4CV2A

Crystal structure of e. coli fabi in complex with nadh and cg400549
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
237
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Broad Spectrum Antibacterial Activity Based on a Clinically Relevant Enoyl-Acyl Carrier Protein (Acp) Reductase Inhibitor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 83
structure length 237
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cv2A00
1T2EA 3GDFA 1XGKA 5DF1A 3RIHA 5KKCA 3QRWA 3DMTA 4JP2A 1NX6A 1KOLA 1R4MB 3GHHA 4D3FA 1PU2A 4KWIA 5KJ6A 2JL1A 5JAZA 4WEQA 1GCOA 3TPCA 4OH1A 5KNLA 5B1YA 4AJ4A 1GDHA 1AN9A 5DOVA 2X4GA 5BSGA 4TROA 4ZN6A 3LF1A 4GGOA 4GWGA 2QHXA 2OXIA 3PXXA 3C7AA 3D4NA 2NU9A 5DP2A 4LK3A 4BNJA 3VTZA 4BO0A 5GZ3A 4NBRA 3UUWA 2FY8A 5DZSA 3VZRA 3PK0A 1LRJA 4LCJA 3QVOA 3VH2A 1IHYA 2EKLA 1LSUA 4XKJA 5THQA 2FWMX 4B7CA 4CQMD 3U09A 4MOWA 3G49A 1GPJA 1R4NA 3JQ7B 2O7SA 4FC6A 5K6AA 3KYDB 1U2GA 4XD2A 4WPGA 2HMUA 1MGOA 4TRRA 4NK5A 4HV4A 4YT8A 1ISJA 4KOAA 4LCEA 2VOEA 1YOVA 4IQ0A 1K6XA 2IZ1A 4ZA2A 4WLVA 3UHAA 5ENDA 1IPFA 3LT0A 1QMGA 1YH3A 3OJOA 1SAYA 1PGJA 1EBUA 1F8FA 3JQAD 3WFJA 2EG9A 3JQGB 5F3RA 3ZV3A 3CINA 2VYND 1I8TA 4FB5A 1VSVA 1WMBA 2ZB7A 2DTXA 4K26A 3ZNNA 2RBEA 2P4QA 3GGOA 3IUPA 1MXHA 4CM8A 3VHRA 3ROQA 1YOVB 1F0YA 4AJ1A 3FF4A 4DIOA 1TT7A 4BNKA 5JC8A 5C7IO 2Z95A 3DBHB 3BZUA 3N58A 4BOYA 5JMPA 3VVCA 4HFNA 4BNLA 4RORA 4TMFA 3VH1A 2D1YA 5KKAA 4EI2A 1MX3A 3KUXA 1UP7A 4GVLA 2H6EA 5FYDA 2FHSA 3DTTA 4YQYA 4HFRA 4UVIA 2JJYA 1E3LA 4CV2A 2YV1A 3I83A 1SO8A 3TL3A 1R0SA 2D2IA 4ZJUA 4FJ2A 4RVSA 3RUCA 1VSUA 2PKQP 1KVUA 3L9WA 1I30A 3L07A 3TNLA 3MCVA 4GKBA 3FHLA 3BHIA 4UULA 3C7CB 1H6AA 4UEOA 3WB9A 4NBVA 2A9FA 5T6BA 1BW9B 1Z45A 2BI7A 2B35A 3OICA 4BKRA 1E7YA 2CSUA 3QVTA 3NDRA 3QQPA 4FDAA 4HNHA 5A5FA 2O3RA 3ZI0A 4J0FA 1ULSA 2AQ8A 2Y1CA 4ZQHA 1E6UA 4XQGA 4YAEA 1B8PA 1EQUA 1G1AA 1T26A 3AFNA 1R0LA 3HADA 2RHCA 5BNFA 4YYZA 3AM3A 2J5KA 5DCUA 5G4LA 1C0IA 1H5QA 1UXKA 3LLVA 1E3SA 1AGNA 2GZ3A 3PFWO 4A73A 2Z1MA 4NJMA 3A14A 1ZIDA 3WS7A 4E33A 3WQQA 4IXTA 1Y1PA 4BO1A 2BH9A 4A5OA 4J4BA 5EJ2A 2PV7A 5IF3A 4ILKA 5JCJD 1D3AA 2W98A 3LT2A 3Q0EA 3JYLA 4FOSA 3ZHXA 4BGVA 4TZTA 2O3JA 1PZFA 5KJCA 5A03A 1YRLA 2BGLA 4RQUA 4I1IA 4NPCA 1EQ2A 1HDGO 1MFPA 2ZB8A 4NQZA 3L9XA 4Z0TA 3HG7A 2NVUA 2GUGA 5A9TA 4L73A 3OA0A 5EN4A 4DIFA 1P1JA 3EY4A 3I9KA 1DC3A 1N9GA 5DNAA 3FN4A 4ZRMA 2VUTA 4CODB 1VC2A 2X5OA 1LDMA 1ENZA 3KM0A 4AJHA 4MKRA 3ASUA 4NBTA 5JBIA 1Y8QB 3ZH2A 1JKIA 1VKOA 1JQBA 2PFGA 2X23A 5JYEA 2GLXA 2C59A 1MFZA 4XX0A 1HZJA 3HFSA 2FP4A 1BG6A 3ZWMA 3EMKA 3KEOA 4AJOA 4I9UA 4CV1A 1GV1A 1B8VA 3SJ7A 2Y1EA 1A9ZA 1DFHA 1F06A 1M76A 2E82A 2X5KO 4H3VA 4IDDA 2O3QA 3E82A 4E5KA 1ADBA 2X0IA 4YAIA 2WE7A 4O59O 4RGBA 3O8QB 2QG4A 4BVAA 4IMPA 1VL0A 1SC6A 2VCYA 3WYBA 3FPCA 1I33A 3EVNA 1E5QA 4A27A 1YBMA 4D43A 3K73O 4Q9NA 5T8KA 2OFPA 3DHEA 5AXBA 2HDHA 4RVDA 3WFIA 3KBOA 5C37A 3AWDA 2PLAA 5CDUA 5JAMA 1PR9A 3PJEA 2F1KA 2R6JA 3U4CA 4DQXA 4URFA 2PZKA 3I1JA 5B37A 1U4OA 1C0LA 1V35A 3FNHA 1WVGA 1C3VA 3EAGA 3K2BA 2FN7A 2G82A 1CJCA 3VAZA 4GH5A 3PPIA 1PGNA 3Q2IA 3KYBA 1LUAA 3H7AA 4ND4A 4Y9DA 4TWRA 2VHYA 4AJIA 5JDIA 3PRJA 3I9OA 2Y0EA 5GY7A 1JKJA 3NT2A 4IJVA 3NTOA 4U5QA 4CR6A 3DMYA 4IIVA 5L53A 1GR0A 4UVEA 4WE3A 3PHGA 5IDQA 4E32A 3JQ8B 4IUYA 4EEXA 4NU5A 1BXGA 1EUCA 1XEAA 3DL2A 3PVZA 5IDYA 3QWFA 4PG4A 2DU8A 3PZBA 1CF2O 3DZGA 1ZJYA 3IDSA 5MDHA 1MLDA 3W6ZA 4AJPA 3VTFA 1FDVA 1X0XA 3ASVA 4QFCA 2R00C 3BYZA 3QWHA 4BNUA 5KJFA 3P19A 4O0LA 4N7RA 3WGIA 1W4ZA 4FQ8A 2NWQA 3IUSA 3WGTA 1U3VA 1LQUA 5BSEA 2HUNA 3PIDA 2PGJA 2I5PO 1DIBA 1CEQA 4PLZA 1BWSA 3ZDFA 5IFLA 3ZWOA 3U62A 3AK4A 4CLOA 1C0PA 1HKUA 1E7WA 2P2SA 3P7MA 4HY3A 4QEDA 1ZEMA 4WLEA 5MGBA 1E6WA 1ID1A 3JQ9C 1ZK1A 2X7HA 3QJ5A 4JBIA 1C1XA 2GYYA 3ADPA 4JX8A 4XYGA 1F12A 4INAA 2IZZA 5JW6A 3I23A 5H83A 3D64A 4CMIA 1H6BA 4J4TA 1Q0LA 3CZRA 3GLQA 3DR3A 4R54A 1DIRA 2OMEA 3PYXA 1PTJA 4NG5A 4D42A 4J49A 1HWYA 4K1LA 1UP6A 3OETA 4BNMA 4OAQA 3PYMA 3F9IA 1E0DA 2YDXA 2J5QA 4DUPA 3GEDA 1K3TA 1PQWA 3JQ8A 1M2WA 1ENPA 1RM4A 2QZZA 2W90A 5GMOA 4PLCA 5I7FA 4RVUA 4E3ZA 1X1TA 4P4GA 1K2WA 3E18A 2ZJ1A 1HSOA 3STHA 2HRZA 3JYOA 3GUYA 4FR5A 4YAJA 5A04A 1HRDA 1JU9A 2Y68A 2PD6A 2O4CA 3GA0A 1NWHA 5AVOA 2YY7A 2WDZA 4B8ZA 1DLIA 2PZLA 1JW9B 4DRYA 4WGGA 4NZ9A 4MVJM 4MIYA 2EF1A 2VYVD 2NU8A 4DA9A 3VOSA 5TX7A 2BI8A 1KY5A 2E6UX 1X7HA 2GR9A 1TLTA 2GN8A 3QA9A 4LVUA 5IJZA 4HFMA 3NAQA 4M49A 1ENOA 2VT2A 1KEVA 1WW8A 3GHYA 4XR9A 3AM4A 2UV8A 3LDHA 2VRBA 1P77A 3JQBC 2GN9A 1GCUA 1T25A 4MP8A 2P9CA 2NVUB 1QYXA 4B7UA 3L4BC 4D0RA 4DLAA 2B0JA 3RWBA 1F14A 4RF4A 1UDBA 3W6UA 3I9MA 3ZWVA 4K28A 3FPLA 3R3SA 2CZCA 4NK4A 4CLHA 2VNSA 4OOEA 3WXBA 1DSSG 3PWZA 4PLVA 5DN9A 4YRAA 3GK3A 1V3UA 4C7KA 3NGLA 4RVFA 2VWPA 4ALLA 6ADHA 1HLDA 2DPHA 1QLJA 1CYDA 4FJ0A 1YQGA 1PJTA 3Q3CA 3FRJA 3BTOA 4MVJA 2YDYA 3GGPA 2PD4A 3SC4A 4AJEA 4B4OA 3LLSA 4BQPA 4XQEA 3NKLA 2ZTLA 4FGSA 2IRWA 4QECA 4ZQGA 5L95A 4WLFA 3WGZA 4DPKA 1QV7A 4CMEA 4IGFA 4IS2A 5T8KC 1QORA 3QW2A 2X22A 1PJBA 3DWFA 5JDCA 2NVWA 4I5GA 3DHYA 3AI2A 5G0UA 2IXBA 3X2EA 4FPXA 4PLFA 1PR3A 1Y7TA 