4CVAA

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
254
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
total genus 80
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cvaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cvaA01
1KE9A 3A7FA 5A4QA 4Z9LA 4BR3A 4IX3A 3UGCA 3VS7A 4FSTA 5JFVA 4H39A 2C6KA 5FG8A 3AMYA 1PJKA 5BQ0A 1AGWA 1V0PA 4PDSA 3UOKA 3RK7A 3SOCA 3NW7A 3HV3A 2FA2A 4RPVA 2G2FA 3DXPA 3KL8A 3HEGA 2GHLA 4TY1A 3QTUA 2C3IB 1YOJA 3PXYA 3BQCA 2C5VA 4FZ6A 4XV3A 5E8VA 1OB3A 5IZFA 5EQYA 1YQJA 4GUEA 5CU3A 3RGFA 4G6OA 4FR4A 4E7WA 4FKRA 4F9WA 4LOPA 2OXXA 4DEBA 4KB8A 4QP6A 3SDJA 4YR8A 4USDA 2OK1A 4FOBA 3PG1A 3IW4A 5AP4A 3TNPC 3VULA 1YKRA 4RJ7A 1ZY4A 1ZYDA 1YI3A 1BI8A 4V05A 4F7JA 2UZWE 4CV9A 5IUGA 5L2TA 3E88A 1GZNA 1KOBA 5HGIA 5FUTA 4L01A 3S2PA 2Y9QA 2UZBA 3R02A 4KIKB 3V6RA 2V62A 4R7BA 5HD7A 2F4JA 5EM8A 5KE0A 4APPA 1V0BA 3O71A 5B2MA 2BZHB 4I3ZA 2WTDA 3QRJA 2E2BA 2C6OA 2ERKA 3Q4ZA 4GG5A 5EDRA 1PYXA 3KCFA 2ETRA 2J0MB 4E4NA 2GU8A 3S1HA 1KSWA 1CM8A 2I0YA 3TDVA 2G15A 2VO7A 4JG7A 2PULA 3D5VA 3W10A 4KSPA 3PSBA 3SW4A 1MRYA 1DAYA 2RIOA 3CGOA 3ZEPA 1U59A 4WRSA 3V5QA 3DZOA 5DT3A 4NW6A 4UV0A 4AW5A 4D4VA 5D41A 5D12A 5J7HA 4RGJA 5F95A 3ZDIA 2OH4A 4ZY6A 4C59A 5BVOA 1YWNA 4AZTA 5TO8A 2JFLA 4ZSAA 4FUYA 4AU8A 4F1TA 3KGAA 4H3BA 2C47A 2C6DA 2ITPA 3F5UA 5AR7A 3HYHA 3R21A 1JKTA 2GSFA 3BYUA 3UNKA 3QXPA 3KXGA 1Y57A 3ZO2A 2VO0A 3RBWA 3TV6A 4QYYA 5DYJA 3LLAA 1UNGA 2JLDA 4TWOA 4AZEA 4IAYA 4JX7A 3SV0A 3S3IA 3QCSA 2V22A 3CTHA 4LOOA 4JXFA 3WOWA 4WRGA 4C2VA 5E9EA 4FNWA 4JI9A 4KIOA 3C0IA 4IWDA 1M7NA 2Y4IB 4HVIA 1GZOA 2VWYA 5BYLA 3LCDA 4OTRA 2CGWA 4AOJA 4HVDA 4EQUA 5CEOA 5LVNA 4RX5A 1XH9A 1XBBA 3FZTA 5HU3A 4CYJA 2QODA 3EN6A 1BUHA 4EBVA 3A7JA 4IJPA 2RG5A 2GQSA 3DLSA 2XS0A 1A48A 1H0VA 5GINE 1WAKA 3PPKA 4DG0E 4FBXA 3GQIA 3I79A 4Y95A 3LFQA 1DM2A 2P0CA 3ZSHA 3R6XA 3NUAA 5H8GA 5CAPA 5AX3A 4HNFA 3QKMA 5FXRA 4U3YA 4KA3A 3ANRA 2C6TA 4ZZMA 4FKQA 4G9CA 4N70A 1GIIA 2O5KA 3P79A 5HG9A 3UOLA 3BQRA 3OEFX 2C5NA 3NYNA 2QNJA 1PMNA 2QVSE 3OT8A 4QQJA 4BCFA 4FIGA 4EK4A 5ANEA 4F7NA 3DAEA 3KK8A 1R0PA 4IAKA 4G1WA 4I22A 1PF8A 5BUIA 4X3FC 4MYGA 4Z3VA 2F7XE 2BUJA 3CD3A 4ACDA 3IKAA 2X2LA 4FT9A 3TWJA 5FXQA 5DNRA 2NRUA 1IA9A 2PVLA 2YITA 3N4UA 3MIYA 5LOHA 3P86A 1OMWA 4GFGA 4E73A 2ERZE 4DITA 2O65A 3G9LX 3FJQE 4FZFB 1LPUA 2GHMA 4JDJA 2W5AA 2ZMCA 4XG4A 4IIRA 4NKAA 1VR2A 4M7IA 5KUPA 5EQPA 3EOCA 3FKNA 4G6NA 5FP5A 2BRMA 3TV4A 4GJ3A 4PMPA 1ZWSA 4GFMA 5C26A 1K9AA 4MX9A 2VN9A 4FEQA 1FGKA 1PMVA 2F49A 3DPKA 5ETIA 3V8WA 3QRKA 3PP0A 4ZTMA 3GU7A 1SZMA 4MD9E 2XZSA 4EH3A 5ANGA 2YM8A 5DRBA 3VS0A 3BPRA 4L3PA 4ZEGA 2Q0NA 2XIYA 4RC2A 2C0TA 5FBOA 3VBXA 5I3RA 4ZS4A 4FGBA 1Q4LA 4FNYA 4RIYA 5EHYA 5C4KA 1WBVA 5M51A 1FPUA 4O84A 3QRTA 4IEBA 4NYEA 4WG3A 3DXNA 4C02A 5J9ZA 4Y5HA 4DH1A 3RCDA 4IB1A 2QOBA 4QMUA 3PXQA 1UV5A 2F7EE 4OW8A 2BZKB 4BBEA 3V5JA 3PA3A 4DC2A 3NR9A 4HVSA 5JGBA 3PY1A 4YZMA 2V7AA 4KBCA 2JIVA 1OM1A 3HRFA 3QTZA 3I81A 1RJBA 4F08A 3WZUA 4ZTSA 4CV8A 4FMQA 4ZLYA 4GUBA 4L52A 3KVWA 5DHJA 4DBNA 4DA5A 4PX6A 4BF2A 3MY0A 4RQVA 2AC3A 3DB8A 4N57A 4L43A 2VAGA 3NX8A 4QMWA 3HV6A 1OPJA 5AIKA 3VAPA 4AT4A 4ACGA 2UZTA 4DFNA 4S30A 4U80A 1OUKA 2WIHA 4U9AA 4DH5A 4FSMA 2YM6A 4ALVA 2CJMA 2NRYA 5H9BA 3BU6A 3BV2A 4FT0A 4K33A 3QD2B 3C50A 4M0ZA 4I92A 5AUUA 3HMMA 5ITAA 4ITHA 1P4OA 5K0KA 1GNGA 3OS3A 3Q53A 4FEWA 4L7FA 1OIRA 3DTCA 2OO8X 3KXNA 3CTJA 5IDNA 2CLXA 4YJTA 4YTHA 3PJ8A 4E20A 4F6WA 2C5OA 4F6SA 3UDBA 4GS6A 4BCMA 2WO6A 2UZVA 3R83A 3N9XA 4IAFA 3VW6A 3BHTA 2C6MA 1OL6A 3BGZA 2OG8A 2YAKA 3ZLXA 4II5A 2XK6A 2HAKA 3OCSA 4PMTA 4NFMA 2REIA 2OI4X 1UU7A 3ZC5A 5H2UA 4YBJA 3ZO3A 1P5EA 2ZVAA 4MH7A 3S0OA 1XO2B 3ROYA 3I5ZA 1P4FA 2YA9A 4TWPA 4EOSA 2YM7A 2WMQA 3FMJA 3MPTA 3AGLA 4AGDA 5B7VA 3MA3A 3T3VA 3KN5A 4JIAA 3FMHA 4ERKA 2IJMA 2XP2A 3I7BA 3V5WA 4A4XA 2C6IA 4QMLA 5F20A 5IA3A 3IW8A 4Y85A 2JDRA 2RFDA 2BRBA 4YO6A 3KXMA 5CF5A 3B2WA 3NNXA 4F0GA 1NY3A 3U6JA 4YZNA 2ITZA 4RX7A 1BLXA 4EH2A 1F0QA 2JBPA 1Y8GA 2O3PA 4EWHA 3K2LA 1U54B 4JNWA 5D9HA 2YLFA 3WIGA 4CKIA 4DH8A 4AGUA 5IU2A 2HZ4A 3BYMA 4DHFA 4F6UA 3EIDA 5C9CA 3JXWA 2X0GA 3OW4A 2FVDA 2Y8OA 2Z02A 4WUNA 1OL1A 4ZSLA 4D4RA 3ZH8A 3RNYA 4FZAB 4DTAA 2CNUA 3QC9A 4B99A 4X3FB 3NSZA 3EQRA 3DKGA 2W05A 4C4FA 3PVBA 2RGPA 3DJ7A 3ZO4A 3OCBA 3NEWA 3VUDA 4JL9A 3L8PA 3E7OA 5IQFA 4Q5HA 1ZZLA 2QCSA 2W1ZA 4BDDA 1H1QA 3LQ5A 3HL7A 3SVVA 3TUBA 3HP2A 1PKDA 3GC0A 3IONA 4IM2A 4OBOA 3ORKA 3ENMA 4O21A 4WBOA 3OVVA 1H8FA 4UXQA 4YHFA 2V0DA 3FLNC 4ERWA 3LLTA 4N6YA 1XQZA 3WZJA 3U9CA 5IA1A 3FXWA 3MTFA 5FTOA 1L3RE 2JDVA 4LGHA 1JQHA 3UYSA 4I4FA 4ZZNA 3ANQA 4BICA 2CKPA 5I9VA 2JKOA 2XIXA 4N6ZA 2PVMA 2JGZA 2RG6A 5AV0A 3AD4A 1BX6A 2J9MA 5DEWA 4L42A 2XK9A 3KK9A 3TZMA 3UVPA 4C33A 3E93A 2YIQA 3B2TA 3TNIA 4FG7A 3NUYA 2CN5A 3NYVA 3R8ZA 5L3AA 2YERA 3Q4CA 4HYSA 3SXSA 4K9YA 2WMUA 3OMVA 3RCJA 5I9ZA 3MPAA 4AN9A 4W4YA 4AW1A 4RJ3A 2XNEA 4KRDA 3A7GA 4XG7A 3EWHA 1ZMVA 3GVUA 3Q4TA 2YDIA 2HK5A 2YABA 2YCSA 3G51A 2W4OA 2YACA 4IACA 3R01A 4ALWA 3SHEA 5C01A 2X81A 3TV7A 5E7RA 5TR6A 1JBPE 3KRLA 4BHNA 5HBJA 2A2AA 3CBLA 3E62A 