4CVAA

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
254
Chain Sequence
b'FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cvaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cvaA01
3A8WA 4E73A 3DTWA 2OXYA 5JKGA 1PXJA 3RMFA 5HX6A 3MH1A 5DHJA 5EOBA 4EH7A 4DFXE 3WILA 2IPXA 2EXMA 2HWPA 5EW8A 5L2QA 1JVPP 5B2MA 4DFBA 4DGNA 3D2KA 4I6QA 4UWCA 2F4JA 2B9FA 4BYIA 4EHVA 3AC5A 4K0YA 3OCTA 4LGGA 5K3YA 4QP3A 4FYNA 5FRIA 5E8XA 2QVSE 2WQNA 4UYAA 5AP0A 4B99A 3O71A 4KBAA 4PL4A 5CAQA 3UOHA 1H07A 2W5HA 1UNGA 3S3IA 4D0WA 2Z7RA 3TNPC 2X8DA 3FDNA 4FV0A 2PZRA 3W33A 1I44A 3IDCA 1LP4A 3WF7A 3KF4A 4EOJA 1DAYA 2JBOA 3FI4A 3MVJA 3RTPA 1YHWA 1G5SA 4WHZA 1H1SA 4QYFA 5HVJA 3PIYA 3EJ1A 1M2RA 5AP3A 4MWIA 1FBNA 2G9XA 4KIQA 2BMCA 2WB8A 5M08A 4IC8A 3DZQA 4ZMEA 4HYIA 5LOHA 2AYPA 4JG8A 3QF9A 4V0GB 5CZIA 2VNWA 2GNLA 3SVVA 3FMHA 3ZYAA 3MBLA 5HIDA 5CTPA 3COMA 3PZHA 4PDOA 4UZHA 2WGJA 3HP2A 4BRXA 2W1DA 4OTPA 1U54A 4FKIA 3RWQA 2C68A 2OF2A 3R83A 5KNJA 1ZMWA 4J96A 2YN8A 3GC8A 4JDIA 3V5QA 5LWNA 3LXNA 3MESA 4YNEA 5I9VA 3R00A 1RQQA 1IAHA 2ZM4A 4BI0A 4RC2A 5HVKA 5EI6A 3UQGA 3CPCA 1JSUA 1F5QA 2R3FA 4DN5A 3UQFA 2HZ4A 3AQVA 4L3JA 4PY1A 4ONAA 5IDNA 4Z55A 4MKCA 4USEA 4FNWA 3H9FA 2H9VA 3UG2A 1R0PA 3BGZA 5BVKA 3W10A 4CYIA 4NCTA 4ZTQA 5DI1A 3VS3A 3R73A 2FUMA 4DEGA 2RF9A 3CY2A 3LLAA 4CT2A 4MHAA 2FYSA 4WRGA 4YP8A 4HVIA 1OITA 2GS7A 2ONLC 4IJPA 3EHAA 4WIHA 4A9TA 1KE8A 4DH3A 4EK5A 3PXKA 4IZ7A 4DGGA 3CD8A 4G3EA 2C5YA 2JGZA 4YGAA 5DOSA 4ZZNA 4MNEA 5DGZA 4Y5QA 5LJJA 4R7BA 4IMYA 5C01A 2BCJA 5K5XA 3G90X 2YCSA 5A4QA 2ETRA 5LVLA 5IA4A 2HY0A 5CNOA 4R3PA 5CANA 4ZSAA 4J1RA 5AUZA 2J90A 5IA0A 3AC2A 3PA3A 4XV3A 