3K5PA 2PTGA 2CUKA 2WEKA 4FFLA 1U9JA 2AQKA 2HQ1A 3AFMA 1V0JA 1LRLA 4GQAA 3HB4X 3TZCA 4EDFA 3V2HA 2AE2A 4CM4B 2RIRA 5JYDA 1HE5A 5AOVA 4OIMA 2HJSA 4XDZA 2EERA 5TSDA 3JSAA 2GDZA 3AOGA 3RVDA 4MPDA 3PDUA 3F4LA 4MIOA 1H2HA 3BMCB 3QWBA 4II3A 1LXCA 2DBRA 1ZCJA 1R15A 3GPIA 2EKPA 3ICCA 3DOJA 4I5DA 3LC1O 5T5QA 3ONEA 1B8UA 4WLUA 3U49A 1DIHA 4CQMB 2HAEA 1ZEJA 3OMLA 4GLLA 1P31A 2DM6A 4YQZA 1NVTA 4B7XA 1QV6A 1YWGO 4BB6A 3V1UA 1VI2A 1ZO8A 1W73A 3PEFA 3ZV6A 3AY7A 4XGKA 1DAPA 3PTZA 2VTEA 1Y9EA 5COBA 2Y05A 2C29D 2GERA 4AVYA 4ZVVA 3TRIA 4NJMB 1PGQA 3JQ7A 4GL4A 4OSOA 5B4VA 1EUDA 1Y81A 2HMVA 4DYDA 1XU9A 3GVPA 1B3BA 2ZCVA 3BAZA 2R00A 4TRNA 5A4DA 1O94A 2BHLA 2DT5A 1E77A 1FJHA 2VZ0A 1B26A 3EVTA 2X0NA 1DHTA 3VPFA 1ARZA 4Z9YA 1M66A 4PG5A 4UVHA 2Q1SA 5DDIP 4P4LA 1MC4A 4CLRB 2DUWA 3WGQA 1JWBB 4B3IA 2YV3A 4ZD6A 2VHZA 3ZNOA 1HYHA 2DC1A 2IXAA 1SZJG 4IPTA 2PZJA 4PRKA 1U8FO 2J6IA 2D59A 2UUPA 2JAHA 3EYWA 4O63O 5TT1A 1H93A 3KRTA 4PLGA 4UUNA 4C7JA 1HDRA 2PWZA 1DPGA 3H3FA 2BGKA 2YW9A 4LSWA 5TIIA 3GR6A 4YB8A 4LISA 1B7GO 4GX1A 3GVXA 2Q1TA 3CXRA 3ZW8A 4OYRA 1T2CA 3D0OA 2O2SA 2PGDA 2P4HX 3OQBA 3BHMA 4AJJA 3V1TC 1EDOA 3ANMA 3QVXA 4NFYA 3Q6IA 3G1TA 4YJDA 1T2DA 4OO3A 3EK2A 2HJRA 4WNCA 1G0NA 1UJMA 3HN7A 1NAIA 3LK7A 4IZIA 2I3GA 1U7TA 3B1FA 1YL6A 4M54A 2B69A 1Y5RA 2WD7B 4BO4A 4CMGA 4G81A 5L45A 5CDGA 4Z3DA 1GTMA 3U4DA 4R3NA 2ZB3A 3GT0A 2UDPA 4ZQFA 2OBYA 4ROSA 3VPXA 4QSMA 1YDWA 1P0CA 4I9NA 4N18A 3PWSA 1IUKA 4YWJA 4RJTA 1E3EA 5CPBA 1SEPA 1QYVA 3T4EA 4GSLA 2G5CA 2Y93A 1XHLA 3JYNA 4CR7A 4PGFA 1DRVA 4PLTA 4RPJA 5L3ZA 3WJAA 2NQ8A 1EFLA 1OAAA 3QIVA 3W4IA 2CF5A 3K9QO 1HDOA 2QIOA 4DC0A 4LN1A 2CDCA 8ADHA 4NFSA 3R1IA 1ZBQA 4DGSA 2ZTMA 1ADFA 1R16A 3H65A 1D8AA 1EE2A 3RBXA 3MWDB 2FR0A 3AM5A 3PHLA 5U1PA 2P91A 1BXKA 4Z9XA 1H9AA 1N2SA 2ZTUA 4XB2A 1PL6A 1UXHA 4U8GA 3OH8A 3FI9A 5I9LA 3RCBA 3GVHA 3L4BA 4I9HA 1QKIA 3ETGA 1SNYA 5BT9A 4XDYA 3RD5A 3OP4A 1NWCA 3LT4A 4D79A 2Y1GA 4OSPA 1SPXA 1GZ3A 1PWZA 3GRPA 4J1QA 3TDKA 3ZHZA 1TA4A 4L74A 2FPIA 3U9LA 3LU1A 4GBJA 5JPIA 2HRBA 5C7OO 4E2YA 5KTKA 2HMSA 4CM3A 2I6TA 3JCZA 2ZYGA 2Y0CA 4YR9A 1SOWA 1UXJA 4CMEC 2GASA 1DB3A 1LDEA 4XJSA 5JO9A 1BRMA 2NVBA 1ONPA 1V9LA 1P44A 4FW8A 3ZN2A 3PI7A 3AJRA 3AOEA 1DBVO 5TGDA 3JQDA 1XG5A 5CEFA 1H2BA 1EE9A 1KEUA 5JAQA 4YAKA 3JD0A 3WLFA 1UR5A 4WCFC 5GZ6A 1CQIA 4RV9A 4WASA 2NNLD 2Y0DA 3B1JA 4FFNA 3VKUA 1ISHA 2Y1DA 3EUWA 4JQCA 5G0VA 4BO2A 4J2HA 4BO8A 1XYGA 4OGWA 4F46A 4PFJA 1IOLA 1DLJA 1GQYA 1NFRA 2YYYA 3PLRA 1TT5B 3DZBA 3OBBA 4CM1A 3O4RA 2BFAA 3IKVA 1ZJZA 3P2YA 1WMAA 2A4KA 1LA2A 4WLOA 3NTQA 2VWQA 3FSRA 3ITDA 1UDCA 4BGUA 4E5YA 3S2GA 1PJLA 2BLLA 3VPSA 1NPDA 2Y1OA 1XR3A 4YJGB 1VKNA 4CM6A 3WYCA 1VJTA 1P74A 4R9SA 4PN3A 3RC2A 2WYUA 2ZYAA 4DTIA 2OUIA 1DDOA 3F3SA 3VDQA 3A4VA 1SMKA 1OBFO 5F1OA 1XCBA 2E4AA 5B4UA 1CWUA 3OIGA 1RYEA 5JMWA 3HWRA 4JP3A 3W8EA 4L76A 2DBQA 2RAFA 2LDBA 1HDXA 1NQ5A 3WQRA 3GNSA 3FTPA 3BMQB 4MO2A 1Z6ZA 4IJWA 3DQPA 1UZLA 4DWVA 3EGOA 4FFMA 4F6LA 2VNAA 3RU9A 1EBFA 4KTTE 3QV1A 2J3HA 4KUEA 2DTDA 1Q7GA 3RFTA 5A3JA 3CKYA 1XIVA 2P5UA 4TZKA 4RLSA 1E1LA 4BMVA 2Y67A 3D3WB 2PD3A 1MG0A 5ER6A 1NAHA 5JXWA 1FDTA 4CLEA 1BTOA 4Z0HO 5I9NA 1T2FA 4ALNA 4EITA 3ZHBA 3O38A 2I66A 5T57A 1Y8RA 3DBLA 4R01A 3WSVA 3RU7A 5A5EA 4QX6A 4MIEA 2EGGA 1ISIA 4R3WA 3ROPA 5ILOA 1Y6JA 2CFCA 3LYLA 3K2EA 4A26A 4BV9A 1U8XX 2EW2A 4GWKA 1HL3A 7MDHA 3T4XA 2DFDA 3ZU4A 4CMKA 1T1RA 3QVWA 2JHGA 2AG5A 3O9ZA 3JD1A 3KYDA 4JNKA 4J1NA 3C24A 4FIZA 5KVCA 5EESA 3FWNA 3JQBA 9LDBA 2OP0A 2Q3EA 3H5NA 1T24A 2R2GA 4CM9A 4L4RA 3BMOA 3M2PA 3HQ4O 4R51A 2VRCA 1G6KA 4AJNA 5CP8A 1CETA 2F00A 3P5SA 2VWGA 3NT5A 1VRWA 1EFKA 4RZIA 3BMNA 3S2IA 4R5MA 2FR8A 3OJEA 3NJ4A 2HK9A 3G79A 3D3EA 4KDFA 4W82A 3ZWCA 1CDOA 3GUCA 3X2FA 1NASA 1PQUA 2Q2WA 3H9JA 2TMDA 5AQ1A 4YJFB 5F1PA 1VJ0A 4RPHA 1YE3A 4QO7A 1FK8A 1ZSYA 5FI5A 3TOZA 4Q3AA 3JD3A 1GZ4A 3LQFA 4CQLA 4MJLA 1B0AA 4Y8VA 5TRTA 4EBFA 4XIYA 1PL7A 2DLDA 3VH4A 1R4NB 5JSFA 2V6FA 3JQ9A 4CM8B 5ADHA 3AUUA 5C5IA 5IAAA 4AFNA 3PGXA 6LDHA 2DFVA 2H63A 5G0SA 3E5RA 2VQ3A 2AE1A 3PHHA 1UH5A 2WJPA 1H94A 5A3VA 3SLGA 2GGSA 2GN4A 3UH1A 3M1LA 1NFQA 1L7DA 3AY6A 2RCYA 4ZU3A 1V3VA 3SVTA 4FFRA 3IAHA 4R1UA 3Q2KA 5T64A 3KLPX 2JFHA 3AOEC 1DFIA 2ZB4A 2G1UA 3FD8A 1MV8A 4J1TA 5DP1A 1A7AA 1U3TA 3ZV4A 2JHFA 3B6ZA 3WDSA 4W9NA 3OHSX 4BMNA 1NR7A 5KVQA 3LT1A 3WX0A 3IOYA 2C5EA 3W8DA 4AJKA 4MKZA 1AE1A 1R6DA 1KVSA 3WGGA 1HDZA 3DBRA 2PK3A 1DJQA 1ZK4A 1TI7A 2HK8A 3INTA 4WCFB 1Q2XA 5K6AC 3BHJA 3WTBA 1IZ9A 4P38A 3F1LA 1DAOA 1E92A 3TFQA 3JQFA 5JC1A 3PQFA 4DVJA 2H1SA 4MVJG 5TT0A 3OSUA 4J7XA 1GFSA 2ZKLA 3VDRA 4E2XA 4PZEA 2Q4EA 3ROKA 1KEPA 1NPTO 4BNIA 2C20A 5K0ZA 2QRKA 1IL0A 4BNTA 1E5LA 4XEHA 4B4UA 2O4UX 2DPGA 5DCWA 4B4VA 2YHUA 4UREA 3GPDG 4B79A 4CMCA 3AU9A 3JQEA 4R1NA 3L4SO 3JYQA 2XXJA 2DVMA 4I08A 4Y6SA 1PGOA 2VTDA 2HMWA 1EMDA 2C07A 4H16A 4YT2A 1GV0A 3VZQA 1KY4A 1O89A 3CPSA 4YEDA 5U4QA 1QR6A 5H82A 2D5CA 3AUSA 2EW8A 2AQIA 2GCGA 4AG3A 4TQGA 4MINA 3DFZA 2Q1WA 3GH3A 4U0JA 5EERA 4AJLA 5JNLA 5DCYA 1X15A 2J3JA 5CG2A 1HYEA 2EV9A 2JCVA 1NXQA 1XWFA 1LDBA 4YA6A 3MJCA 1C14A 4DMMA 2NV6A 3H8VA 3RUEA 2PNFA 