4NM0A 4BN1A 5BVDA 3Q6WA 2BCJA 5EQEA 5HO7A 2R3NA 5F94A 3PDTA 1H28A 2QR8A 3LFAA 3EFLA 3R8MA 4H1JA 3SXRA 4GL9A 5L2SA 3R73A 2DS1A 1GZ8A 3NUUA 4WNMA 4G3GA 5AR4A 3F9NA 5L6PA 2ITXA 4QPMA 1Q62A 5GJDA 4FEVA 4TW9A 3NAXA 5HTIA 3PIYA 1NW1A 4O83A 1E1XA 5EW9A 2W4JA 4YSJA 1K2PA 4I5CA 4OTGA 2R3PA 4QP1A 2HW7A 3CQEA 3FL4A 1STCE 3BHYA 4YJUA 4UN0C 2RL5A 3BEGA 3LFSA 4UMQA 4BGHA 4DAWA 3UZTA 4IC7A 4NL0A 4BIEA 5CLPA 3N4VA 5DG5A 3RHKA 3UVQA 2BIYA 4FTIA 4EEVA 2XM8A 5K4IA 3Q5IA 5CU2A 4O7VA 3R22A 4LL5A 4HYUA 3FMDA 3QA8A 3UJGA 4C36A 4W9XA 5AUXA 3VRYA 3KQ7A 2UZNA 3FAAA 3HDNA 5A4EA 2XKDA 3EHAA 4GFOA 4AZWA 4G3EA 4FYOA 4D1ZA 4JDHA 3WF7A 2WELA 3AC8A 5K0XA 4QP4A 3PIXA 4YC6A 5AP1A 2XMYA 4XYFA 3H9OA 4YURA 4RA5A 4L45A 4ARKA 3LCSA 3MS9A 4YC3A 3U8WA 4DEGA 3R0TA 5DRDA 5HG7A 2WTJA 4D2WA 1WVXA 2WTKC 3QQJA 4TL0A 4ZZOA 5AAGA 4R3PA 3F6XA 4J97A 4O38A 1R0EA 4Y8DA 2CKOA 4DT9A 1MRVA 1YOMA 4GV1A 4KS8A 4AE9A 3WILA 3R7IA 4TTHB 4EH6A 2XIZA 4ZSEA 2OWBA 4FSUA 3L1SA 5A6NA 5IQEA 3VHKA 2FSLX 3GB2A 3NUXA 1UKHA 4G6LA 4L8MA 5AP7A 3DBDA 4ASEA 2PMNX 2ZMDA 5JRSA 3UPZA 5I9YA 5EK7A 4C3PA 1H1PA 5FRIA 3W2QA 3ZLYA 2ACXA 3QYWA 1MP8A 4B8LA 4F1MA 3MVLA 3AG9A 5L2WA 1ERKA 4ITIA 1NXKA 4FX3A 5ACBC 1PXMA 3U87A 4ITJA 4W4VA 5M4FA 1CTPE 5DMZA 3LCTA 3O50A 3D2IA 4I6QA 1H1SA 2Q0BA 3M2WA 3C13A 4XG8A 4WNKA 3BYOA 3D7ZA 1OL7A 1Q97A 2UZEA 3CC6A 4OTWA 3ZBFA 1H24A 5JMSA 3VBVA 5LVOA 4BCJA 3CE3A 4HPUE 2WMRA 3MH2A 4F63A 3KULA 3OHTA 1YXXA 4BIBA 2B53A 3PY3A 3QTQA 4FKGA 3C51A 2WTIA 4AOTA 2YIXA 4HZRA 5IUIA 4BCIA 3F5GA 5IPJA 1E1VA 2YIWA 3D14A 4GMYA 4M0YA 4OUCA 4PV0A 3GXLA 4A06A 1YOLA 4GRBA 4HNIA 4CQEA 5F4NA 4XUFA 4CCUA 1XH4A 3LMGA 4U79A 5LMKA 1YDSE 3RPYA 4FV9A 2C0OA 5JKGA 5M4IA 4R5SA 4V0GB 4X21A 4JS8A 3W55A 1Q41A 4QP7A 1DAWA 2W5HA 2YJSA 2IZRA 4YJSA 5LMBA 3GCVA 3MTLA 3EFWA 4MD7E 5AV4A 5EDPA 5CYIA 5KBQA 4UX9A 2XK4A 4K1BA 5JRQA 3P1AA 3AC1A 4O2PA 4AA0A 1HCKA 3KY2A 4EOKA 3EKNA 3KFAA 4PTEA 2E9VA 3OY3A 2XKCA 4DCEA 5CNOA 2B9FA 4Z55A 1SM2A 3DQWA 4BI1A 3W18A 3E92A 4R1YA 4W9WA 2XJ2A 1ZYLA 2BDWA 4ID7A 3D0EA 1V1KA 2UW7A 3TXOA 3UC4A 2OLCA 4BI2A 2P55A 2J50A 3HV4A 3W2RA 4HW7A 4TNBA 2ZYBA 4ZOGA 4MBIA 4E3CA 4O0RA 3WF8A 3RMFA 3FLWA 5HESA 4RA4A 2C3LA 4DEIA 4DTKA 5HTCA 2BAJA 3KN6A 4J7BA 1YI4A 3LXKA 3PJ3A 4D2TA 2VTJA 2ITYA 3FKOA 4AX8A 2Z8CA 5A6OA 2CLQA 3GNIB 3NYOA 3FWQA 3DDQA 4ZTRA 3QHRA 3PVGA 4J8MA 3V04A 4EK6A 2VWZA 3F66A 1YXSA 2ZB1A 3F3UA 4HGLA 2XIRA 4IB0A 2B52A 4IZ7A 5H3QA 2W1GA 3VS6A 5I9WA 4M69A 4I23A 4FKJA 5TT7A 3LFCA 4CFNA 4FI1A 4DGOA 1UU3A 2JAMA 3MY5A 3NLBA 2IWIA 4FTJA 3DA6A 3EQBA 4G31A 4TYHB 3ZOSA 1SVGA 4BCHA 4RVLA 4EL9A 4QMPA 5LARA 2XK7A 4Z7GA 4ZJJA 4R1VA 4CNHA 1PXKA 5FEQA 2JBOA 4ANMA 4O81A 1ZOEA 3T8OA 3PP1A 4MEDA 4LMUA 4QP2A 4EH9A 2Z7LA 4PPBA 2A27A 3R7VA 5HLPA 4GKIA 4CEGA 4U97A 5CAOA 5HG8A 2W4KA 4YLJA 4AAAA 4RIWA 3IQ7A 1OKWA 3QRIA 3ZS5A 5CSXA 5B0XA 4CD0A 1VZOA 3I60A 3QUDA 1X8BA 4BDIA 3F3TA 4IHPA 3TIYA 1PKGA 4Y83A 3P23A 3TT0A 4DFXE 5IDPA 3OTUA 3PE2A 3IOKA 4O7TA 4BGQA 5L4QA 1F5QA 2J5FA 4BWXA 3RJCA 4AZSA 3L8VA 1ZMUA 4QTDA 4DGLC 3ATTA 3FLYA 2CMWA 3R7YA 4U5JA 2JDOA 2X9EA 4JAIA 4I0RA 4FK3A 4EK5A 3LXPA 3QGYA 2HOGA 2PVRA 1XHAA 1YVJA 4UEUA 3ZZEA 3FZPA 4ANBA 4IMYA 2BAKA 4QPSA 1W7HA 2X2MA 2XIKA 4HJOA 2PVKA 4BKZA 5C1QB 4U81A 4HVGA 3V51A 3FXXA 3Q9XA 4YPDA 4EH8A 5AV1A 3WYXA 4NM3A 1KV2A 1ZYCA 2P33A 3CKXA 4UBAA 1IRKA 3OBGA 4U44A 4YUQA 3F7ZA 5M08A 2QU6A 3R8UA 5E8WA 3DDPA 3EB0A 4KKEA 5E8YA 5ANDA 1SVHA 4IZAA 2BRGA 3GEQA 2XF0A 3UNZA 3AC3A 4BDEA 5JEBA 4JDKA 1OITA 4H1MA 4APCA 4L53A 1W0XC 3WE4A 2ZV9A 1M2RA 4F70A 2QOLA 5DN3A 3ROCA 3RAWA 4TPTA 4QYEA 2IG7A 3IDBA 4KIKA 2PVYA 1ZYSA 4O0XA 3VQUA 3KXZA 4OTHA 4CKJA 4KSQA 4DFLA 4H05A 1UNHA 2XKFA 2PE0A 3FXZA 5FM3A 2JFMA 2FSTX 3V5TA 3FI4A 2WMXA 2RSVA 2ITOA 2JKQA 3P7CA 4G5JA 1H0WA 2XNMA 5C8MA 5J7BA 4NSTA 2BAQA 2G9XA 3BYSA 3KMMA 5AA9A 2CHLA 3IOPA 1ZOGA 3GFEA 4L67A 4HCTA 3GCQA 2WB8A 1TQMA 3DY7A 4X3FA 4NT4A 3W2PA 3VBWA 4DEDA 2VZ6A 4FIHA 4IVCA 5HNIX 2JD5A 3L8XA 4MWIA 3O8PA 1XJDA 5HLNA 3RZFA 1J1CA 1GIHA 3FC1X 4S34A 2P2HA 3SOAA 3II5A 4C62A 3MJ2A 3EQPA 3GU4A 3OC1A 3QTRA 1SNXA 3LCKA 5GZ9A 3VC4A 5M53A 1H25A 3K5UA 4YC8A 4XCUA 1H26A 1LP4A 1CSNA 5M4UA 5C03A 4A07A 1G3NA 4FT7A 3MVMA 2FSOX 4I1ZA 4QMZA 2X8DA 3AGMA 1IAHA 3LMHA 3VS4A 4TYIA 3DBQA 3RWPA 4MXCA 3NAYA 3DBEA 4RIOA 5H8EA 3BELA 5AADA 3AT3A 5BVWA 2AYPA 2WKMA 2XYUA 3A8XA 3BBTB 4R5YA 2OFUA 3Q2JA 5LVMA 3PE1A 4YTIA 2UW0A 2YM3A 3R7UA 4EOQA 5T68A 2WEVA 3PVUA 3C4FA 5D7AA 3R7EA 4ALUA 1QPEA 2OZAA 4KINA 5GJFA 3VJOA 4BCGA 5HORA 2QOCA 3QA0A 4BKYA 4FIJA 2HWOA 3MFTA 4AFJA 3Q9WA 2CKQA 2HENA 3RM6A 5CZIA 5BUEA 4FIFA 3VW8A 4O7ZA 3EN4A 4C35A 4U42A 4NH1A 3HV5A 3D94A 5E8UA 1UNLA 5IQHA 3NUNA 2C3JA 2XK3A 3Q9YA 4OAUC 3MESA 3SQQA 2R0UA 4IB5A 5L2QA 4D0XA 4I94A 3W8LA 5GNKA 1GIJA 1H01A 3PWDA 2H9VA 4L68A 2QOQA 4PL3A 3FSKA 1WBSA 2Z2WA 4E8AA 4DTBA 4XNEA 2WPAA 1YXUA 3DAKA 3OEZA 4R3CA 4YNOA 2VTLA 3KF4A 3OF0A 4BYIA 4IAAA 4FZDB 4E4MA 4FTKA 5AP0A 3OBJA 3GI3A 4E6DA 2QG7A 2UV2A 3F61A 4Y5QA 3DOGA 3R1SA 4O0TA 4U40A 5FWKK 4FKUA 4MQ1A 3MV5A 2UW8A 2GS6A 4FL1A 2EU9A 3EZRA 3ZSGA 4AE6A 4CRSA 5AA8A 