZV A;  3T2O A;  2YB7 A;  1J83 A;  1UY2 A;  2B9V A;  2WAA A;  1JI6 A;  4QB2 A;  3OGR A;  3GXU A;  2JD9 A;  2V4V A;  1UY1 A;  5LA0 A;  2W5F A;  2LS6 A;  3GDB A;  4P5Y A;  3WEZ A;  3WNP A;  3DYM A;  4LKS A;  3I3E A;  3VD5 A;  3I2F A;  3OGS A;  4PQQ A;  1I5P A;  3CMG A;  2WO2 A;  2X10 A;  3K46 A;  3LEG A;  2WAO A;  3A7Q A;  5HPO A;  3ACI A;  2QQJ A;  4CU7 A; 
#chains in the Genus database with same CATH topology
 4A2U A;  3VV1 A;  4KNC A;  4JGZ C;  4LBQ D;  4OZO A;  3HT1 A;  2Y26 A;  3OGG A;  2A3W A;  1IS5 A;  4P9W A;  3O1P A;  1G86 A;  4A4A A;  4KG8 A;  4BQ5 A;  1QH7 A;  3AYC A;  1C1F A;  1JHJ A;  3O7O A;  3OY8 B;  5L7O B;  5CFD A;  2WA4 A;  1HKD A;  3OF1 A;  1VRB A;  1ONA A;  2ZGP A;  4XW3 A;  1HDK A;  3PUH A;  4NHM A;  3IAQ A;  5FY1 A;  2WNU C;  2WZR 2;  1XSQ A;  3GJB A;  2DDU A;  3LA2 A;  3NL1 A;  5FY5 A;  4ERO A;  1NUK A;  1RGS A;  2CU5 A;  4LHS A;  4FTB A;  1IKP A;  4FP3 A;  4GH4 B;  1AR7 1;  1GSL A;  1KGY A;  1AJO A;  5A3M A;  3CJX A;  2JB4 A;  3K3O A;  1D4V B;  4K8F A;  3PNA A;  3N9O A;  3PUQ A;  4YG0 A;  4M4R A;  1QOS A;  5C5U A;  1AR6 3;  2J1U A;  2J7M A;  4YZ2 A;  4XHX A;  3JB8 A;  2CGO A;  4XUN A;  5J37 A;  1NQJ A;  5JZG C;  4CDQ A;  3BTA A;  5DAV A;  1GWM A;  4AI3 A;  4XAE A;  4S2D A;  5HCB A;  2XQX A;  5ABJ A;  2VCM A;  1O3S A;  2VCA A;  1POQ A;  2JKX A;  4OLL A;  3D8C A;  1RUD 2;  3T08 A;  3WIN E;  2BOJ A;  2BW8 A;  1UXZ A;  1NG0 A;  4ASM B;  2DUO A;  4P9X A;  3M3I A;  1ZZB A;  2YGM A;  2ZGO A;  4YW3 A;  1WCS A;  2HWE 1;  2YYO A;  3J7H A;  5KHJ A;  3N36 A;  1JU4 A;  4KWK A;  2XJP A;  2PLV 3;  2C26 A;  1UKR A;  2WUH A;  4XJ9 A;  4MGI E;  1WCQ A;  3HVD A;  4J1X A;  3VB9 A;  3KWV A;  5F3E A;  2RR1 2;  2P6C A;  5FOJ B;  1PX3 A;  2DCJ A;  1O3T A;  1UL9 A;  5JMC A;  4ZPI A;  3O1U A;  4YLZ A;  4BWO A;  3LEI A;  3VKL A;  1RUN A;  2R7E B;  4BE3 A;  3M2M A;  1C28 A;  1GP5 A;  3H1M A;  2P5B A;  3LPG A;  4XCA A;  4WVZ A;  3MIG A;  3ZYR A;  4LR4 A;  5EFU A;  3WW3 A;  3I97 A;  4G3Y C;  2OVU A;  2W52 A;  3PJY A;  4MG2 A;  1K45 A;  1HRV 3;  1N3P A;  1OT5 A;  1RHI 2;  2IWG B;  4JCK A;  2E7A A;  5FMO S;  3MUY 1;  3OUJ A;  5C4W B;  1ENR A;  1MEC 1;  4DB5 A;  1YUD A;  1T6B X;  4KL1 A;  1ULD A;  5LBE A;  3TNP B;  1FOD 1;  1D7P M;  4ZZ5 A;  5AFE A;  2VOK A;  4KU7 A;  2VVF A;  5C70 A;  3V0A A;  3DYO A;  1T6G C;  2RV9 A;  4TSV A;  5C9A B;  1ACC A;  4Q0P A;  5CFC B;  4XUT A;  5E6H A;  1BBT 1;  2W0X A;  2ZAC A;  3OJB A;  4UFH A;  3VZO A;  5JR2 A;  1WKY A;  4AGV A;  1GQP A;  4LKE A;  4HKL A;  1WZX A;  3SEE A;  4IV1 C;  3NV4 A;  4P02 B;  5JOY A;  4LA3 A;  2DCT A;  2WSU A;  1PM4 A;  3ZFE C;  4K20 A;  2EID A;  2RS5 1;  5T54 A;  1ZRD A;  1MZ6 A;  2Q8D A;  2G9G A;  1GUI A;  4LIT A;  4YW2 A;  1MZE A;  1PMI A;  4W6W A;  5IK4 A;  3RI9 A;  1EP0 A;  1BLZ A;  1MQT C;  4BME A;  1UPI A;  5FZ9 A;  4CCC A;  3AKQ A;  4BA6 A;  2XBO 1;  1MEC 3;  4PLN A;  4Q29 A;  3WR0 A;  4BZ4 A;  1YQC A;  4G4F A;  2V4A A;  1TME 1;  2VO5 A;  3FX3 A;  2VM9 A;  3WNK A;  2R07 3;  2R30 A;  1BVP 1;  3RYP A;  5LA2 A;  1E57 A;  3I2H A;  4UF0 A;  5A7P A;  3VBF A;  1AYM 3;  4CCJ A;  2PQQ A;  3NNM A;  5FXZ A;  3SEP A;  4Y1U A;  3RZG A;  4AHX A;  3ASI A;  1FMD 3;  1STM A;  4CU9 A;  4I09 A;  4UF0 B;  4AI8 A;  1D4M 1;  1E5S A;  2C4X A;  2JEC A;  2WNU B;  3AB0 A;  2QDR A;  4PIY A;  1W9W A;  3OPW A;  4HVR A;  1SPP B;  4Q4X 2;  2JE9 A;  2W91 A;  1QXJ A;  1W9S A;  4CUB A;  2YRO A;  3FHQ A;  4TLF A;  2E7T A;  5CAD A;  2D6K A;  3PVN A;  1LEC A;  2BDR A;  4Q4W 2;  1WLW A;  3B3Q E;  2QDN A;  5JIU A;  2WR9 A;  4UI9 L;  4OHZ A;  3SH5 A;  3WG3 A;  4A41 A;  5BNO C;  3BPS A;  5L9V A;  5FDB A;  1WA6 X;  1ZVF A;  1RXF A;  2BOI A;  5CIR A;  1S0C A;  1CX1 A;  1ALY A;  2XBO 3;  1OVS A;  2VW0 A;  2D6N A;  2OQ6 A;  2ZX0 A;  1REE A;  4H2A A;  4O7X A;  4NIA A;  3OEB A;  3ZSL A;  1TME 3;  4DUV A;  1ODN A;  4C1W A;  5ISL A;  2WFF 3;  3LAG A;  4Q0Q A;  4Z2A A;  4GAZ A;  5LB6 A;  2VZP A;  4DMI A;  1S0F A;  1YFW A;  3IN9 A;  3WDU A;  1NAE A;  5FKC A;  3I2D A;  3B00 A;  4FPK A;  4LBK A;  1KS4 A;  4A7K A;  3POI A;  5HCF A;  2XB6 C;  3V0A B;  1W0P A;  2XR4 A;  5T5O A;  3O1V A;  2OZJ A;  2B9U A;  4HVQ A;  5IVB A;  3H1W A;  5JZG A;  3WCS A;  3AJZ A;  1QJU 2;  4CEW A;  1Q8P A;  3USU B;  1JS9 A;  1O91 A;  4I0B A;  2JG8 C;  2C24 A;  2IVI B;  3WF2 A;  5CB7 A;  1CWP A;  3A21 A;  2V09 A;  3JCI A;  4XTP A;  1TMF 3;  1KQR A;  1FPN 3;  1CON A;  2RM2 1;  5F2S A;  5FO7 B;  2QBX A;  5FBZ A;  3MEP A;  2HWE 2;  1PGS A;  1VAL A;  4RS5 B;  3ZYG A;  3ZSM A;  5FO8 B;  4N8M A;  4OZX A;  5DZE A;  2P3Y A;  2VQA A;  1MZF A;  2ZCW A;  2ZEY A;  5C3S A;  4BJ0 A;  3EHK A;  3PL0 A;  4CEY B;  3O12 A;  5CFD C;  3NV1 A;  3UKT A;  5IVE A;  5FUI A;  2DBN A;  3GBG A;  1JOP A;  1PK6 B;  3ZSK A;  3ZYF A;  3POB A;  4QGL A;  4Z82 A;  2EA7 A;  1PGL 2;  4R52 A;  3MIB A;  4PDW B;  4BOW A;  4M00 A;  3IPV A;  4AWD A;  3LZZ A;  4H7M A;  4E2G A;  1RUI 1;  1DGR N;  5T50 A;  1ND3 C;  2DF7 A;  3CBN A;  3ZR6 A;  2KM2 A;  3ZYJ B;  5JXI A;  4PI0 A;  3RWK X;  4C0B A;  4CDQ C;  1CIY A;  3OCP A;  5T52 A;  3N7J A;  3F95 A;  1ENQ A;  1FOD 2;  3ETP A;  3QLQ A;  1UOG A;  4FPF A;  2YFZ A;  1FV2 A;  4R9B A;  3GBF A;  5CU1 A;  2RG4 A;  3OYW A;  1JZ6 A;  4OVE A;  1A78 A;  1Y9M A;  4LO4 B;  4QPW A;  5FYY A;  4V2W A;  4Q0U A;  4DOU A;  4D6Q A;  1OVP A;  2XDV A;  1BBT 2;  1W90 A;  3T0B A;  4RFR B;  1W6O B;  3MIC A;  1CAU B;  3BN6 A;  5FTT C;  1KDM A;  1JN2 P;  3U1X A;  4CDX A;  2GMP A;  4UBH A;  2RS3 3;  3ME2 A;  4QHO A;  4BXF A;  4DUX A;  4D6R A;  2IZW A;  3VBH A;  3ZIW A;  1DQ2 A;  1KS5 A;  1XNA