1JN0A 1ZUD1 2I99A 1KYQA 3ON5A 1N92A 1XSEA 3HDYA 3H9UA 3QP9A 4QUKA 2NTVA 3DZKA 1PSDA 2CMDA 5JDCC 3H2ZA 4FJ1A 1WDKA 2BD0A 3L0DA 5KJEA 3I4CA 4I8XA 4R9RA 1N7GA 4B3JA 2IE0A 1KS9A 3H9EO 2V7PA 4RPKA 3RKRA 2FR1A 1D1TA 3CUKA 3HB5X 3ETEA 5COQA 3D4OA 5CDTA 3I9LA 1LJ8A 5KIAA 3KSZO 1Y8RB 5CEJA 4YTEA 1D4FA 1QRRA 1U2DA 4UEKA 3RSHA 2YUTA 4R41A 4NI5A 3KVOA 1KIFA 4GX0A 1KEWA 3LZ6A 3DZHA 1E7QA 1U3UA 1MC5A 5BSHA 3GF4A 4R69A 4DC1A 4M8SA 2BELA 2J8ZA 3TQHA 4BKOA 5IDXA 3M1AA 4XYBA 2I65A 1NR1A 1LRKA 2O23A 1EVIA 4RVGA 3ZW9A 3RKUA 3UKOA 2Z5LA 2Q1UA 1DOHA 5AXAA 5G0WA 1K5HA 4CLOB 2W2KA 1YKFA 1BXZA 5TJ9A 4CUJA 2VZ8A 3IP3A 5KOIA 2JD0A 3QY9A 1R12A 1TEHA 3N7UA 1O6ZA 4L9RA 1LDYA 3NV9A 3DEYX 4E5NA 1QYDA 2QZ9A 3VVBA 4ZHSA 4Q3CA 4J7UA 3KYCB 2XAAA 1O95A 2LDXA 4AJ2A 4E21A 3ONFA 1V3TA 3DXFA 2X9GA 3OEWA 4JGBA 3DBLB 3BXXA 4PVCA 4AICA 4Z3KA 1JTVA 3V2UA 1T1SA 4LGVA 1S6YA 1GL3A 1B14A 1J49A 1JVBA 5GZ1A 4GLOA 2OGUA 4OKNA 1DC4A 3SLKA 3NDJA 1LDGA 3RI3A 3B20A 3NEPX 1SOVA 1Q1NA 4GGPA 4TVBA 5JCXA 4AL4A 5COAA 5ENVA 5A9RA 4XQ9A 3IC5A 1BHSA 1M6HA 4TRJA 1F8GA 3QHAA 4YJGA 5LC1A 2OOSA 1A71A 3ZWBA 3NX4A 2YJZA 1T2AA 1UZMA 3PYLA 2Q45A 5JY1A 3ANLA 4R68A 4E0BA 3ORFA 2AW5A 1DFGA 3ROMA 3PP8A 3BIOA 1GYQA 1PZGA 3ZWPA 4JN6B 5BR7A 4A0SA 1Z73A 1LLQA 2Q2QA 4W9NC 3JD2A 4GKVA 1OMOA 4J2OA 1A72A 4MP6A 3VH3A 5BQFA 3ANNA 1KBZA 5U9CA 3FBTA 1CQJA 3OJFA 3ZV5A 1GUFA 2FMUA 1M75A 2YHIA 2VT3A 3BMQA 3K96A 5JDIC 3Q9UA 3NRCA 2FOIA 1SB8A 1E7SA 4FGWA 4RZHA 4FC7A 3G17A 4A03A 2IYOA 3U4IA 4HKTA 3A9WA 3GDOA 1J0XO 1NYTA 5I7VA 4J91A 1N7HA 3OM9A 3DO5A 1GD1O 1P1RA 4K6FA 5TLSA 2JCYA 2HO5A 3KYCA 1YGYA 3FR8A 4H7PA 3RBZA 5F21A 1C1DA 4DLBA 1F17A 1Q0QA 3PJFA 2OP1A 2WYWA 2VUUA 5J23A 2WMDA 1LSSA 3E9MA 4YAGA 1NP3A 1UZNA 4N5NA 1Y5MA 2CVZA 5KJ1A 2O2YA 2BF7A 3I6IA 4N54A 1YQDA 3WGYA 3GMDA 4X54A 3WIDA 3MEQA 3OIDA 1A27A 4MDHA 3MOGA 2EIHA 4CV3A 3GEGA 1EZ4A 3DFUA 5JCJA 5IZ4A 3KETA 1I2BA 2DBZA 4JBHA 3GAZA 4JIGA 1I2ZA 2HSDA 1ZK2A 3P2OA 1PL8A 2Q4BA 4U6QA 4RL6A 2IYPA 2PZMA 3U0BA 4CMBA 1GYRA 4P22A 3TN7A 1RWBA 4J1SA 1AXEA 4J6FA 2CNBA 2WTBA 1PWXA 2X1HA 2W4QA 3ETDA 1Z7EA 5FWNA 3G0OA 2C0CA 4NIMA 3VZPA 5TNXA 3RC1A 1ZNQO 3R0IA 1X0VA 1JKFA 3FWZA 3GAFA 1P1KA 2V6MA 3PWKA 4OQYA 1A9YA 3ZU3A 1HZZA 4C4OA 3OIFA 4BO7A 1HE2A 1SCUA 3TWOA 4OQZA 2G17A 2D0IA 2XPCA 4NDNE 3IKTA 1R37A 5FEUA 4LRSB 2QW8A 4XR4A 1GY8A 1EEHA 1EVJA 2OBNA 3HZZA 1BVUA 4J4HA 4ONEA 1QG6A 1YS4A 4D0SA 1YO6A 4NU6A 4RLHA 1LC0A 3IMFA 2GZ2A 4XGIA 3FCOA 4F45A 3IJRA 1NTOA 3NDIA 4MVJH 5ITWA 3R3JA 4WCFA 1M6WA 4RDHA 3KHUA 4RO0A 4QQRA 4N5MA 4MVJD 2AEMA 3E03A 2HK7A 4R16A 2P9GA 4CM7A 3GVIA 8LDHA 4BNGA 3U3XA 3EZYA 3WQSB 4GX5A 3F1KA 4EGFA 1GU7A 2IODA 3H5AA 2X8LA 2P68A 5BNTA 3DB2A 4JXKA 1KETA 3UVEA 1ZZEA 3DZJA 2NACA 3QLJA 1LSJA 1N9GB 4PLPA 5AYVA 1I3LA 1LQTA 4M55A 3ENNA 1DJNA 1MA0A 2UVDA 3KLMX 3TZHA 4D3SA 1IULA 2PKQO 3GVCA 3ZWWA 3GOHA 3ZWYA 4OXNA 1RPNA 2AA3A 3RROA 1YB4A 5CPFA 3ICPA 1GEEA 1UXGA 3HJAA 2VHVA 4FSHA 1U28A 1Z75A 5F5LA 1S7CA 1O8CA 1RYDA 2X86A 4EYEA 1HF3A 4F6CA 1A7KA 3GMSA 1HT0A 4YCAA 4MVJI 4XYMA 1HE4A 3KZVA 2QQ5A 3OJ0A 1DC6A 4UEJA 1H6CA 4IQGA 3C7DB 1HDCA 3HNPA 3RASA 1BSVA 4QO8A 3DOOA 1LDNA 3HDQA 2X0JA 1I5RA 4CR8A 2W2KB 3BTUA 1JDJA 4OOFA 4JROA 2EGHA 4IXWA 4CUKA 5L7TA 1IY8A 1O5IA 4TVOA 3AW9A 5L51A 4PIVA 1Q0HA 1XLTA 2GNAA 3ZNQA 2Y1FA 4DQUA 3SC6A 3HDHA 3HE3A 4I5FA 1DEHA 4YJFA 1I0ZA 1IZ0A 3TZQA 4JLWA 4BHTA 3I9NA 2D3TA 4KQWA 3W1VA 4QXMA 1PS0A 1WWKA 1OOEA 4M89A 2G76A 1R4MA 3S2FA 1W8DA 4M1QA 3F5QA 4A7PA 1E3WA 3I9JA 4EJ0A 2PH3A 3AU8A 4B3HA 2D5AA 1KVQA 3W4JA 4GMFA 4IS3A 3GZNB 1DC5A 1YL5A 4BS9A 4OJNA 3CTMA 2I76A 4L0QA 1BW9A 3JQAA 4JJIA 4XIJA 4Q3BA 2EP5A 3A1NA 3KSUA 5JAIA 4CM4A 2OZPA 1GUZA 1PJCA 4Y98A 3GQVA 4G5HA 2FPGA 3DZIA 1ULUA 4WK6A 1KVRA 4ZRNA 3V8BA 1R66A 2X0RA 1FXSA 1V6AA 4EUEA 2CVQA 3F46A 5G0TA 4E13A 1B3RA 2ILTA 3DBHA 4UUPA 1IYZA 2ZJ0A 5HTOA 5T67A 5HS4A 4XYLA 1I36A 4OKIA 5CAEA 1ZH8A 5H81A 4CQMA 3H4VA 1H0KA 1PJ4A 2XXBA 1CRWG 1OC4A 1QYCA 3V2GA 1GPDG 4PLWA 3UCFA 3E5MA 4ZQEA 1NNUA 3QWAA 3NYWA 5IN5A 3JQGA 4FBGA 1KVTA 4YXFA 2ZIZA 2CDBA 3LVFO 1E1MA 2X5JO 2IDZA 2D4AA 2FSSA 3R6DA 2C7VA 3D4PA 3RUFA 1GAEO 4LMPA 1RKXA 4IY1A 3SX2A 3HSKA 4IDEA 5F5NA 3KSDO 4GPD1 3BMCA 1GZ6A 4G2NA 4R1TA 1PZHA 3DHNA 3IS3A 3N74A 2EJWA 4B4WA 3FNFA 5KVVA 2WWRA 3U4HA 3C85A 2VYNA 2IZ0A 2G0TA 1E7MA 3PJGA 5EQDA 2NQTA 2E49A 4NMHA 4ZICA 2A94A 2YV2A 3A06A 3AUTA 5L4LA 5I7SA 1ORRA 1N5DA 2YQ4A 5A06A 3JQAB 1OZAA 1EVZA 1K0UA 1GYPA 4CUZA 2Y66A 4IDBA 2E37A 4YT5A 3W4KA 3DZFA 2C7GA 4ESOA 4M86A 1LNQA 1XDWA 1DO8A 4XWYA 2ZATA 2VWHA 2JFGA 4CLXA 4DQVA 1Q7CA 1H9BA 3CMCO 1RM3A 2UYYA 4Y6PA 1P33A 1LEHA 1PJ2A 2GO1A 1X13A 5K9ZA 3L77A 3F6YA 3GN2A 4PZDA 1QLHA 1QP8A 4CPDA 3EHEA 4DIBA 1LU9A 1YBVA 4BO6A 4UUOA 1Z74A 1JLLA 3CE6A 4PG8A 1KC3A 2IEDA 3RUDA 1U7HA 4ALMA 4DYVA 4O5OA 1EDZA 5IXSA 2BKAA 3WLEA 4YACA 3KTDA 5ES3A 1K6IA 4TRMA 4OXYA 1YONA 2C82A 2H5LA 4FS3A 4L4XA 4Y67A 4FCCA 1VE9A 2NTJA 3G1UA 1PJSA 4RPGA 2C2XA 7ADHA 4HXYA 3E48A 3S8MA 3IQDB 3JYPA 3UOGA 4XYEA 4FN4A 1TT5A 4P8RA 5BNIA 3HFGA 4FD3A 3PLNA 3OECA 2W2LA 5TF4A 3ULKA 4E4YA 2CD9A 2Q99A 1VPDA 1CIVA 1MXFA 