5IH4A 1KE7A 4UMTA 1J3HA 3QX2A 3ZHPC 1PMEA 2PU8A 3TJCA 4BB4A 3QQHA 4O0YA 2LAVA 2VTRA 5AUWA 3VUGA 4KABA 3EQCA 2OZAB 4ZTNA 2ETKA 3BE2A 4ZTQA 3KEXA 4O96A 3SG9A 4GW8A 4M67A 1J7LA 2C4GA 4F7LA 3EL8A 4FKIA 3ODZX 4CFXA 5CSPA 1WBOA 4CTCA 1QMZA 4FG9A 4NJ3A 3SRVB 3F7WA 2EWAA 1NA7A 4IADA 3RPVA 2OJFE 4G9RA 2VTOA 5TKDA 3ORTA 3F88A 4C7TA 5EI8A 4F99A 2GNIA 3ELJA 3OD6X 5CSHA 1WBNA 4WO5A 5CX9A 1HOWA 3RAHA 3VUHA 5IQAA 3PG3A 3IW7A 1YXVA 2EXEA 4J53A 3RPOA 4BZNA 3WE8A 5GZAA 3CP9A 4QRCA 4U6RA 3PJCA 4XH6A 2O2UA 4ZMEA 3QLGA 3ITZA 3WBLA 4X6RA 2YN8A 1UVRA 2WNTA 2ITQA 4PPAA 2YJRA 5ETFA 4IH8A 4H58A 4IM3A 2WMVA 4RJ4A 2YCFA 3Q2MA 3DT1A 3MY1A 4MNFA 4V04A 3O8UA 1DS5A 1F3MC 4PTCA 3VS2A 4AF3A 3FI8A 5CVGA 3E7VA 3QD3A 4CZTA 4TWNA 5IF1A 3LXLA 4D1SA 1ZY5A 3NPCA 4DEEA 1YHVA 3PXZA 4NKSA 3QF9A 4FV2A 4TYGA 3LM5A 1OKZA 3FMLA 1JOWB 5CVHA 5JT2A 2QR7A 4CTBA 3FHRA 2Z7QA 4EOPA 4S2ZA 4HOKA 4ZMFA 4D58A 2JIIA 4C38A 2J0IA 2DQ7X 4QMYA 4M14A 2UUEA 3FMEA 3NIEA 3PIZA 4M84A 1BMKA 4XMOA 4EBWA 5AUTA 3JR1A 3ORZA 4BY9E 4PDPA 4D4SA 3I5NA 4ZAUA 3RAKA 2EUFB 2GQGA 3EL7A 1CKPA 3LZBA 4S31A 5IQIA 4W8EA 4AQCA 1OKYA 4DLIA 3A4PA 3FYJX 2IO6A 2F9GA 2VWBA 3SKCA 4ACMA 3HV7A 3MH1A 2J0LA 4BIDA 4RLLA 2DYLA 3ZLSA 3D5UA 1XWSA 2XRWA 1OKVA 2HIWA 5CT7A 5HKMA 1FVVA 2OFVA 3WZDA 3QYZA 5J5TA 4PY1A 4FTOA 5DE2A 1OI9A 2W9FB 3HRCA 5FBNC 1PXNA 4ANOA 5A4CA 4F64A 3QCXA 4YU2A 5JK3A 3EKKA 4R6VA 5K5XA 1O6LA 4BWPA 3L9PA 4MWHA 3NGAA 3DBCA 4RIWB 3ZTXA 2PY3A 2IZUA 4DN5A 4U43A 2VWXA 3MFUA 3OXIA 3HNGA 2VTHA 5D11A 4XG9A 5AUZA 4AN2A 3FI2A 4IDVA 3CSVA 5HVKA 2A0CX 3R9NA 1VEBA 2G1TA 2XNPA 1S9IA 2CGVA 5AAFA 5FD2A 2BKZA 3PRIA 3PSDA 3DZQA 3JVSA 4MXZA 3VBTA 4O86A 3KRXA 3GQLA 3OY1A 2BHEA 4X6QC 4USEA 1B6CB 4O1OA 5DLSA 3UC3A 3HKOA 1U54A 2WMBA 3HECA 3R7GA 4OTDA 4R7HA 1R3CA 4O0VA 5J87A 1JAMA 3R63A 3FHIA 3MBLA 5CALA 4OT5A 3ZCLA 1M14A 2ITNA 5CAUA 3U55A 1OPKA 2PUNA 2WQOA 4E5WA 4TKSA 3EYHA 4GT5A 4EKLA 2YFXA 5DBXA 4XLIA 5AX9A 4MF1A 5AR3A 2ITWA 3UYTA 5BNJA 2CNVA 3CR0A 4H36A 4G3CA 3BHUA 2QU5A 4GSBA 2IW8A 2VX3A 3CS9A 3CD8A 3MFSA 3FZSA 3UP2A 3MW1A 4YMJA 1L8TA 4FNXA 1DI8A 3VO3A 4YTCA 4WUAA 5ANOA 5HCZA 4E5BA 3Q96A 5E1SA 1WBWA 4FV3A 2WIPA 2BDJA 4RVMA 1ZRZA 1KUTA 4QPAA 4WD5A 3TUCA 5E91A 4L7SA 3DNEA 2FH9A 2FSMX 1BYGA 1GOLA 2OW3A 3KCKA 4D9TA 4TZRA 3LJ1A 4MKCA 3BE9A 4GIIA 4RG0A 1ATPE 3FZOA 5EM6A 4Q9ZA 3C1XA 3F2AA 4J52A 5LQFA 4BDGA 2VWVA 3ACKA 2UZLA 4P90A 1BI7A 4EQCA 2KULA 3POZA 2JKKA 4D5HA 1HCLA 4CCBA 4N4SA 4PMMA 2B4SB 3QALE 5GIPE 4X2FA 4AW0A 5BPYA 3EN9A 3I0QA 4L46A 2W0JA 4RVTA 1BKXA 4U7ZA 5CF8A 3DK7A 4M8TA 3G9NA 1ZAOA 5CS6A 5CXZA 5DEYA 3OCGA 2X1NA 5GIOE 2VV9A 4FKOA 1IA8A 1TQIA 5AM6A 4ASXA 2VTTA 4PQNA 4QYFA 1B38A 2QOKA 5M07A 3FE3A 3QTIA 3KULB 4MXAA 3QWJA 4E93A 4XV9A 4HGEA 1M17A 1JSVA 2X39A 3VUMA 4RMZA 3CIKA 2CSNA 3ULZA 3W2CA 3MPMA 4DFYA 2Y6OA 4JQ7A 4GK4A 4R8QA 4EC8A 3SW7A 4A9TA 2HZIA 4KKHA 3ZRKA 2XVDA 5FXSA 2LGCA 1MUOA 4G3FA 5TOZA 3W2SA 4LV8A 2W1CA 3CPBA 4FL2A 5BMSA 1UWJA 4I6BA 4Y72A 4AWIA 5E4HA 3JY9A 3A62A 4O22A 3U4WA 2C1AA 5ETCA 3VNTA 2W5BA 4WBBB 4D5KA 1WZYA 2WEIA 5AEPA 3KRRA 3R8PA 4F0IA 1P14A 2VO3A 2IVUA 2UW5A 4ANSA 2RKUA 2VU3A 2XCHA 4IW0A 3C4XA 4RX8A 2P3GX 3L9NA 3S00A 4WA9A 2WXVA 1JKSA 2IW6A 3CCNA 3DTWA 4O0UA 3ZLWA 4C4JA 4CMUA 4D28A 3C4WA 5TF9A 4S32A 3PFQA 4YTFA 3A8WA 4IZYA 5JFXA 1W84A 4FSZA 5KMJA 2QKWB 3CQWA 4FV0A 5JFSA 3W1FA 3ZRLA 4U8ZA 2X7FA 2QOIA 3N51A 4GU9A 3GUBA 3EQHA 4ACHA 3QUEA 1FMOE 2YM5A 4PDOA 5CENA 3UMWA 4DGMA 4BDFA 4V0GA 2NNWB 4J1RA 2R3MA 2W1FA 4FV7A 2BTSA 4NUSA 4C58A 3WF5A 3VIDA 4DYMA 4CG8A 2R3OA 2WOTA 2X2KA 1PXIA 4BCOA 5EKNA 5L8KA 3ZMMA 4X2NA 1PYEA 1R1WA 1RQQA 3LHJA 3D7TB 4AN3A 3ORMA 4BBMA 1J91A 1U46A 4USFA 4NCTC 2PVHA 3DFCB 3E87A 3ZC6A 5CEQA 3COKA 2JEDA 3FQHA 4YJVA 4O1PA 3QTSA 2WD1A 2UW3A 3PSCA 4A7CA 1KE8A 4FEUA 4QMTA 3U51A 3A99A 4JLCA 2HWPA 4WG4A 4BHZA 3SGCA 3C5IA 5HU9A 5FEEA 5EHOA 3VN9A 1REKA 1UU9A 3BU3A 3DU8A 3PVWA 5IA0A 4AA5A 2VX0A 5IQCA 5AUYA 3UZRA 4XX9A 3G33A 5A3XA 5KMMA 3SXFA 2C68A 3AD5A 4AP7A 3FV8A 4D2SA 1MQ4A 5DR2A 2Z60A 3FKLA 2VTNA 4FT3A 4MAOA 4X2GA 2QURA 4LRJA 3U4UA 3ZFYA 3FMMA 2OJJA 4CMOA 3FMNA 4J96A 5CSVA 4AFEA 4FUXA 4XV1A 1QL6A 2VGPA 4NIFA 4CVAA 4EQMA 2J2IB 3NNUA 3OXZA 4JX3A 3UODA 4GT4A 3QKLA 2ZV7A 3P7AA 2J5EA 3HUBA 2PVNA 4PNKA 2ZV2A 4IJ9A 4LG4A 4DH7A 3R30A 4AZFA 4HVHA 1PXJA 4U41A 2B54A 3NYXA 4QOXA 3Q04A 2OGVA 3M1SA 3DLZA 3DFAA 4KNBA 4RJ6A 1KE5A 2PPQA 2X4FA 2C6LA 3I1AA 4G34A 4UXLA 3ZU7A 3FMKA 2FUMA 2R5TA 3OWPA 4RWJA 1WBPA 3O0GA 3V8TA 4BTJA 3UTOA 4EWQA 5BMMA 3QX4A 2YHVA 2ITUA 4XG3A 4FKPA 2OBJA 3F2NA 4I0TA 5GZ8A 4UY9A 2XEZA 5KO1A 2CDZA 2J0KA 3A7HA 2WTVA 4FYNA 2BZIB 3ALNA 5DGZA 5LCKA 3VJNA 3AD6A 2XNGA 3UIMA 4EZ5A 3FLQA 4FV1A 4D2VA 4PRJA 2C5XA 4P5QA 4BCNA 3ATSA 2PVFA 2FYSA 4YHTA 3FSFA 3LJ2A 2W06A 4LYNA 4BDBA 2WQNA 2ZJWA 4FG8A 1I44A 1YRPA 2J0JA 1W8CA 2VNYA 5E1EA 4Z16A 4EH7A 5ICPA 1SMHA 3FQSA 4FKSA 4FSWA 3UVRA 3MVHA 2YWPA 5CTPA 5HVYA 4IDTA 2R3FA 5CF4A 2QONA 3FPMA 3VS5A 4BFMA 2B0QA 3PZHA 4XP3A 4DLJA 1IAJA 2HY81 4CFMA 5M06A 1SVEA 3UG2A 4RSSA 3TI1A 3WARA 1PXLA 4BTMA 5CQUA 5ANIA 1Q8TA 3MB6A 2YDJA 1OBDA 4GYIA 4QNAA 