3L9LA 3MS9A 3MW1A 1MRUA 2QKWB 4O2ZA 3OCBA 4FEUA 3FLYA 3EFLA 3AMYA 4RSSA 4Q9SA 5IA3A 2VGOA 4LMUA 2WQOA 2YWPA 4QQJA 1URWA 1H24A 4I3ZA 3D94A 2WMSA 2YJRA 2BALA 3BKBA 2WMQA 4ZSLA 3L1SA 4ASEA 4OTDA 2QD9A 4BN1A 4N57A 3OTVA 2C30A 1Q61A 5C8NA 4M97A 3IDBA 5LVNA 2IW9A 5FM2A 4OT5A 3OD6X 4AW0A 3FKLA 4ZJVA 2B9HA 3OFMA 3VIDA 1CTPE 3W1FA 4C34A 3NUXA 4IIRA 3QC9A 2QO2A 4JOAA 4FSTA 3G0FA 4FVQA 4G16A 4U79A 4YZ9A 1OIRA 3QTWA 5BYYA 5IEYA 2NO3A 3PIZA 3TZMA 3EQPA 2H96A 4O6EA 4D2VA 4MXOA 4PPAA 3BYMA 1Q62A 5TR6A 3DTCA 3P4KA 5HG8A 4DE4A 4KIKA 1PMUA 4ZTNA 4TN6A 5CF5A 4V04A 1UU9A 3II5A 4P90A 3ZO2A 4MXCA 2Z8CA 4DTKA 4XLVA 4YJNA 2YM8A 4FSUA 1YXXA 3HUBA 4NTTA 1SMHA 4XCUA 5DR9A 1WBWA 4NH1A 5CVFA 5CQWA 3FMNA 5F95A 4YURA 5IQHA 4QPSA 2ZV7A 3ZOSA 5AUUA 3TDVA 2W5AA 2HAKA 4HGSA 3HX4A 5CEPA 1YXSA 3MH3A 3W2SA 5HCYA 4EH5A 2W0JA 3LW0A 2WEIA 2YA9A 4NM7A 4RIXA 4XRJA 5LCKA 5GZ8A 4CFFA 3BHTA 2XBJA 2ITVA 4QP1A 3QAME 1WBNA 5JT2A 1NW1A 5J5SA 4K8AA 3H0YA 5AR2A 2DUVA 5HQ0A 1NXKA 2QLQA 3LFDA 5L6PA 4YPDA 3BLQA 2EVAA 3Q4TA 5LVOA 2KTYA 3QXPA 4GL9A 4H1MA 3E93A 2BAQA 5CU0A 2CKEA 2WMUA 3OY1A 2C6EA 4TNDA 5EQYA 2BVAA 2CGVA 1IASA 4ZAUA 2A19B 4EWHA 4S32A 1STCE 1V1KA 2GS6A 2XH5A 3BGQA 3VS0A 4CKRA 4FOCA 3NUYA 4I6HA 4C4IA 4D9UA 3FUPA 3KK8A 5DMZA 2F2UA 2QOQA 3EOCA 4I0TA 2V5QA 5J79A 4GFMA 1YDTE 3RK9A 3MTLA 2W1FA 4OTGA 3RHXA 3SXFA 2GFSA 2X7OA 1ZY4A 4Y5HA 4E8AA 3AT2A 1Q4LA 1R39A 3GP0A 1WBPA 2YIXA 5DYJA 2XK4A 3CKWA 2UVZA 3TTJA 3LXKA 3R9NA 2OZAA 3GENA 5L8JA 3E8NA 1WVYA 4JG7A 5AWMA 4R8QA 4Z16A 2VTQA 2XNNA 3W8QA 3EN9A 2Y4PA 2XEZA 4FIIA 5CF6A 3HV3A 4CZYB 2C5XA 4N4SA 1F0QA 2CHLA 3Q9YA 3GCPA 1M17A 4C4HA 4CCUA 5CF4A 4ZLOA 3FMMA 2YAKA 1HCLA 3V5PA 4YJOA 2IVSA 3RNYA 4KAOA 4ZY4A 1OZ1A 4N6YA 2HELA 4RVKA 5AV3A 4IEBA 4RZWA 2NP8A 3UGCA 2C5OA 2XS0A 3MA3A 3P23A 4I5HA 3LKMA 2B4SB 1Q3WA 4EOLA 4S33A 2C6KA 3FZOA 3Q04A 5J9YA 3O50A 3FPQA 4ENYA 3ALOA 3W2RA 4BBFA 4RPVA 5KMLA 2VX0A 4D4SA 1O6YA 3VW6A 5TT7A 4C38A 4DEDA 2Z60A 4LGDA 5FUTA 4GH2A 3NYOA 2PU8A 1YRPA 3LCOA 1JKLA 2XKCA 3UZRA 4HVGA 3Q5IA 3PSCA 5FG8A 4DCAA 5DT0A 3P1AA 3LM0A 5JFXA 3UIMA 1DAWA 2GCDA 2QR7A 3PXFA 4ASZA 3UZPA 1J91A 1SVEA 3DPKA 3SV0A 4BCPA 3PPKA 5LVMA 4B6LA 5EM5A 2PUUA 2YCRA 2YLEA 3HRCA 4ID7A 3W18A 4PDYA 3NLBA 2WNTA 5E1SA 4FV5A 3DNEA 3EN6A 4DT9A 3S0OA 1PF8A 3TT0A 1LUFA 3D7TB 3R28A 4X6RA 2GNIA 5E8YA 3I6UA 5AP2A 1UNHA 4MXAA 2XKFA 4PPBA 5ANJA 4BIBA 4O91A 5AA9A 4CV8A 1AGWA 1ZYCA 1Q97A 3OWPA 4CD0A 3F3VA 4DAWA 2G1TA 2QG7A 4G5JA 4RJ7A 3CE3A 4O0XA 3NVKI 1WZYA 3BYSA 4FEXA 3V5LA 4H36A 4O1PA 3ZFMA 1IAJA 2PE1A 1K3AA 2VTIA 3AC1A 3ZXZA 3CTJA 3Q4ZA 4LI5A 1LR4A 2IN6A 4XH6A 2E2BA 3COIA 5H8GA 5FD2A 3BEAA 4A9YA 3DCVA 3NUSA 4A4LA 5IH6A 3ROYA 4HJOA 5DNRA 5AAGA 3OHTA 5DR6A 2J2IB 3BQCA 2CJMA 2WFYA 5F4NA 5HICA 2E9NA 3H9RA 4QRCA 3QTXA 1SVHA 1K9AA 4M0YA 3U8WA 3PE1A 3R02A 4FTOA 3ZTXA 4CFXA 1OKYA 4GFGA 4FSWA 2JDRA 4TNBA 3TUCA 4NCTC 2A27A 1CKPA 2VN9A 2XIYA 1YHSA 4FT3A 4FVRA 3VUKA 4D1SA 3AC3A 1ZWSA 4E5AX 3N51A 4K9YA 5JMSA 3RWPA 4F7SA 3PJ1A 2UVYA 2QCSA 1GZOA 3BELA 3CJFA 4WUNA 5D7VA 3RBWA 4R3CA 4QYGA 2J5EA 4RGJA 1H25A 2GPHA 3AMBA 5C26A 3Q3BA 4GU9A 4QMVA 4JBQA 5M4IA 1ZXEA 1ZZ2A 5AX3A 2J0JA 4IANA 4CVAA 1XH4A 4UY9A 4D2WA 1CKIA 1J1BA 3FL5A 4KINA 2XB7A 2OJIA 5M56A 4NM3A 2WAJA 5JSMA 3FMLA 5KBRA 1OKWA 2XK8A 2YHVA 4C02A 5JFVA 3KB7A 4XX9A 1WMKA 2YIYA 1NVSA 2GFCA 1R78A 4Y73A 