3D5QA 2AG8A 1W6UA 4W6ZA 5EQFA 2WYVA 2ZTVA 3CH6A 1GQ2A 4YDRA 2DUUA 1IPEA 3WWYA 3ZZNA 3WGHA 2YFHA 2ZQZA 5TS3A 1FDUA 4KWHA 1C0KA 4BNXA 5IDWA 4H15A 4D3DA 1PQPA 4BNWA 4D46A 4PCVA 4IZHA 2NM0A 1PGPA 3DONA 4PLHA 1BXGB 2HLPA 3I4FA 1HTBA 4UAGA 1JAXA 1XQ1A 4NFHA 2E48A 3RBVA 1M67A 2AHRA 3SXPA 2J3IA 2H9IA 3QVSA 4XRRA 2B36A 3C1TA 3S1LA 4HWKA 5KVSA 3FR7A 2I67A 4A10A 2DQ4A 2GN6A 4FOOA 4WKGA 4J43A 2JCXA 4ND2A 1SBYA 1ZFNA 4BNHA 5DBIA 3AI3A 3ENKA 3INGA 2O3UA 2V6BA 3ZWXA 3IJPA 3PHJA 2PA3A 4J7CA 1ZVMA 3Q1LA 4TKMA 1HSZA 4K9DA 3H9QA 4O6VA 4RQTA 2V65A 2D8AA 3L6OO 1ZXBA 2BFPA 1WNTA 3LSYA 3NT4A 1ZMOA 4HBGA 4J16A 3V5NA 1I32A 2C2YA 4BIIA 2YZ7A 1ONNA 1C1XB 4HX5A 4BNZA 4CM9D 3F47A 4Z6KA 3DC2A 1LLCA 3LF2A 1DXYA 3WNVA 2ET6A 1P45A 4CL3A 4BKPA 2FZWA 1NPYA 2BMAA 3AI1A 1EUZA 4MVJP 2Q50A 4Q39A 4BKUA 4TKLA 1WLYA 4CMJA 4DMLA 4E2WA 2VHWA 5AXCA 4BNVA 1P9LA 3K92A 3LC2O 3WWZA 2AQHA 3JQCA 3CMMA 4L8VA 4ITUA 3CSDA 4NR0A 3ABIA 4A2CA 3EZLA 1VLLA 3OA2A 4LRTB 4OL9A 3RUHA 5G4KB 3MOIA 5JFOA 2J3KA 2RHRA 1KERA 3WR5A 4BNNA 2OL4A 4DL9A 4R1SA 1N1GA 1LLDA 1PS9A 3DAGA 1NBOA 1TB4A 3MJEA 4NHEA 4S1VA 2GPTA 3GZ4A 4HUJA 4RF5A 4XA8A 3WMXA 2ZCUA 4EUFA 5L7WA 4G65A 2HKIA 3FNGA 3H5RA 5FF9A 2CF6A 3ZU5A 2YQ5A 1EVYA 3H6KA 4NNJA 3Q9NA 4YJHA 4LMRA 1ISMA 3GN1A 4IBOA 5BSFA 5L40A 3MJ4A 4E12A 5JY6A 2C54A 4FFPA 2A35A 2W2LD 1B2LA 1Z82A 2OO5A 5CDSA 3TZ6A 1YQXA 3MJVA 1PEDA 2TMGA 4OMUA 3C3XA 3C1AA 3MTJA 4GI2A 4RDIA 5HRUA 3EC7A 3IP1A 5JE8A 4Y6RA 1O9BA 4ND1A 4Z9FA 1L7EA 1WXDA 2UUOA 5KWEA 4GX2A 1LC3A 4DREA 3I52A 3T7EA 5HM8A 2NU7A 1R0KA 1AHIA 4MVJE 2V6GA 3EW7A 2P5YA 2WSBA 4O1MA 3DTYA 4EZBA 3M2TA 4YT4A 3E8XA 4UUMA 3PFFA 5CDYA 1PS8A 1WAMA 3O03A 1XA0A 4PVDA 2QRLA 4BO5A 1E7RA 5IXYA 2NUAA 1NHWA 2FPPA 1NM5A 3CZMA 3INRA 4ALJA 3WJ7A 5A05A 4CM5A 3GC6A 3K6JA 3NTRA 4I5EA 3KO8A 2VZ9A 2FZEA 4WOJA 4WUVA 2I3AA 2JFFA 1U5CA 4BB5A 2AEJA 3NGXA 3GFGA 1I2CA 3VC7A 2ZYDA 3SEFA 1FDWA 3VKVA 4CJXA 1U5AA 1YVEI 3DMTC 1E3WB 2ZK7A 4IMRA 4YRDA 5TQVA 3I5MA 4U0KA 1ZKMA 3GNTA 3IIEA 3OEYA 4BV8A 1RJWA 5CEEA 1Y9AA 3WBBA 5JS6A 5ER9A 3OQ6A 1LTHR 1QYWA 5CHEA 4KZPA 4UVGA 1RM5A 1ENYA 2P9EA 4XJTA 4E31A 5EMHA 3PDJA 4BNFA 4CLRA 1FF9A 3JTMA 3U5TA 4LW8A 4UVDA 3PQDA 3MTGA 1ML3A 4NBUA 1Z7BA 2NADA 1DIAA 3B1KA 1ISGA 4W99A 1PIWA 4CQLB 4DBVO 4L4SA 2B5WA 1DIGA 1WZIA 1HLPA 2AXQA 2HMTA 4RF2A 3CIFA 3RC7A 4ZGWA 1TXGA 1X1EA 5C7LO 1E1NA 2NTNA 1OC2A 5IN4A 1O0SA 3RFVA 1J6UA 3OJLA 3K30A 4BKQA 2BGMA 4K6CA 1ZW1A 3E9NA 4PZCA 1PZEA 3E6AA 3S2EA 4CMHA 1B16A 3AY3A 1E6EA 1WPQA 2JKVA 5LDHA 1XU7A 3TSCA 3OFSA 1MUUA 1ZK3A 1DHRA 2GF2A 2VOJA 1P1FA 4R4JA 1YXMA 2Y99A 3WYEA 2IEBA 1BGVA 1AUPA 2A92A 5DULA 3CEAA 5HWSA 1E3JA 5TJHA 3BTVA 1IE3A 1CERA 3E9QA 3PHIA 2X58A 4IIUA 1P1IA 1QSGA 3JQFC 1MP0A 4PLYA 2WD7A 3V1YA 4PG7A 3RQSA 2C5AA 3TFOA 1I10A 2QX7A 2GSDA 1FMCA 4ALKA 2XF8A 4PG6A 1NHGA 2PY6A 1I3MA 5IZCC 4ND5A 1IHXA 1FDSA 2NU6A 3UCXA 1NFFA 3DOCA 2OHXA 1WZEA 3PGJA 4RCVA 4D45A 2WE8A 4Q3EA 4YRBA 3ADOA 2SCUA 3GRKA 3DBRB 4RVHA 3ST7A 2AEFA 4E6PA 2QYSA 1BDBA 1U4SA 5L4SA 1ZSVA 3KOUA 4TSKA 2I9PA 3KV3O 4HADA 3HUDA 2QRJA 5JLAA 4CL8A 3C1OA 1UAYA 3ZWAA 4EUHA 3F5SA 4DXHA 3GEMA 2HCTA 2FSVA 4MKXA 3PIIA 2POQX 3GZNA 1E1KA 2Q46A 4BGEA 3WMWA 1MB4A 5CFZA 1HXHA 3RUAA 3TJRA 1LX6A 1DRUA 5THKA 4GSKA 4JBGA 1KC1A 4E5PA 4XRGA 4QFDA 4ALIA 1YB1A 4EW6A 4DBZA 5EPOA 4II2A 1X14A 5IG2A 4QTZA 4WJZA 3E1KA 3TOXA 3BMOB 3L6EA 1ONOA 1VJ1A 4NJOA 4IQ8A 3LC7O 1D7OA 4RPLA 3RC9A 4YPOA 3DBVO 5KCZA 4Z0PA 5HA5A 3BTSA 4U6SA 2VUSA 4EJMA 4BQRA 4CMIB 3HN2A 1EK6A 3UF0A 5FFFA 2EJVA 2W8ZA 1E3IA 4D41A 4Q3DA 3C8MA 4WCDA 1YJQA 2O48X 2X9NA 3ZHYA 3PJDA 1DRWA 4DPMA 4EJ6A 5ICSA 4P4NA 5I8WA 1PJ3A 3GGGA 4J0EA 1NVGA 4PRLA 3W8FA 4J3FA 1GUYA 1XKQA 3O26A 3TL2A 1ADGA 5A9SA 1ZMTA 1J4AA 1K6JA 3D5TA 3H3JA 4IGEA 4NBWA 1TVEA 4KDEA 5JO0A 5HS6A 1ISFA 1YDEA 2B83A 2EEZA 3COSA 5TC4A 1B15A 2B4TO 3MZ0A 3FNEA 1VL6A 4S3MA 2CDAA 4WNIA 4ZQBA 3RFXA 5DBFA 3L6DA 3JV7A 3VPGA 5C3MA 2EP7A 4KTVE 5I9MA 2CY0A 4YJHB 4KMSA 5I8ZA 3MJSA 3QWIA 3UFXA 2UAGA 3D7LA 2VN8A 4LSMA 2CVOA 1SB9A 5EINA 4CV0A 3M6IA 5F1KA 2RH4A 1AHHA 4W7HA 5DOZA 4EEZA 3RJ5A 1U1IA 3I6QA 3PZRA 1K89A 5LCXA 3IL2A 1PX0A 1GADO 5FI3A 3WG9A 4IDCA 3WTCA 4IDAA 3NJ8A 4GMGA 4BMSA 1P1HA 4JK3A 4XQCA 2J5RA 1T4DA 3WNQA 1LBEA 1P3DA 1V8BA 2O3SA 4OXKA 3UCEA 5A02A 1LI4A 4E5MA 2B37A 3SJUA 3WICA 4IM7A 1I3NA 1JAYA 2DKNA 2GD1O 1GEGA 1H6DA 1WP4A 2RH8A 3KB6A 1P0FA 1RM0A 2GRAA 2EWMA 3K31A 4J9VA 3MWEB 4KUHA 4KQXA 1U3WA 4HP8A 4RF3A 5EIOA 1XELA 3BMNB 1HYGA 1HDYA 4W4TA 4BNYA 2Q2VA 3UICA 5B4TA 3HDJA 1GQQA 2EXXA 3H2SA 2EHDA 4DPLA 1OI7A 1C1DB 1VL8A 3UXYA 3UW3A 1NVMB 1PJQA 1YJ8A 2YFQA 4IJKA 4D44A 3Q11A 3VZSA 5L4NA 3OQ1A 3RAJA 2GZ1A 4Q3NA 1W0CA 1LSOA 3K8ZA 5AXDA 1G0OA 1BVRA 3B70A 3TF5A 4MVJF 4BO9A 3ZGYA 2OORA 4W7IA 1UP4A 1SEVA 5HBRA 3EDMA 1BMDA 1NQAO 3WSWA 2B5VA 3DAPA 3KEQA 2PR2A 4ID9A 2YHIB 1T4BA 3D1LA 3VPHA 4CLDA 3T7CA 4M87A 4B8WA 1UUFA 3AUAA 4XB1A 1BDMA 2O7QA 3H9GA 4KP7A 3DAFA 5DT9A 1YB5A 4J90A 1EK5A 1WDLA 2JD2A 3D3WA 2FRDA 1JWAB 4NH4A 2HU2A 2PGLA 4LVCA 4XGNA 1ZSNA 5EL0A 4N5LA 1L1FA 3ZCXA 3PQEA 3GFBA 4WEOA 1LLUA 1IB6A 2Q49A 2X6TA 3HHPA 4ND3A 1UAGA 