3PJ1A 3HAVA 2PYWA 4HZSA 1G8AA 2OIBA 2QD9A 3VBYA 1O6YA 2E9OA 5CI6A 5KNJA 1QCFA 2IZTA 4L3JA 5E8XA 3V01A 4NCTA 3EYGA 2FO0A 4M13A 4U3ZA 3I6UA 3O7LB 2PWLA 2KTYA 1YWRA 3ET7A 4J95A 2I0EA 1XR1A 2XA4A 4OT6A 1DI9A 2OF4A 3RZBA 2W99B 3GOPA 4C3FA 3I6WA 3NCZA 3GCSA 5LWMA 3T3UA 3QZGA 2IVVA 4CZYB 5AUVA 3BYVA 5EFQA 2HXQA 1ZXEA 5HNBA 4B9DA 4PPCA 1JSUA 3LOKA 3UIXA 4K11A 4CT1A 3TDWA 4G2FA 3FC2A 3UBDA 1H1WA 4KKGA 5CSWA 4DCAA 4H3PA 3CLYA 4FF8A 4WG5A 3OFMA 2WU7A 4K18A 2BILB 2XNOA 3WF9A 1IG1A 1UU8A 2B9IA 3F3WA 3I4BA 3LPBA 2VTQA 4F9YA 3OWKA 3GU6A 2E9UA 2PZRA 2CN8A 3PXKA 3QCQA 2RFNA 3KA0A 4R3RA 5K9IA 4BKJA 2GQRA 2XH5A 2XEYA 3DGKA 3LXNA 2UW4A 3C4ZA 3IGGA 4QMSA 5K3YA 4AS0A 4BC6A 3F5XA 5A46A 5ANKA 5EKOA 5CEMA 3G15A 4IB3A 2OIDA 4M3QA 2EB3A 2UVYA 2XM9A 4RWLA 3QBNA 5DVRA 5TE0A 3RPSA 3ZXTA 1ZOHA 4FSRA 4PP9A 4BDJA 3DBFA 5K4JA 1TQPA 3EJ1A 4QTAA 1G5SA 2BRNA 4YNEA 5ANJA 2PUIA 1CKIA 5G1XA 5HOAA 3ZUTA 4FTLA 4RLKA 4FZ7A 1PMUA 4EJNA 3HLLA 3T9IA 3TZ8A 4C4EA 3U6IA 4C3RA 4PP7A 4Y46A 4MNEA 5DT4A 2PUUA 3G0FA 3JUHA 2ZM4A 2UW9A 3ZZWA 5EOLA 4O0SA 2WMSA 3VVHA 2XK8A 4YZCA 2H8HA 2HZNA 2BFXA 1GY3A 3GCUA 3NNVA 5EH0A 5CEIA 2F2CB 5M55A 3R8LA 5JZJA 1NT2A 5AP3A 3AC2A 4BZOA 4IFGA 5HE2A 2PK9A 1OBGA 2WMWA 3GFWA 1W98A 2X6DA 1GAGA 3C5UA 3AOXA 5M56A 4FTAA 1PXPA 1YW2A 3D83A 4FKLA 5J8IA 2P4IA 3ZUVA 2JKMA 3QQFA 1OECA 3R1NA 2ZV8A 4D55A 3R1YA 4YZ9A 4ZJVA 2R64A 4IAZA 4DFZE 1Y8YA 5EYMA 3TKIA 2WQBA 2PMIA 4QQ5A 3IS5A 4DBXA 2CGUA 4WKQA 3NVMB 3G5DA 4NTTA 1OL2A 5FGKA 1AQ1A 2AUHA 4UMUA 2H6DA 4JQEA 5FTGA 4ZXTA 1FOTA 4TT7A 4WOVA 4RFMA 2CKEA 5EW3A 2GNJA 5HNGA 5IEVA 3ZO1A 2BKKA 4YLKA 4DG3E 3KKVA 3V5LA 4IQ6A 3WI6A 3EN5A 4C0TA 3PA4A 3H30A 4O7RA 2Y0AA 3GOKA 3LVPA 4X3JA 3P08A 5L6OA 3ORPA 2VUWA 4JAJA 4IC8A 3GGFA 1Q61A 2OJGA 3MVJA 4PNIA 2O63A 3OWLA 4E6QA 4JG8A 1WVWA 4YJNA 1OIQA 3KRWA 2HY0A 5AR5A 3QCYA 3CY2A 4MNEB 3KF7A 4P2KA 5LVPA 3NRMA 1FVTA 3H9RA 3TNWA 4RC4A 3RAIA 2GTNA 2QO9A 5A4TA 5I3OA 4O6EA 5DH3A 3V3VA 4E5AX 5J9YA 3FPQA 2E9NA 4UALA 4BBFA 5E8ZA 4F7SA 3ZM9A 4OGRA 4WSYA 2R3RA 4RWIA 5CI7A 1V0OA 2XRUA 1CKJA 4FVQA 5IQBA 4EHVA 4WNOA 2W1DA 3BIZA 1E9HA 3C4EA 4X7QA 2R3QA 2ITVA 4LRKA 3IW5A 5HE1A 3RINA 3CY3A 2VWIA 3BRBA 1H27A 3QXOA 3O51A 3CJGA 2YAAA 1Q5KA 3MDYA 2BR1A 3PUPA 2BIKB 4ZS0A 4BDCA 5HQ0A 2YM4A 1ND4A 4F1OA 2GHGA 3MN3A 5CU0A 3LE6A 4D2RA 2IPXA 5CEPA 3NW5A 3QC4A 2PZYA 4EKKA 4O7WA 4ANLA 5KMKA 3PXFA 4E1ZA 3BGPA 4YPSA 4RZVA 4F9AA 4BI0A 3ORNA 2OU7A 4BDHA 2ESMA 4N0SA 5DIAA 2XBJA 4XJ0A 3L9LA 2R3GA 3GP0A 3HMIA 2ONLA 3PLAE 3ZBXA 4QTBA 3TM0A 1Z5MA 3GT8A 3FI3A 5IKWA 4NK9A 4FKWA 4EYJA 5EYKA 2BHHA 1YDTE 4YP8A 5CF6A 5M4CA 4D9UA 1ZZ2A 3CEKA 3G2FA 4TYJA 1URWA 4ONAA 5GJGA 4RVKA 3FUPA 4O27B 4A9RA 2PUPA 4CXAA 4EK3A 5CAVA 2BRHA 3HA8A 4GIHA 5L2IA 5I0BA 2WTCA 3ID6C 3EFJA 5D7VA 2VX1A 4AT3A 3H3CA 5BYZA 4YO4A 4GVAA 2IZSA 3E3BX 4GEOA 2OF2A 3RHXA 4ANNA 4DFBA 2PMLX 3BHVA 3DK6A 4RRVA 4JR3A 5D1JA 3HMPA 2XB7A 3NZ0A 5EG3A 5JQ8A 4QYGA 5JGAA 4RX9A 4EUUA 3LQ3A 1OL5A 4C4HA 3DNDA 3ORXA 4GYGA 3F5PA 2B55A 4IVBA 2YISA 1LUFA 3QQUA 5HICA 3WZEA 1R39A 5KMOA 2PE1A 5IMXA 3M11A 4XP0A 5CWZA 2HELA 5HO8A 3ZEWA 3SD0A 2V7OA 4HGTA 5EYCA 2YLEA 4UYAA 4WHZA 1WFCA 5DOSA 3QUPA 2A19B 5JFWA 3BCEA 3FLZA 3HMOA 4J8NA 4R78A 3KU2A 2YZAA 3CQUA 3TUDA 3BLQA 3R9DA 3BU5A 3DB6A 3U54A 4ANQA 4C34A 5FDXA 5CEKA 4LI5A 1U5RA 4DGGA 5KX8A 3RNIA 4I0SA 2ZDTA 4I20A 2VTPA 4RZWA 2JAVA 4OTQA 5E90A 2WMTA 3DJ5A 4X0MA 3VUTA 3JY0A 3R2YA 4J99A 2W1HA 4L9IA 3QQGA 5DWRA 2IW9A 3DXQA 4EOOA 4GK2A 1YI6A 4CT2A 4L00A 4F9BA 3MIAA 3IGOA 4FVPA 5JGDA 3Q6UA 2Q83A 5HBHA 5AP6A 3F3VA 2PL0A 3PZEA 2W9ZB 3QQKA 4FSYA 4KWPA 4NM7A 2WGJA 2G01A 3RK9A 4KUJA 4B4LA 5IUHA 5IEYA 2UW6A 5JQ5A 2O64A 5CAQA 3IW6A 2XBAA 5C4LA 5JZNA 5HD4A 2BROA 3FLSA 4XG6A 2ZAZA 4EZ3A 4ZLOA 2VWUA 2GFCA 4L3LA 3G6GA 3SG8A 3ODYX 3POOA 3RALA 3ZONA 4CGAA 2OIQA 2R7BA 1O6KA 4IANA 5G6VA 3VBQA 2R0IA 3R9HA 3B8RA 4ZY4A 3QZFA 4MXXA 2I1MA 3PPJA 5EDQA 3ZXZA 4BTKA 4KBKA 3UQGA 3NCGA 4L6QA 5IA5A 4WNPA 5AV2A 2C69A 1Q8ZA 3KMUA 4EJ7A 4EYMA 3LM0A 1Q8UA 2OXYA 3C9WA 1Y91A 1ZLTA 2UZUE 5DA3A 4ZSJA 2Z7RA 1RDQE 5AP5A 3DKFA 1WVYA 3AT4A 4ZP5A 5IQGA 3FBVA 2OXDA 3NS9A 5HO6A 1Q8YA 5AAEA 1FBNA 3QKKA 1WCCA 4E26A 1G8SA 4FTNA 2XJ1A 4FKTA 3VS3A 2XYNA 3TN8A 2CCHA 5AIRA 5JSMA 5HCYA 3FEGA 4BDKA 3KREA 1H00A 4XBRA 1MRUA 3RVGA 3TNQB 3ULIA 4AT5A 3FZ1A 4FTUA 4G3DA 4O91A 3PLSA 2WAJA 4EI4A 5J1VA 1Y6BA 3W2OA 4FODA 4O7SA 4IWPA 3FDNA 4EC9A 3EQDA 4QNYA 2ZM1A 1FINA 1KOAA 3H9FA 4W4WA 1REJA 1UKIA 3E5AA 4EK8A 3OZ6A 4DEAA 4G16A 3SX9A 3QHWA 1VYWA 4QT1A 2CNQA 3JYAA 2J4ZA 3EH9A 4HYHA 4FTTA 3EQGA 4NZWB 4K77A 2PZIA 2DUVA 2VO6A 4HCUA 4BCQA 2QO2A 4KBAA 4LM5A 3CPCA 5LMKC 3W32A 1Z9XA 5HIEA 4QMQA 4FGRA 4O6LA 4IFCA 5DI1A 4JBQA 2QLQA 4NFNA 4TXCA 3UO6A 2VRXA 2ONLC 2WTKB 1CMKE 3SA0A 3W16A 1XKKA 4NJDA 2WQMA 1MQBA 4IX5A 4NW5A 5AR8A 4ZTHA 5JN2A 1PXOA 2R9SA 3OCTA 4U0IA 4QMNA 2V55A 4YHJA 5LJJA 2OSCA 3NVKI 1S9JA 1P2AA 3S95A 1XH6A 3LFDA 2X8IA 1R78A 4NEUA 2YEXA 4CYIA 1XBCA 3BGQA 3IDCA 2EB2A 3D9VA 3G0EA 4RJ5A 3QD4A 3R00A 3UMXA 5M44A 2NO3A 5LWNA 4C57A 3ETAA 4DH3A 2J7TA 2WHBA 5D10A 4MTAA 4BRXA 1W83A 2WOUA 