4CUDA

Human notch1 egf domains 11-13 mutant fucosylated at t466
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fringe-Mediated Extension of O-Linked Fucose in the Ligand-Binding Region of Notch1 Increases Binding to Mammalian Notch Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF07645 EGF_CA Calcium-binding EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4cudA01
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4cudA03
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4cudA02
2BOHA 2FLRL 2Y82B 2W2NE 5E8DA 4CSYA 2BQ6A 4C16A 3F6UL 1YUFA 5JBBE 2CJIB 2P16L 2P93L 5CKNA 3H5CB 2FZZL 1XKBA 4JZEL 2WPME 4PH9A 4RRXA 1EAIC 4RRYA 3TH3L 1ATBA 1JV2B 2B7DL 3HO4A 2GD4A 2EI6B 1LQDA 1N1IA 1F7EA 5K0HB 1FF7A 1NPEB 3C9AC 4ZAEB 1NFYB 1IQFL 5IKRA 1LPGA 2W2ME 3HO3A 4RS0A 2NPRA 3LTGD 1SZBA 1XDTR 2FLBL 2K2SB 1MQ5L 3HS7A 3LN1A 1IGXA 2I9AA 3V64C 1PGEA 1W7XL 1EMOA 1MQ6L 1LPZA 2Y38A 2PR3B 3TBDA 2VVUL 4YT7L 1JBUL 4CUDA 4YT6L 3GCXE 5JBCE 4O02B 3U73A 1KIGL 1IQIL 1IGZA 3KQEL 1COUA 2W26B 5COXA 2AYLA 1ATAA 2P26A 1G2MB 1G2LB 1N7DA 3CENL 1HAEA 3K9XA 2EI8B 4D90A 5IKQA 4LORA 2XBWL 4Y7AB 1EPHA 1A3PA 1Z6CA 4Y79B 1KLOA 4CUEA 1UZPA 2OYEP 2MGRA 4D0EA 4XL1A 3TZIA 2J94B 5KN5C 4Y76B 2BO2A 5EGMB 4JYVL 1WHFA 3N8ZA 1P9JA 5JVZA 1EPIA 2FLGA 1JL9A 1EPJA 1NQLB 3N8WB 1DDXA 2Y7XB 2RHPA 4RRZA 1HX2A 1EBVA 4YZUB 3U7UG 4BDWA 5JB8E 3LN0A 1HJ7A 1IQGL 3CFWA 4OTJA 4TGFA 4ZXXL 1CX2A 2M74A 1RFNB 1GK5A 3KL6B 2P3FN 4NG9L 1EQHA 3F1SB 1IQLL 3MQEA 3LC5B 3NTBA 2PUQL 4MMYB 1DVAL 3N8YB 4ISIL 1G1RA 2VWNL 2UWPB 3EGFA 1L3YA 2WYJB 1IQHL 1Z6EL 1ZAQA 1J9CL 2WPIE 1IVOC 3SOBB 1PTHA 1HZ8A 1FJSL 5I46L 5L30L 4Z0KB 1PFXL 3LC3B 2XBVL 4X8VL 3POYA 1HCGB 1WU1B 4M10A 4MMZB 2OYUP 3ENSA 5KIRA 2K2TA 3NT1A 1LPKA 3LIWB 4NGAL 2WYGB 1UZQA 1CEJA 2KL7A 2P3UA 4LMFA 5F1AA 1CQEA 2Y5GL 1KLJL 4ZH8B 1CVUA 2RA0L 1ATDA 2P28B 2Y5HL 3FCSB 1IP0A 1P0SL 3KRKA 4BDXA 5CKQA 1K36A 1G1QA 2YGOA 1B9WA 2YGPA 4XBMA 3TK5B 2W2PE 2VH6B 4NA9L 4BXSA 4ZHAB 2KB9A 2BOXA 3P5BL 2BOKL 4Z0LA 2ADXA 2WPHE 5CKMA 1FSBA 2UWOB 2P94L 3BT1A 3FFGL 1EPGA 4M11A 2Y81B 2H9EL 4AQTA 4JZDL 1OB1C 1G1TA 3TGFA 1IJQA 2UWLB 2J95B 2TGFA 1IOEL 4COXA 1LMJA 4E1GA 1FAKL 1HREA 3N8WA 2J38B 1CCVA 1XFEA 1DQBA 4A7IA 2FD6A 3LTFB 1W8BL 4Y7BB 3IJEB 2G00L 1V3XB 2WPJE 3IITB 1F0RB 2P3TA 1KSNB 1TLEA 2EI7B 2W2OE 3TK6B 1PXXA 1L5GB 2JKHL 1C5MF 3N8YA 4XLWA 3KK6A 1HT5A 2WFTA 3M37L 1F7MA 2VH0B 3MDLA 2Y7ZB 1TPGA 2RNLA 3ZYGA 1NZIA 1KLIL 1TOZA 2F9BL 1ADXA 1O5DL 2XC5L 3CS7L 1NFWB 1HAFA 3HO5A 3RR3A 4Z6AL 1CCFA 1NFXB 1NT0A 1EMNA 1NFUB 2W3KB 3BPSE 1XKAL 4BXWA 2J2UB 1IQML 1ATEA 2DDUA 6COXA 3QCWA 3N8VA 3HS6A 1URKA 3SOQA 2Q1JB 1FFMA 1IQEL 4D0FA 2PHBB 2VWMK 5JB9E 1BF9A 1YGCL 1APOA 2VVCK 2BQWA 4BTUA 3QH0A 3FBYA 3CA7A 2BQ7A 3GISX 1YUKB 4ISHL 1HRFA 3KQBL 1APQA 1MOXC 1Q4GA 2VVVL 2I9BA 1IOXA 1IQNL 2WG3C 2W86A 3M36L 3DEMA 3PGHA 2Y5FL 5L2YL 3OLUA 4X8SL 1WHEA 2XC0L 2WG4B 4JYUL 1YO8A 5IKVA 4Y71B 2J4IB 2W3IB 1K37A 4O1ZA 1HT8A 2XBYL 