A;  3OY8 A;  5FZG A;  1US3 A;  4AGR A;  1LHN A;  1GP4 A;  3ZYI B;  4TWT A;  4H55 A;  5G04 L;  5F37 A;  1JYC A;  4Q26 A;  4V2V A;  1IHM A;  1LHW A;  2IXL A;  1RED A;  3K77 A;  1VMF A;  1W6Q B;  4D0Q A;  1G8W A;  1DIW A;  1EAH 2;  1G9D A;  1ULP A;  1V00 A;  3KV9 A;  4QDS A;  1M06 G;  4A7Z A;  3HBZ A;  2X05 A;  1RUO A;  2W1Q A;  4XAB A;  3AVR A;  3C7H A;  4N43 C;  1CAW A;  4CP9 A;  2CV6 A;  2PHW A;  4RYD A;  2Y6J A;  3PLQ A;  1V6J A;  5FZ1 A;  1N47 A;  3WUD A;  1DBN A;  4Q0S A;  1LGN A;  1OOP C;  1VBE 3;  1GR3 A;  2XH6 A;  3LPF A;  3AZY A;  4LXL A;  4Q4Y 3;  2Z4F A;  5FZ0 A;  4LT5 A;  2BGC A;  3X29 B;  1QJF A;  5HXM A;  5CG8 A;  2ZHK A;  5GLT A;  3MW4 A;  1LOD A;  2JKB A;  1UW8 A;  2PQS A;  4CYD A;  2B7Y A;  4MAD A;  4L99 A;  2BNM A;  1J3Q A;  4L0P A;  5HV0 A;  2Q1M A;  5DQ0 A;  2EXH A;  2VZO A;  3VDD A;  5KXB A;  3OUH A;  3SKV A;  3MFA A;  4CDW A;  4GXL A;  3R0R A;  2TNF A;  4GAL A;  4GMP 0;  4ZU5 A;  1XSR A;  2R07 1;  3KS7 A;  4DUW A;  4QU2 A;  1Z7S 2;  2JG9 B;  5DAB A;  4CCK A;  1I6X A;  2YDE A;  4N7I A;  5JIA A;  4CDW C;  4CXY A;  2W2I A;  1RUG 3;  4UFJ A;  1KFX L;  2UUR A;  4FPL A;  2RR1 3;  1EPW A;  4XUR A;  3VLB B;  4KI5 M;  2HWD 2;  3WDT A;  4NO4 A;  5C8W A;  3H8X A;  3MGU A;  3CKH A;  2HWB 3;  4IEX A;  4CCE A;  3S0M A;  2W39 A;  5GM0 A;  1IPS A;  3DPR C;  1H4G A;  3WV6 A;  4DFS A;  4CP0 A;  3THT A;  3WG1 A;  5EQU A;  1HX6 A;  1RJ7 A;  2DFC A;  2UWB A;  4QQO A;  2AGS A;  1W99 A;  1I5Z A;  2VUC A;  3ZN6 A;  2EIG A;  2YU2 A;  3MV1 1;  3ZFF A;  4XAA A;  5FAX A;  1MS5 A;  3T0D A;  1W8U A;  1RUJ 2;  1DZT A;  5KXE A;  4P9G A;  2ADE A;  2QZ2 A;  4IV3 C;  1W6N B;  2X5I B;  5JSO A;  1KD7 A;  3AC0 A;  1ZZ9 A;  3EYP A;  3I3B A;  3NST A;  1ODM A;  2B39 A;  4W8J A;  4YFZ A;  3FLR A;  4P5H A;  3KV6 A;  5FYZ A;  5IVF A;  3MPB A;  5J09 A;  4OQ8 A;  4HPK A;  1YWK A;  3KB5 A;  1AR9 2;  4CEW C;  1OQE A;  3GNE A;  2W47 A;  2WYS A;  3ZDS A;  1C8M 3;  2RJK A;  5JVV A;  1PVC 2;  3DPR B;  3LB9 A;  4YVS A;  4XC9 A;  1A8D A;  2HWF 1;  1KXG A;  5FYT A;  3T3Y A;  3BYW A;  5ANN A;  1AL2 3;  3J7L A;  3ZXE A;  5I8T A;  3GHN A;  1L7L A;  3Q9O A;  4NWW A;  4QDR A;  3VGI A;  1N1T A;  4UWD A;  4NHL A;  4MUV A;  3S6P A;  2A6X A;  5ACA 1;  5FZO B;  4EWD A;  5DXD A;  2ID4 A;  5E1R A;  3I54 A;  2DU1 A;  4Z92 B;  2A73 B;  2JG9 C;  5FQ0 B;  4BXS V;  3U0Z A;  2GP5 A;  2X53 S;  4Y24 A;  4A3X A;  3DKW A;  2PHU A;  3TEX A;  2VTX A;  3CJI B;  3N9L A;  4K1Y A;  4QX0 A;  3F2Z A;  1RUI 3;  5I93 A;  3ITQ A;  1UXX X;  3K48 A;  4RGA A;  1IS3 A;  4UFM A;  2BBA A;  1JHN A;  1SLL A;  2I45 A;  2A6W A;  4COU A;  2XWJ B;  4NIG A;  4Q8K A;  1K5M B;  3B94 A;  3ZXD A;  4U36 A;  3BKZ A;  1PO2 2;  2R1B A;  4CDU C;  2E53 A;  1DG6 A;  4PIZ A;  5JI9 A;  3CJI A;  1FV3 A;  5HCH A;  3MYX A;  1NZI A;  4ARY A;  5AC9 1;  2JE7 A;  3DEC A;  2YZ4 A;  2BPA 2;  3ILN A;  1OF3 A;  2FDH A;  2VJX A;  5KWR A;  1K3I A;  3RZZ A;  2BGO A;  3ACL A;  1FX5 A;  5FUP A;  2XXZ A;  4AFD A;  3V0B A;  2UU8 A;  3FHA A;  1W3X A;  3M3Q A;  3H50 A;  3ZYH A;  5FMB A;  2E9Q A;  3I59 B;  3R4U A;  4FOY A;  4PBO A;  5K8S A;  1W6O A;  3UK9 A;  4AFA A;  2WWS A;  3WDY A;  3LGR A;  4EYU A;  1GZC A;  4XQ4 A;  1SQ4 A;  2Y6H A;  5FP9 A;  4Q0V A;  4AVV A;  3IPV B;  1RUF 2;  2HEV F;  2WKK A;  3I2O A;  3RWN A;  1Q56 A;  2JEN A;  4NAO A;  1KFU L;  3N9Q A;  5BXX A;  1F9K A;  3BVC A;  2HYK A;  2WWJ A;  5BYN A;  1SLA A;  4MGK E;  4CCN A;  4CCD A;  4X6R B;  4LBM A;  3HWJ A;  2ENR A;  2YV8 A;  4BQ1 A;  1SLT A;  4C91 A;  2VNO A;  4FOW A;  2HWE 3;  1VBC 3;  1RXG A;  3N9P A;  3VBO A;  2QQU A;  1ULG A;  2QE3 A;  3D5O A;  3PUS A;  1HRI 3;  4GA9 A;  4NOT A;  4AW7 A;  2BGP A;  1J3R A;  4UXA A;  2GU9 A;  3LEK A;  2HWD 1;  1W3V A;  3PUA A;  4HSJ A;  4DRV A;  4COW A;  4N9I A;  2IXC A;  1UCX A;  3EB7 A;  5CA6 A;  4XFH A;  3ZFF B;  3R05 A;  5JOZ A;  5FRE A;  4IES A;  4PDW C;  1SFY A;  5G05 L;  5LEJ A;  3T1L A;  2FQP A;  5FPU A;  1ZBE 1;  3VBH C;  1HXS 1;  4RS5 A;  2RJL A;  1X36 A;  2UYA A;  1F31 A;  2JDP A;  1YI9 A;  3HBK A;  1UY2 A;  1XYP A;  1RMU 3;  4QWN A;  1RUJ 1;  3E6C C;  4BB3 A;  5A1L A;  4QB2 A;  3ZFG C;  4PHZ A;  1V9U 3;  1VAM A;  4OUM A;  5EPA A;  5LBB A;  1QJX 3;  2O8Q A;  4Y5S A;  5DUW A;  1RUG 2;  2I07 B;  5HV4 A;  1BXH A;  4YW7 A;  1ULE A;  2LRO A;  4LHN A;  4AI0 A;  3VD5 A;  4FPO B;  4XCB A;  3OGS A;  4MHU A;  1AYM 1;  1HW5 A;  1U0A A;  3OBR A;  1I5P A;  4MLO A;  4GIQ A;  1X33 A;  1D2Q A;  4PQQ A;  1QOO A;  2VQ0 A;  1Y4W A;  3LEG A;  3I4I A;  3WHU A;  2Y60 A;  5E16 A;  4LBQ B;  4RQP A;  2RS5 3;  3THP A;  5C5T A;  2QQJ A;  2VVE A;  4C90 A;  3WW1 A;  2WS9 1;  4HZF A;  2NQY A;  4IE5 A;  4HKW A;  2CTV A;  1RUJ 3;  3LF7 A;  2OZ6 A;  1OH3 A;  1YCI A;  3VHP A;  2AYH A;  2R32 A;  4HSL A;  1YLL A;  1JMU B;  1BKZ A;  1JW6 A;  4HK8 A;  5JCT A;  1HB1 A;  4HET A;  3W9A A;  2ZAB A;  1PVC 1;  1CAW B;  5IAX A;  3AMN A;  1J1T A;  2WQZ C;  4MVT A;  4Y4R A;  3VBF C;  2HEW F;  2WFF 1;  3IIA A;  2H6C A;  4I3P A;  5CKQ A;  2HBT A;  2ZKN A;  4D7S A;  1VP6 A;  3NVC A;  2W9X A;  4NN0 A;  4XFA A;  1RJ8 A;  4NMI A;  3QAC A;  2EIC A;  1ND2 B;  1IG3 A;  4YM0 A;  5DUX A;  1COV 3;  1WMX A;  3OBZ A;  1O5U A;  5LAS A;  4IUG A;  2I74 A;  4GJY A;  2E26 A;  1OLQ A;  1WGP A;  3FLT A;  4WM7 A;  4Y22 B;  3SQO A;  4ZKT B;  4IGP A;  3RI8 A;  2QQP A;  1WCD J;  5T55 A;  3VBH B;  1PHM A;  4K3U A;  1S55 A;  4XZP A;  3T4H B;  2FCU A;  3O1R A;  4LBQ A;  4RQP B;  2JE8 A;  3WF0 A;  4S2G A;  5AVP A;  4YVW A;  4EQV A;  3NNL A;  1PO2 1;  1H2K A;  3KV4 A;  4Q4X 3;  2N7G A;  1IPK A;  1VPH A;  3ALQ A;  4XOG A;  1Q8Q A;  1SG3 A;  4J6G A;  2D5F A;  5FZM A;  5FY9 A;  4GB3 1;  1W2T A;  3VBR C;  1TVG A;  4DZG A;  3SXW A;  3BI3 A;  3I2G A;  4QXK A;  1C5I A;  4AZZ A;  2YMZ A;  1WLC A;  1W0O A;  1CPM A;  1IGO A;  1UYZ A;  4YYO A;  1UMI A;  2CWS A;  3GZA A;  4I2O A;  2W87 A;  5E8A A;  1UKG A;  1W03 A;  3BAL A;  1QF3 A;  4XHB A;  4J25 A;  4TXW A;  1RUH 1;  4FQ4 A;  1VJ2 A;  2ZHL A;  5JXJ A;  4JZR A;  2F4P A;  3NNF A;  2E6V A;  3PMS A;  2JIJ A;  1JYX A;  4L2N A;  3ZFE B;  3P1I A;  1R08 1;  3VBO B;  2XJR A;  3FFQ A;  4LHL A;  5FY4 A;  2XG3 A;  3BGA A;  2V5D A;  2GH8 A;  1YXW A;  3ZMN A;  4BMB A;  2QQM A;  1NA1 A;  2DUQ A;  2YUE A;  1QJY 1;  2J1T A;  2NMN A;  2Y0O A;  4Q1P A;  4RHV 2;  4JRL A;  5D1I A;  4Z07 A;  3AXE A;  4N43 B;  2GMM A;  3LIG A;  4ZU4 A;  4WVV A;  4XJ8 A;  3P3N A;  2VW1 A;  1B35 A;  4D69 A;  5BNO B;  1VIW B;  3BOD A;  5A3P A;  1CN1 A;  5FPZ A;  3KMH A;  1VLN A;  3KT7 A;  2JG9 A;  3IMM A;  3NMB A;  5FBJ A;  4CEY A;  4MX3 A;  4AFC A;  3FUQ A;  2HH9 A;  1NCR C;  3I49 A;  3WY6 A;  4AVS A;  1JZ5 A;  4CZS A;  3WCR A;  4JV4 A;  4Y20 B;  3VDD B;  4N53 C;  1KIT A;  4AVT A;  4XJW A;  5A70 A;  1V6L A;  2QUO A;  4CU6 A;  2WQ8 A;  1G9C A;  4OUL A;  1DHK B;  5ABJ B;  1YRZ A;  3WG4 A;  3AZV A;  1TMF 2;  4KWJ A;  4CDU B;  4KBB A;  3ATG A;  4URT A;  5F1R A;  3TEZ A;  2AAC A;  2GNT A;  1UPS A;  3WSO A;  4IEU A;  1TNR A;  4GWI A;  2VMG A;  1WME A;  2VR4 A;  2JDZ A;  4KGG A;  3NAP A;  3RGB A;  1Y9G A;  1I3H A;  3WLU A;  1V9U 2;  2WLP A;  2PLV 2;  5FZD A;  1Z7S 1;  3NV2 A;  3VD4 A;  3M3C A;  4QDQ A;  2DFB A;  3B02 A;  4HLT A;  4AEK A;  4URA A;  3KV5 A;  4XJZ A;  5ANQ A;  5DAW A;  1MS4 A;  1UZW A;  1WMD A;  2GN7 A;  2DU0 A;  1VAV A;  2WN2 A;  3AKR A;  1MPX A;  1N1Y A;  3PHM A;  4PLO A;  5DPN A;  3B5L B;  5EJ3 A;  1LU1 A;  4ZON A;  4FBF A;  1HJF A;  1GU3 A;  2J1A A;  5DDJ 1;  1GBG A;  2QQK A;  2GP3 A;  5J3U A;  4GKX A;  2GNM A;  5JPM B;  4NHX A;  4RS5 C;  1HRV 2;  4W6Y A;  1C57 A;  2D98 A;  3RVH A;  5HBA A;  5JXG A;  3AK0 A;  5JR7 B;  1XND A;  1OOP A;  1ZRR A;  2OT7 A;  4QKF A;  1G9B A;  4QB6 A;  4B4R A;  1GNY A;  3CLP A;  1VBE 2;  1BYH A;  1R1A 3;  1ASJ 3;  1U5I A;  2WWU A;  1F35 A;  5LCW L;  1AX0 A;  5B4X A;  4Z1V A;  4XJU A;  2ZTN A;  3I3D A;  3KLS A;  2NM1 A;  4GH4 C;  1AR8 2;  1EV1 2;  3ES1 A;  2HEY F;  3WVJ A;  3AP6 A;  1ZA4 A;  1O4Y A;  4P9Y A;  1CZV A;  3S5A A;  3NAP C;  3R6S A;  2VQT A;  1BQP A;  1QJE A;  4UFL A;  5F39 A;  3RQ0 A;  5A32 A;  2B8M A;  2RDQ A;  1NCQ B;  4NUB A;  4M3C A;  4QKN A;  4QM8 A;  3VDA A;  4MO3 M;  3LWC A;  5FZE A;  1GYK A;  3VBR A;  5EXO A;  1NY7 1;  1ZRC A;  2VOT A;  4PJY A;  2WS9 2;  1H6X A;  2RR1 1;  4XIK A;  5FZO A;  1Q43 A;  4JKM A;  3VKN A;  2VC9 A;  3A0N A;  2EIE A;  2QZ3 A;  3LSE A;  1LOF A;  1S2E A;  2AZ5 A;  2X5I A;  3ILF A;  4KWL A;  5D2A A;  5FK8 A;  4MXW A;  5C3O A;  3U14 A;  3ZFG B;  2BFU S;  2WO7 A;  2D7F A;  4B4P A;  3VBU A;  1G9A A;  1XQN A;  3WZ1 A;  3KCY A;  3PTR B;  1NOV A;  1SHW B;  1RUE 1;  3ZVX A;  4HOO A;  3I3Q A;  2ZGR A;  2JB8 A;  3ACG A;  1QQP 2;  4MOA A;  4OUE A;  1V0A A;  1H2L A;  2VZ3 A;  1OUX A;  1CD3 G;  3H3L A;  4FFH A;  4QQH A;  2NZ9 A;  1RUC 3;  3RRD A;  4IET A;  1W0N A;  2J1E A;  2WT0 A;  2XVK A;  3E5U A;  5LZ6 A;  3O0V A;  4YZ3 A;  4NHK A;  3KSC A;  3TRS B;  1V6N A;  4P9I A;  1MS3 A;  2PXJ A;  4YZ5 A;  4Q5O A;  3VN4 A;  2OPK A;  3GBW A;  3THC A;  3VL8 A;  1QNW A;  1GZ9 A;  2PAM A;  5FLH A;  2OYZ A;  1CGP A;  1F8V A;  1MAC A;  2ZPX A;  4NRO A;  2Q1Z B;  4LKF A;  1LAJ A;  2VUL A;  3IDA A;  5EIY B;  3LCP A;  2WNE A;  3AYA A;  4IDZ A;  4KMQ A;  4XXA A;  4Y33 A;  3IZO A;  2R6Q A;  1CAX A;  2NLR A;  2HWF 3;  4WM8 A;  1F5J A;  2CWM A;  1LOE A;  1MEC 2;  3EJK A;  2W1S A;  3FBY A;  5FLJ A;  1X82 A;  4XJA A;  4HVO A;  3ZLI A;  2WFP A;  3O5S A;  4B8E A;  3JXS A;  1X50 A;  4WZF A;  1AL2 2;  2YBS A;  1LUL A;  5FP8 A;  5JUV A;  2A7A A;  1GAN A;  1JYN A;  3B93 A;  1VBA 1;  2BU9 A;  4BQY A;  1UMH A;  2VOW A;  3K75 B;  4LJH A;  3O1S A;  1SEF A;  2D5H A;  1LEM A;  2A75 A;  3J7N A;  1GQG A;  5B2G B;  5I0S A;  1I1E A;  2QQW A;  3MID A;  2EVX A;  3ZOI A;  3QOP A;  5CAZ A;  1OSG A;  4CP9 B;  3LSD A;  4S2H A;  4BQ3 A;  2VMC A;  1CES A;  2XWB B;  3MW3 A;  3H9A A;  1H2M A;  1VAK A;  3ZYP A;  2QQI A;  2VVD A;  2YGL A;  3GZU C;  2VD7 A;  2FDI A;  1YJK A;  1WBL A;  1D4M 2;  1G6N A;  1OH4 A;  1CJD A;  1WD4 A;  2JDN A;  2GC1 A;  3UV9 A;  1TME 2;  1EUT A;  4XET A;  5KHH A;  4BM8 A;  2WYF A;  3Q8E A;  4ES9 A;  4HK9 A;  5FP3 A;  4XEZ A;  5L9B A;  1VBA 3;  3DXU A;  3FFZ A;  5AC9 3;  1B09 A;  1H1M A;  1ASJ 1;  2IFR A;  2X29 A;  2YC2 A;  2HWC 3;  4LEJ A;  4QPI A;  4UFI A;  5CNA A;  5EWS A;  1AZD A;  3W21 A;  4AAX A;  4AQ2 A;  5FZ7 A;  1UF2 C;  5FZF A;  3KHC A;  5T5P A;  2SLI A;  3FMG A;  1XJA A;  4JKK A;  1DQ4 A;  4O9G A;  1RIN A;  2A3Y A;  2XLG A;  1ZBE 2;  3ZSJ A;  2Q8C A;  3VBS B;  1K12 A;  5K0U A;  4AE2 A;  2E51 A;  4QGM A;  2VNG A;  3HJR A;  1C8M 2;  3N9N A;  3TOJ A;  4BU2 A;  2BV4 A;  5A1F A;  1X8M A;  1OMI A;  3LFI A;  2C9K A;  5BNP A;  5BNN A;  2OPW A;  2YBP A;  1RB8 G;  4AOC A;  3M7A A;  2WO1 A;  1RUG 1;  4XUO A;  1PIV 1;  5C9A A;  1SLI A;  4E9K A;  2CAV A;  1SFP A;  3POY A;  4LUK A;  4W6X A;  2HWC 1;  2PHD A;  5IVJ A;  2JWP A;  3EMR A;  5BNQ A;  5FZ3 A;  4D6S A;  4Z8B A;  4G9S B;  1U5Z A;  4W65 A;  1OLM E;  4L8Q A;  3T0A A;  1QJU 1;  3GZE A;  4JHZ A;  4NRP A;  3LDK A;  1PM7 A;  4BIS A;  4WV8 A;  2J42 A;  4YPJ A;  4AVC A;  5J48 A;  4AVB A;  1PMH X;  1EUU A;  2XHK A;  2DUP A;  4Y1Z A;  2WZP P;  3NJV A;  4XYX A;  