5F1ZA 2WFYA 5LVLA 5HHWA 4DGNA 4FT5A 4I21A 2OJ9A 3ORLA 2OJIA 5I9XA 4YGAA 3OWJA 1BL7A 4YJQA 4JDIA 4PL4A 1NVRA 4RIXB 2Y4IC 4GT3A 5BVKA 5C8NA 2C5YA 2R3IA 4D4YA 2XNBA 3P5KA 5IEXA 2PZPA 4O0WA 2GTMA 4EHEA 3TL8A 1KE6A 3LJ0A 1I09A 3THBA 3EZVA 3HGKA 3SAYA 4KS7A 3WZKA 3ZYAA 3C4CA 1PW2A 3OT3A 4XEYA 5T6KA 4AA4A 2VWWA 1H07A 4UZDA 3MH0A 3K3JA 3NWWA 4S33A 3QLFA 1XBAA 4DINA 3KB7A 2GNFA 3D4QA 4FVRA 4AGCA 4PMSA 3BLRA 3HX4A 5AM7A 3LMIA 2X9FA 4I6HA 4ZTLA 3ENHA 4G5PA 5B2KA 1M7QA 3HUCA 3QZHA 3Q3BA 4IVDA 3TG1A 4C4IA 5KZ0A 3F2RA 5E92A 3LQ8A 3LFBA 4BCPA 3V5PA 4BYJA 4RWKA 1YWVA 4EORA 3UE4A 5A14A 2Y7JA 4RFZA 2F7ZE 3IECA 3PRFA 4GH2A 4M66A 1Q3WA 2V5QA 3D5WA 5I4NA 4U45A 2JITA 2R2PA 1YDRE 5AP2A 3LFEA 4XLVA 4B0GA 3OG7A 4EHZA 2R3KA 1OPLA 3B8QA 3O8TA 4AACA 4B8MA 5HX8A 2VD5A 2J90A 3OXTA 1OZ1A 2HXLA 3RP9A 3ZFXA 3TCPA 2BVAA 4FSNA 4FNZA 5EM7A 4TN6A 4F09A 3LAUA 4UWCA 3DAJA 5AJQA 2HW6A 3CTQA 3OOMA 3RKBA 4FV8A 4QQTA 3EMGA 3W8QA 4OLIA 4RBLA 5H8BA 2VNWA 1ZYJA 4O7NA 4OBQA 5LMAA 1BL6A 3Q32A 4OTIA 3P4KA 3Q9ZA 4TWCA 2QI8A 4TYHA 3TIZA 2YIYA 4AUAA 4QMVA 3TKHA 4EHGA 1YHWA 5CQWA 4A4OA 5HE3A 5CT0A 4GVJA 4M69B 3NIZA 5ETAA 4EH5A 2YCQA 4QTEA 4NIFB 3UG1A 2QOHA 1TVOA 5EI2A 3KRJA 2J51A 4LUDA 1URCA 2GS7A 1SYKA 4AXAA 2R3HA 3BWFA 1WBTA 4I5MA 4K8AA 4O7LA 3WF6A 4F4PA 1CDKA 5E8TA 3W33A 1Q99A 2BPMA 3O2MA 4TYEA 4JOAA 3NMUF 5FEDA 3ZSIA 3GU5A 2WZJA 3BWJA 1LEZA 3DKCA 4K2RA 4OR5A 4DE4A 1OVEA 2C3KA 2SRCA 4LRMA 2YIRA 3IG7A 4F9CA 2I6LA 1U4DA 5EOBA 1JLUE 1NVQA 2VTSA 4QP9A 3HRBA 3I7CA 4HCVA 4B6LA 4DT8A 4FTCA 4CLJA 5IG1A 3CGFA 2H96A 2P2IA 2WTWA 3CJFA 2GNGA 4IAIA 4LUEA 3CKWA 4XRJA 3O7LD 3OP5A 1WMKA 4OBPA 4CQGA 1XH5A 4YZBA 4HPTE 2XCKA 5DPVA 5HG5A 5GHVA 4FE2A 3DKOA 2JDTA 2W1IA 4FK6A 5DR6A 4IVAA 4E6AA 4RQKA 1J1BA 4MK0A 4CG9A 4IZ5A 5J1WA 3OROA 4I24A 5LXMA 1JKLA 2XKEA 4I41A 5EM5A 3A61A 3REPA 2RFEA 5AR2A 2B1PA 4GU6A 5LCJA 5FM2A 4GKHA 4JJRA 2IVTA 3F69A 3QAME 3HDMA 2GMXA 4GG7A 3RM7A 4ACCA 4ASZA 3OUKA 4CRLA 4F0FA 4C4GA 4M15A 3QRUA 3DV3A 3R04A 1Q8WA 3IPHA 2OICA 4MD8E 5ACKA 2OH0E 4UB7A 2NPQA 3D15A 3D7TA 2R3JA 4KIPA 2BMCA 5CVFA 3U6HA 2ZM3A 3MGYA 3MYGA 3QTXA 4OAVB 1JPAA 5KMLA 2Y6MA 4C8BA 4LFIA 3HA6A 2Z7SA 3VWAA 5IMEA 5IISA 1J7IA 3QFVA 1AD5A 3QWKA 2CCIA 2CGXA 1B39A 4BL1A 2Y4PA 1FMKA 5FTQA 2VTIA 4FTQA 3BEAA 3ERKA 4MXOA 2B7AA 3COIA 3MSSA 3F82A 3FZRA 2I0HA 3IK3A 4MXYA 2GS2A 5FP6A 4IM0A 3LW0A 4JBOA 4XOYA 4XP2A 4YBKA 3MWUA 3WYYA 5CNNA 4MVFA 3H0ZA 3OUNB 2RFSA 3HVCA 2YCRA 4OTFA 3UP7A 3UO5A 5J9LA 2I40A 3VQHA 2ZDUA 5B2LA 3PXRA 4KAOA 3FY2A 4CFUA 3DQXA 5C27A 2QC6A 1A9UA 3P7BA 3AXWA 3ZDUA 4ZY5A 1UA2A 4MCVA 1RW8A 5HBEA 2GNLA 4Q9SA 2DWBA 3T9TA 2ETMA 3E64A 2AC5A 1T46A 3O23A 5KKRB 3K5VA 2OZOA 4YJOA 3SRVA 4I5HA 4NWMA 3Q60A 4NTSA 5EI6A 4E4XA 2BDFA 3KC3A 4RC3A 4DFUA 3H10A 4A9SA 4ENXA 3Q52A 4QMOA 4DEHA 4EUTA 3R1QA 3NUPA 2WQEA 4BTFA 2HZ0A 4I6FA 4W8DA 3JS2A 5KCVA 4JBVA 2R4BA 3VF9A 3IDPA 2QHNA 2PSQA 3FY0A 4QMXA 3FQEA 4AZVA 3BV3A 4CFFA 5DT0A 3JPVA 5KHXA 3NNWA 4UYNA 5J95A 2BALA 2O0UA 4F65A 4UMRA 4CKRA 1VYZA 3UOHA 2HYYA 4XBUA 5AV3A 4ZJIA 3C0HA 3GC8A 3LFNA 1Z57A 3RI1A 3ORIA 3V6SA 3F3ZA 2QHMA 4RIYB 3HZTA 2YZLA 3OOGA 4QO9A 3NW6A 4I93A 2O8YA 5I5ZA 2WU6A 3PPZA 2C1BA 4UWYA 2PVJA 3M42A 4AW2A 3O96A 3DK3A 3BBWA 2C6EA 1LEWA 4Y73A 3ZM4A 1OUYA 1U5QA 3Q5ZA 4I4EA 5T3QA 5IA2A 4XS2A 4O82A 3UOJA 4DF3A 4FTMA 3GU8A 4XOZA 5J5SA 2WMAA 4FSQA 1UWHA 4K0YA 3GBZA 3VF8A 1FQ1B 3MB7A 4R7IA 5HEZA 5BVFA 1EH4A 1H1RA 3BZ3A 1ZMWA 4RT7A 5FLFA 3A4OX 3C7QA 4H3QA 5CANA 4PTGA 5KMNA 4LOQA 5K5NA 4V01A 4IX6A 5J79A 1OIYA 3QL8A 1KWPA 3NUSA 4JG6A 2W17A 4OTPA 4XRLA 1PHKA 5C8KA 4C61A 5EHLA 2QG5A 4UWBA 4XV2A 4EZ7A 4QTCA 4CFWA 2VGOA 3PJ2A 4X2KA 4C37A 3MI9A 4WIHA 1PRYA 3R9RA 3MFRA 4MBJA 3COHA 3R9OA 3EQIA 4K6ZA 4M12A 2QKRA 4M97A 3S4QA 4Q5EA 4PDYA 1OGUA 4IE9A 4JQ8A 5FDPA 2GCDA 4IX4A 2BTRA 4B7TA 2XUUA 2J6MA 1RE8A 2ZB0A 2W96B 3E8CA 3RPRA 4D2PA 3RK5A 5I9UA 5HTBA 3GC7A 3DS6A 2X7GA 4JT3A 3TZ7A 2XNNA 4FV5A 3ACJA 3EFKA 3AC4A 3NDMA 3MJ1A 4FOCA 2W1EA 5CXHA 4EOMA 5IQDA 4G17A 3K54A 4KD1A 5AWMA 3UO4A 3VS1A 2PZ5A 5HCXA 4ZLZA 3HAMA 2JDSA 2PTKA 4FIIA 3RWQA 3EN7A 1SNUA 4E6CA 5CU6A 3VUKA 4CLIA 2YDKA 3KXXA 5HIBA 4ENYA 2EXMA 3E8DA 3PTGA 2X8EA 2EVAA 4HGSA 3R28A 4QYHA 4FL3A 4D1XA 3CXWA 4UMPA 3E8NA 2C0IA 4Q2AA 3FL5A 3BI6A 1TKIA 3U9NA 1KV1A 4BGGA 2JC6A 5A9UA 5BUJA 4AGWA 3MA6A 1O9UA 3BHHA 4WT6A 4HYIA 5KBRA 3D2KA 5E8SA 5A54A 2QOOA 3TEIA 3PWYA 2PMOX 3SC1A 2ZOQA 3LFFA 4IWOA 4R77A 4WSQA 5FQDC 3UQCA 3E63A 1M2QA 1XH8A 2BZJA 3DCVA 3TTIA 3H4JA 3QZIA 2I0VA 2FB8A 3OTVA 3P0MA 3GENA 2F57A 3L9MA 4M68A 4L44A 4NM5A 5BX0A 4GK3A 1K3AA 4QQCA 4D0WA 2PE2A 4KRCA 2B9HA 5AFVA 4FKVA 1ZARA 4JIKA 5HIDA 4AG8A 4BVUA 2UZDA 2VTAA 3VRZA 5CZHA 2NP8A 3LKMA 3Q4UA 5JH6A 5M09A 4EOIA 2HCKA 5KKRC 2H34A 3K3IA 5EW8A 4YZDA 4O7YA 5L6WL 2C30A 1JNKA 2UVXA 5KMIA 4FC0A 1JSTA 3QQLA 2X7OA 3E3PA 2G2HA 2GNHA 3A7IA 3PY0A 3WIKA 1JWHA 1YXTA 1FGIA 4ZK5A 4PL5A 5L8LA 3L8SA 2BFYA 4QMMA 4EOLA 1JVPP 4W4XA 3AMBA 4O2ZA 4LQMA 4CZUA 2JIUA 3KXHA 1T45A 3QD0A 4A9YA 4EOJA 3TNHA 4MQ2A 3P78A 3AC5A 4XHKB 2B9JA 2CPKE 3MH3A 3V8SA 3EQFA 4ASDA 4CSVA 3UZPA 4RJ8A 2A4LA 