4OTYA 1FE2A 3R05A 3HPTA 1YUGA 2P95L 1AUTL 3KQDL 4BTTA 1PRHA 1EZQB 1UZKA 5CISA 4RUTA 5JBAE 3SOVA 1IQKL 3QMOA 3KQCL 3Q3KB 1G1SA 1EGFA 2BMGA 2WPLE 4FM5A 1I0UA 2VWOL 3ELAL 1DIYA 4MMXB 3BT2A 4G1MB 2W2QE 2BOUA 3LAQA 4X8UL 1U67A 2VJ3A 3SW2A 2WFXB 3ASIA 5F19A 5L2ZL 2Y80B 4BTIA 2D1JB 2VWLL 3NTGA 5IKTA 2WPKE 2BZ6L 3NJPC 1QFKL 1M1XB 5FDQA 1UZJA 1FAXL 4Y6DB 1EQGA 2KV4A 1IQJL 1DX5I 3ZYJB 3OLTA 4X8TL 1U8CB 2MGPA 1F0SB 3Q7DA 5JVYA 2P3FL 4JZFL 2J34B 1CVWL 3GCWE 2XBXL 2XC4L 1X7AL 3HS5A 2MHPA 4RRWA 3V65B 3KCGL 4CUFA 4ZXYL 3ZYIB 3N8XA 5JW1A
chains in the Genus database with same CATH superfamily
2BOHA 2FLRL 2Y82B 2W2NE 5E8DA 4CSYA 2BQ6A 4C16A 3F6UL 1YUFA 5JBBE 2CJIB 2P16L 2P93L 5CKNA 1LMMA 3H5CB 2FZZL 1XKBA 4JZEL 2WPME 4PH9A 4RRXA 1EAIC 4RRYA 3TH3L 2HORA 1ATBA 1JV2B 2B7DL 3HO4A 2GD4A 2EI6B 1LQDA 1N1IA 1F7EA 5K0HB 1FF7A 1NPEB 3C9AC 4ZAEB 1NFYB 1IQFL 5IKRA 1LPGA 2W2ME 3HO3A 4RS0A 2NPRA 3LTGD 1SZBA 1XDTR 2FLBL 2K2SB 1MQ5L 3HS7A 3LN1A 2HOXA 1IGXA 2I9AA 3V64C 1PGEA 4GU4A 1W7XL 1EMOA 1MQ6L 1LPZA 2Y38A 2PR3B 3TBDA 2VVUL 4YT7L 1JBUL 4CUDA 4YT6L 3GCXE 5JBCE 4O02B 3U73A 1KIGL 1IQIL 1IGZA 3KQEL 1COUA 2W26B 5COXA 2AYLA 1ATAA 2P26A 1G2MB 1G2LB 1N7DA 3CENL 1HAEA 3K9XA 2EI8B 4D90A 5IKQA 2BT8A 4LORA 2XBWL 4Y7AB 1EPHA 1A3PA 1Z6CA 1KKEA 4Y79B 1V1HA 1KLOA 4CUEA 1UZPA 1QIUA 2OYEP 2MGRA 4D0EA 4XL1A 3TZIA 2J94B 5KN5C 4Y76B 2BO2A 5EGMB 4JYVL 1WHFA 3N8ZA 1P9JA 5JVZA 1EPIA 2FLGA 1JL9A 1EPJA 1NQLB 3N8WB 1DDXA 2Y7XB 2RHPA 4RRZA 1HX2A 1EBVA 4YZUB 3U7UG 4BDWA 5JB8E 3LN0A 1HJ7A 1IQGL 3CFWA 4OTJA 4TGFA 4ZXXL 1CX2A 2M74A 1RFNB 1GK5A 3KL6B 2P3FN 4NG9L 1EQHA 3F1SB 1IQLL 3MQEA 3LC5B 3NTBA 2PUQL 4MMYB 4A94C 1DVAL 3N8YB 4ISIL 1G1RA 2VWNL 2UWPB 3EGFA 1L3YA 2WYJB 1IQHL 1Z6EL 1ZAQA 1J9CL 2WPIE 1IVOC 3SOBB 1PTHA 1HZ8A 1FJSL 5I46L 5L30L 4Z0KB 1PFXL 3LC3B 2XBVL 4X8VL 3POYA 1HCGB 1WU1B 4M10A 4MMZB 2OYUP 3ENSA 5KIRA 2K2TA 3NT1A 1LPKA 3LIWB 4NGAL 2WYGB 1UZQA 1CEJA 2KL7A 2P3UA 4LMFA 5F1AA 1CQEA 2Y5GL 1KLJL 4ZH8B 1CVUA 2RA0L 1ATDA 2P28B 2Y5HL 3FCSB 1IP0A 1P0SL 3KRKA 4BDXA 5CKQA 1K36A 1G1QA 2YGOA 2YGQA 1B9WA 2YGPA 4XBMA 3TK5B 2W2PE 2VH6B 4NA9L 4BXSA 4ZHAB 2KB9A 4GU3A 2BOXA 3P5BL 2BOKL 4Z0LA 2ADXA 2WPHE 5CKMA 1FSBA 2UWOB 2P94L 3BT1A 3FFGL 1EPGA 4M11A 2Y81B 2H9EL 4AQTA 4JZDL 1OB1C 1G1TA 3TGFA 1IJQA 2UWLB 2J95B 2TGFA 1IOEL 4COXA 1LMJA 4E1GA 1FAKL 1HREA 3N8WA 2J38B 1CCVA 1XFEA 1DQBA 2BSFA 4A7IA 2FD6A 3LTFB 1W8BL 4Y7BB 3IJEB 2G00L 1V3XB 2WPJE 3IITB 1F0RB 2P3TA 1KSNB 1TLEA 2EI7B 2W2OE 2H9EC 3TK6B 1PXXA 1L5GB 2JKHL 1C5MF 3N8YA 4XLWA 3KK6A 1HT5A 2WFTA 3M37L 1F7MA 1V1IA 2VH0B 3MDLA 2Y7ZB 1TPGA 2RNLA 3ZYGA 1NZIA 1KLIL 2KNIA 1TOZA 2F9BL 1ADXA 1O5DL 2XC5L 3CS7L 1NFWB 1HAFA 3HO5A 3RR3A 4Z6AL 1CCFA 1NFXB 1NT0A 1EMNA 1NFUB 2W3KB 3BPSE 1XKAL 4BXWA 2J2UB 1IQML 1ATEA 2DDUA 6COXA 3QCWA 3S6XA 3N8VA 3HS6A 1URKA 3SOQA 2Q1JB 1FFMA 1IQEL 4D0FA 2PHBB 2VWMK 5JB9E 1BF9A 1YGCL 1APOA 2VVCK 2BQWA 4BTUA 3QH0A 3FBYA 3CA7A 2BQ7A 3GISX 1YUKB 4ISHL 1HRFA 3KQBL 