3MJTA 2B4QA 4J9UE 2VHXA 5DBGA 1ZXLA 3WBFA 2WM3A 5A1TA 2JAPA 3ZNPA 4HNGA 1AXGA 4MP3A 3JD4A 2WD8A 9LDTA 4OHUA 3SBOA 4OM8A 3UN1A 2O3TA 1D1SA 3QE3A 4GAEA 1N1EA 4YBZA 1YL7A 3WGOA 2XOXA 4IINA 3RJ9A 4JJGA 4WLNA 4E30A 1JVSA 1X7GA 3KXDA 5B12A 2O50A 2BFMA 1X7DA 4XZ3A 4YVFA 4DLLA 4F3YA 2BFOA 2ZQYA 1A4UA 2DBVO 5L7YA 5G2OA 1J5PA 3UAGA 3BA1A 5A9SB 3F4BA 1HETA 5LDGA 3ONDA 4E2ZA 3ZU2A 4KUGA 3GY0A 2NLOA 3RUIA 5ICMA 4WOKA 4IJUA 5IZCA 1MG5A 1VM6A 2BRUA 4JJFA 1NQTA 2QYTA 3GG9A 4XCVA 3UGKA 1UDAA 5ILGA 3A28A 2PKRA 4BO3A 3O8QA 1YBAA 1QXSA 1Q7BA 1JA9A 1HEUA 4D7AA 3GG2A 3QSGA 5G4KA 2VYVA 3OF2A 2EKQA 3DDNA 1N8KA 1NQOA 1WDMA 1Y8QA 1I24A 4QT0A 4IDGA 3FTNA 1ZK0A 4U7WA 3NUGA 2DAPA 4IDFA 4FFOA 2AMFA 2NSDA 4BGIA 5ITVA 3GNQA 3ZWNA 3ITKA 4L75A 4JCOA 2JD1A 1XQ6A 3WOHA 2Z1NA 1A5ZA 2PH5A 3G3EA 1OFGA 2DTEA 2X9VA 3JQ6A 5L9AA 4HFJA 4CMAA 3GDGA 1UXIA 3S55A 1ADCA 3FBGA 2B4RO 4R5HA 3WIEA 4GVXA 4BUCA 1I3KA 1I01A 3TZKA 5CG1A 2VRCD 5I7EA 4WECA 4BL5A 1HE3A 3I3OA 1A4IA
chains in the Genus database with same CATH superfamily
3NHLA 1SHJA 2GYWA 3GDFA 2QE7D 3F6BX 2PMEA 4DARA 2HZBA 4HZUA 3R6LA 1OLSA 5KKCA 4XPZA 1P4GA 4L4ZA 1XZNA 3H18A 3N87A 5KQLA 1D4ZA 2O59A 2OV6A 1R4MB 4D3FA 1PU2A 1SUIA 2AG6A 3RYIB 1MVLA 5KJ6A 4WEQA 4EG3A 2BFBB 3R5XA 4OH1A 1KO7A 2XUPA 3ED1A 5DOVA 2APJA 2QZJA 1QK4A 2HX1A 1RXEA 3NHWA 4GWGA 4BTVA 3QNMA 2IH5A 2G07A 3LO5A 3FXAA 3ZHCA 3FSEA 4MAFA 3DZ8A 1PW7A 2OV4A 4F3RA 3STXA 1LRJA 2A0XA 3QVOA 1NUHA 1DARA 3WRXA 4LRQA 1ZX1A 4CZ2A 4CQMD 1SHLA 2FWMX 4IDQA 1W4BA 1P8JA 1T5SA 2CGEA 4FXPA 1R4NA 2ZXUA 1H2XA 1IY0A 4KI7A 2NO4A 3KYDB 4DY4A 4XVQA 1DV2A 1ZN2A 1MGOA 2QUHA 4NK5A 5FOUA 4YT8A 3ZHQA 3HKEA 1NQUA 4GLFA 1KMIY 2VOEA 2IHJA 5KNDH 1XRMA 4D9NA 5D6OA 2HPVA 1BRTA 3KZCA 2JLXA 5ES4B 3HDTA 1YH3A 2OXFA 3H1PA 3OJOA 4X61A 1SAYA 1GN9A 2OY0A 1U8EA 1VGVA 4KMOA 1KRWA 1F8FA 3ITNA 3H19A 4MR8B 2B8EA 1SWVA 4ZYVA 1Y33E 1VYUA 2GARA 3CINA 3TRKA 1I8TA 5GM1A 1L4NA 1Z34A 1VSVA 1W94A 3SSAA 2DTXA 4K26A 4G4SO 4HYTA 2P4QA 2O2HA 2IYNA 3BK1A 4NP6A 3IUPA 5JSUA 3QE2A 1YOVB 2GTHA 2Z2KA 1H1LB 2RH9B 5AW1A 2PZGA 5EZQA 1EM8A 3M9LA 4ZU1X 1CUUA 1O77A 2CFTA 2IOYA 1QKJA 1N4AA 4O2LA 1W1UA 2KJQA 1P19A 3EDOA 1YZQA 3N58A 4QGHA 1J0DA 2ODBA 2ZBPA 5JMPA 4YRGA 2HTFA 2J7PD 4QXOA 4M0LA 2UYCA 2IVZA 4EI2A 1Y1LA 2A1TR 3FGZA 4M8IA 4R3UC 1MX3A 1XRLA 3N0RA 1Z25A 1Q6YA 1ODIA 2H6EA 4MUNA 3VOTA 5E6SA 3DTTA 1K0FA 2W22A 4GI5A 3ETLA 3CSUA 1BEUB 4M1WA 1TU0A 3HU5A 2QT9A 1C9NA 1R0SA 4ZJUA 1WTAA 2VTVA 1IY9A 3W5HA 3R6WA 3OU6A 3T6KA 3ZGVA 5CJJA 1CR1A 4LVOA 1M1YE 3M70A 5B1HA 3QX8A 3W9UA 1PSWA 3E9ZA 2WF9A 3P71T 4GKBA 1IK6A 3C7CB 4RSRA 3DCIA 4H18A 3BWMA 2OFXA 2Y4NA 2C2KA 4G0ZA 1EFVA 4HEQA 1YQUA 3WB9A 3LLUA 1WA5A 2P77A 3GA7A 2ERXA 2GTPA 3R76A 1T6XA 3SSMA 4N9WA 2GI4A 4YRIA 3OICA 1G291 2BR4A 2WWXA 3RFCA 4YPVA 4TTIA 3FOCA 3ANSA 1MPXA 4QVGA 3G1WA 5A5FA 1KZ9A 4DR5B 2UZIR 3ZXIA 2NYRA 1ZU4A 2YOGA 3A9SA 1ZJ5A 3GV0A 4LIPD 3OPMA 1IIBA 1U0GA 1G1AA 1SKQA 2QD2A 3C6QA 3KZXA 4ZYUA 1R0LA 5K8VA 1X77A 1QGYA 5G4LA 4F92B 5L45A 5IJWA 4IDNA 1UXKA 3EASA 1AGNA 1ESDA 3DE6X 3CRNA 3VAYA 3NWBA 4A73A 5HXAA 2NUTB 4IIXA 4B80A 3L7BA 3N39C 3WS7A 3WQQA 2OCLA 3T5AA 2BH9A 1FU4A 2M9MA 3O3NB 3ORSA 5IF3A 1Q16A 1EG7A 2WKSA 4MCHA 4CKCA 3VYSB 1IXRC 4DW8A 3AR4A 5JCJD 1D3AA 2W98A 3Q0EA 4GWLA 2G8NA 1AMUA 4YRMA 1PZFA 1BZYA 1NVFA 1E8MA 3LG2A 5KJCA 2FMHA 4HGPA 4I1IA 3AFIA 2W2TA 2VPZA 4ER7A 2XTJA 1KI2A 1ZC3A 3L9XA 3HG7A 4GQBA 1MOPA 5FPYA 3OPYI 5TV2A 5KTYA 4RJIA 2XTAA 5KNBD 5I47A 5HQ3A 1DBRA 4WXRA 1A5SB 1RWMA 3V8PA 3IEMA 1SQ5A 2J5BA 1KOFA 1XQXA 3CNHA 1DAIA 1P1JA 3I9KA 5H3HA 5AW0A 1QUEA 2AC4A 4C78A 4PANA 4C07A 1DC3A 5DNAA 3FN4A 4ZRMA 3RDPA 3B9RA 4JB0A 2KSQA 2ZUFA 1YJAA 3I0MA 4W8HA 4OLAA 3KKPA 3HM2A 3KM0A 4Z53A 4MKRA 2QUBA 4M88A 4QQ8A 1Y8QB 3MOSA 5EVCA 3IMKA 4ZI5A 1KO5A 1VKOA 5EE5B 1NMZA 3TBKA 3THWB 4Z8YA 3I5YA 5CD1A 3CQ9A 2BGIA 2FE1A 2IIQA 2X23A 4DKJA 2PT5A 2C59A 4MTLA 4DV7B 2BZSA 5FUQA 1MQ8B 1NR5A 2HF9A 1BG6A 3KEOA 1Y3FE 4CV1A 4I9UA 3G6KA 1Z8HA 3NBUA 1HOXA 1YNSA 3EXFA 3PV0A 3IQGX 5IM5A 1A9ZA 1E2QA 1F06A 1L8AA 1PNTA 2I4TA 3CKLA 2GKGA 1X7YA 3KR9A 3LUFA 4IDDA 4Q05A 4BJ6A 5J4HA 3IJ5A 3ZUGA 3R4CA 4E5KA 1RQRA 1ADBA 4Z4IA 3D7RA 1PZMA 1Y3CE 1WCV1 2X0IA 1J8VA 1PT7A 1QHXA 3A6DA 5DWVA 4LE1A 5FL3A 3TDKA 5IH7A 2F3RA 5K0EA 5F7XA 3QX7A 3O8QB 1E9RA 1KK0A 1RJ9B 1J00A 3DMPA 4QUAA 2HV9A 1I7NA 1Z2PX 2QRQA 3ODPA 4G0WA 3K9LA 3RC3A 1ZGGA 1DKMA 4RFSA 3V8MA 1JNXX 2P78A 3NP9A 2J9YB 4A27A 3KXPA 2COKA 4BXOB 1YBMA 4D43A 3N1UA 4Q9NA 2DHQA 1Q0UA 1V5WA 3AWDA 2PLAA 1C3LA 5KYNA 1B0ZA 3G59A 4FFBA 2R6JA 3U4CA 2P3OA 3TTYA 2JCGA 3G2NA 4URHA 1IK4A 3QENA 1JT9A 2O19A 3EAGA 5F7ZA 2HU8A 3LA6A 4N0MA 3LCRA 4ZAXA 2I87A 2G82A 4AKHA 1CJCA 4FYJA 3IV9A 4QSHA 4EB3A 3OO1A 3GU3A 2HPZA 4BMZA 1N6OA 3ZDAA 1N7JA 2Q5OA 1ABEA 2GETA 2JGMA 4TZ6A 1NVKA 4PNPA 2OHGA 2JFNA 5DYTA 3K53A 3MCTA 2B1GA 2YIDA 5JDIA 3PRJA 3I9OA 4KQHA 1JKJA 2P8SA 3E2MA 4B09A 4IIVA 1U0SY 3PHGA 5KDLA 4DCUA 1JSRA 4UBJA 4E5SA 4E32A 5C4IA 3FCCA 3SD7A 4IUYA 4UBNA 4AP5A 3T7DA 1YQEA 1MDBA 3DYVA 4M22A 3TLEA 4Q4DA 1W2WB 2O8NA 2OBLA 1X8JA 1BXGA 3TM4A 1KO1A 2DXIA 4JMPA 5FTJA 2C2BA 