1YIF A;  4MZU A;  4XUP A;  5DAQ A;  3KQ4 B;  5J1X A;  4JGY B;  3AP4 A;  1VBB 2;  2ZHM A;  3VZL A;  1RUE 2;  2ZXQ A;  3VD7 A;  2R06 3;  3RDI A;  2RMU 2;  2WFF 2;  4N43 A;  3E5X A;  1S0D A;  3N7L A;  2Q30 A;  1W2A X;  3B7M A;  3CZJ A;  1OD3 A;  3O0X A;  2ES3 A;  3PUR A;  4AHW A;  5T5J A;  5FV3 A;  3MDP A;  3PIJ A;  1QXP A;  5E89 A;  1UY3 A;  1YC6 1;  2PHL A;  3NNG A;  3VKM A;  1CX4 A;  2JG8 A;  2WZ8 A;  1MQT A;  1AR6 1;  3JD7 3;  4ES8 A;  2ETE A;  1FXZ A;  2IXH A;  2XL9 A;  1WUV A;  4FPJ A;  5EYX A;  3ZXL A;  2DTW A;  2VMD A;  4FFI A;  3H3Z A;  4IXL A;  3PU3 A;  1ZM1 A;  3H42 B;  5CKM A;  2NN8 A;  5FYS A;  1HV0 A;  2JDY A;  1QQP 1;  2VL4 A;  3BB6 A;  1H8V A;  4LBN A;  4AEM A;  2VE1 A;  4R8H A;  1NE4 A;  4MH0 E;  1YJL A;  4QXH A;  1OC1 A;  2HKX A;  3BPZ A;  2IXK A;  4Y1X A;  1PX4 A;  1LOA A;  4E4Z A;  3LOI A;  2CAU A;  1OA4 A;  2BZD A;  4IGO A;  4DEQ A;  4QKB A;  3MF9 A;  2XKP A;  1JH5 A;  1W6P A;  5FYC A;  1FPN 1;  1YIP A;  2OS2 A;  2ZEW A;  5DUU A;  5A6Z A;  1JZ7 A;  1O3R A;  1LJ7 A;  1OFS A;  2ADD A;  4YVW C;  4RGK A;  5BNP B;  1RUH 2;  3WF3 A;  5BNN B;  5IYY A;  5IK5 A;  1BK0 A;  4F8A A;  2XUE A;  1LOC A;  3MLJ A;  1QGL A;  3ELN A;  1OFN A;  4MSV A;  4EZH A;  2CDP A;  4ORF A;  3JQX A;  3SLI A;  1NXD 1;  1POV 3;  3MZH A;  3AP7 A;  3AKS A;  3KT1 A;  3RS6 A;  5K0U B;  4Q2F A;  4YFW A;  3VBF B;  3VBS A;  2R06 2;  2R04 1;  1WCK A;  5JOX A;  3UKN A;  2LAL A;  3AM2 A;  1BCX A;  2WJS A;  4QXB A;  4D8M A;  1FT9 A;  4E4H A;  5FQ0 A;  5F32 A;  4HXC A;  2HWB 1;  3URF A;  1AVB A;  3SCF A;  1ZBA 1;  4Q4W 1;  4CE8 A;  1TNF A;  2E32 A;  3KZ4 C;  4AED B;  1O5L A;  3POW A;  5J96 B;  3CQO A;  5A33 B;  1GNZ A;  1LOG A;  4AL9 A;  3WNL A;  3MHZ A;  2QQO A;  2GC2 A;  2YU1 A;  5FZC A;  2QQL A;  3U11 A;  4R9C A;  3FC0 A;  1BEV 3;  1PVC 3;  2DWR A;  2VGD A;  3DN7 A;  5JMO A;  4KWU A;  2AH2 A;  4C8D A;  4E8C A;  1RUC 1;  2WNV C;  3I8T A;  4Q1R A;  3RMX A;  2GDF A;  4XF0 A;  1K5J A;  4L9B A;  3OGV A;  1XE7 A;  2XJT A;  3IAP A;  4N7U A;  5F6L B;  2DCZ A;  4AG4 A;  2RDR A;  5KXD A;  1SBF A;  5FXW A;  1NT0 A;  2E33 A;  4DIN B;  4IV3 A;  5LBC A;  4SBV A;  1XC6 A;  2ARE A;  3ABZ A;  2RDS A;  3VDC A;  1VBC 1;  4W4Z A;  1H1I A;  3J9S A;  5FLI A;  2ILM A;  3NW4 A;  3QCW A;  3W20 A;  1UY0 A;  2ZHN A;  3PVO A;  1PMJ X;  1U5Y A;  1CR7 A;  2ZX2 A;  3RSJ A;  1DGW A;  4YAR A;  3AX4 A;  4FQZ A;  3DYP A;  5DG1 A;  4IND A;  4K40 A;  5D8A A;  1H6Y A;  2ZX3 A;  3H7Y A;  3O1M A;  1AR9 3;  2HWC 2;  1YFY A;  2Q5T A;  3LA3 A;  3LIH A;  4WM8 B;  3USS A;  3UJQ A;  5L9R A;  5CKN A;  4CPB A;  2KXL A;  3AP5 A;  2B46 X;  3DUI A;  2BWA A;  4MV2 A;  4LQR A;  4R9D A;  1OXC A;  1PVX A;  5A7O A;  1SCR A;  4CUG A;  4DY3 A;  3V65 A;  1DZR A;  1RUD 1;  4WVW A;  2ZAH A;  4NRM A;  3SNM A;  3ACH A;  2JDH A;  2XUM A;  2YBK A;  3J8F 2;  2VBD A;  2HWF 2;  4FXG B;  1RTV A;  3T2O A;  2W68 A;  1XYO A;  3BUC A;  1H9P A;  2RMU 1;  1BZW A;  5ACA 2;  4AI9 A;  3S57 A;  1LOB A;  4KU8 A;  5GZD A;  5A7Q A;  3GXU A;  5LA0 A;  2ET7 A;  4NRQ A;  2FDK A;  4F3J A;  1HQN A;  3GDB A;  3MI8 A;  3W59 A;  4FVV A;  4P5Y A;  4N53 B;  2K9Z A;  4YZ1 A;  1N1V A;  4TZD A;  5A6Q A;  4WVM A;  3DYM A;  4LKS A;  2WQ4 A;  2FDF A;  4K8R B;  4O61 A;  2WO2 A;  2PYT A;  5JI7 A;  3UGG A;  4YM3 A;  4A6S A;  4MHR A;  1WA4 A;  2WAO A;  3IKW A;  3H8O A;  1OKO A;  2DVA A;  4BCU A;  3V0B B;  3UL2 A;  5C8C C;  2F6B A;  1GZT A;  4RD7 A;  3WW2 A;  4JTO A;  1H8T B;  4EV0 A;  5IW0 A;  4FSJ A;  1VBD 3;  3C7G A;  3AYE A;  4JX0 A;  3OUI A;  1NCQ A;  5LW9 A;  2ATF A;  2BRT A;  5A32 B;  1O6U A;  1FAY A;  2RMU 3;  5FWE A;  3VUO A;  2IVJ A;  4RR3 A;  1AXK A;  3C7F A;  5F3G A;  1S0I A;  4PLM A;  4AEJ A;  4AHZ A;  4CTE A;  1LKN A;  5FPL A;  5K9Y A;  4ONU A;  1UYX A;  1TEI A;  3KHB A;  4QPI B;  1CAU A;  1HN0 A;  1GWL A;  3TYJ A;  4CXX A;  1FAT A;  2LM3 A;  2Y34 A;  3GJA A;  4LOR A;  4FFF A;  5L7O A;  3POF A;  3SKJ E;  5F7U A;  3FUO A;  5IAT A;  5FFO C;  3FE5 A;  3VZN A;  1ULF A;  2HWD 3;  5IVY A;  2CYF A;  4HMZ A;  1RL3 A;  5A3W A;  3I7D A;  3NJY A;  2DCK A;  1QIQ A;  1MS0 A;  1ND3 B;  2MNG A;  4CCL A;  5IVC A;  4OHY A;  4RSU A;  4IEO A;  4XZU G;  3FWE A;  2JJ6 A;  1UU4 A;  3NRU A;  1ZBA 2;  3ACF A;  1DQ1 A;  2RVA A;  4HON A;  1AL2 1;  2A3X A;  2LUW A;  1GOH A;  2IXI A;  1JUH A;  3WD5 A;  4GUL A;  1QKQ A;  3TN9 1;  3T2P A;  1U12 A;  5GZF A;  5IAV A;  1PK6 C;  3FJS A;  2OUH A;  5FPX A;  1FNZ A;  1JYV A;  3PME A;  3OGJ A;  2C0Z A;  2R06 1;  1YNA A;  3R4S A;  1GOF A;  4S2F A;  1ZRI A;  3GHM A;  2PHX A;  2BNO A;  4XPV A;  2F4L A;  5GJ6 A;  4N53 A;  1LGB A;  1B35 B;  2PHR A;  1F5F A;  1RHI 3;  4NE9 A;  4XE9 A;  4B29 A;  2ZKL A;  4H3W A;  1PK6 A;  4M4P A;  4Q4V 1;  4COY A;  4DS0 A;  1C4R A;  3WNN A;  2CHH A;  2XJU A;  1X9P A;  3HMY A;  2OX0 A;  2QQV A;  4KGQ A;  3AMH A;  4LLF A;  2ZAA A;  1UOF A;  1SMV A;  1JUI A;  4HKO A;  1R1Z A;  3FHI B;  1HB2 A;  5FR3 A;  2YFU A;  4YM2 A;  4OI4 A;  3FBM A;  4GWM A;  4MGS A;  3ZKY A;  3U75 A;  1KRI A;  1OI6 A;  2XPJ A;  2VZS A;  5EJZ B;  3UT0 A;  3C8X A;  1O8S A;  2WBK A;  1EY2 A;  1PZ7 A;  2TBV A;  2QJV A;  1NCR B;  3HN3 A;  2VXR A;  1C5H A;  2RJ2 A;  4NIH A;  4XBL A;  3ORJ A;  3Q8B A;  2G9F A;  2DCY A;  2HBU A;  2UWA A;  4LO7 A;  5FZ4 A;  1DQ6 A;  1UZ0 A;  5F9T A;  1PGW 2;  4UW4 A;  4TLG A;  5JLV A;  1YQ5 A;  3AFG A;  3AZW A;  5IK8 A;  5T5L A;  4QU1 A;  3MV0 1;  1CQ9 A;  4XUQ A;  3LEM A;  5FYH A;  1PO1 3;  3GM8 A;  5K4L A;  2MEV 2;  4E27 A;  2C9A A;  4BQX A;  5I0T A;  1FMD 2;  1AR7 2;  2ZML A;  3BOP A;  2ZEZ A;  1SBD A;  2VEC A;  4J1W