1APQA 1MOXC 1Q4GA 2VVVL 2I9BA 1IOXA 1IQNL 2WZPP 2WG3C 2W86A 3M36L 3DEMA 3PGHA 2Y5FL 5L2YL 3OLUA 4X8SL 1WHEA 2XC0L 2WG4B 4JYUL 1YO8A 5IKVA 4Y71B 2J4IB 2W3IB 1K37A 1LK9A 4O1ZA 1HT8A 2XBYL 4OTYA 1FE2A 3R05A 3HPTA 1YUGA 2P95L 1AUTL 3KQDL 4BTTA 1PRHA 1EZQB 1UZKA 5CISA 4RUTA 5JBAE 3SOVA 1IQKL 3QMOA 3KQCL 3Q3KB 1G1SA 1EGFA 2BMGA 2WPLE 4FM5A 1I0UA 2VWOL 3ELAL 1DIYA 4MMXB 3BT2A 4G1MB 2W2QE 2BOUA 3LAQA 4X8UL 1U67A 2VJ3A 3SW2A 2WFXB 3ASIA 5F19A 2BT7A 2JJLA 5L2ZL 2Y80B 4BTIA 2D1JB 2VWLL 3NTGA 2VRSA 5IKTA 2WPKE 2BZ6L 3NJPC 1QFKL 1M1XB 5FDQA 1UZJA 1FAXL 4Y6DB 1EQGA 2KV4A 1IQJL 1DX5I 3ZYJB 3OLTA 4X8TL 1U8CB 2MGPA 1F0SB 3Q7DA 5JVYA 2P3FL 4JZFL 2J34B 1CVWL 3GCWE 2XBXL 2XC4L 1X7AL 3HS5A 2MHPA 4RRWA 3V65B 3KCGL 4CUFA 4ZXYL 3ZYIB 3N8XA 5JW1A
chains in the Genus database with same CATH topology
2BOHA 2FLRL 2Y82B 2W2NE 5E8DA 4CSYA 2BQ6A 4C16A 3F6UL 1YUFA 5JBBE 2CJIB 2P16L 2P93L 5CKNA 1LMMA 3H5CB 2FZZL 1XKBA 4JZEL 2WPME 4PH9A 4RRXA 1EAIC 4RRYA 3TH3L 1ATBA 1JV2B 2B7DL 3HO4A 2GD4A 2EI6B 1LQDA 1N1IA 1F7EA 5K0HB 1FF7A 1NPEB 3C9AC 4ZAEB 1NFYB 1IQFL 5IKRA 1LPGA 2W2ME 3HO3A 4RS0A 2NPRA 3LTGD 1SZBA 1XDTR 2FLBL 2K2SB 1MQ5L 3HS7A 3LN1A 1IGXA 2I9AA 3V64C 1PGEA 1W7XL 1EMOA 1MQ6L 1LPZA 2Y38A 2PR3B 3TBDA 2VVUL 4YT7L 1JBUL 4CUDA 4YT6L 3GCXE 5JBCE 4O02B 3U73A 1KIGL 1IQIL 1IGZA 3KQEL 1COUA 2W26B 5COXA 2AYLA 1ATAA 2P26A 1G2MB 1G2LB 1N7DA 3CENL 1HAEA 3K9XA 2EI8B 4D90A 5IKQA 4LORA 2XBWL 4Y7AB 1EPHA 1A3PA 1Z6CA 4Y79B 1KLOA 4CUEA 1UZPA 2OYEP 2MGRA 4D0EA 4XL1A 3TZIA 2J94B 5KN5C 4Y76B 2BO2A 5EGMB 4JYVL 1WHFA 3N8ZA 1P9JA 5JVZA 1EPIA 2FLGA 1JL9A 1EPJA 1NQLB 3N8WB 1DDXA 2Y7XB 2RHPA 4RRZA 1HX2A 1EBVA 4YZUB 3U7UG 4BDWA 5JB8E 3LN0A 1HJ7A 1IQGL 3CFWA 4OTJA 4TGFA 4ZXXL 1CX2A 2M74A 1RFNB 1GK5A 3KL6B 2P3FN 4NG9L 1EQHA 3F1SB 1IQLL 3MQEA 3LC5B 3NTBA 2PUQL 4MMYB 4A94C 1DVAL 3N8YB 4ISIL 1G1RA 2VWNL 2UWPB 3EGFA 1L3YA 2WYJB 1IQHL 1Z6EL 1ZAQA 1J9CL 2WPIE 1IVOC 3SOBB 1PTHA 1HZ8A 1FJSL 5I46L 5L30L 4Z0KB 1PFXL 3LC3B 2XBVL 4X8VL 3POYA 1HCGB 1WU1B 4M10A 4MMZB 2OYUP 3ENSA 5KIRA 2K2TA 3NT1A 1LPKA 3LIWB 4NGAL 2WYGB 1UZQA 1CEJA 2KL7A 2P3UA 4LMFA 5F1AA 1CQEA 2Y5GL 1KLJL 4ZH8B 1CVUA 2RA0L 1ATDA 2P28B 2Y5HL 3FCSB 1IP0A 1P0SL 3KRKA 4BDXA 5CKQA 1K36A 1G1QA 2YGOA 2YGQA 1B9WA 2YGPA 4XBMA 3TK5B 2W2PE 2VH6B 4NA9L 4BXSA 4ZHAB 2KB9A 2BOXA 3P5BL 2BOKL 4Z0LA 2ADXA 2WPHE 5CKMA 1FSBA 2UWOB 2P94L 3BT1A 3FFGL 1EPGA 4M11A 2Y81B 2H9EL 4AQTA 4JZDL 1OB1C 1G1TA 3TGFA 1IJQA 2UWLB 2J95B 2TGFA 1IOEL 4COXA 1LMJA 4E1GA 1FAKL 1HREA 3N8WA 2J38B 1CCVA 1XFEA 1DQBA 4A7IA 2FD6A 3LTFB 1W8BL 4Y7BB 3IJEB 2G00L 1V3XB 2WPJE 3IITB 1F0RB 2P3TA 1KSNB 1TLEA 2EI7B 2W2OE 2H9EC 3TK6B 1PXXA 1L5GB 2JKHL 1C5MF 3N8YA 4XLWA 3KK6A 1HT5A 2WFTA 3M37L 1F7MA 2VH0B 3MDLA 2Y7ZB 1TPGA 2RNLA 3ZYGA 1NZIA 1KLIL 2KNIA 1TOZA 2F9BL 1ADXA 1O5DL 2XC5L 3CS7L 1NFWB 1HAFA 3HO5A 3RR3A 4Z6AL 1CCFA 1NFXB 1NT0A 1EMNA 1NFUB 2W3KB 3BPSE 1XKAL 4BXWA 2J2UB 1IQML 1ATEA 2DDUA 6COXA 3QCWA 3S6XA 3N8VA 3HS6A 1URKA 