3AXSA 1I7LA 2HNAA 2XRMA 1HRKA 1JXQA 1HI9A 3R5KA 3Q3EA 2O07A 2IK8A 3QY0A 4OQ4A 3PD7A 1USWA 2H0QA 3CPHA 3UMVA 4HLUA 4ZAYA 1VBFA 3KUDA 1DKQA 3OEED 1X0XA 4ZI7F 4QFCA 4V0RA 2EHJA 2QJFA 3QWHA 4KB5A 5DLPA 5EZYB 2O05A 4C0BA 4PNHA 1PNRA 3DBIA 3ICVA 4N7RA 1YHYA 3FDZB 4M83A 2VVTA 3NUZA 3D6AA 3CUWA 2NZVG 3IUBA 3WGTA 4AY6A 1LQUA 4K5QA 3LPDA 1JJIA 5BSEA 2I5PO 4OI1A 2G1PA 4D8YA 3RTGA 1D04A 4O4IB 3DT6A 3C98A 5BSRA 1B8OA 2GPWA 1LPMA 2QTGA 1MIOA 3OD1A 4JITA 3BSYA 4RY0A 4ZOQI 3VR6H 2PKCA 4A0QA 1J21A 1WW3A 1WP9A 1ZEMA 4WLEA 1JEYA 5MGBA 1ID1A 2JFYA 3EX7C 2X7HA 8AT1A 5FRDA 1Q3HA 4P0TA 3V55A 3D2CA 3VSBA 1HYQA 3P9CA 1AD2A 2Z2ZA 1WHTA 1A5TA 3CNQS 1J8YF 1G20A 3HJRA 3KFLA 3FZEA 2CNKA 2DGDA 2QSZA 4FCVA 1N8SA 3W9YA 5EHXA 2NMVA 2PS3A 4S12A 1NA5A 1WQ1R 1E2NA 1EFDN 1FSGA 3IP5A 1PTJA 4NG5A 3T61A 1XKTA 1XMOB 1F7VA 3PQ3A 4X20B 4JB2A 3PC3A 3A2KA 2VSFA 1R5BA 4X1IB 5CB0A 4K1LA 2G4VA 4K0RA 3TR6A 4G5RA 4BNMA 4F4DA 2NV0A 2GXAA 1JMVA 1WUKS 1YMVA 2LCFA 1EP1B 1HE8B 4KPGA 1GUBA 4X00A 1G38A 4RHFA 2XZDA 3OLCX 2FFAA 2HQSA 3EF0A 1UMBA 3F0TA 4DXAA 1GZUA 1Z35A 2BT4A 2DPYA 4EG5A 3HXTA 1RM4A 3BC1A 1ZRHA 5GMOA 1B43A 4G8BA 4U9HS 4BX2A 5JSZA 3A6FA 3B7WA 4DLNA 3T9EA 1L7AA 2UKDA 5ARBA 5BY2A 2ID4A 4DJJA 4U6NA 1FXWA 5LQDA 1VLJA 1JU9A 3EWSA 4CCYB 5HDBB 3Q3VA 4BMOB 5JANA 2B9VA 2O4CA 4B85A 3R7DA 4PC6A 1AV6A 5FO1A 2QU8A 3SU8A 1D6MA 4AUMA 4F93B 1PUXA 1RYZA 1ZVJA 1JW9B 4K88A 1QTQA 4KI0A 1OFUX 4NCHA 2OGTA 4NZ9A 1GT91 3TAXA 2WAXA 3W77A 4BV9A 1WF6A 4HG2A 2EBWA 4P31A 3KEGA 5TX7A 4DTCA 1KY5A 2BI8A 4HH4A 1XO1A 4M1SA 3DGEC 2JATA 4D8UA 2QAJA 1ENOA 2WHPB 1KEVA 4O2BA 1E2EA 3ZH9B 4AN4A 5C80A 4CEJA 1A88A 3QKSB 1Q7RA 4H59A 4JJ6A 4B44A 1J2EA 2H85A 4O1HA 5H9VA 4B87A 3C6ZA 2VRBA 2XVYA 4RHYA 4E6EA 2V7TA 1GTRA 1T25A 1FRQA 2WFAA 2ZBDA 4MP8A 1L1FA 4B7UA 3L4BC 5C81A 4IICA 4RF4A 4GI1A 1ZR4A 4RQAA 3NRBA 1XAJA 3FPLA 4FMDF 3NBZC 4NK4A 2GRJA 2VNSA 3NKFA 4OOEA 2OUKA 2R6FA 1REQB 5DTJA 2QUJA 4ZOLA 3V4OA 3FJOA 4YRAA 2RKWA 4IXNA 3HFJA 2ZW9A 2VWPA 3K5HA 1TTTA 2WUFA 1SKUA 3FPAA 1CYDA 2W2XA 3H5LA 3U1TA 5KU7A 2OZEA 4HDSB 3OT5A 4Y2PA 1FP6A 4L5AA 2A9PA 2OG1A 2ECFA 2VYFA 4LQDA 4MW4A 1W34A 1U7WA 2C4VA 1NRJB 1P62B 2WSSD 3KAQA 3OZFA 5FPQA 1L9KA 3W6NA 3O4VA 1G59A 2C5FA 3JASB 4BQPA 3NKLA 4JLUA 4JR1A 1KQGA 2IRWA 4JYBA 2ZZMA 5JTUA 5L95A 1KEEA 1A82A 1JHUA 2WIFA 3C5EA 3ML1A 4FDLA 3VC3A 4DR3B 2F4VB 2QWXA 4GI3A 4IS2A 4R2HA 1N25A 1QIEA 3CX4A 1N6LA 4LTMA 2ON6A 3RVNA 1G3UA 5LNK1 2FA9A 3DHYA 4C0QC 3AI2A 1Y6GA 2IXBA 4RFVA 4LJ8A 4BUJA 2D0DA 3JU3A 1P0IA 1CUWA 2DCMA 2WWVD 1Y7TA 1OAOC 2PEYA 2PTGA 3HYSA 1EXMA 4TWBA 5FR1A 3PSAA 1RC8A 1BQ4A 4ER0A 2AQKA 2OHFA 1KRXA 3TZCA 2JVKA 3OT1A 4L4YA 4LOJA 3TCKA 2QMUA 3PI6A 2IPNA 4HQFA 3UJ6A 4C22A 5CITA 1EX7A 2GBIA 4V1CB 2HJSA 2BVNA 3P2IA 4D0GA 1N2EA 3CLUD 4I8IA 4QQKA 2GDZA 2C4MA 4QDXA 3VR5D 3VR4H 1C3EA 2HRRA 3TZLA 3DEIA 2HHLA 3OTQA 2IYLD 4C5AA 4RVNA 2C2MA 1Z83A 4II3A 3BG5A 1NQWA 3HKBA 2QVZX 2IXEA 2C9ZA 3EXEA 2XA2A 1R15A 4G4JA 3LBAA 1KDZA 3RVRA 4D3YA 3EIWA 3MJRA 4RA9B 3MUFA 2QN3A 2W6OA 3IEPA 1Y3DE 1NBMD 3B3QA 3ONEA 5BQOA 2Q5JA 4CQMB 5C46F 1UODA 4ZT2A 1K8QA 3OMLA 4YQZA 1NVTA 2RKBA 2RB4A 3FYUA 4BB6A 3TG2A 1V5FA 1Q77A 3IEIA 5B3KA 1CP2A 1IVYA 1NBME 3IDAA 5HTKA 5IPFA 1UMDB 2CKDA 2QR2A 3W6OA 3ZV6A 2NZUG 2IHYA 3GQBA 2QQ0A 3V1NA 4H0FA 4ZHQF 2IS6A 1Y9EA 3CUVA 2Y05A 1IQPA 4KIJA 4RTQA 2PLWA 2VTKA 4NABA 4C0HA 5LQNA 2H5EA 5DLEA 1TEZA 2GZSA 1ZRNA 1QDLB 2WIAA 5ALYA 4FZ3A 1EUDA 3ZEIA 1E0AA 1QO9A 1XU9A 3FFTA 4QDUA 1Z0FA 2WILA 3CUTA 3HP7A 3A2LA 3I53A 2R00A 2L69A 4RTNA 4KQGA 4R84A 3TRDA 2BHLA 2GN2A 3QK7A 2VZ0A 3DG9A 5KPDA 3RYCB 4KXNA 3QOYA 3U19A 2FEWB 3REGA 3VPFA 1ARZA 1G2OA 2HA4A 1CBUA 1G8PA 3TSWA 3SP1A 3CRW1 1L5KA 5HCUA 1RZRD 5DM70 1E9FA 2VPYA 4QQFA 4ZWNA 2OCAA 2PT7A 2KLBA 1GNLA 3K9HA 5CDHA 3HYNA 1R1DA 2QN6A 1CIPA 1U8FO 3G7SA 2D59A 3LDUA 4P3PA 2UUPA 4UCQA 1NZJA 2N42A 2ZJ4A 3FI0A 4R2IA 1TKBA 3QIAA 1JIJA 1SN7A 3TL6A 2ZAGA 5A62A 4I5IA 2P0AA 3QA3E 5JWHA 2V3VA 2XQGA 4IG9A 4UUNA 1O96A 1HNZB 4GOLD 2YMLA 3A6GA 4ZKEA 1VYHA 2O6HA 5TMEA 1PT5A 1P29A 1ZI8A 4WBSA 1ORVA 3UJ8A 4CIBA 2PSHA 4LSWA 4ZVMA 1WKVA 1XDGA 1XZJA 3GR6A 4I4TA 4K6GA 4C0XA 1GGHA 2VXYA 3MCWA 4QA9A 4RIIA 2QTVA 4FYHA 1W93A 2R7KA 1R0XA 2GN0A 1D2MA 4DLUA 4OYRA 2FG5A 2O2SA 1OB5A 4HTFA 2PGDA 2CHGA 1E64A 3FWKA 3RF6A 1M0WA 3MPUA 4FYMA 2EYQA 2INGX 2CJFA 4C4XA 1Y4AE 3UK7A 3Q98A 4G0MA 4V24A 3GJQA 5HZHA 4M1YA 5JSZB 3FCEA 1XNQB 5AIAA 3EXHC 3KTFA 1MA3A 3B7PA 2XYQA 4EKIA 2VJMB 3O2QB 4WACA 2B8JA 4BO4A 5EZ5A 3R7AA 1Y42X 1KAMA 2ZRBA 1N6KA 2ZIGA 4WESB 5DGXA 3TR0A 5LZ2A 3ABSB 5CCXA 4ABYA 1XB2A 2AOVA 2ZJ3A 1VHDA 2UDPA 4M0KA 3TH5A 4ZVKA 5HHTA 3EWIA 1T36A 5L3SA 1P0CA 4N18A 3DZCA 3JWPA 3PWSA 4YWJA 4UE2A 5CPBA 5K0CA 1JF8A 1VPEA 4ARZA 1FFBA 1GT6A 2HEIA 1DC8A 3H87A 2AFHE 2ID9A 1Q0PA 2RHOA 3IB3A 2Y93A 5J63A 1XHLA 3V4SA 5H9WA 2FN8A 4KE9A 4NJEA 2PSJA 4PGFA 4PLTA 4WN9B 2NQ8A 4D9FA 3F73A 4BZWA 3ZE1B 4WD3A 3T7KA 2QIOA 4LN1A 4TT3D 2QPOA 3K1ZA 2VP2A 1O08A 3U44B 4NFSA 3R1IA 1ZBQA 4FMBB 3SIRA 5FH9A 1NM5C 2YWRA 4DGSA 3D4LA 2GAIA 1BFUA 4WH0A 1XTZA 2ADOA 4ITVA 4JOBA 1KL7A 5BMOA 3SHQA 4HS9A 1AXRA 5AUQA 2H00A 