A;  3AZZ A;  4LE4 A;  4P08 A;  3FL7 A;  4N90 A;  5F5A A;  1UN1 A;  2D93 A;  5LK5 A;  4R9A A;  3U07 A;  5L36 A;  2HYX A;  4LK7 A;  5FXV A;  3N4M A;  1H4H A;  1RIT A;  4H7L A;  3VBR B;  4CXW A;  2QQN A;  5FYU A;  2AEZ A;  2BTV C;  5EJ1 B;  1HRI 1;  1LGC A;  4FFG A;  1HLC A;  3TEY A;  3WQ0 A;  3BU7 A;  2BQP A;  2WNU A;  2XHN A;  4B3N A;  1AF9 A;  1O7F A;  4YW6 A;  1VBD 2;  3OB8 A;  1JZ2 A;  4XQD A;  5CZK A;  4LIV A;  5DAP A;  3HAG A;  2J22 A;  2EAK A;  3ZM8 A;  1Q8O A;  3HNB M;  1ZBE 3;  2PN5 A;  5FMD A;  3G7D A;  4YGB A;  5ERL A;  2H0B A;  4X8N A;  3WDX A;  1XXN A;  4JGZ A;  4B7K A;  5A6X A;  1J1L A;  2BUK A;  4I0A A;  2CSG A;  4MGT A;  2D44 A;  3C7E A;  2MPF A;  1CAV B;  2A1X A;  2ZEX A;  3E97 A;  1OOP B;  2DV9 A;  3I2K A;  4H14 A;  1YYN A;  3FLP A;  1QJX 2;  4ZS3 A;  5EYY A;  4JC1 A;  2WDB A;  2FMY A;  4HN1 A;  1IKQ A;  1KJL A;  3P6B A;  2OKX A;  1S2K A;  3LKJ A;  1AX1 A;  1LES A;  2Y64 A;  5C6C A;  1D4M 3;  1VB4 A;  3VKF C;  1YI7 A;  1Q5O A;  1MVQ A;  1UX7 A;  1S0J A;  2RS5 2;  1S0G A;  3INA A;  2P3I A;  2B42 B;  4AF9 A;  3J7M A;  1H30 A;  4RL7 A;  2Y33 A;  3CIH A;  4YW1 A;  3WDV A;  3ZXK A;  4FPY A;  4OQ9 A;  3ZPY A;  2QKD A;  4OI2 A;  4QHZ A;  1W6M B;  1QDO A;  1S2B A;  3CHX A;  4DY5 A;  2RHP A;  3NQH A;  1WCU A;  1QHD A;  2KA3 A;  2XVL A;  1W8W A;  3ZPO A;  1QJY 2;  2FHR A;  2XON A;  5A7N A;  2IFW A;  2XOM A;  3VHO A;  2VCB A;  1OD5 A;  3L2Y A;  4FOV A;  1QU0 A;  3RZH A;  1O3Q A;  1MQT B;  4ISQ A;  3MF6 A;  4M01 A;  1CZT A;  4XMA A;  4ZU7 A;  4EN0 A;  2WL1 A;  4A7Y A;  4BH9 A;  1R1A 2;  1CVN A;  3CJI C;  1UZY A;  2A6Y A;  4QB1 A;  4XIO A;  3WOG A;  4ARX A;  1QOT A;  4DQA A;  3NKG A;  2C5D A;  3POG A;  1DP0 A;  4PBP A;  5GKA C;  4XDP A;  4QX2 A;  4CP2 A;  1JYT A;  4GQ7 A;  2VTX J;  4U2A A;  5DDJ 3;  4TTG A;  3TN9 2;  1KDK A;  4YGD A;  4UT5 A;  2DBI A;  4R4Z A;  5H9Q A;  4IE4 A;  3PDQ A;  4I3G A;  5GZC A;  4OCT A;  4OUS A;  4XMI A;  1W05 A;  4BQW A;  4LUL A;  4FPH A;  4B7E A;  4XF4 A;  1ZZ7 A;  1TMF 1;  2RM2 3;  3H0O A;  1DLL A;  3U37 A;  5GZG A;  3UET A;  1CJP A;  2D3R A;  4Q4X 1;  1LHV A;  1N3Q A;  2JX9 A;  2P3J A;  1HN1 A;  1F2N A;  4QXC A;  1SLB A;  3Q8F A;  1MVE A;  1NKG A;  1UOB A;  2J1R A;  2ARX A;  4I02 A;  1HXS 3;  4WM7 C;  5FP7 A;  1Y3T A;  4M3C B;  3TBD A;  2CNA A;  1W6M A;  4IEV A;  4SLI A;  2FD8 A;  4LHK A;  4UW6 A;  1BHG A;  1TG7 A;  1ST8 A;  2QNK A;  1DYO A;  3K2O A;  5LBF A;  3I3M A;  2C6S A;  1POV 1;  4EN9 B;  1UIJ A;  2TUN A;  3U4S A;  2Z69 A;  3E5Q A;  3ILR A;  3SCG A;  1OBN A;  3WF4 A;  5CEH A;  4EN6 B;  1DF0 A;  3QBQ A;  4WZC A;  4BPZ A;  1ZRF A;  1R09 3;  1W06 A;  1VBE 1;  2BP6 A;  2Y6L A;  4FO9 A;  5FKB A;  3VHN A;  3T4V A;  1QXR A;  1XOY A;  4PT6 A;  4YGC A;  3HIF A;  2BVV A;  4ZXK A;  4ATE A;  4P9J A;  1QJZ A;  4Q27 A;  2EXI A;  2WSV A;  3A0K A;  1DDL A;  3O0W A;  1E5R A;  3B01 A;  4ZXE A;  4BIF A;  3HPN A;  1KJR A;  2Z42 A;  5DDJ 2;  2PTM A;  4UFK A;  4QHB A;  2D3P A;  2ZBJ A;  4GKY A;  4PF1 A;  2WT1 A;  2WS9 3;  5DZF A;  2PEL A;  1HRV 1;  1WLD A;  4DEV A;  4JGZ B;  5FZB A;  5LEK A;  1OUS A;  5GZE A;  4A44 A;  5A1A A;  2A6V A;  5CVR A;  5LK7 B;  4LNV A;  4AQT A;  2VY0 A;  1APN A;  3OBT A;  4QX7 A;  2RM2 2;  4IEQ A;  4D7T A;  2E31 A;  1OF4 A;  1P8J A;  4ATF A;  5JOW A;  3G6J B;  2CDO A;  1SDD B;  1REF A;  3ST7 A;  2AEN A;  2OQ7 A;  1UU6 A;  3MBW A;  1DGW X;  3DPR A;  4YVS B;  5BNN C;  5BNP C;  3WQ7 A;  5LY1 A;  5APA A;  3WP3 A;  1Y7B A;  5KBF A;  1J3P A;  5LRR A;  5C33 A;  1QH6 A;  5FXX A;  2B4K A;  4C0H A;  5SV8 A;  1DYP A;  1QJX 1;  3QD6 A;  2Q0A A;  4PIX A;  5JDB A;  1PGL 1;  1F15 A;  2CGN A;  1BMV 1;  4L97 A;  4OI1 A;  4Y1Y A;  1UZZ A;  3PUI A;  5A3T A;  2WNV A;  4LBO A;  1W6N A;  2JDK A;  3MW2 A;  3ENR A;  2AEY A;  2XL7 A;  4A42 A;  1J84 A;  3WX5 A;  5BV6 A;  3WP5 A;  1POV 0;  1UY4 A;  3LFM A;  1VBB 3;  2ZMK A;  1RUE 3;  1OQ1 A;  3OSD A;  4LA2 A;  3WT3 A;  4B4Q A;  2FCT A;  2YY1 A;  5DG2 A;  3U10 A;  1Q3E A;  2BVB A;  2MHF A;  2LRP A;  4R4X A;  2JEM A;  3VZM A;  4CA9 A;  5A3U A;  3D4K A;  2Y0I A;  1DU3 D;  5C4W C;  4LBL A;  5I91 A;  5AC9 2;  3RZL A;  1XE8 A;  1NLR A;  2Y38 A;  2EXK A;  2ET1 A;  5FO9 B;  5FIX A;  1WW6 A;  3VD9 A;  2VZT A;  1O8P A;  2DTY A;  5C4W A;  3RJ2 X;  2W3J A;  2RS1 2;  5FZA A;  5C71 A;  2PHT A;  4EZ4 A;  4LIU A;  3PVB B;  2ZGL A;  4ASK A;  2VZU A;  3IWZ A;  3ZN6 B;  2XLA A;  3ETQ A;  4IV3 B;  3OBA A;  1FNY A;  2WLQ A;  1W2N A;  4LMF A;  4MGY E;  4COV A;  2P17 A;  4GJZ A;  4DNY A;  2XJQ A;  5FZH A;  5HXV A;  1LRH A;  1S4C A;  4QAW A;  5LA1 A;  3S7I A;  5FZ8 A;  1W8F A;  3T09 A;  1VB2 A;  4BYY A;  1HB4 A;  4IE7 A;  3W5N A;  4CUA A;  1OQD A;  5AVA A;  1VR3 A;  4DXZ A;  5GLZ A;  2MEV 3;  3DKQ A;  4AVA A;  4HG6 B;  4XFC A;  1GNH A;  4XFB A;  4YW5 A;  3IMN A;  4MXW B;  4I0W B;  4FPG A;  3IM0 A;  3GAL A;  3SC7 X;  4EN7 B;  2FZ2 A;  2GND A;  1AYN 3;  4QQL A;  5A3N A;  3LDR A;  2ORZ A;  2VMI A;  3DEM A;  3AMQ A;  2BEO A;  3C7O A;  2VOV A;  1UYY A;  3I59 A;  1W8O A;  3Q8A A;  2ARB A;  4GWJ A;  5DAX A;  3AL6 A;  2R16 A;  4GD4 A;  1VMJ A;  3PVE A;  4IE0 A;  1UMZ A;  3GGL A;  3NWK A;  3WNM A;  3VBS C;  1IS4 A;  2Q1F A;  2VTF A;  1LR5 A;  4OI0 A;  3GCX A;  2GH2 A;  5FZL A;  5F3C A;  2R07 2;  3THD A;  3I2J A;  4RGG A;  3ZXA C;  3ROU A;  3AJY A;  3W58 A;  1H1A A;  2JDA A;  2C1F A;  1NYW A;  1K5M A;  1WW5 A;  3KQR A;  1HIX A;  2ZX4 A;  2FZ1 A;  4FCA A;  2P1B A;  1QWR A;  4L92 A;  2FCV A;  4YZ4 A;  4K21 A;  4ASL A;  4PI2 A;  2IXJ A;  1V6K A;  4YWA A;  5FK7 A;  3NJX A;  4E8D A;  2JDM A;  4GMP 1;  1K42 