1H08A 4PUZA 3DJ6A 5DR9A 3TTJA 2GFSA 4RIXA 4MHAA 3A60A 4JRNA 5A4LA 5KHWA 1QPCA 5BVEA 5M57A 2GPHA 3GCPA 3R2BA 3QU0A 4LMNA 5CASA 1NVSA 2UZOA 5HI2A 4P5ZA 5EYDA 2G2IA 4EONA 3PA5A 4YLLA 1Q24A 4UZHA 5L8JA 4FA2A 2R7IA 2E9PA 2X4ZA 3VHEA 5HX6A 2GDOA 2PHKA 1PY5A 1H4LA 1APME 3PYYA 3AQVA 3RTPA 4TNDA 1FVRA 4YJRA 4P4CA 4DG2E 3N4TA 2X6EA 3G90X 4J71A 2R3LA 4J98A 4QD6A 3ALOA 3FYKX 5CU4A 3UQFA 4PF4A 3HP5A 3JVRA 3ZFMA 3QGWA 4IXPA 4FIEA 2QQ7A 1OIUA 2EXCX 1XH7A 1IASA 4GCJA 3SLSA 3UIBA 3HMNA 3TZ9A 3ZRMA 5BVNA 5HZNA 5DFPA 4JRVA 5AMNA 4LV5A 3BX5A 1Y6AA 3G6HA 4TRLA 2YWVA 4LL0A 3UPXA 4A9UA 3QTWA 2QO7A 1W82A 1Q3DA 2XJ0A 2W7XA 4MF0A 4BDAA 4ZSGA 4E4LA 3COMA 4IWQA 3AT2A 4JR7A 3UIUA 4NU1A 3P9JA 2ITTA 4IBMA 4BZDA 4P7EA 1M2PA 3R71A 4LGDA 3TKUA 4ZIMA 1M52A 3KMWA 3A2CA 5BYYA 5HE0A 3E8EA 4C2WA 3KVXA 4JVGA 4BCKA 2QOFA 3BKBA 5CY3A 3R8VA 3C0GA 4KIQA 1QPJA 4QP8A 3GC9A 3VUIA 5IH5A 3LCOA 3OW3A 2A1AB 2VTMA 2F2UA 4LGGA 5F9EA 1J7UA 1YHSA 3ZUUA 3BLHA 1GJOA 3AMAA 2FGIA 1IEPA 4PWNA 4GJ2A 2QLUA 4RFYA 5IH6A 4JBPA 1IR3A 3I0OA 4I5PA 3D5XA 2I7QA 3TJDA 4Z7HA 4EH4A 4A4LA 3TACA 1LR4A 4FV4A 4YJPA 4X2JA 4XG2A 5HVJA 4ORKA 1VJYA 3H0YA 2RF9A 2IN6A 4FV6A 1A06A 5KZIA 4MBLA 3IO7A 4CFVA 2UVZA 4YSMA 1GZKA 4BWKA 4FICA 1QPDA 4AOIA 3LIJA 3UNJA 5IA4A 4QP3A 4CMTA 5HLWA 4FEXA 4FTRA 3R7OA 3O17A 1JKKA 2OKRA 2IVSA
chains in the Genus database with same CATH superfamily
1KE9A 3A7FA 5A4QA 4Z9LA 4FJVA 4BR3A 4IX3A 3UGCA 3VS7A 4FSTA 5JFVA 4H39A 2C6KA 5FG8A 3AMYA 1PJKA 5BQ0A 1AGWA 1V0PA 4PDSA 3UOKA 3RK7A 3SOCA 3NW7A 3HV3A 2FA2A 5BV3A 4RPVA 2G2FA 3DXPA 3KL8A 3HEGA 2GHLA 4TY1A 3QTUA 2C3IB 1YOJA 3PXYA 3BQCA 2C5VA 4FZ6A 4XV3A 5E8VA 1OB3A 5IZFA 5EQYA 1YQJA 4GUEA 5CU3A 3RGFA 4G6OA 4FR4A 4E7WA 4FKRA 4F9WA 4LOPA 2OXXA 4DEBA 4KB8A 4QP6A 3SDJA 4YR8A 4USDA 2OK1A 4FOBA 3PG1A 3IW4A 5AP4A 3TNPC 3VULA 1YKRA 4RJ7A 1ZY4A 1ZYDA 1YI3A 1BI8A 4V05A 4F7JA 2UZWE 4CV9A 5IUGA 5L2TA 3E88A 1GZNA 1KOBA 5HGIA 5FUTA 4L01A 3S2PA 2Y9QA 2UZBA 3R02A 4KIKB 3V6RA 2V62A 4R7BA 5HD7A 2F4JA 5EM8A 5KE0A 4APPA 1V0BA 3O71A 5B2MA 2BZHB 4I3ZA 2WTDA 3QRJA 2E2BA 2C6OA 2ERKA 3Q4ZA 4GG5A 5EDRA 1PYXA 3KCFA 2ETRA 2J0MB 4E4NA 2GU8A 3S1HA 1KSWA 1CM8A 2I0YA 3TDVA 3P5JC 2G15A 2VO7A 4JG7A 2PULA 3D5VA 3W10A 4KSPA 3PSBA 3SW4A 1MRYA 1DAYA 2RIOA 3CGOA 3ZEPA 1U59A 4WRSA 3V5QA 3DZOA 5DT3A 4NW6A 4UV0A 4AW5A 4D4VA 5D41A 5D12A 5J7HA 4RGJA 5F95A 3ZDIA 1W2CA 2OH4A 4ZY6A 4C59A 5BVOA 1YWNA 4AZTA 5TO8A 2JFLA 4ZSAA 3UDZA 4FUYA 4AU8A 4F1TA 3KGAA 4H3BA 2C47A 2C6DA 2ITPA 3F5UA 5AR7A 3HYHA 3R21A 1JKTA 2GSFA 3BYUA 3UNKA 3QXPA 3KXGA 1Y57A 3ZO2A 2VO0A 3RBWA 3TV6A 4QYYA 5DYJA 3LLAA 1UNGA 2JLDA 4TWOA 4AXCA 4AZEA 2AEGA 4IAYA 4JX7A 3SV0A 3S3IA 3QCSA 2V22A 3CTHA 4LOOA 4JXFA 3WOWA 4WRGA 4C2VA 5E9EA 4FNWA 4JI9A 4KIOA 3C0IA 4IWDA 1M7NA 2Y4IB 4HVIA 1GZOA 2VWYA 5BYLA 3LCDA 4OTRA 2CGWA 4AOJA 4HVDA 4EQUA 5CEOA 5LVNA 4RX5A 1XH9A 1XBBA 3FZTA 5HU3A 4CYJA 2QODA 3EN6A 1BUHA 4EBVA 3A7JA 4IJPA 2RG5A 2GQSA 3DLSA 2XS0A 1A48A 1H0VA 5GINE 1WAKA 3PPKA 4DG0E 4FBXA 3GQIA 3I79A 4Y95A 3LFQA 1DM2A 2P0CA 3UDSA 3ZSHA 3R6XA 3NUAA 5H8GA 5CAPA 5AX3A 4HNFA 3QKMA 5FXRA 4U3YA 4KA3A 3ANRA 2C6TA 4ZZMA 4FKQA 4G9CA 4N70A 1GIIA 2O5KA 3P79A 5HG9A 3UOLA 3BQRA 3OEFX 2C5NA 3NYNA 2QNJA 1PMNA 2QVSE 3OT8A 4QQJA 4BCFA 4FIGA 4EK4A 5ANEA 4F7NA 3DAEA 3KK8A 1R0PA 4IAKA 4G1WA 4I22A 1PF8A 2X0QA 4X3FC 5BUIA 4MYGA 4Z3VA 2F7XE 2BUJA 3CD3A 4ACDA 3IKAA 2X2LA 4FT9A 3TWJA 5FXQA 5DNRA 2NRUA 1IA9A 2PVLA 2YITA 3N4UA 3MIYA 5LOHA 3P86A 1OMWA 4GFGA 4E73A 2ERZE 4DITA 2O65A 3G9LX 3FJQE 4FZFB 1LPUA 2GHMA 4JDJA 2W5AA 2ZMCA 4XG4A 4IIRA 4NKAA 1VR2A 4M7IA 5KUPA 5EQPA 3EOCA 3FKNA 4G6NA 5FP5A 2BRMA 3TV4A 4GJ3A 4PMPA 1ZWSA 4GFMA 5C26A 1K9AA 4DDGA 4MX9A 2VN9A 4FEQA 1FGKA 1PMVA 2F49A 3DPKA 5ETIA 3V8WA 3QRKA 3PP0A 4ZTMA 3GU7A 1SZMA 4MD9E 2XZSA 4EH3A 5ANGA 2YM8A 5DRBA 3VS0A 3BPRA 4L3PA 4ZEGA 2Q0NA 2XIYA 4RC2A 2C0TA 5FBOA 3VBXA 5I3RA 3ML1A 4FGBA 1Q4LA 4FNYA 4RIYA 5EHYA 4ZS4A 5C4KA 1WBVA 5M51A 1FPUA 4O84A 3QRTA 4IEBA 4NYEA 4WG3A 3DXNA 4C02A 5J9ZA 4Y5HA 4DH1A 3RCDA 4IB1A 2QOBA 4QMUA 3PXQA 4O4BB 1UV5A 2F7EE 4OW8A 2BZKB 4BBEA 3V5JA 3PA3A 4DC2A 3NR9A 4HVSA 5JGBA 3PY1A 4YZMA 2V7AA 4KBCA 2JIVA 4QDEA 1OM1A 3HRFA 3QTZA 3I81A 1RJBA 4F08A 3WZUA 4ZTSA 4CV8A 4FMQA 4ZLYA 4GUBA 4L52A 3KVWA 5DHJA 4DBNA 4DA5A 4PX6A 4BF2A 3MY0A 4RQVA 2AC3A 3DB8A 4N57A 4L43A 2VAGA 3NX8A 4QMWA 3HV6A 1OPJA 5AIKA 3VAPA 4AT4A 4ACGA 2UZTA 4DFNA 4S30A 4U80A 1OUKA 2WIHA 4U9AA 4DH5A 4FSMA 2YM6A 4ALVA 2CJMA 2NRYA 5H9BA 3BU6A 3BV2A 4FT0A 4K33A 3QD2B 3C50A 4M0ZA 4I92A 5AUUA 3HMMA 5ITAA 4ITHA 1P4OA 5K0KA 1GNGA 3OS3A 3Q53A 4FEWA 4L7FA 1OIRA 3DTCA 2OO8X 3KXNA 3CTJA 5IDNA 2CLXA 4YJTA 4YTHA 3PJ8A 4E20A 4F6WA 2C5OA 4F6SA 3UDBA 4GS6A 4BCMA 2WO6A 2UZVA 3R83A 3N9XA 4IAFA 3VW6A 3BHTA 2C6MA 1OL6A 3BGZA 2OG8A 2YAKA 3ZLXA 4II5A 2XK6A 2HAKA 3OCSA 4PMTA 4NFMA 2REIA 2OI4X 1UU7A 3ZC5A 5H2UA 4YBJA 3ZO3A 1P5EA 2ZVAA 4MH7A 3S0OA 1XO2B 3ROYA 3I5ZA 1P4FA 2YA9A 4TWPA 4EOSA 2YM7A 2WMQA 3FMJA 3MPTA 3AGLA 4AGDA 5B7VA 3MA3A 3T3VA 3KN5A 4JIAA 3FMHA 4DHIB 4ERKA 2IJMA 2XP2A 3I7BA 3V5WA 4A4XA 2C6IA 4QMLA 5F20A 5IA3A 