2C78A 4QELA 5LFAA 5K0BA 1AC5A 3CG0A 3LBNA 1Q0ZA 5SV2A 1PL6A 1UXHA 1SVMA 2WV7A 3NAMA 1E2DA 2VQSA 4MUFA 2P5SA 2A59A 3FYDA 3G8BA 3GVHA 3ESZA 3OFND 3RCBA 5C5DA 4YP0A 3TLMA 5JH7B 2IIVA 2ID7A 2ZGVA 3JWEA 4XDYA 3P0JA 3KJGA 4Q9HA 1YA6A 4ZYLA 3UWPA 4LWZA 2F1JA 1PWZA 3DTVB 1VB3A 2I4LA 1TD9A 1PWYE 4L74A 4N8EA 5EKXA 4QXAA 4FYPA 4I19A 1YQ9A 3L04A 5JPIA 4I55B 4E2YA 5SYNA 1P80A 3NWJA 4MUHA 3HJBA 4FDMA 4TKUA 3ZDEA 4CM3A 2I6TA 5BSVA 2P62A 4F1KA 4F72A 2Y0CA 5A2QA 1TAUA 5FBZA 1FZTA 1TMKA 3D8SA 1MJGM 1SOWA 1QC5B 2PUVA 3WL8A 1E20A 1DB3A 1EVEA 2BEUA 3HCBA 1B74A 3OX2A 4IX9A 2BEVB 1JQ5A 3E23A 5IJ9B 1D2HA 5FJIA 4LJ7A 5LQAA 1UBHS 2FAXA 1MC1A 2Q5FA 2QRUA 3ZN2A 4UOEA 5GPBA 4Z1OA 2XVMA 3KR2A 1IN4A 2YXBA 3T34A 1H2BA 5B6JA 3I2YX 4BQQA 1I6MA 3LHKA 3ADDA 1FFDA 2PVPA 3VA7A 4ZMBA 4Q7LA 4LYAA 4YAKA 3WLFA 1UJ6A 1UQRA 3MT9A 1I3OA 4IEFB 4RV9A 3BQNB 3GEHA 3B1JA 1GPWB 1RCFA 1PLLA 4JQCA 2DWCA 5G0VA 3UJ9A 4J2HA 4BO2A 2Z6QA 3L01A 1XYGA 2HXYA 1B6SA 4OGWA 3BEOA 3VR5H 1CLEA 1IOLA 2RGNC 3CY6A 5TEVA 5IX8A 1G3IA 1J5EB 1VKJA 1RRKA 4G41A 4H60A 1JFTA 4OLFA 2JDID 4RSHA 1EWVA 3O4RA 2X2PA 2XUKA 4JGGA 3RVJA 1ZM4A 4P2BA 2YV4A 2NAPA 4XIFA 2WIDA 5KNCH 3R3HA 1QG0A 3FSRA 3EVCA 4TMWA 3KWJA 5EG5A 4PX3A 4ER3A 1CVRA 3S2GA 1PJLA 2Q4TA 2BE7A 2JFOA 3HY4A 3HU2A 1T3HA 1GCIA 3QW4B 2H1IA 3QJYA 1VKNA 2PEZA 3ELUA 3A4YA 3PA8A 4Q0MA 4PN3A 2SKDA 4I6JA 5CXXA 1S2DA 4YRRA 2ODPA 2ZYAA 3IVRA 3PGLA 1C1HA 2VAXA 2OZLA 3IIMA 4WJLA 4LF9B 1M1YB 1CVLA 1KYVA 5HKKD 1QP4A 1OBFO 3L0SA 5F1OA 4HWGA 3ZPXA 3OURA 3QBVA 4NMLA 5B4UA 1RYEA 1YR9A 3OX4A 5DXFA 4KR6A 4MW9A 1IQUA 4PHFA 1ZGBA 3SMQA 3OIYA 1JXOA 1NDQA 5BQXA 3WQRA 1NBIA 4PO3X 3FTPA 1VRVA 3S7TA 3IA2A 2DZDA 4MO2A 2ONCA 2RBKA 3HWWA 4W6QA 3DQPA 4DWVA 1E79A 4FFMA 2RJOA 2VNAA 1LW6E 4CIYA 4HQKA 1E2IA 2J3HA 5DM0A 2O8BB 4HMQA 2J46A 4LOHA 3DVRX 3O8LA 4EYSA 4OB6A 3U61B 2Z9CA 4HSEA 2ZBRA 3NBAA 3T15A 1XIVA 2P5UA 4Q4HB 3UBMA 2V7UA 3PITA 4PE5B 1MG0A 2GD6A 1YB2A 1YVUA 4XI9A 3RM3A 3RSCA 1JHYA 1SXGA 1BTOA 4KG7A 4FHZA 2HDOA 4UM9B 4BU0A 4MGIR 1N2JA 3A7EA 1FFXA 2C4WA 2JGJA 3JATB 2JLZA 2Z58A 2I66A 5T57A 1NDHA 5ICEA 3BB4A 5EIXA 1RW4A 3GYGA 3JY6A 4R01A 3H84A 4QX6A 1WD7A 1X7YB 4R3WA 5JLJA 1Z2EA 2MMCA 3G5TA 4C6HA 1X9HA 1LD3A 1JEOA 1JLKA 2FSIA 1AMNA 2OHVA 1PDVA 4EFLA 1FDOA 4EUSA 3RJZA 2CVFA 3CFYA 4LZOA 5HKLA 2PKXA 4GWKA 3CRMA 5ALRA 4FGKA 5FOVA 1G21B 2YJ3A 2DFDA 3PSHA 7MDHA 4QYMA 1WNFA 4PFQA 2R47A 4IHJF 1UJ5A 5YASA 5FNVB 1EX6A 3NHBA 4HGZA 4QL3A 4KGVA 4UBLA 4WFQA 5LA6F 1NP6A 1WEKA 3OOSA 5DMHA 4JNKA 2PUHA 3AINA 3D6NB 3IUQA 3NYIA 4FIZA 4FXOA 5BYJA 1JH8A 5EESA 4QTYA 2LGJA 3BH7A 3FWNA 4MS1A 4DV6B 2P4EA 4K9PA 3GT4A 3BK2A 3ZE0B 3SAJA 4UBKA 3EUAA 1T24A 3N2ZB 2R2GA 2BM9A 3CF4A 4JVLA 4X1KB 5CT8A 4KR2A 1H2YA 4R51A 2GCEA 1XL1A 2P9YA 2VRCA 5JMTA 1OYOA 2G9RA 1QU3A 4CRWB 3I30X 2VWGA 3CLRC 3NT5A 2VJDA 3DDCA 3FOBA 3OJEA 4DCTA 1SCIA 1M6YA 2HK9A 3I2IA 3WHLA 4C43A 3H2IA 2VBGA 3EQZA 3AJEA 1V26A 3D2BA 3ZWCA 1VFNA 1XMQB 3DLBA 1XZBA 2ZJZA 2I4MA 1OLXA 1LF5A 1P75A 5AVVA 1RHJA 3MRSA 2NP7A 2AVNA 3TBFA 3ZI7A 4YJFB 1JDSA 1U6KA 3DT9A 3B2EA 3NOXA 2C00A 2ZSHA 4N5HX 5B58T 1II8A 3W3AD 4QO7A 2WR8A 1WV0A 3ZBUA 3C45A 1FVFA 4DMRA 4LC0A 3LQFA 1GZ4A 3RE1A 5A5DA 5SYAA 1L5HB 4JVNA 4DY6A 5D1HA 3DDUA 1SCAA 3OLZA 3R3ZA 4NOLA 1SVNA 1CPYA 3LBIA 3FM9A 3DF7A 3IDQA 1IXSB 4H1VA 4LXIA 4TLCA 4B4KA 1G66A 2ICAA 5ADHA 5LMNB 4C2AA 1ECGA 2FWJA 1JQJC 2JGNA 3Q7QA 2GEJA 5G0SA 1YZUA 5FYQA 2R5NA 1P2VA 2VQ3A 3GFPA 3LO8A 1UH5A 4YNBA 2QT1A 1A8PA 2WJIA 5C5EA 1M5RA 3JTEA 1BD4A 4GRIA 3SLGA 2I2BA 5K45A 1CDZA 3PL1A 4Q9AA 4V0SA 4ZGWA 3KLBA 4Y6LA 1SG9A 2XNKA 2AYZA 4N47A 5JROA 1WKCA 5C2JB 3UC5A 2AN4A 5FBRB 3S27A 1C81A 1Y3BE 2OXRA 2ODEA 3FD8A 3LWZA 5H4HA 5DP1A 4J1TA 1QIMA 3W9BA 4PAOA 5J23A 1M8FA 3NHUA 4X84A 5HK8A 5DWQA 2GBLA 5KBYA 3ZV4A 1V47A 4RZ3A 5EUQB 4ZZ2A 2PIAA 3IXLA 3AYXB 3OHSX 4KFCA 5LMZA 3LOUA 3D6HA 5KVQA 3UHJA 4OIFA 3U4AA 5I7RA 2I4RA 2VYCA 3W8DA 1FPMA 3ZTYA 1KQPA 5IWCA 1AE1A 2CN1A 3KZ1E 1R6DA 3A4TA 3F8TA 4V2IA 4DILA 1HDZA 1TX4B 4H7FA 1N77A 4UCWA 1U02A 1ZK4A 3TVTA 3INTA 4NAHA 3HBAA 4B17A 5BWLA 4RJJA 5K3FA 1A98A 2YZMA 5E6UA 1DAOA 1E92A 3TFQA 1FLVA 3JQFA 1N2ZA 5AH0A 4BVHA 3U4GA 2H1SA 4I9GA 4MVJG 3QYAA 4WZZA 1W85A 2W83A 2AJDA 2HCBA 4JI1B 1CS0B 4EVQA 4HAWA 2XGJA 3F7OA 1KJ8A 2Q4EA 5GVSA 3KQKA 3L8MA 2Z4RA 4DMCA 3EF3A 2C20A 4G1MB 4MYCA 3TSAA 3QTBA 1OTXA 2QRKA 4LX0A 5EIEA 1KR5A 2VSOA 4I4LA 3IE1A 1F2TB 4X41A 4LPKA 4BTEA 2VDOB 1H42A 4FYIA 4B4UA 1THMA 4P0QB 3C3AA 4BX3A 2ACEA 2DPGA 2G09A 2JI6A 3DOUA 4B4VA 5FOQA 4PNEA 2IS1A 1CV2A 3BILA 3GPDG 3FB4A 4B79A 3B53X 2Z8YM 4R1NA 3L4SO 4TYQA 4ENQA 3JYQA 4I08A 2NU9B 1PGOA 2XECA 5BURA 2HMWA 1EMDA 1M73E 1JKMA 2C07A 2IEZA 3O82A 3RSFA 4YT2A 1O89A 2QEQA 4YEDA 4HVTA 1YS1X 2DPXA 1ONSA 1EWRA 3AUSA 4RD6A 2AQIA 5FD8A 5EZSA 5H82A 2QU7A 2ZIFA 4EHIA 2PRJA 4IGIA 5CA0F 4MINA 4KN9S 3R9WA 2Q1WA 5ITZB 3GH3A 5JI2E 5JZSA 4O0MA 4AJLA 3HJHA 3JQQA 5HOQA 5JNLA 1OWMA 2H1VA 1MAWA 4JU9A 4INZA 2QGZA 3EUFA 5BSUA 3FB1A 2JCVA 5CG2A 3M5PA 4M1OA 1LDBA 1GKKA 2JARA 2HIHA 1G7CA 2CLIB 2XGSA 3MJCA 3OOJA 4D9GA 2GKOA 2QI9F 1VG9B 2MJLA 3H9BA 3OBIA 3BGVA 1V39A 