3SOQA 2Q1JB 1FFMA 1IQEL 4D0FA 2PHBB 2VWMK 5JB9E 1BF9A 1YGCL 1APOA 2VVCK 2BQWA 4BTUA 3QH0A 3FBYA 3CA7A 2BQ7A 3GISX 1YUKB 4ISHL 1HRFA 3KQBL 1APQA 1MOXC 1Q4GA 2VVVL 2I9BA 1IOXA 1IQNL 2WZPP 2WG3C 2W86A 3M36L 3DEMA 3PGHA 2Y5FL 5L2YL 3OLUA 4X8SL 1WHEA 2XC0L 2WG4B 4JYUL 1YO8A 5IKVA 4Y71B 2J4IB 2W3IB 1K37A 4O1ZA 1HT8A 2XBYL 4OTYA 1FE2A 3R05A 3HPTA 1YUGA 2P95L 1AUTL 3KQDL 4BTTA 1PRHA 1EZQB 1UZKA 5CISA 4RUTA 5JBAE 3SOVA 1IQKL 3QMOA 3KQCL 3Q3KB 1G1SA 1EGFA 2BMGA 2WPLE 4FM5A 1I0UA 2VWOL 3ELAL 1DIYA 4MMXB 3BT2A 4G1MB 2W2QE 2BOUA 3LAQA 4X8UL 1U67A 2VJ3A 3SW2A 2WFXB 3ASIA 5F19A 5L2ZL 2Y80B 4BTIA 2D1JB 2VWLL 3NTGA 5IKTA 2WPKE 2BZ6L 3NJPC 1QFKL 1M1XB 5FDQA 1UZJA 1FAXL 4Y6DB 1EQGA 2KV4A 1IQJL 1DX5I 3ZYJB 3OLTA 4X8TL 1U8CB 2MGPA 1F0SB 3Q7DA 5JVYA 2P3FL 4JZFL 2J34B 1CVWL 3GCWE 2XBXL 2XC4L 1X7AL 3HS5A 2MHPA 4RRWA 3V65B 3KCGL 4CUFA 4ZXYL 3ZYIB 3N8XA 5JW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOH A;  2FLR L;  2Y82 B;  2W2N E;  5E8D A;  4CSY A;  2BQ6 A;  4C16 A;  3F6U L;  1YUF A;  5JBB E;  2CJI B;  2P16 L;  2P93 L;  5CKN A;  3H5C B;  2FZZ L;  1XKB A;  4JZE L;  2WPM E;  4PH9 A;  4RRX A;  1EAI C;  4RRY A;  3TH3 L;  1ATB A;  1JV2 B;  2B7D L;  3HO4 A;  2GD4 A;  2EI6 B;  1LQD A;  1N1I A;  1F7E A;  5K0H B;  1FF7 A;  1NPE B;  3C9A C;  4ZAE B;  1NFY B;  1IQF L;  5IKR A;  1LPG A;  2W2M E;  3HO3 A;  4RS0 A;  2NPR A;  3LTG D;  1SZB A;  1XDT R;  2FLB L;  2K2S B;  1MQ5 L;  3HS7 A;  3LN1 A;  1IGX A;  2I9A A;  3V64 C;  1PGE A;  1W7X L;  1EMO A;  1MQ6 L;  1LPZ A;  2Y38 A;  2PR3 B;  3TBD A;  2VVU L;  4YT7 L;  1JBU L;  4CUD A;  4YT6 L;  3GCX E;  5JBC E;  4O02 B;  3U73 A;  1KIG L;  1IQI L;  1IGZ A;  3KQE L;  1COU A;  2W26 B;  5COX A;  2AYL A;  1ATA A;  2P26 A;  1G2M B;  1G2L B;  1N7D A;  3CEN L;  1HAE A;  3K9X A;  2EI8 B;  4D90 A;  5IKQ A;  4LOR A;  2XBW L;  4Y7A B;  1EPH A;  1A3P A;  1Z6C A;  4Y79 B;  1KLO A;  4CUE A;  1UZP A;  2OYE P;  2MGR A;  4D0E A;  4XL1 A;  3TZI A;  2J94 B;  5KN5 C;  4Y76 B;  2BO2 A;  5EGM B;  4JYV L;  1WHF A;  3N8Z A;  1P9J A;  5JVZ A;  1EPI A;  2FLG A;  1JL9 A;  1EPJ A;  1NQL B;  3N8W B;  1DDX A;  2Y7X B;  2RHP A;  4RRZ A;  1HX2 A;  1EBV A;  4YZU B;  3U7U G;  4BDW A;  5JB8 E;  3LN0 A;  1HJ7 A;  1IQG L;  3CFW A;  4OTJ A;  4TGF A;  4ZXX L;  1CX2 A;  2M74 A;  1RFN B;  1GK5 A;  3KL6 B;  2P3F N;  4NG9 L;  1EQH A;  3F1S B;  1IQL L;  3MQE A;  3LC5 B;  3NTB A;  2PUQ L;  4MMY B;  1DVA L;  3N8Y B;  4ISI L;  1G1R A;  2VWN L;  2UWP B;  3EGF A;  1L3Y A;  2WYJ B;  1IQH L;  1Z6E L;  1ZAQ A;  1J9C L;  2WPI E;  1IVO C;  3SOB B;  1PTH A;  1HZ8 A;  1FJS L;  5I46 L;  5L30 L;  4Z0K B;  1PFX L;  3LC3 B;  2XBV L;  4X8V L;  3POY A;  1HCG B;  1WU1 B;  4M10 A;  4MMZ B;  2OYU P;  3ENS A;  5KIR A;  2K2T A;  3NT1 A;  1LPK A;  3LIW B;  4NGA L;  2WYG B;  1UZQ A;  1CEJ A;  2KL7 A;  2P3U A;  4LMF A;  5F1A A;  1CQE A;  2Y5G L;  1KLJ L;  4ZH8 B;  1CVU A;  2RA0 L;  1ATD A;  2P28 B;  2Y5H L;  3FCS