1IG1A 4IM2A 3B2TA 4RLKA 4RQKA 3TKHA 5A4EA 1JAMA 3DQXA 3EB0A 4IQ6A 5FEEA 3O17A 2BDWA 2R3GA 3MJ2A 4QTCA 3HV5A 4G17A 4U7ZA 4CKIA 1YHVA 4AUAA 4U45A 4Y85A 5L2TA 2P3GX 5A4CA 2X7FA 3POZA 2I0VA 2WQEA 4FNZA 4XG8A 3PJ8A 4NEUA 4YO4A 3PXRA 5HU9A 4AFEA 4GW8A 4DGMA 2W4JA 4BCHA 2I7QA 4FICA 3EQGA 4JJRA 3CEKA 3GC9A 4GEOA 4XRLA 4FBXA 3OT8A 4FK3A 4IX3A 4QMTA 4V01A 5CEQA 4F70A 3NWWA 4QP2A 4JDKA 2XNOA 3UMWA 2E9VA 5IG1A 1UWJA 3ORPA 3L8VA 3TTIA 4WNOA 4DEAA 5BVNA 3VUGA 3LFQA 3RP9A 4DFNA 2VWXA 3KRJA 1YDSE 4LYNA 3K5VA 2VO6A 3DJ5A 4LFIA 5J95A 2JAMA 3FSKA 3P7BA 4ZZOA 5IH5A 2Y9QA 2NPQA 4FODA 3TNHA 2VWZA 2CNVA 3PPZA 3QGYA 5HBEA 3ZU7A 5HG7A 4BL1A 2VO3A 3U9NA 3ET7A 1M52A 3L8PA 2EB2A 2F49A 3CBLA 4BGHA 4L00A 2B1PA 3MPTA 3Q52A 5EFQA 5H9BA 2FSOX 5EM6A 4AA0A 4ANLA 4EJ7A 4YLLA 2VZ6A 2VTHA 2X0GA 1YW2A 4QP4A 1ZOEA 4UZDA 4R7IA 2AUHA 5HEZA 3A7IA 4GIHA 2GHLA 4IACA 2NRYA 4NKSA 3ZRLA 5BVDA 2RKUA 3BEGA 2OJFE 4C2WA 2QLUA 2UW0A 2GS2A 2XF0A 3QC4A 5C03A 3LCTA 5HTBA 1OL5A 2PHKA 4F6SA 4Q9ZA 3OBGA 3SRVA 1WVWA 4FKLA 5EKNA 4ZIMA 4NZWB 4R7HA 3TNIA 4O7ZA 3Q60A 3FL4A 3IQ7A 3HMMA 2LAVA 4J71A 3HNGA 4QMYA 2BFYA 3BLRA 1Q8YA 3A60A 3ACJA 3WZEA 5A4TA 5M44A 4C59A 4FL2A 5BMSA 3IW7A 4JLCA 4AU8A 5FQDC 4PMPA 2OH4A 3ITZA 4TW9A 3LAUA 5B2LA 3DXPA 3HECA 2YM7A 3LIJA 3IGGA 1IR3A 3NMUF 1B39A 1PYXA 2UZUE 5CAVA 2B0QA 4DFLA 1I09A 2C6TA 4V05A 1YXTA 5AA8A 4ZMFA 2V7AA 2UZEA 2YABA 1K2PA 4FSMA 4L43A 2FA2A 3R04A 4XG4A 3MSSA 3DBEA 3EQCA 3B8QA 3R7YA 5BVFA 3IW6A 4WG4A 1B38A 2OWBA 3VVHA 4BDAA 3CKXA 5F94A 4ZS4A 3MJ1A 2ITQA 3U9CA 3MA6A 4XV1A 1RDQE 2NRUA 3PUPA 4FKTA 2QNJA 4BDJA 3A4OX 4U5JA 5HE2A 3WYYA 4O86A 5JK3A 5T3QA 3RZFA 3UDBA 2PE0A 3V3VA 