5FIUA 3SR4A 5I45A 1Y1KE 4G9BA 4JGIA 4ZO6A 1HT1E 2I99A 3UPDA 2FPPB 1VMAA 5FNVA 4G4IA 1N92A 4KWTA 3H9UA 5ALSA 1ZN9A 4B32A 1E1QA 1PSDA 4P4TA 5K6RA 3JVEA 3TLGA 1GKYA 1QE3A 3X1YA 3MQ2A 2PPVA 1JEEA 1QFMA 1BXRB 1HKHA 2OB1A 3KSBC 4E14A 1Z5PA 2QUKA 4B3JA 5JT1A 4KRYA 4GDFA 1TO6A 1KS9A 4YHHB 2X1MA 3NI2A 3JWJA 1DT3A 3K9GA 3LUDA 2D4HA 4PQGA 2JLSA 4QUBA 3C8ZA 1U0FA 4RPKA 3RKRA 3TLCA 1UJCA 1RHQA 1B6RA 3D4OA 5COQA 1Y6ZA 3SBDA 4MLZA 3JWHA 1LJ8A 2JJ1A 1VOTA 2H08A 1FMFA 5KX5A 1LFAA 2P41A 3CU5A 3HA5A 4TYMA 2NO5A 2XE7A 5DHUA 3ZWDA 1U2DA 2OHIA 3FUWA 3I2GA 3MILA 4R41A 1ECJA 5K8UA 2WQ6A 3CBQA 1VLMA 5CX1B 3U5ZB 3P52A 2AEEA 3LZ6A 3DZHA 1Z26A 4CCAA 2DMRA 2D62A 3GF4A 2OFFA 4R69A 1XPUA 2Y1WA 1ZM2A 4EYGA 1RAFA 4XUCA 3O5AA 4LVNA 3TQHA 1TK3A 2OC9A 4DWWA 5H3LA 4XYBA 4RVGA 2O23A 4ML3A 5KSYA 4AM8A 2VF4X 3RKUA 3U7IA 2NYAA 1RXWA 4GNKA 4XM1A 2Q6KA 1WSDA 1K5HA 3E61A 2W2KA 1PZNA 5ETJA 3OZVA 3BA6A 3IP3A 4US0R 2JD0A 5KOIA 1ZXXA 1CE8B 2QRZA 1I4DD 3LWDA 4MQEA 2ZSDA 5JZVA 1EVQA 3MBIA 3E5NA 3T94A 2Q07A 2HF8A 4G09A 4MI6A 4Q1FA 4Q3CA 4ZHSA 5IHXA 3U4MA 3LBHA 4AJ2A 1PJRA 3ONFA 3DXFA 2JJ1D 3K5IA 1F0KA 1V95A 4E31A 1Z33A 3BXXA 2Z5VA 3QE4A 5TGTA 5JQGB 1KGSA 1Z6AA 2I4IA 4OFBA 1CRZA 1AGXA 1JTVA 2Q0SA 3AUXA 3A2MA 4O8CA 4YBRA 5GONF 3V2UA 1S6YA 3LNTA 2N47A 3SM9A 2UUCB 3S44A 4OKNA 3E2PA 3AETA 1UJBA 4AY3A 1JEDA 1V6CA 4Y1FA 1JILA 2FW9A 5TY0A 3NDJA 4X3OA 5AJXA 3SEAA 5TPWA 3W3AH 3L0PA 1XVIA 4IUBS 1NKTA 2CT8A 1JRLA 1YS2X 3NEPX 5B3AA 3RYHA 1BVYF 5JVDB 1NXVA 2QTFA 3LXUX 1XVVA 3QHPA 4KSBA 3GP5A 4D5EA 5JCXA 5LD2C 1FS5A 4MKIA 2C95A 2ZE6A 5COAA 3IA7A 5AI6A 3IC5A 3S1AB 5A9RA 1ZHOA 4MV9A 1F8GA 1DG3A 1J9ZA 1A71A 2JGKA 1ZVQA 3E7DA 3LH5A 4FEYA 3ZWBA 1YS9A 1T2AA 1UZMA 5ARDA 1TYZA 2Q45A 1NLFA 3D1JA 4B3XA 2AW5A 1CDEA 1DFGA 2ZUUA 3BIOA 3D2LA 1GYQA 3KCQA 5K3BA 3VU8A 2FR8C 4JN6B 4EPXA 1EFPB 4TXNA 1Q3KA 2AF4C 4W1QA 2ZZNA 3O92A 5CGQB 1C4WA 1Y0BA 2Q2QA 4GKVA 4ENWA 1TGYA 4AU1A 3GLVA 2G0NA 3BN3A 3K35A 1CE8A 4W5TA 3O1HB 4GR9A 1CQJA 3A1UA 1G20B 3BL5A 2IW3A 3P20A 1GUFA 1YTUA 2MDTA 5GAJA 2DCUA 1NJGA 1IRIA 3NRCA 4EPTA 1E7SA 3E2IA 4FGWA 5JASA 3VSAA 1MDFA 1H5UA 2IGTA 2RDMA 1NIJA 4R8VA 2IYOA 4HWSA 1NYTA 3SS9X 1IHPA 1OLOA 1V1RA 4LOLA 1EX1A 1YA4A 4QYIA 3WK6A 4J91A 4C04A 1JHRA 4RA6A 4JODA 5G3YA 2VAWA 4JQZA 1GD1O 2IV3A 5EJ6A 4U63A 5TLSA 2OK7A 2CLLB 4KX3A 3RW9A 5BSTA 3KYCA 3FR8A 5F21A 2PUJA 3AG5A 2VTBA 2ALJA 3E9YA 1EGVB 3FYCA 3K3PA 4FUTA 1D8TA 4YHBA 1R8XA 1HOTA 1EZ1A 3IBTA 5LB4A 2ZYHA 2WYWA 3UK6A 3AF1A 3L43A 3WOVA 5DI9A 4BJ3A 4D9MA 3TW8B 3N0VA 4FONA 4MWGA 4X9XA 4YAGA 1SKYE 5AVTA 5L3QA 3PF8A 3O9VA 3FOZA 4MCJA 4N5NA 3EPKA 2CVZA 1OYWA 2BF7A 1E9AA 1OU4A 1CY6A 3GMDA 4PTLA 4X54A 4LJYA 1A27A 1RC1A 4DNPA 2WIKA 2B4KA 1NVBA 2XI4A 1EZ4A 5HKAA 4CDRA 5IZ4A 5B7QA 4QU0A 3GAZA 3BJEA 3EIOA 1NN5A 4IUDS 4JIGA 3F8SA 4BV3A 4DT1B 4TTVA 1BE1A 1Z7YA 5LZ7A 1FTWA 4RL6A 3LY9A 3U0BA 4CMBA 4CG1A 4P22A 3TN7A 3VZCA 3PRYA 5F12A 1J97A 2WTBA 3ETDA 4M1TA 3QLUC 1Z7EA 4TT3A 3TUZC 1CR0A 2PS0A 5TNXA 3CW2A 2R1ZA 2HRCA 3VYTB 5FPSA 1H0HA 3N2IA 2KE5A 5C35A 1E2LA 3FCSB 2JLWA 1X0VA 3RRZA 5CA0B 4BRUA 1NNSA 3FWZA 3G89A 1BE0A 4US2R 1P1KA 1ZCBA 4AZWA 5UKDA 5IS2A 5LQUA 3DA8A 4X8LA 2VF7A 4OQYA 1TMOA 1RAGA 1G9SA 3OIFA 1I1QB 4BO7A 3KPWA 3VI3B 1UK7A 1UL1X 2RC5A 2RKOA 4QDOA 5LXTF 1RNLA 3UZUA 1KNXA 2XUFA 5IBQA 1JYFA 3OLQA 1W4RA 5HRAA 5LWHA 1GPNA 3VU1A 3T1HB 1OH8A 4HJXA 4LJAA 2ESRA 3IKTA 2YVUA 3DE3X 2DHCA 4FMDB 3B1WA 5FV7A 3P4YA 4IIGA 3V00A 4B6OA 5JALA 1E2GA 4XR4A 1QS0B 1GY8A 3BWVA 4G5QA 3TAHA 1F0NA 4JC5A 2OBNA 1BVUA 1TZCA 4RW0A 5L3QB 5BORA 3ONVA 1YO6A 3FHTA 3AZPA 4GSYA 3EA0A 4ODIA 1LC0A 4X45A 1JHAA 5AW8A 2BEKA 3KVRA 2XMPA 5DYNA 4V02A 3FDFA 2Z2IA 5AR1A 1KYWA 5MF6A 3UJAA 1G55A 3ZE2B 2YYSA 3PVCA 4F45A 4OQPA 1JZTA 1NLZA 5BW8A 3U17A 2P6NA 3RSOA 4KITB 2ZWAA 3L18A 5CNMA 4KFRA 1QB7A 2RAPA 4HWPA 2PGOA 5JD3A 4KN6A 1GM5A 1AJEA 4HDMA 4N5MA 1MVNA 2I62A 3KLOA 5FHQA 3GVIA 4G8CA 3U3XA 1W7AA 2X8LA 3H2GA 3UAYA 4TTRA 2G9NA 3DB2A 5K8LA 5MN6A 1CK4A 3IP9A 4Y30A 3HMKA 3F6CA 4FEAA 4GBGA 1RJGA 3USZA 1XNJA 4B0OA 1IFXA 2IZ6A 1UEXC 1GR1A 1N9GB 3D7SA 4PLPA 4U2FA 2H17A 3K8OE 5E7MA 1V8DA 3HGTA 1LNZA 3R5FA 4A4DA 1MA0A 3TO5A 4B3DA 5C9ZA 3KLMX 3TZHA 4D3SA 1XLUA 4EQ6A 5K3EA 1E4YA 2A2ZA 1NW8A 3QMMA 1C9KA 2QSUA 2YCBA 3GOHA 3ZWWA 4GPIB 3ZWYA 5BV1A 1RPNA 2AA3A 3FJYA 2Y92A 1E32A 1XQYA 4M8NE 1Q0TA 4EO9A 1Z75A 3ISTA 2PGNA 1YULA 2FKAA 1O8CA 1XEXA 2X86A 1S2LA 2YRWA 1GVNB 1O94D 4PWZA 3QLTA 3L5OA 5EKUA 5EMKA 5BR1A 4JEUA 2J9FA 1DAHA 4IZ6A 4XYMA 2PXAA 2QQ5A 1A7JA 4I2NA 1DC6A 3U31A 1NNEA 1WY7A 4K9OA 1W0KA 2VBIA 3C7DB 1M5UA 3I1YA 2AIRA 4Z9AA 3LP5A 3RASA 1BEEA 3VUFA 2JI7A 3IUMA 2ZLBA 3FTDA 1OB2A 2J9XB 2W0SA 1G2QA 1I0IA 3L4JA 5J59A 2V1UA 4OOFA 1YZHA 5L7TA 3TS1A 1IY8A 1O5IA 4JP1A 3SICE 2GJAA 3NDPA 2ZDQA 3PFGA 1YJXA 1PFUA 3TG8A 3GRRA 3B51X 3HDHA 2CLCX 3HE3A 2CNOA 4G5SA 4I5FA 2AOXA 5CU7A 4F96A 3DLHA 2O8EB 1I0ZA 3UXMA 1J1UA 4AIRA 2GSWA 4C4YA 1RYBA 1H8HD 1WTCA 5H1YA 1E0SA 4O3MA 3BDVA 3O4HA 2EDAA 4IIJB 4GQIA 2G76A 3CZ4A 4XW2A 3IMCA 3AHIA 3ZE9A 3JS5A 2O1WA 3I09A 3O7MA 4HAUA 1GQFA 1DG1G 1E3WA 2PBFA 4KHPB 1OX4A 1QJCA 2PH3A 3AU8A