3IW8A 4Y85A 2JDRA 2RFDA 2BRBA 4YO6A 3KXMA 5CF5A 3B2WA 3NNXA 4F0GA 1NY3A 3U6JA 4YZNA 2ITZA 4RX7A 1BLXA 4EH2A 1F0QA 2JBPA 1Y8GA 2O3PA 4EWHA 3K2LA 1U54B 4JNWA 5D9HA 2YLFA 3WIGA 4CKIA 4DH8A 4AGUA 5IU2A 2HZ4A 3BYMA 4DHFA 4F6UA 3EIDA 5C9CA 3JXWA 2X0GA 3OW4A 2FVDA 2Y8OA 2Z02A 4WUNA 1OL1A 4ZSLA 4D4RA 3ZH8A 3RNYA 4FZAB 4DTAA 2CNUA 3QC9A 4B99A 4X3FB 3NSZA 3EQRA 3DKGA 2W05A 4C4FA 3PVBA 2RGPA 3DJ7A 3ZO4A 3OCBA 3NEWA 3VUDA 4JL9A 3L8PA 3E7OA 5IQFA 4Q5HA 1ZZLA 2QCSA 2W1ZA 4BDDA 1H1QA 3LQ5A 3HL7A 3SVVA 3TUBA 3HP2A 1PKDA 3GC0A 3IONA 4IM2A 4OBOA 3ORKA 3ENMA 4O21A 4WBOA 3OVVA 1H8FA 4UXQA 4YHFA 2V0DA 3FLNC 4ERWA 3LLTA 4N6YA 1XQZA 3WZJA 3U9CA 5IA1A 3FXWA 3MTFA 5FTOA 1L3RE 2JDVA 4LGHA 1JQHA 3UYSA 4I4FA 4ZZNA 3ANQA 4BICA 2CKPA 5I9VA 2JKOA 2XIXA 4N6ZA 2PVMA 2JGZA 2RG6A 5AV0A 3AD4A 1BX6A 2J9MA 5DEWA 4L42A 2XK9A 3KK9A 3TZMA 3UVPA 4C33A 3E93A 2YIQA 3BL9A 3B2TA 3TNIA 4FG7A 3NUYA 2CN5A 3NYVA 3R8ZA 5L3AA 2YERA 3Q4CA 4HYSA 3SXSA 4K9YA 2WMUA 3OMVA 3RCJA 5I9ZA 3MPAA 4AN9A 4W4YA 4AW1A 4RJ3A 2XNEA 4KRDA 3A7GA 4XG7A 3EWHA 1ZMVA 3GVUA 3Q4TA 2YDIA 2HK5A 2YABA 2YCSA 3G51A 2W4OA 2YACA 4IACA 3R01A 4ALWA 3SHEA 5C01A 2X81A 3TV7A 5E7RA 5TR6A 1JBPE 3KRLA 4BHNA 5HBJA 2A2AA 3CBLA 3E62A 4NM0A 4BN1A 5BVDA 3Q6WA 2BCJA 5EQEA 5HO7A 2R3NA 5F94A 3PDTA 1H28A 2QR8A 3LFAA 3EFLA 3R8MA 4H1JA 3SXRA 4GL9A 5L2SA 3W0QA 3R73A 2DS1A 1GZ8A 3NUUA 4WNMA 4G3GA 5AR4A 3F9NA 5L6PA 2ITXA 4QPMA 1Q62A 5GJDA 4FEVA 4TW9A 3NAXA 5HTIA 3PIYA 1NW1A 4O83A 1E1XA 5EW9A 2W4JA 4YSJA 1K2PA 4I5CA 4OTGA 2R3PA 4QP1A 2HW7A 3CQEA 3FL4A 1STCE 3BHYA 4YJUA 4UN0C 2RL5A 3BEGA 3LFSA 4UMQA 4BGHA 4DAWA 3UZTA 4IC7A 4NL0A 4BIEA 5CLPA 3N4VA 5DG5A 3RHKA 3UVQA 2BIYA 4FTIA 4EEVA 2XM8A 5K4IA 3Q5IA 5CU2A 4O7VA 3R22A 4DHZA 4LL5A 4HYUA 3FMDA 3QA8A 3UJGA 4C36A 4W9XA 5AUXA 3VRYA 3KQ7A 2UZNA 3FAAA 3HDNA 5A4EA 2XKDA 3EHAA 4GFOA 2X0OA 4AZWA 4G3EA 4FYOA 4D1ZA 4JDHA 3WF7A 2WELA 3AC8A 5K0XA 4QP4A 3PIXA 4YC6A 5AP1A 1VLRA 2XMYA 4XYFA 3H9OA 4YURA 4RA5A 4L45A 4ARKA 3LCSA 3MS9A 4YC3A 3U8WA 4DEGA 3R0TA 5DRDA 5HG7A 2WTJA 4D2WA 1WVXA 2WTKC 3QQJA 4TL0A 4ZZOA 5AAGA 4R3PA 3F6XA 4J97A 4O38A 1R0EA 4MUQA 4Y8DA 2CKOA 4DT9A 1MRVA 1YOMA 4GV1A 4KS8A 4AE9A 3WILA 3R7IA 4TTHB 4EH6A 2XIZA 4ZSEA 2OWBA 4FSUA 3L1SA 5A6NA 5IQEA 3VHKA 2FSLX 3GB2A 3NUXA 1UKHA 4G6LA 4L8MA 5AP7A 3DBDA 4ASEA 2PMNX 2ZMDA 5JRSA 3UPZA 4DDIA 5I9YA 3NFFB 5EK7A 4C3PA 1H1PA 5FRIA 3W2QA 3ZLYA 2ACXA 3QYWA 1MP8A 4B8LA 4F1MA 3MVLA 3AG9A 5L2WA 1ERKA 4ITIA 1NXKA 4FX3A 5ACBC 1PXMA 3U87A 4ITJA 4W4VA 5M4FA 1CTPE 5DMZA 3LCTA 3O50A 3D2IA 4I6QA 1H1SA 2Q0BA 3M2WA 3C13A 4XG8A 4WNKA 3BYOA 3D7ZA 1OL7A 1Q97A 2UZEA 3CC6A 4OTWA 3ZBFA 1H24A 5JMSA 3VBVA 5LVOA 4BCJA 3CE3A 4HPUE 2WMRA 3MH2A 4F63A 3KULA 3OHTA 1YXXA 4BIBA 2B53A 3PY3A 3QTQA 4FKGA 3C51A 2WTIA 4AOTA 2YIXA 4HZRA 5IUIA 4BCIA 3F5GA 5IPJA 1E1VA 2YIWA 3D14A 4GMYA 4M0YA 4OUCA 4PV0A 3GXLA 4A06A 1YOLA 4GRBA 4HNIA 4CQEA 5F4NA 4XUFA 4CCUA 1XH4A 3LMGA 4U79A 5LMKA 1YDSE 3RPYA 4FV9A 2C0OA 5JKGA 5M4IA 4R5SA 4V0GB 4X21A 4JS8A 3W55A 1Q41A 4QP7A 1DAWA 2W5HA 2YJSA 2IZRA 4YJSA 5LMBA 3GCVA 3MTLA 3EFWA 4MD7E 5AV4A 5EDPA 5CYIA 5KBQA 4UX9A 2XK4A 4K1BA 5JRQA 3P1AA 3AC1A 4O2PA 4AA0A 1XMLA 1HCKA 3KY2A 4EOKA 3EKNA 3KFAA 4PTEA 2E9VA 3OY3A 2XKCA 4DCEA 5CNOA 2B9FA 4Z55A 1SM2A 3DQWA 4BI1A 3W18A 3E92A 4R1YA 4W9WA 2XJ2A 1G8KA 1ZYLA 2BDWA 4ID7A 3D0EA 1V1KA 2UW7A 3TXOA 3UC4A 2OLCA 4BI2A 2P55A 2J50A 3HV4A 3W2RA 3W0SA 4HW7A 4O4DA 4TNBA 2ZYBA 4ZOGA 4MBIA 4E3CA 4O0RA 3WF8A 3RMFA 3FLWA 5HESA 4RA4A 2C3LA 4DEIA 4DTKA 5HTCA 2BAJA 3KN6A 4J7BA 1YI4A 3LXKA 3PJ3A 4D2TA 2VTJA 3PUFC 2ITYA 3FKOA 4AX8A 2Z8CA 5A6OA 4FRFA 2CLQA 3GNIB 3NYOA 3FWQA 3DDQA 4ZTRA 3QHRA 3PVGA 4J8MA 3V04A 4EK6A 2VWZA 4QEBA 3F66A 1YXSA 2ZB1A 3F3UA 4HGLA 2XIRA 4IB0A 2B52A 4IZ7A 5H3QA 2W1GA 3VS6A 5I9WA 4M69A 4I23A 4FKJA 5TT7A 3LFCA 4CFNA 4FI1A 4DGOA 3KIOC 1UU3A 2JAMA 3MY5A 3NLBA 2IWIA 4FTJA 3DA6A 3EQBA 4G31A 4TYHB 3ZOSA 1SVGA 4BCHA 4RVLA 4EL9A 4QMPA 5LARA 2XK7A 4Z7GA 4ZJJA 4R1VA 4CNHA 1PXKA 5FEQA 2JBOA 4ANMA 2XARA 1ZOEA 4O81A 3T8OA 3PP1A 4MEDA 4LMUA 4QP2A 4EH9A 2Z7LA 4PPBA 2A27A 3R7VA 3BLAA 5HLPA 4GKIA 4CEGA 4U97A 5CAOA 5HG8A 2W4KA 4YLJA 4AAAA 4RIWA 3IQ7A 1OKWA 3QRIA 3ZS5A 5CSXA 5B0XA 4CD0A 1VZOA 3I60A 3QUDA 1X8BA 4BDIA 3F3TA 4IHPA 3TIYA 1PKGA 4Y83A 3P23A 3TT0A 4DFXE 5IDPA 3OTUA 3PE2A 3IOKA 4O7TA 4BGQA 5L4QA 1F5QA 2J5FA 4BWXA 3RJCA 4AZSA 3L8VA 1ZMUA 4QTDA 4DGLC 3ATTA 3FLYA 2CMWA 3R7YA 4U5JA 2JDOA 2X9EA 4JAIA 4I0RA 4FK3A 4EK5A 3LXPA 3QGYA 2HOGA 2PVRA 1XHAA 1YVJA 4UEUA 3ZZEA 3FZPA 4ANBA 4IMYA 2BAKA 4QPSA 1W7HA 2X2MA 2XIKA 4HJOA 2PVKA 4BKZA 5C1QB 4U81A 4HVGA 3V51A 3FXXA 3Q9XA 4YPDA 4EH8A 5AV1A 3WYXA 4NM3A 1KV2A 1ZYCA 2P33A 3CKXA 4UBAA 1IRKA 3OBGA 4U44A 4YUQA 3F7ZA 5M08A 2QU6A 3R8UA 5E8WA 3DDPA 3EB0A 4KKEA 5E8YA 5ANDA 1SVHA 4IZAA 2BRGA 3GEQA 2XF0A 3UNZA 3AC3A 4BDEA 5JEBA 4JDKA 1OITA 4H1MA 4APCA 4L53A 1W0XC 3WE4A 2ZV9A 1M2RA 4F70A 2QOLA 5DN3A 3ROCA 1ST0A 3RAWA 4TPTA 4QYEA 2IG7A 3IDBA 4KIKA 2PVYA 1ZYSA 4O0XA 3VQUA 3KXZA 4OTHA 4CKJA 4KSQA 3AKLA 4DFLA 4H05A 1UNHA 2XKFA 2PE0A 3FXZA 5FM3A 2JFMA 2FSTX 3V5TA 3FI4A 3W0MA 