B;  1IP0 A;  1P0S L;  3KRK A;  4BDX A;  5CKQ A;  1K36 A;  1G1Q A;  2YGO A;  1B9W A;  2YGP A;  4XBM A;  3TK5 B;  2W2P E;  2VH6 B;  4NA9 L;  4BXS A;  4ZHA B;  2KB9 A;  2BOX A;  3P5B L;  2BOK L;  4Z0L A;  2ADX A;  2WPH E;  5CKM A;  1FSB A;  2UWO B;  2P94 L;  3BT1 A;  3FFG L;  1EPG A;  4M11 A;  2Y81 B;  2H9E L;  4AQT A;  4JZD L;  1OB1 C;  1G1T A;  3TGF A;  1IJQ A;  2UWL B;  2J95 B;  2TGF A;  1IOE L;  4COX A;  1LMJ A;  4E1G A;  1FAK L;  1HRE A;  3N8W A;  2J38 B;  1CCV A;  1XFE A;  1DQB A;  4A7I A;  2FD6 A;  3LTF B;  1W8B L;  4Y7B B;  3IJE B;  2G00 L;  1V3X B;  2WPJ E;  3IIT B;  1F0R B;  2P3T A;  1KSN B;  1TLE A;  2EI7 B;  2W2O E;  3TK6 B;  1PXX A;  1L5G B;  2JKH L;  1C5M F;  3N8Y A;  4XLW A;  3KK6 A;  1HT5 A;  2WFT A;  3M37 L;  1F7M A;  2VH0 B;  3MDL A;  2Y7Z B;  1TPG A;  2RNL A;  3ZYG A;  1NZI A;  1KLI L;  1TOZ A;  2F9B L;  1ADX A;  1O5D L;  2XC5 L;  3CS7 L;  1NFW B;  1HAF A;  3HO5 A;  3RR3 A;  4Z6A L;  1CCF A;  1NFX B;  1NT0 A;  1EMN A;  1NFU B;  2W3K B;  3BPS E;  1XKA L;  4BXW A;  2J2U B;  1IQM L;  1ATE A;  2DDU A;  6COX A;  3QCW A;  3N8V A;  3HS6 A;  1URK A;  3SOQ A;  2Q1J B;  1FFM A;  1IQE L;  4D0F A;  2PHB B;  2VWM K;  5JB9 E;  1BF9 A;  1YGC L;  1APO A;  2VVC K;  2BQW A;  4BTU A;  3QH0 A;  3FBY A;  3CA7 A;  2BQ7 A;  3GIS X;  1YUK B;  4ISH L;  1HRF A;  3KQB L;  1APQ A;  1MOX C;  1Q4G A;  2VVV L;  2I9B A;  1IOX A;  1IQN L;  2WG3 C;  2W86 A;  3M36 L;  3DEM A;  3PGH A;  2Y5F L;  5L2Y L;  3OLU A;  4X8S L;  1WHE A;  2XC0 L;  2WG4 B;  4JYU L;  1YO8 A;  5IKV A;  4Y71 B;  2J4I B;  2W3I B;  1K37 A;  4O1Z A;  1HT8 A;  2XBY L;  4OTY A;  1FE2 A;  3R05 A;  3HPT A;  1YUG A;  2P95 L;  1AUT L;  3KQD L;  4BTT A;  1PRH A;  1EZQ B;  1UZK A;  5CIS A;  4RUT A;  5JBA E;  3SOV A;  1IQK L;  3QMO A;  3KQC L;  3Q3K B;  1G1S A;  1EGF A;  2BMG A;  2WPL E;  4FM5 A;  1I0U A;  2VWO L;  3ELA L;  1DIY A;  4MMX B;  3BT2 A;  4G1M B;  2W2Q E;  2BOU A;  3LAQ A;  4X8U L;  1U67 A;  2VJ3 A;  3SW2 A;  2WFX B;  3ASI A;  5F19 A;  5L2Z L;  2Y80 B;  4BTI A;  2D1J B;  2VWL L;  3NTG A;  5IKT A;  2WPK E;  2BZ6 L;  3NJP C;  1QFK L;  1M1X B;  5FDQ A;  1UZJ A;  1FAX L;  4Y6D B;  1EQG A;  2KV4 A;  1IQJ L;  1DX5 I;  3ZYJ B;  3OLT A;  4X8T L;  1U8C B;  2MGP A;  1F0S B;  3Q7D A;  5JVY A;  2P3F L;  4JZF L;  2J34 B;  1CVW L;  3GCW E;  2XBX L;  2XC4 L;  1X7A L;  3HS5 A;  2MHP A;  4RRW A;  3V65 B;  3KCG L;  4CUF A;  4ZXY L;  3ZYI B;  3N8X A;  5JW1 A; 
#chains in the Genus database with same CATH topology
 2BOH A;  2FLR L;  2Y82 B;  2W2N E;  5E8D A;  4CSY A;  2BQ6 A;  4C16 A;  3F6U L;  1YUF A;  5JBB E;  2CJI B;  2P16 L;  2P93 L;  5CKN A;  1LMM A;  3H5C B;  2FZZ L;  1XKB A;  4JZE L;  2WPM E;  4PH9 A;  4RRX A;  1EAI C;  4RRY A;  3TH3 L;  2HOR A;  1ATB A;  1JV2 B;  2B7D L;  3HO4 A;  2GD4 A;  2EI6 B;  1LQD A;  1N1I A;  1F7E A;  5K0H B;  1FF7 A;  1NPE B;  3C9A C;  4ZAE B;  1NFY B;  1IQF L;  5IKR A;  1LPG A;  2W2M E;  3HO3 A;  