A;  2PAK A;  4AXO A;  3CZU A;  4IL7 A;  1RVF 1;  1XNT A;  1HXS 2;  3OTF A;  4COZ A;  3ES4 A;  4DXR A;  3ZXG A;  1W8T A;  4MYE A;  2D6M A;  5GLV A;  5KHK A;  1NLQ A;  3AFK A;  4P14 A;  4E2Q A;  3MLL A;  5JAX A;  3BIW E;  5FZI A;  2YC4 A;  2K46 A;  1ULC A;  2O1Q A;  5FZ6 A;  5KHI A;  3WNX A;  4CDX B;  4IV1 B;  5IUQ A;  1C1L A;  1MS9 A;  2ORX A;  1OLM A;  4Y20 A;  5C3Q A;  4QKD A;  3JBG 1;  5A6Y A;  2P4E A;  5T3N A;  4PCR A;  5I0D A;  2QTW B;  3EQE A;  1DFQ A;  3JD7 1;  3MUZ 1;  2ZGS A;  4IW3 A;  1W39 A;  4QPG B;  3RZJ A;  3OYW B;  1C3H A;  1AR9 1;  1BK1 A;  1VRH 2;  1NE6 A;  4HN0 A;  4ZS2 A;  5DUV A;  3GYD A;  4UOJ A;  2VZQ A;  1QJU 3;  1DQ0 A;  1AR8 3;  1EV1 3;  5LA9 A;  3ZIX A;  1RVF 3;  2DVG A;  2WN3 A;  1OA2 A;  4QGN A;  4BIO A;  2UY8 A;  2OW4 A;  3WDW A;  3A4U A;  2ZZQ A;  4PF5 A;  5FPB A;  1QEX A;  2G9Z A;  5IJR A;  1RHI 1;  4W50 A;  4JGY C;  1RUD 3;  2O8O A;  2Y6G A;  3APB A;  5FOB B;  4OFG A;  1DQ5 A;  1JU3 A;  2NYY A;  4F83 A;  3ZX7 A;  1YO8 A;  5BNO A;  3KF5 A;  3S7E A;  1WWY A;  3JBG 3;  4YNI A;  5CG9 A;  2IC1 A;  4IEY A;  2VBP A;  1US2 A;  1W9T A;  4Y4Y A;  3H8R A;  3H8U A;  1Y9Q A;  5A7S A;  2W1W A;  4RQP C;  3ZMO A;  2TEP A;  2W95 A;  3KCX A;  3VBU C;  5IK7 A;  2YB7 A;  2DVD A;  3ZFE A;  4AED C;  4IER A;  3V64 A;  4IV1 A;  2RS1 1;  3BOW A;  2A71 A;  1FPN 2;  2B9V A;  1UQX A;  1JI6 A;  1E5H A;  1AR6 2;  1ND2 C;  1VMH A;  5AFB A;  2V4V A;  1QQP 3;  4EN8 B;  4XFI A;  2ZA9 A;  3AMP A;  4CEW B;  4AHY A;  3RJR A;  2QVS B;  2E63 A;  4KG0 A;  5K0U C;  1A6C A;  5JZG B;  3HR9 A;  4M0H A;  3WEZ A;  1BEV 1;  2UWC A;  3P3P A;  1RUF 1;  3RNS A;  1JBC A;  1C8N A;  2WNV B;  3HD8 B;  4Z2W A;  4QQ2 A;  3H7J A;  3KT4 A;  3K46 A;  4DRR A;  2K0G A;  4YVW B;  3A7Q A;  1UD1 A;  3ZN5 A;  1PNG A;  4BQ4 A;  5IVV A;  4UBG A;  2ZOE B;  2GAU A;  3SMH A;  2ZGT A;  3HN1 A;  2VOX A;  2R04 2;  4WM7 B;  3B9C A;  3T2Q A;  1NXM A;  2YHJ A;  4Y5T A;  3KM5 A;  5KC5 A;  2RS1 3;  1GWK A;  4ISR A;  3ZXJ A;  5A3L A;  3SCH A;  4YM1 A;  5FY8 A;  2YXS A;  1LB2 A;  1W8N A;  2X09 A;  4I30 A;  1FOD 3;  3D6E A;  1IQA A;  1PO1 2;  1DYK A;  2PAE A;  4BHP A;  1HQL A;  3H3U A;  4M3C E;  4XFG A;  1D0H A;  1S1A A;  1OA3 A;  1YHF A;  5KR7 A;  4AGG A;  2A5Z A;  1BBT 3;  3M70 A;  4JQT A;  2HWB 2;  2G1M A;  5F6K A;  5FYM A;  1H2N A;  4N9H A;  3NV3 A;  5C8C A;  3RG0 A;  5FYI A;  1XNK A;  4MGZ E;  1EYB A;  5FCC A;  1V70 A;  5TSW A;  4EWE A;  1NX9 A;  4QT6 A;  1IZ3 A;  4GWN A;  5J98 B;  5JSR A;  1SBE A;  4X6Q B;  2VZR A;  4X8P A;  1AXZ A;  4OHV A;  2Z79 A;  3AZX A;  4BLI A;  4LPL A;  3AKT A;  1W6P B;  2BJS A;  4CCM A;  3IBM A;  4KH9 A;  5C3R A;  3CDZ B;  3VHR A;  2UYB A;  5KXC A;  4FAG A;  4XDO A;  3UES A;  2H0V A;  3NKT A;  1HB3 A;  1QNY A;  1OKQ A;  1NCR A;  1PZ8 A;  2E7Q A;  2VMH A;  3CU7 A;  4M3C F;  4CPB D;  1IQD C;  5KHG A;  3SH3 A;  2EF6 A;  1SAC A;  1GZW A;  2YPD A;  3AP9 A;  3CO2 A;  3D0S A;  2NP0 A;  1AR8 1;  1EV1 1;  3POS A;  4HL0 A;  2VNR A;  3LE0 A;  4XBQ A;  3AL5 A;  5L19 A;  3A23 A;  4CP1 A;  1AX2 A;  1RMU 2;  1ZA7 A;  4K6B A;  1HQW A;  3FN9 A;  1RVF 2;  1RC6 A;  3ON7 A;  4HT1 T;  4TN7 A;  4LO5 B;  5F5C A;  4RFT 0;  1JOB A;  1VRH 1;  2XVG A;  4XBN A;  1LHO A;  5CIS A;  4CSW A;  1H8T C;  3VL9 A;  3H1Y A;  2J1S A;  3SH4 A;  1PIV 3;  3J8F 1;  4RN5 A;  1NY7 2;  4IEP A;  3WF1 A;  1Z7S 3;  3JBG 2;  2G4I A;  5GLW A;  3UNP A;  2VUA A;  5M0T A;  3JD7 2;  1XPW A;  3TWI A;  3FZ3 A;  1RUH 3;  4QPG A;  3A22 A;  1F4H A;  5H9P A;  4V1P A;  4L11 A;  4AI1 A;  3L2H A;  4ZHN A;  4B1L A;  4C1X A;  2I2S A;  3E1F 1;  1O4Z A;  4CDQ B;  5IHR A;  1X7N A;  1OHF A;  5C3P A;  4RA0 A;  2D97 A;  1YFX A;  3VZJ A;  4Q4Y 2;  4JTN A;  1VRH 3;  3VD3 A;  3RYK A;  1H0B A;  3WP4 A;  3V56 A;  4OMC A;  4BDV B;  1UO9 A;  2D6L X;  3OD0 A;  4GH4 A;  4JDN A;  3AXD A;  4O9E A;  4QX8 A;  2GNB A;  4OMD A;  5FWJ A;  1OLR A;  4ZZ8 A;  1G9F A;  4NID A;  3KGL A;  3DL3 A;  4FPC A;  5J7M A;  2HJI A;  4LKD A;  3UGF A;  4GMP 3;  4KQ7 A;  1A34 A;  2LW8 A;  1L7Q A;  3E6B A;  2RDN A;  3AMM A;  2ZMN A;  1XYN A;  4OHW A;  3ZR5 A;  4CEY C;  2OXB A;  2JDU A;  4I01 A;  3GZT B;  1EAH 1;  3S30 A;  3T30 A;  4K7J A;  4XF1 A;  2PFW A;  3O1O A;  1H8T A;  4XAC A;  4Y26 A;  1SZB A;  2CY6 A;  3RFR A;  1MS8 A;  4LBJ A;  5BUV A;  3CEW A;  1V6I A;  3JUU A;  4Y1V A;  3S5Q A;  2VH9 A;  1ZYB A;  5JPN B;  4QX5 A;  1HJG A;  3OPT A;  5E88 A;  5CFD B;  4UAP A;  1SPP A;  2RE9 A;  4WBB A;  2V73 A;  1BEV 2;  2ARA A;  4LO6 B;  1AXY A;  4RR3 B;  1O4T A;  1NZC A;  2UY9 A;  2W92 A;  3MIH A;  4QX1 A;  3NAP B;  4YRD A;  1OPO A;  4BQ2 A;  1O59 A;  5BPX A;  1RIR A;  2V5Y A;  3LOB A;  3ZXF A;  3SIS A;  5F3I A;  3ZO0 B;  1X9T A;  1EAH 3;  4HPK B;  1VBA 2;  5F2W A;  5J36 A;  1DGL A;  4XXP A;  4CU8 A;  1MR5 A;  2YG0 A;  3W5M A;  1DGR A;  2D43 A;  2AR6 A;  2KR2 A;  2DVF A;  1XU1 A;  1WD3 A;  4NAM A;  4QPG C;  3DXT A;  5DZG A;  1GFF 2;  3AYD A;  3M1H A;  3R4D B;  4XVH A;  5BY5 A;  1B35 C;  5I0U A;  2XQR A;  3NJZ A;  1PO1 1;  4K1Z A;  3TNQ A;  4HAN A;  3P5B A;  4AFB A;  1MZ5 A;  1SFN A;  4FOQ A;  5A80 A;  3WQB A;  5DMY A;  3BIE A;  1NA1 C;  1YEW A;  1W8Z A;  2JD4 A;  1JYI A;  3MLK A;  4Q4V 2;  2BNN A;  2Q8O A;  5ACA 3;  1BVV A;  3UKV A;  2A6Z A;  4LO8 A;  2AC1 A;  1V9U 1;  2B5H A;  3K3N A;  2PLV 1;  4P00 B;  1ZNP A;  5FY7 A;  1UOJ A;  1AL0 G;  3ZFF C;  1XRU A;  3VDB A;  1XBF A;  3MIE A;  1A8M A;  4E4S A;  5FJK A;  4D3W A;  2ZX1 A;  3PTY A;  3VBO C;  3OOX A;  4XTM A;  5HCA A;  5D8A C;  3BU0 A;  3USU A;  1ZBA 3;  2WNO A;  4Q4W 3;  4FP2 A;  5JXH A;  1RUF 3;  2WZR 1;  1NCQ C;  