2WMXA 2RSVA 2ITOA 2JKQA 3P7CA 4G5JA 1H0WA 2XNMA 5C8MA 5J7BA 4NSTA 2BAQA 2G9XA 3BYSA 3KMMA 5AA9A 2CHLA 3IOPA 1ZOGA 3GFEA 4L67A 4HCTA 3GCQA 2WB8A 1TQMA 3DY7A 4X3FA 4NT4A 3W2PA 3VBWA 4DEDA 2VZ6A 4FIHA 4IVCA 5HNIX 4AXDA 2JD5A 3L8XA 4MWIA 3O8PA 1XJDA 5HLNA 3RZFA 1J1CA 1GIHA 3FC1X 4S34A 2P2HA 3SOAA 3II5A 4C62A 3MJ2A 3EQPA 3GU4A 3OC1A 3QTRA 1SNXA 3LCKA 5GZ9A 3VC4A 5M53A 1H25A 3K5UA 4YC8A 4XCUA 1H26A 1LP4A 1CSNA 5M4UA 5C03A 4A07A 1G3NA 4FT7A 3MVMA 2FSOX 4I1ZA 4QMZA 2X8DA 3AGMA 1IAHA 3LMHA 3VS4A 3AKKA 4TYIA 3DBQA 3RWPA 4BJJA 4MXCA 3NAYA 3DBEA 4RIOA 5H8EA 3BELA 5AADA 3AT3A 5BVWA 2AYPA 2WKMA 2XYUA 3A8XA 3BBTB 4R5YA 2OFUA 3Q2JA 5LVMA 3PE1A 4YTIA 2UW0A 2YM3A 3R7UA 1W2FA 4EOQA 5T68A 2WEVA 3PVUA 3C4FA 5D7AA 3R7EA 4ALUA 1QPEA 2OZAA 4KINA 5GJFA 3VJOA 4BCGA 5HORA 2QOCA 3QA0A 4BKYA 4FIJA 2HWOA 3MFTA 4AFJA 3Q9WA 2CKQA 2HENA 3RM6A 5CZIA 5BUEA 4FIFA 3VW8A 4O7ZA 3EN4A 4C35A 4U42A 4NH1A 3HV5A 3D94A 5E8UA 1UNLA 5IQHA 3NUNA 2C3JA 2XK3A 3Q9YA 4OAUC 3MESA 3SQQA 2R0UA 4IB5A 5L2QA 4D0XA 4I94A 3W8LA 5GNKA 1GIJA 1H01A 3PWDA 4O4FA 2H9VA 4L68A 2QOQA 4PL3A 3FSKA 1WBSA 2Z2WA 4E8AA 4DTBA 4XNEA 2WPAA 1YXUA 3DAKA 3OEZA 4R3CA 4YNOA 2VTLA 3KF4A 3OF0A 4BYIA 1ST4A 4IAAA 4FZDB 4E4MA 4FTKA 5AP0A 3OBJA 3GI3A 4E6DA 2QG7A 2UV2A 3F61A 4Y5QA 3DOGA 3R1SA 4O0TA 4U40A 5FWKK 4FKUA 4MQ1A 3MV5A 2UW8A 2GS6A 4FL1A 2EU9A 3EZRA 3ZSGA 4AE6A 4CRSA 5AA8A 5IH4A 1KE7A 4UMTA 1J3HA 3QX2A 3ZHPC 1PMEA 2PU8A 3TJCA 4BB4A 3QQHA 1W2DA 4O0YA 2LAVA 2VTRA 5AUWA 3VUGA 4KABA 3EQCA 2OZAB 4ZTNA 2ETKA 3BE2A 4ZTQA 3KEXA 4O96A 3SG9A 4GW8A 4M67A 1J7LA 2C4GA 4F7LA 3EL8A 4FKIA 3ODZX 4CFXA 5CSPA 1WBOA 4CTCA 1QMZA 4FG9A 4NJ3A 3SRVB 3F7WA 2EWAA 1NA7A 4IADA 3RPVA 2OJFE 4G9RA 2VTOA 5TKDA 3ORTA 3F88A 4C7TA 5EI8A 4F99A 2GNIA 3ELJA 3OD6X 5CSHA 1WBNA 4WO5A 5CX9A 1HOWA 3RAHA 3VUHA 5IQAA 3PG3A 3IW7A 1YXVA 2EXEA 4J53A 3RPOA 4BZNA 3WE8A 5GZAA 3CP9A 4QRCA 4U6RA 3PJCA 4XH6A 3VONA 2O2UA 4ZMEA 3QLGA 3ITZA 3WBLA 4X6RA 2YN8A 1UVRA 2WNTA 2ITQA 4PPAA 2YJRA 5ETFA 4IH8A 4H58A 4IM3A 2WMVA 4RJ4A 2YCFA 3Q2MA 3DT1A 3MY1A 4MNFA 4V04A 3O8UA 1DS5A 1F3MC 4PTCA 3VS2A 4AF3A 3FI8A 5CVGA 3E7VA 3QD3A 4CZTA 4TWNA 5IF1A 3LXLA 4D1SA 1ZY5A 3NPCA 4DEEA 1YHVA 3PXZA 4NKSA 3QF9A 4FV2A 4TYGA 3LM5A 1OKZA 3FMLA 1JOWB 5CVHA 5JT2A 2QR7A 4CTBA 3FHRA 2Z7QA 4EOPA 4S2ZA 4HOKA 4ZMFA 4D58A 2JIIA 4C38A 2J0IA 2DQ7X 4QMYA 4M14A 2UUEA 3FMEA 3NIEA 3PIZA 4M84A 1BMKA 4XMOA 4EBWA 5AUTA 3JR1A 3ORZA 4BY9E 4PDPA 4D4SA 3I5NA 4ZAUA 3RAKA 2EUFB 2GQGA 3EL7A 1CKPA 3LZBA 4S31A 5IQIA 4W8EA 4AQCA 1OKYA 4DLIA 3A4PA 3FYJX 2IO6A 2F9GA 2VWBA 3SKCA 4ACMA 3HV7A 3MH1A 2J0LA 4BIDA 4RLLA 2DYLA 3ZLSA 3D5UA 1XWSA 2XRWA 1OKVA 2HIWA 5CT7A 5HKMA 1FVVA 2OFVA 3WZDA 3QYZA 5J5TA 4PY1A 4FTOA 5DE2A 1OI9A 2W9FB 3HRCA 5FBNC 1PXNA 4ANOA 5A4CA 4F64A 3QCXA 4YU2A 5JK3A 3EKKA 4R6VA 5K5XA 1O6LA 4BWPA 3L9PA 4MWHA 3NGAA 3DBCA 4RIWB 3ZTXA 2PY3A 2XALA 2IZUA 4DN5A 4U43A 2VWXA 3MFUA 3OXIA 3HNGA 2VTHA 5D11A 4XG9A 5AUZA 4AN2A 3FI2A 4IDVA 3CSVA 5HVKA 2A0CX 3R9NA 1VEBA 2G1TA 2XNPA 1S9IA 2CGVA 5AAFA 5FD2A 2BKZA 3PRIA 3PSDA 3DZQA 3JVSA 4MXZA 3VBTA 4O86A 3KRXA 3GQLA 3OY1A 2BHEA 4X6QC 4USEA 1B6CB 4O1OA 5DLSA 3UC3A 3HKOA 1U54A 2WMBA 3HECA 3R7GA 4OTDA 4R7HA 1R3CA 4O0VA 5J87A 1JAMA 3R63A 3FHIA 3MBLA 5CALA 4OT5A 3ZCLA 1M14A 2ITNA 5CAUA 3U55A 1OPKA 2PUNA 2WQOA 4E5WA 4TKSA 3EYHA 4GT5A 4EKLA 2YFXA 5DBXA 4XLIA 5AX9A 4MF1A 5AR3A 2ITWA 3UYTA 5BNJA 2CNVA 3CR0A 4H36A 3NFGB 3W0OA 4G3CA 4AAYA 3BHUA 2QU5A 4GSBA 2IW8A 2VX3A 3CS9A 3CD8A 3MFSA 3FZSA 3UP2A 3MW1A 4YMJA 1L8TA 4FNXA 1DI8A 3VO3A 4YTCA 4WUAA 5ANOA 5HCZA 4E5BA 3Q96A 5E1SA 1WBWA 4FV3A 2WIPA 2BDJA 4RVMA 1ZRZA 1KUTA 4QPAA 4WD5A 3TUCA 5E91A 4L7SA 3DNEA 2FH9A 2FSMX 1BYGA 1GOLA 2OW3A 3KCKA 4D9TA 4TZRA 3LJ1A 4MKCA 3BE9A 4GIIA 4RG0A 1ATPE 3FZOA 5EM6A 4Q9ZA 3C1XA 3F2AA 4J52A 5LQFA 4BDGA 2VWVA 3ACKA 2UZLA 4P90A 1BI7A 4EQCA 2KULA 3POZA 2JKKA 4D5HA 1HCLA 4CCBA 4N4SA 4PMMA 2B4SB 3QALE 5GIPE 4X2FA 4AW0A 4BJJB 5BPYA 3EN9A 3I0QA 4L46A 2W0JA 4RVTA 1BKXA 4U7ZA 5CF8A 3DK7A 4M8TA 3G9NA 1ZAOA 5CS6A 5CXZA 5DEYA 3OCGA 2X1NA 5GIOE 2VV9A 4FKOA 1IA8A 1TQIA 5AM6A 4ASXA 2VTTA 4PQNA 4QYFA 1B38A 2QOKA 5M07A 3FE3A 3QTIA 3KULB 4MXAA 3QWJA 4E93A 4XV9A 4HGEA 1M17A 1JSVA 2X39A 3VUMA 4RMZA 3CIKA 2CSNA 3ULZA 3W2CA 3MPMA 4DFYA 2Y6OA 4JQ7A 4GK4A 4R8QA 4EC8A 3SW7A 4AXFA 4A9TA 2HZIA 4KKHA 3ZRKA 2XVDA 5FXSA 2LGCA 1MUOA 4G3FA 5TOZA 3W2SA 2NYAA 4LV8A 2W1CA 3CPBA 4FL2A 5BMSA 1UWJA 4I6BA 4Y72A 4AWIA 5E4HA 3JY9A 3A62A 4O22A 3U4WA 2C1AA 5ETCA 3VNTA 2W5BA 4WBBB 4D5KA 1WZYA 2WEIA 5AEPA 3KRRA 3R8PA 4F0IA 1P14A 2VO3A 2IVUA 2UW5A 4ANSA 2RKUA 2VU3A 2XCHA 4IW0A 3C4XA 4RX8A 2P3GX 3L9NA 3S00A 4WA9A 2WXVA 1JKSA 2IW6A 3CCNA 3DTWA 4O0UA 3ZLWA 4C4JA 4CMUA 4D28A 3C4WA 5TF9A 4S32A 3PFQA 4YTFA 3A8WA 4IZYA 5JFXA 1W84A 4FSZA 5KMJA 2QKWB 3CQWA 4FV0A 5JFSA 3W1FA 3ZRLA 4U8ZA 2X7FA 2QOIA 3N51A 4GU9A 3GUBA 3EQHA 4ACHA 3QUEA 1FMOE 2YM5A 4PDOA 5CENA 3UMWA 4DGMA 4BDFA 4V0GA 2NNWB 4J1RA 2R3MA 2W1FA 4FV7A 2BTSA 4NUSA 4C58A 3WF5A 3VIDA 4DYMA 4CG8A 2R3OA 2WOTA 2X2KA 1PXIA 4BCOA 5EKNA 5L8KA 3ZMMA 4X2NA 1PYEA 3W0NA 1R1WA 1RQQA 3LHJA 3PFYA