4RS0 A;  2NPR A;  3LTG D;  1SZB A;  1XDT R;  2FLB L;  2K2S B;  1MQ5 L;  3HS7 A;  3LN1 A;  2HOX A;  1IGX A;  2I9A A;  3V64 C;  1PGE A;  4GU4 A;  1W7X L;  1EMO A;  1MQ6 L;  1LPZ A;  2Y38 A;  2PR3 B;  3TBD A;  2VVU L;  4YT7 L;  1JBU L;  4CUD A;  4YT6 L;  3GCX E;  5JBC E;  4O02 B;  3U73 A;  1KIG L;  1IQI L;  1IGZ A;  3KQE L;  1COU A;  2W26 B;  5COX A;  2AYL A;  1ATA A;  2P26 A;  1G2M B;  1G2L B;  1N7D A;  3CEN L;  1HAE A;  3K9X A;  2EI8 B;  4D90 A;  5IKQ A;  2BT8 A;  4LOR A;  2XBW L;  4Y7A B;  1EPH A;  1A3P A;  1Z6C A;  1KKE A;  4Y79 B;  1V1H A;  1KLO A;  4CUE A;  1UZP A;  1QIU A;  2OYE P;  2MGR A;  4D0E A;  4XL1 A;  3TZI A;  2J94 B;  5KN5 C;  4Y76 B;  2BO2 A;  5EGM B;  4JYV L;  1WHF A;  3N8Z A;  1P9J A;  5JVZ A;  1EPI A;  2FLG A;  1JL9 A;  1EPJ A;  1NQL B;  3N8W B;  1DDX A;  2Y7X B;  2RHP A;  4RRZ A;  1HX2 A;  1EBV A;  4YZU B;  3U7U G;  4BDW A;  5JB8 E;  3LN0 A;  1HJ7 A;  1IQG L;  3CFW A;  4OTJ A;  4TGF A;  4ZXX L;  1CX2 A;  2M74 A;  1RFN B;  1GK5 A;  3KL6 B;  2P3F N;  4NG9 L;  1EQH A;  3F1S B;  1IQL L;  3MQE A;  3LC5 B;  3NTB A;  2PUQ L;  4MMY B;  4A94 C;  1DVA L;  3N8Y B;  4ISI L;  1G1R A;  2VWN L;  2UWP B;  3EGF A;  1L3Y A;  2WYJ B;  1IQH L;  1Z6E L;  1ZAQ A;  1J9C L;  2WPI E;  1IVO C;  3SOB B;  1PTH A;  1HZ8 A;  1FJS L;  5I46 L;  5L30 L;  4Z0K B;  1PFX L;  3LC3 B;  2XBV L;  4X8V L;  3POY A;  1HCG B;  1WU1 B;  4M10 A;  4MMZ B;  2OYU P;  3ENS A;  5KIR A;  2K2T A;  3NT1 A;  1LPK A;  3LIW B;  4NGA L;  2WYG B;  1UZQ A;  1CEJ A;  2KL7 A;  2P3U A;  4LMF A;  5F1A A;  1CQE A;  2Y5G L;  1KLJ L;  4ZH8 B;  1CVU A;  2RA0 L;  1ATD A;  2P28 B;  2Y5H L;  3FCS B;  1IP0 A;  1P0S L;  3KRK A;  4BDX A;  5CKQ A;  1K36 A;  1G1Q A;  2YGO A;  2YGQ A;  1B9W A;  2YGP A;  4XBM A;  3TK5 B;  2W2P E;  2VH6 B;  4NA9 L;  4BXS A;  4ZHA B;  2KB9 A;  4GU3 A;  2BOX A;  3P5B L;  2BOK L;  4Z0L A;  2ADX A;  2WPH E;  5CKM A;  1FSB A;  2UWO B;  2P94 L;  3BT1 A;  3FFG L;  1EPG A;  4M11 A;  2Y81 B;  2H9E L;  4AQT A;  4JZD L;  1OB1 C;  1G1T A;  3TGF A;  1IJQ A;  2UWL B;  2J95 B;  2TGF A;  1IOE L;  4COX A;  1LMJ A;  4E1G A;  1FAK L;  1HRE A;  3N8W A;  2J38 B;  1CCV A;  1XFE A;  1DQB A;  2BSF A;  4A7I A;  2FD6 A;  3LTF B;  1W8B L;  4Y7B B;  3IJE B;  2G00 L;  1V3X B;  2WPJ E;  3IIT B;  1F0R B;  2P3T A;  1KSN B;  1TLE A;  2EI7 B;  2W2O E;  2H9E C;  3TK6 B;  1PXX A;  1L5G B;  2JKH L;  1C5M F;  3N8Y A;  4XLW A;  3KK6 A;  1HT5 A;  2WFT A;  3M37 L;  1F7M A;  1V1I A;  2VH0 B;  3MDL A;  2Y7Z B;  1TPG A;  2RNL A;  3ZYG A;  1NZI A;  1KLI L;  2KNI A;  1TOZ A;  2F9B L;  1ADX A;  1O5D L;  2XC5 L;  3CS7 L;  1NFW B;  1HAF A;  3HO5 A;  3RR3 A;  4Z6A L;  1CCF A;  1NFX B;  1NT0 A;  1EMN A;  1NFU B;  2W3K B;  3BPS E;  1XKA L;  4BXW A;  2J2U B;  1IQM L;  1ATE A;  2DDU A;  6COX A;  3QCW A;  3S6X A;  3N8V A;  3HS6 A;  1URK A;  3SOQ A;  2Q1J B;  1FFM A;  1IQE L;  4D0F A;  2PHB B;  2VWM K;  5JB9 E;  1BF9 A;  1YGC L;  1APO A;  