1Y6BA 4GJ3A 2JEDA 4EYJA 1FGIA 3BPRA 3LCKA 4AT3A 3WIGA 4J99A 2WKMA 3UVQA 4NM5A 2PMOX 1NVQA 1WBSA 1X8BA 1GZ8A 2CLQA 2HY81 1LPUA 5D1JA 5DIAA 3QQLA 5FP5A 4IAFA 3COKA 4JQ8A 1VYZA 2E9UA 2F7EE 2QODA 3CCNA 5FBNC 1GIJA 1OPKA 4H1JA 2Q0NA 4HPUE 4EHEA 5BNJA 2XM9A 2Z7QA 2I0HA 3KRRA 3VS6A 4HVDA 3MYGA 5J1VA 4EC9A 5AIKA 5JQ8A 3VN9A 2DYLA 4GRBA 3GOKA 3O23A 1TQMA 4NIFA 5IKWA 2W17A 2A4LA 4D5KA 4CT1A 4ASDA 4GS6A 3I5NA 2OBJA 4PF4A 4I0SA 3BLHA 3EN4A 3FC2A 1XHAA 4XG7A 4JVGA 2R0IA 2YM4A 5ACKA 5HBJA 4Y83A 5CT0A 5A6NA 2OO8X 3KMMA 2ZMDA 2CN8A 4TT7A 3FY2A 5KHXA 3FEGA 4AFJA 4D5HA 3CGOA 2CKOA 3FZSA 4FZ7A 3ZMMA 5E7RA 3QTQA 2C4GA 4W4XA 2Z2WA 3FY0A 1OL1A 5FM3A 1H1QA 3R1YA 5DE2A 2WZJA 5J5TA 3R9OA 4RA4A 2B7AA 2BFXA 5E4HA 3E64A 4EOPA 4UMPA 2PWLA 3LVPA 2ZDUA 4P2KA 3ZM4A 5A14A 1FMOE 5HLPA 3RAHA 2WTVA 3FKNA 4RBLA 4BVUA 4E4MA 3BU6A 4WG3A 4AWIA 2NNWB 5IQEA 3EKNA 2IZTA 4FKRA 4NL0A 1GOLA 2OW3A 4PMTA 3FMKA 3RPSA 2X39A 5I9WA 4FC0A 2CGXA 5JGAA 4IM0A 3LZBA 4TWOA 4F9WA 1REKA 3R9RA 3M11A 2QHNA 5IQCA 2ZV9A 1YOMA 4IVCA 4RJ6A 2PULA 4I6BA 1UA2A 4NYEA 1ZYDA 3AGLA 2OJGA 3DKCA 3M2WA 1VJYA 3VBVA 4NW5A 4CFVA 3DJ7A 1JKKA 1W84A 4M12A 4M3QA 4EWQA 2OZOA 3BRBA 4ZJJA 4YR8A 2YIWA 3QRKA 2WIPA 3RINA 3G9NA 5K4IA 4FGRA 5HKMA 4IAYA 3NAYA 1PMNA 4J8MA 4Y8DA 4YZBA 3HMPA 3VHEA 5AM7A 2JITA 3SC1A 4CRSA 3M42A 5D12A 1WFCA 3FYKX 2GU8A 3KXXA 2J0KA 3BU5A 2YFXA 2XM8A 3F2AA 3QGWA 5ACBC 5KKRC 3H9OA 2ZM1A 4OGRA 4KB8A 4W9WA 1W0XC 3A7GA 4BY9E 1REJA 3SAYA 3VRYA 4EZ3A 4M68A 3BU3A 1KV2A 2QOFA 4E4NA 4AN3A 2CNQA 2YM5A 2J51A 1QPCA 2QI8A 4FKGA 3GNIB 5D9HA 5DH3A 3ZO3A 4EK6A 3TNWA 2PVYA 3HMNA 3KXGA 3UE4A 5CYIA 2CNUA 4QPMA 4B8LA 4XP0A 4O6LA 3FXXA 