1RMU 1;  1X8E A;  1PIV 2;  3CNA A;  1PGW 1;  4NR1 A;  1H9W A;  2P34 A;  5FPA A;  3SIT A;  2MEV 1;  2VUJ A;  1E5I A;  2VAU A;  2QFE A;  1T2X A;  3OD4 A;  3DF0 A;  4DPN A;  4FAH A;  1JTZ X;  3PU8 A;  4YVS C;  4F7Z A;  5D8A B;  1XNB A;  4BK4 A;  4ITC A;  2V72 A;  2BWC A;  4JAA A;  3LDB A;  4JVA A;  3T1M A;  2W94 A;  1C8M 1;  1GP6 A;  3DCQ A;  5FPV A;  1GV9 A;  4YW4 A;  1WW4 A;  2Q8E A;  5FYV A;  1GIC A;  2SBA A;  5CFC C;  4Y22 A;  3N7K A;  1PO2 3;  1Z78 A;  4EWA A;  1N3O A;  5C9A C;  1HRI 2;  1TZO A;  4AR2 A;  4XF3 A;  2EAA A;  5C8C B;  1LU2 A;  5LWB A;  3OPZ A;  2BBV A;  1ND2 A;  1LOF C;  1W2O A;  1LNS A;  1UAI A;  2EXJ A;  1SCS A;  2R1D A;  1QDC A;  2Y6K A;  3EBR A;  1V6O A;  1FMD 1;  4Y3O A;  1TQ5 A;  3B69 A;  2GN3 A;  2VU9 A;  3U78 A;  4JRA A;  2VMF A;  1CZS A;  2ZGN A;  4A3Z A;  2WZE A;  4GZ9 A;  4FPE A;  5A7W A;  1HV1 A;  5GLU A;  1DCS A;  2FMD A;  2GZW A;  4QMA A;  4RR3 C;  3J8F 3;  1IPJ A;  3RMY A;  4BK5 A;  2KD7 A;  4LOS A;  3LD8 A;  3N9M A;  2CGP A;  1FI2 A;  3WQ1 A;  2WC2 A;  2WA3 A;  5IT6 A;  2W08 A;  3WG2 A;  3UYJ A;  1XU2 A;  3RYR A;  3TAY A;  1SLC A;  3M8L A;  4NII A;  3WXP A;  3HT2 A;  2YPJ A;  3ECQ A;  5A33 A;  1VBD 1;  1JZ3 A;  4CUC A;  5GAL A;  3KVB A;  2WII B;  4CVU A;  3AKP A;  2WZR 3;  2X8K A;  3CF6 E;  1AYN 2;  2ZGQ A;  1W6Q A;  3WUC A;  2XML A;  4DXS A;  3WNO A;  3U4X A;  2WIN B;  3VKO A;  4BLJ A;  4NPL A;  1EPZ A;  3ZN4 A;  1MS1 A;  2GC0 A;  5CBL A;  3T2T A;  2XJS A;  4MGQ A;  2WT2 A;  3KD4 A;  1QMJ A;  4RHV 3;  5JWP A;  3NO8 A;  1UU5 A;  3HNM A;  2ERF A;  3KGZ A;  2JIC A;  2PHF A;  3HQX A;  2ZZJ A;  4A6O A;  4NVP A;  5A3O A;  1AJK A;  1A3K A;  1JOD A;  2O14 A;  2GME A;  4E4D X;  1L3J A;  3DGT A;  4JKL A;  4PDW A;  5FUN A;  3TN9 3;  4CRQ A;  4AYU A;  1XNC A;  2D6P A;  2JXA A;  2FDJ A;  1R08 3;  4QPI C;  4JQR A;  2GAL A;  3VDD C;  1AUY A;  4FTS A;  1NLS A;  1JZ4 A;  3IDE A;  1U5X A;  4A45 A;  1COV 2;  4CDU A;  1LEN A;  1IOA A;  5FYB A;  4JGY A;  3ZSE A;  2NMO A;  1SDW A;  1GLH A;  4E2S A;  4O65 A;  3OG2 A;  4DXT A;  1G7Y A;  2JG8 B;  4Q4V 3;  5H9S A;  2O0O A;  1Q8S A;  1R09 1;  1UZV A;  1ZRE A;  3POJ A;  2VXJ A;  2R49 A;  3WW4 A;  1L7R A;  3OEA A;  3IDC B;  3HEI A;  1V6M A;  1R1A 1;  5F5Q A;  4JHT A;  4D94 A;  1W04 A;  5LY2 A;  3PJQ A;  4FT8 A;  1VE0 A;  1I9R A;  1KEX A;  1LCL A;  1NA1 B;  2VPV A;  2WO3 A;  3KF3 A;  2QCS B;  2PMW B;  3N7M A;  4LE3 A;  4AFM A;  5I0R A;  4B1M A;  4IE6 A;  2G19 A;  4P9L A;  4HBN A;  3QH6 A;  3J26 N;  4KBZ A;  1CIW A;  1ZZ6 A;  4AI2 A;  5C7G A;  3TEW A;  3UJO A;  1IG0 A;  5K7P A;  1VBC 2;  1UX6 A;  2Q4S A;  5FMO L;  4QD2 A;  2GC3 A;  1GZW B;  3TB0 A;  1ASJ 2;  2CL2 A;  1ZZ8 A;  2W1U A;  2WAB A;  4NPR A;  2RS3 1;  4Q8L A;  4CDX C;  1ND3 A;  4LUM A;  1N1S A;  4XF9 A;  3GCW A;  3D3A A;  5IFP A;  1UNB A;  1DLC A;  2XLF A;  4XDQ A;  4DO0 A;  4TYS A;  3BTY A;  1W9Y A;  1CAV A;  1NQD A;  2DVB A;  4IEW A;  1ULO A;  4LTA A;  2BYV E;  4D7Y A;  2VME A;  3L9J T;  1K5M C;  1YQ8 A;  3MIF A;  2H6B A;  2ARC A;  5EV7 A;  4GB3 3;  2FDG A;  1OPM A;  5IFT A;  5I8S A;  1AYM 2;  1WLT A;  3IDB B;  1ENX A;  1UWW A;  5FJH A;  4JDO A;  3K4A A;  2J1V A;  4AK3 A;  3VZK A;  3JU9 A;  4OYU A;  1JXN A;  1VBB 1;  5FP4 A;  1M4W A;  5F5I A;  4CCO A;  2ZGU A;  1Y43 B;  1DZQ A;  1GKB A;  5A7W B;  4EJR A;  5EZW A;  3ZYB A;  4HFS A;  1OUR A;  1F4A A;  3K4Z A;  3D0J A;  3KCC A;  2VCC A;  1JYW A;  2VZ1 A;  1Q8V A;  2D6O X;  1AR7 3;  3WP6 A;  1Z0H A;  5FY0 A;  1QY4 A;  1R64 A;  4ZY9 A;  1UYP A;  3HOB A;  1QJY 3;  4WVM B;  2R0H A;  2DYC A;  4K9S A;  1RUI 2;  1BMV 2;  1GMM A;  4LOT A;  2P2K A;  2BER A;  5LRS A;  1D0G A;  2L9L A;  2Y8K A;  2HLE A;  4FI9 A;  4NHY A;  1GOG A;  4XIL A;  1LTE A;  5SV5 A;  4XFF A;  4MET A;  2BFU L;  2R04 3;  1FYU A;  2XKO A;  3IT8 A;  2XJV A;  2XGX A;  4IGQ A;  1XB9 A;  3GF6 A;  5CFC A;  4Q4Y 1;  1JOJ A;  1GQH A;  4NPM A;  1YQ6 A;  4AAP A;  2DUR A;  1S0E A;  2OA2 A;  2Z2S B;  2VW2 A;  3BCW A;  3JB4 C;  3M3O A;  3EXU A;  5DN2 A;  5ABJ C;  1CAX B;  5H9R A;  5CYY A;  3M3E A;  4UYB A;  1WMF A;  3ZDV A;  3RZK A;  4AQS A;  4ET7 A;  2VUD A;  4QQP A;  4CU7 A;  2Z5W A;  1YFU A;  2P6H A;  2VBB A;  2EIB A;  1TE1 B;  4GB3 2;  5B4N A;  3III A;  1CPN A;  2R0F A;  5LAT A;  2VQU A;  3MFC A;  2LTN A;  1XE0 A;  1R08 2;  1URX A;  4QPY A;  1AYN 1;  2D3S A;  5FMC A;  3O1T A;  3K4D A;  1W2U A;  2ZGK A;  2FBE A;  5L73 A;  1W9F A;  3DV8 A;  1ENS A;  3QH7 A;  3M4F A;  2VNV A;  4EE2 A;  2W46 A;  1RYY A;  3HNY M;  3N3H A;  1S0B A;  4MXV A;  4PQ9 A;  1YQ2 A;  2AUY A;  2ZGM A;  1COV 1;  3IB3 A;  2P3K A;  3MO4 A;  4YSF A;  4OHX A;  1UIK A;  2ZS6 B;  3Q8C A;  5EHD A;  2A70 A;  5FRA A;  5IWF A;  3VBU B;  3C2U A;  3I2I A;  1ZZC A;  2GSY A;  1J58 A;  3JZV A;  1LHU A;  3PIG A;  4RHV 1;  1JZ8 A;  3LQC A;  4FXK B;  2JIG A;  3WHT A;  3NNJ A;  2NPI A;  3C3V A;  4QX3 A;  4DIQ A;  1R09 2;  1WBF A;  1IS6 A;  4IQP A;  4NJ4 A;  1ZX5 A;  2D40 A;  2VZV A;  1PZ9 A;  4IEZ A;  4CDW B;  4QM9 A;  2VG9 A;  3MPP G;  3UGH A;  4Y5Z 0;  1J83 A;  3ZKU A;  3LA7 A;  2X5I C;  2IUW A;  4FTE A;  3BTZ A;  3K51 A;  1W28 A;  3RZM A;  2EAL A;  4YG3 A;  1RUC 2;  2WAA A;  3JQW A;  4NWV A;  2WRA A;  3OGR A;  3KVA A;  2F17 A;  2JD9 A;  3E6D A;  4AQ6 A;  2XBO 2;  3AVS A;  4UW3 A;  1UY1 A;  3B9I A;  4LK6 A;  1LED A;  1WW7 A;  2LS6 A;  2W5F A;  3O14 A;  4UW5 A;  5F8P A;  5KC6 A;  3ZFG A;  1BJQ A;  3WNP A;  3BTX A;  5L7O C;  5JSP A;  3I3E A;  3HQR A;  3I2F A;  5I8Y A;  3HQU A;  2Y6F A;  3CMG A;  1D2S A;  2YC0 A;  4JDM A;  2X10 A;  5D21 A;  4AED A;  4XQW A;  4YG6 A;  4LLO A;  1AHS A;  2B45 X;  1PNF A;  2P37 A;  5EP9 A;  3SHR A;  5HPO A;  2PA7 A;  2OII A;  4YGE A;  2RS3 2;  2ZJC A;  3ACI A;  3CL1 A;  3J4U H;  2OUJ A;  3D82 A;  3N35 A;  2K2S A;  4WM8 C;  5FZK A;  3RPQ A;  5HI0 A;  1W8H A;  1J59 A;  3POE A;  3EO6 A;  4M0N A; 