2VVC K;  2BQW A;  4BTU A;  3QH0 A;  3FBY A;  3CA7 A;  2BQ7 A;  3GIS X;  1YUK B;  4ISH L;  1HRF A;  3KQB L;  1APQ A;  1MOX C;  1Q4G A;  2VVV L;  2I9B A;  1IOX A;  1IQN L;  2WZP P;  2WG3 C;  2W86 A;  3M36 L;  3DEM A;  3PGH A;  2Y5F L;  5L2Y L;  3OLU A;  4X8S L;  1WHE A;  2XC0 L;  2WG4 B;  4JYU L;  1YO8 A;  5IKV A;  4Y71 B;  2J4I B;  2W3I B;  1K37 A;  1LK9 A;  4O1Z A;  1HT8 A;  2XBY L;  4OTY A;  1FE2 A;  3R05 A;  3HPT A;  1YUG A;  2P95 L;  1AUT L;  3KQD L;  4BTT A;  1PRH A;  1EZQ B;  1UZK A;  5CIS A;  4RUT A;  5JBA E;  3SOV A;  1IQK L;  3QMO A;  3KQC L;  3Q3K B;  1G1S A;  1EGF A;  2BMG A;  2WPL E;  4FM5 A;  1I0U A;  2VWO L;  3ELA L;  1DIY A;  4MMX B;  3BT2 A;  4G1M B;  2W2Q E;  2BOU A;  3LAQ A;  4X8U L;  1U67 A;  2VJ3 A;  3SW2 A;  2WFX B;  3ASI A;  5F19 A;  2BT7 A;  2JJL A;  5L2Z L;  2Y80 B;  4BTI A;  2D1J B;  2VWL L;  3NTG A;  2VRS A;  5IKT A;  2WPK E;  2BZ6 L;  3NJP C;  1QFK L;  1M1X B;  5FDQ A;  1UZJ A;  1FAX L;  4Y6D B;  1EQG A;  2KV4 A;  1IQJ L;  1DX5 I;  3ZYJ B;  3OLT A;  4X8T L;  1U8C B;  2MGP A;  1F0S B;  3Q7D A;  5JVY A;  2P3F L;  4JZF L;  2J34 B;  1CVW L;  3GCW E;  2XBX L;  2XC4 L;  1X7A L;  3HS5 A;  2MHP A;  4RRW A;  3V65 B;  3KCG L;  4CUF A;  4ZXY L;  3ZYI B;  3N8X A;  5JW1 A; 
#chains in the Genus database with same CATH homology
 2BOH A;  2FLR L;  2Y82 B;  2W2N E;  5E8D A;  4CSY A;  2BQ6 A;  4C16 A;  3F6U L;  1YUF A;  5JBB E;  2CJI B;  2P16 L;  2P93 L;  5CKN A;  1LMM A;  3H5C B;  2FZZ L;  1XKB A;  4JZE L;  2WPM E;  4PH9 A;  4RRX A;  1EAI C;  4RRY A;  3TH3 L;  1ATB A;  1JV2 B;  2B7D L;  3HO4 A;  2GD4 A;  2EI6 B;  1LQD A;  1N1I A;  1F7E A;  5K0H B;  1FF7 A;  1NPE B;  3C9A C;  4ZAE B;  1NFY B;  1IQF L;  5IKR A;  1LPG A;  2W2M E;  3HO3 A;  4RS0 A;  2NPR A;  3LTG D;  1SZB A;  1XDT R;  2FLB L;  2K2S B;  1MQ5 L;  3HS7 A;  3LN1 A;  1IGX A;  2I9A A;  3V64 C;  1PGE A;  1W7X L;  1EMO A;  1MQ6 L;  1LPZ A;  2Y38 A;  2PR3 B;  3TBD A;  2VVU L;  4YT7 L;  1JBU L;  4CUD A;  4YT6 L;  3GCX E;  5JBC E;  4O02 B;  3U73 A;  1KIG L;  1IQI L;  1IGZ A;  3KQE L;  1COU A;  2W26 B;  5COX A;  2AYL A;  1ATA A;  2P26 A;  1G2M B;  1G2L B;  1N7D A;  3CEN L;  1HAE A;  3K9X A;  2EI8 B;  4D90 A;  5IKQ A;  4LOR A;  2XBW L;  4Y7A B;  1EPH A;  1A3P A;  1Z6C A;  4Y79 B;  1KLO A;  4CUE A;  1UZP A;  2OYE P;  2MGR A;  4D0E A;  4XL1 A;  3TZI A;  2J94 B;  5KN5 C;  4Y76 B;  2BO2 A;  5EGM B;  4JYV L;  1WHF A;  3N8Z A;  1P9J A;  5JVZ A;  1EPI A;  2FLG A;  1JL9 A;  1EPJ A;  1NQL B;  3N8W B;  1DDX A;  2Y7X B;  2RHP A;  4RRZ A;  1HX2 A;  1EBV A;  4YZU B;  3U7U G;  4BDW A;  5JB8 E;  3LN0 A;  1HJ7 A;  1IQG L;  3CFW A;  4OTJ A;  4TGF A;  4ZXX L;  1CX2 A;  2M74 A;  1RFN B;  1GK5 A;  3KL6 B;  2P3F N;  4NG9 L;  1EQH A;  3F1S B;  1IQL L;  3MQE A;  3LC5 B;  3NTB A;  2PUQ L;  4MMY B;  4A94 C;  1DVA L;  3N8Y B;  4ISI L;  1G1R A;  2VWN L;  2UWP B;  3EGF A;  1L3Y A;  2WYJ B;  1IQH L;  1Z6E L;  1ZAQ A;  1J9C L;  2WPI