4X2FA 4XOYA 4OTQA 3HGKA 2R9SA 3DDQA 2X9FA 5E8WA 3V04A 4BTJA 3N4TA 5HTIA 4TKSA 5ANGA 4TXCA 3EQBA 3BV3A 4ZEGA 3R8VA 3C0GA 3IW4A 4UXLA 4YZCA 4L67A 4TL0A 5GHVA 3LCDA 3ACKA 3FHIA 1YQJA 2HIWA 2C69A 2UZWE 3EN5A 3F6XA 3TKIA 1XH7A 3LQ5A 1IA9A 4W4YA 3FLSA 5I3RA 2ZOQA 1QCFA 4YHJA 3C4FA 4BICA 3V01A 1W8CA 1FPUA 2C5VA 3CQWA 3G6GA 4QYYA 2WTKC 4ZY5A 2P2HA 3FI3A 4FKUA 3GI3A 3RALA 4AW5A 3OOGA 4X3JA 5KMNA 4L45A 2ZVAA 2R64A 5H2UA 3QTUA 3C4EA 1OUYA 1P14A 5AR3A 5IZFA 1J7UA 2R4BA 3CXWA 3LPBA 4JBOA 5B7VA 4RWJA 5CALA 3SA0A 4GKHA 5HU3A 2J4ZA 5FEDA 5L2WA 5HD4A 4AF3A 3FBVA 1DS5A 3IGOA 3MI9A 3ZO1A 4BTFA 4X2NA 3TNQB 2VRXA 3R6XA 4BTMA 3BBTB 4D2PA 4F9AA 4XEYA 4I1ZA 3ZXTA 3UQCA 4WO5A 2ITPA 3RAKA 4F08A 2YLFA 4M84A 3EN7A 5KCVA 1BUHA 4AGWA 3QYWA 5CI6A 1OM1A 5C27A 4IB0A 3Q9WA 3HA8A 4TZRA 1XR1A 2FB8A 2G2IA 3NYXA 4IVAA 3CR0A 2VWYA 4TY1A 4F0IA 2QU6A 3HV4A 5J9LA 4UALA 4C33A 3ZUTA 5A9UA 3K2LA 5CSXA 2R0UA 4PMMA 4RJ4A 4YJTA 3FQSA 3EWHA 4J95A 3ZLSA 4I5CA 4EOMA 3DKOA 3ZZEA 3IPHA 4XV2A 4C61A 4DEEA 5A54A 5K4JA 3DBQA 4Q2AA 5HE1A 4DHFA 3W55A 3UNKA 5AAEA 3MFRA 4U9AA 3FZPA 3R71A 5AUTA 4F1TA 3KULA 2JBPA 5I9UA 4IWDA 4M8TA 2IVVA 3PA5A 5JZNA 3FHRA 5I0BA 3A62A 2XA4A 4HZRA 4MEDA 5DLSA 1OL6A 2YIRA 4UMUA 1GZNA 3QRUA 4HCVA 5EYKA 4H58A 1UNLA 5AV0A 3COHA 3MH2A 3MY0A 5BYLA 4ALUA 2C1AA 1XWSA 2UZNA 3LJ1A 3EIDA 2W7XA 3GU5A 3PY0A 3Q5ZA 4FZAB 4K1BA 2PVMA 3KL8A 4YC6A 4MWHA 4JX7A 5EYDA 3ZDIA 4ZLYA 2P4IA 2Y6MA 3S95A 3L9MA 3DXQA 2PSQA 4D2SA 4P7EA 3D9VA 4CMUA 3R8MA 2PVRA 4JRVA 5AP4A 5DG5A 3HYHA 4ZSGA 4ZZMA 5IMEA 4CZUA 5EKOA 2ZM3A 4YC3A 2C6OA 3EQHA 4FTJA 2WMAA 5HNBA 4FF8A 4RMZA 4RFYA 3OUNB 2PL0A 4AN9A 3TV6A 4FL1A 4RC4A 4FTUA 