#chains in the Genus database with same CATH homology
 3C7G A;  4JX0 A;  4OZO A;  3T2Q A;  4A4A A;  3C7F A;  1JHJ A;  1W8N A;  2X09 A;  1UYX A;  3PUH A;  3IAQ A;  2DDU A;  1NUK A;  2W9X A;  4LHS A;  2EIC A;  5F7U A;  3SKJ E;  1KGY A;  4IUG A;  2DCK A;  4M4R A;  2E26 A;  2J1U A;  2J7M A;  4XZU G;  4XUN A;  1NX9 A;  3NRU A;  3ACF A;  2RVA A;  1GOH A;  2JE8 A;  2XQX A;  3T2P A;  3WF0 A;  2VZR A;  2VCA A;  2JKX A;  3T08 A;  4LPL A;  1UXZ A;  1JYV A;  1SG3 A;  3CDZ B;  1GOF A;  1TVG A;  3J7H A;  1JU4 A;  3I2G A;  3UES A;  2C26 A;  2WUH A;  1UYZ A;  1UMI A;  4M4P A;  1WCQ A;  2W87 A;  1IQD C;  3WNN A;  1PX3 A;  4TXW A;  2DCJ A;  5JXJ A;  3LE0 A;  3LEI A;  3A23 A;  2R7E B;  1JYX A;  3P1I A;  3FN9 A;  3LPG A;  2YFU A;  3BGA A;  2V5D A;  4MGS A;  3I97 A;  2QQM A;  1K45 A;  2VZS A;  2J1T A;  5EJZ B;  1OT5 A;  3C8X A;  1O8S A;  2J1S A;  2WBK A;  4RN5 A;  3MUY 1;  3HN3 A;  2RJ2 A;  3WF1 A;  3UNP A;  1XPW A;  1D7P M;  4ZZ5 A;  3A22 A;  1F4H A;  5C70 A;  3DYO A;  1UZ0 A;  1JZ5 A;  2RV9 A;  4XUT A;  4CU6 A;  2WQ8 A;  5JR2 A;  1WKY A;  1GQP A;  3E1F 1;  3MV0 1;  3SEE A;  4XUQ A;  5IHR A;  4P02 B;  3WSO A;  3GM8 A;  4GWI A;  2VR4 A;  2EID A;  3VD3 A;  1GUI A;  4OMC A;  4BDV B;  2ZEZ A;  4P08 A;  3FL7 A;  4OMD A;  3VD4 A;  4QDQ A;  4ZZ8 A;  2HYX A;  2QQN A;  2VO5 A;  2LW8 A;  2WN2 A;  1MPX A;  2VM9 A;  1L7Q A;  5DPN A;  5EJ1 B;  3WNK A;  2XHN A;  2J1A A;  1GU3 A;  3I2H A;  5LA2 A;  2QQK A;  3SEP A;  3OB8 A;  4CU9 A;  5JXG A;  1JZ2 A;  2C4X A;  5CZK A;  1W9W A;  2J22 A;  2W91 A;  3ZM8 A;  4QB6 A;  1GNY A;  1W9S A;  3HNB M;  4CUB A;  3FHQ A;  5LCW L;  5B4X A;  3I3D A;  3C7E A;  4UI9 L;  4A41 A;  2ZEX A;  4UAP A;  3I2K A;  1CZV A;  2W92 A;  1CX1 A;  2VQT A;  4QX1 A;  2WDB A;  3P6B A;  3OEB A;  2OKX A;  3VDA A;  4DUV A;  1O59 A;  2Y64 A;  4MO3 M;  4Z2A A;  2VZP A;  2VOT A;  1UX7 A;  1NAE A;  1H6X A;  4CU8 A;  3W5M A;  2YG0 A;  4JKM A;  2VC9 A;  2EIE A;  3CIH A;  4XVH A;  3NQH A;  5DMY A;  3WQB A;  3WF2 A;  1SHW B;  3A21 A;  2XON A;  3ACG A;  4MOA A;  4OUE A;  2VZ3 A;  2XOM A;  2VCB A;  1W0N A;  2J1E A;  2QBX A;  1CZT A;  4P00 B;  4ARX A;  4QB1 A;  2ZEY A;  4BJ0 A;  3VDB A;  1DP0 A;  4QX2 A;  3THC A;  5FUI A;  4TTG A;  3IDA A;  5JXH A;  5EIY B;  4KMQ A;  1T2X A;  3U37 A;  2W1S A;  3UET A;  4BK4 A;  2V72 A;  2W94 A;  5JXI A;  1HN1 A;  3JXS A;  1CIY A;  5JUV A;  1NKG A;  2J1R A;  1JYN A;  3ETP A;  1UMH A;  2YFZ A;  3K75 B;  1JZ6 A;  4QPW A;  1BHG A;  1TG7 A;  1DYO A;  3T0B A;  1LNS A;  2Y6K A;  3WF4 A;  3BN6 A;  2VMC A;  2VMF A;  1CZS A;  4A3Z A;  2WZE A;  4GZ9 A;  2Y6L A;  4DUX A;  2QQI A;  4BK5 A;  1XNA A;  1US3 A;  1OH4 A;  2KD7 A;  4PT6 A;  1EUT A;  5G04 L;  4ZXE A;  3HPN A;  3K77 A;  4D0Q A;  3ECQ A;  4PF1 A;  1ULP A;  4QDS A;  2YC2 A;  2X05 A;  1JZ3 A;  4CUC A;  4DEV A;  2W1Q A;  4CVU A;  3C7H A;  4A44 A;  4AAX A;  5A1A A;  4RYD A;  2Y6J A;  4JKK A;  3LPF A;  4DXS A;  2E31 A;  1OF4 A;  3WNO A;  1K12 A;  2Z4F A;  1P8J A;  2CDO A;  1SDD B;  3MBW A;  5HXM A;  3HJR A;  4MGQ A;  2PQS A;  2B4K A;  2C9K A;  4MAD A;  3HNM A;  4L0P A;  5DQ0 A;  2VZO A;  2WO1 A;  4XUO A;  4A6O A;  3SKV A;  4DUW A;  3PUI A;  4JKL A;  4A42 A;  1J84 A;  1UY4 A;  1JZ4 A;  4A45 A;  4XUR A;  4KI5 M;  3T0A A;  4JHZ A;  3CKH A;  3OG2 A;  4YPJ A;  4DXT A;  1PMH X;  1EUU A;  3NJV A;  4XUP A;  1W99 A;  5J1X A;  3OEA A;  1L7R A;  2ZXQ A;  3VD9 A;  3HEI A;  3VD7 A;  3MV1 1;  2VZT A;  1O8P A;  3T0D A;  2W3J A;  3CZJ A;  5C71 A;  1OD3 A;  1KEX A;  2WO3 A;  2VZU A;  3AC0 A;  3OBA A;  3EYP A;  1UY3 A;  3NNG A;  3I3B A;  4W8J A;  5C7G A;  2WZ8 A;  4QAW A;  5LA1 A;  2W47 A;  2WYS A;  2VMD A;  3T09 A;  3W5N A;  2VL4 A;  4CUA A;  2W1U A;  2WAB A;  4HG6 B;  3D3A A;  1PX4 A;  5IFP A;  1DLC A;  2BZD A;  4DEQ A;  4QDR A;  2ORZ A;  2ZEW A;  3C7O A;  1UYY A;  1ULO A;  2ID4 A;  1W8O A;  1JZ7 A;  4GWJ A;  3WF3 A;  2VME A;  4BXS V;  5IYY A;  5IFT A;  3GGL A;  3WNM A;  2CDP A;  2VTF A;  1UWW A;  3THD A;  3I2J A;  4QX0 A;  3K4A A;  2J1V A;  3F2Z A;  4OYU A;  2JDA A;  1UXX X;  4D8M A;  1F4A A;  3K4Z A;  2BBA A;  2VCC A;  1JYW A;  2E32 A;  2VZ1 A;  3CQO A;  3NJX A;  4E8D A;  4ZY9 A;  1R64 A;  1K42 A;  3HOB A;  3WNL A;  2QQO A;  3CZU A;  1XNT A;  1GMM A;  2QQL A;  2BER A;  2L9L A;  4ARY A;  4DXR A;  2Y8K A;  3DEC A;  2HLE A;  4FI9 A;  1OF3 A;  1GOG A;  5JMO A;  2VJX A;  4KWU A;  1K3I A;  4E8C A;  2BGO A;  2YC4 A;  3FHA A;  2ORX A;  3OGV A;  3IAP A;  4AG4 A;  5DN2 A;  5I0D A;  2Y6H A;  3MUZ 1;  5CYY A;  2E33 A;  4ET7 A;  1XC6 A;  3ABZ A;  3VDC A;  2EIB A;  4W4Z A;  5B4N A;  3III A;  4UOJ A;  2VZQ A;  1UY0 A;  2VQU A;  1PMJ X;  3K4D A;  2WN3 A;  3DYP A;  1H6Y A;  5IJR A;  4W50 A;  2W46 A;  1RYY A;  2Y6G A;  3HNY M;  2BGP A;  1JU3 A;  1YQ2 A;  3LEK A;  3IB3 A;  4LQR A;  3MO4 A;  1US2 A;  1W9T A;  3EB7 A;  3I2I A;  5G05 L;  1JZ8 A;  3LQC A;  3ACH A;  2W1W A;  4QX3 A;  2W95 A;  2VZV A;  3T2O A;  2YB7 A;  1J83 A;  1UY2 A;  2B9V A;  2WAA A;  1JI6 A;  4QB2 A;  3OGR A;  3GXU A;  2JD9 A;  2V4V A;  1UY1 A;  5LA0 A;  2W5F A;  2LS6 A;  3GDB A;  4P5Y A;  3WEZ A;  3WNP A;  3DYM A;  4LKS A;  3I3E A;  3VD5 A;  3I2F A;  3OGS A;  4PQQ A;  1I5P A;  3CMG A;  2WO2 A;  2X10 A;  3K46 A;  3LEG A;  2WAO A;  3A7Q A;  5HPO A;  3ACI A;  2QQJ A;  4CU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...