E;  1IVO C;  3SOB B;  1PTH A;  1HZ8 A;  1FJS L;  5I46 L;  5L30 L;  4Z0K B;  1PFX L;  3LC3 B;  2XBV L;  4X8V L;  3POY A;  1HCG B;  1WU1 B;  4M10 A;  4MMZ B;  2OYU P;  3ENS A;  5KIR A;  2K2T A;  3NT1 A;  1LPK A;  3LIW B;  4NGA L;  2WYG B;  1UZQ A;  1CEJ A;  2KL7 A;  2P3U A;  4LMF A;  5F1A A;  1CQE A;  2Y5G L;  1KLJ L;  4ZH8 B;  1CVU A;  2RA0 L;  1ATD A;  2P28 B;  2Y5H L;  3FCS B;  1IP0 A;  1P0S L;  3KRK A;  4BDX A;  5CKQ A;  1K36 A;  1G1Q A;  2YGO A;  2YGQ A;  1B9W A;  2YGP A;  4XBM A;  3TK5 B;  2W2P E;  2VH6 B;  4NA9 L;  4BXS A;  4ZHA B;  2KB9 A;  2BOX A;  3P5B L;  2BOK L;  4Z0L A;  2ADX A;  2WPH E;  5CKM A;  1FSB A;  2UWO B;  2P94 L;  3BT1 A;  3FFG L;  1EPG A;  4M11 A;  2Y81 B;  2H9E L;  4AQT A;  4JZD L;  1OB1 C;  1G1T A;  3TGF A;  1IJQ A;  2UWL B;  2J95 B;  2TGF A;  1IOE L;  4COX A;  1LMJ A;  4E1G A;  1FAK L;  1HRE A;  3N8W A;  2J38 B;  1CCV A;  1XFE A;  1DQB A;  4A7I A;  2FD6 A;  3LTF B;  1W8B L;  4Y7B B;  3IJE B;  2G00 L;  1V3X B;  2WPJ E;  3IIT B;  1F0R B;  2P3T A;  1KSN B;  1TLE A;  2EI7 B;  2W2O E;  2H9E C;  3TK6 B;  1PXX A;  1L5G B;  2JKH L;  1C5M F;  3N8Y A;  4XLW A;  3KK6 A;  1HT5 A;  2WFT A;  3M37 L;  1F7M A;  2VH0 B;  3MDL A;  2Y7Z B;  1TPG A;  2RNL A;  3ZYG A;  1NZI A;  1KLI L;  2KNI A;  1TOZ A;  2F9B L;  1ADX A;  1O5D L;  2XC5 L;  3CS7 L;  1NFW B;  1HAF A;  3HO5 A;  3RR3 A;  4Z6A L;  1CCF A;  1NFX B;  1NT0 A;  1EMN A;  1NFU B;  2W3K B;  3BPS E;  1XKA L;  4BXW A;  2J2U B;  1IQM L;  1ATE A;  2DDU A;  6COX A;  3QCW A;  3S6X A;  3N8V A;  3HS6 A;  1URK A;  3SOQ A;  2Q1J B;  1FFM A;  1IQE L;  4D0F A;  2PHB B;  2VWM K;  5JB9 E;  1BF9 A;  1YGC L;  1APO A;  2VVC K;  2BQW A;  4BTU A;  3QH0 A;  3FBY A;  3CA7 A;  2BQ7 A;  3GIS X;  1YUK B;  4ISH L;  1HRF A;  3KQB L;  1APQ A;  1MOX C;  1Q4G A;  2VVV L;  2I9B A;  1IOX A;  1IQN L;  2WZP P;  2WG3 C;  2W86 A;  3M36 L;  3DEM A;  3PGH A;  2Y5F L;  5L2Y L;  3OLU A;  4X8S L;  1WHE A;  2XC0 L;  2WG4 B;  4JYU L;  1YO8 A;  5IKV A;  4Y71 B;  2J4I B;  2W3I B;  1K37 A;  4O1Z A;  1HT8 A;  2XBY L;  4OTY A;  1FE2 A;  3R05 A;  3HPT A;  1YUG A;  2P95 L;  1AUT L;  3KQD L;  4BTT A;  1PRH A;  1EZQ B;  1UZK A;  5CIS A;  4RUT A;  5JBA E;  3SOV A;  1IQK L;  3QMO A;  3KQC L;  3Q3K B;  1G1S A;  1EGF A;  2BMG A;  2WPL E;  4FM5 A;  1I0U A;  2VWO L;  3ELA L;  1DIY A;  4MMX B;  3BT2 A;  4G1M B;  2W2Q E;  2BOU A;  3LAQ A;  4X8U L;  1U67 A;  2VJ3 A;  3SW2 A;  2WFX B;  3ASI A;  5F19 A;  5L2Z L;  2Y80 B;  4BTI A;  2D1J B;  2VWL L;  3NTG A;  5IKT A;  2WPK E;  2BZ6 L;  3NJP C;  1QFK L;  1M1X B;  5FDQ A;  1UZJ A;  1FAX L;  4Y6D B;  1EQG A;  2KV4 A;  1IQJ L;  1DX5 I;  3ZYJ B;  3OLT A;  4X8T L;  1U8C B;  2MGP A;  1F0S B;  3Q7D A;  5JVY A;  2P3F L;  4JZF L;  2J34 B;  1CVW L;  3GCW E;  2XBX L;  2XC4 L;  1X7A L;  3HS5 A;  2MHP A;  4RRW A;  3V65 B;  3KCG L;  4CUF A;  4ZXY L;  3ZYI B;  3N8X A;  5JW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...