4YBKA 4U3YA 5IPJA 4DITA 2F2CB 3K3JA 3LE6A 3R8UA 2QC6A 3F5UA 3V8TA 4LV5A 4O22A 5F20A 4LG4A 3TZ9A 3KVWA 3ZDUA 4D0XA 3I7BA 3I1AA 3D5WA 1OGUA 4V0GA 5AUYA 2XUUA 4IB5A 5BUIA 1JKTA 1WCCA 3KQ7A 3BE9A 3OUKA 5FEQA 5EM8A 5AUXA 3R01A 1Z9XA 1VR2A 1APME 1OECA 3E7VA 3MVMA 3MV5A 3V51A 3BV2A 2YDJA 2BUJA 2QKRA 1H00A 3HLLA 3MGYA 4QMPA 2J5FA 4O7VA 4QQCA 3BI6A 2WELA 2Y4IB 3ELJA 4FUYA 5CNNA 3QQGA 2XRWA 1JBPE 4DLIA 3NS9A 4A06A 4BDHA 2VX3A 1T45A 4BBMA 3NW7A 3KC3A 4BZOA 1ZMUA 2X81A 3DBFA 4HGEA 3RI1A 4BDDA 4BBEA 4GU6A 5JGBA 1ATPE 4XG6A 1WBTA 4LV8A 5KX8A 5E8ZA 2EWAA 3PVGA 2ETMA 4QMSA 3WIKA 4BIEA 1Q41A 3D0EA 1VYWA 2C5NA 3PJ2A 3P79A 4L01A 4MBIA 4GT5A 3TZ7A 2A1AB 4YUQA 5L2SA 4RX8A 4BC6A 3QQHA 1KE7A 4FTAA 4HZSA 3LFNA 3LCSA 3UIUA 3V8WA 3TUDA 3TN8A 3LOKA 4MQ2A 5EYCA 1UWHA 5HVYA 4CCBA 3GEQA 4XHKB 3GOPA 3H4JA 5KZ0A 4AGDA 3NX8A 3PTGA 3IKAA 1XJDA 1V0BA 4WBOA 3E3PA 4O0WA 4JAJA 4HPTE 1DI8A 4YTFA 3E62A 2W99B 3E5AA 2UW5A 3JY0A 3GT8A 4Y95A 5HCZA 3KF7A 4IE9A 3E7OA 3UOLA 1RJBA 2WD1A 4AS0A 4LGHA 4X2JA 2R3KA 4USFA 2GTNA 2V55A 2VWWA 3KA0A 1H26A 4UMQA 4YZNA 4C62A 3FLWA 5I9XA 4S34A 5GINE 2W9FB 4XYFA 3QTSA 4ALWA 1IA8A 3FWQA 3L9PA 4FK6A 2X4FA 3ENHA 4C7TA 3LJ2A 1YXUA 3NNVA 4TYHB 4O38A 5FP6A 4AW2A 3TM0A 1S9JA 2UVXA 4G3DA 4XNEA 4BDEA 2VO0A 3FPMA 4II5A 3HDNA 3V5JA 3P7CA 3WOWA 3LJ0A 2VWVA 1RE8A 4AX8A 3VQHA 3AD4A 4O0TA 3I81A 5CENA 1MRYA 4AN2A 5KMOA 3TIYA 4ZY6A 4KIOA 5AIRA 4Z3VA 2W9ZB 3RHKA 4APPA 3I0OA 3DB6A 5GJDA 4EQCA 4RLLA 3WZDA 1CDKA 3C4XA 3ZH8A 2VV9A 3ROCA 4FZFB 5BUJA 4DC2A 3R8PA 3CQEA 3UYSA 3UVRA 5EHLA 1YI6A 2R3QA 4QNYA 4AE6A 2GNHA 2R3JA 4IAZA 4RFZA 4BKZA 3PLAE 3LMIA 5B2KA 4ALVA 4EOKA 1FVTA 1JLUE 2ITWA 4IX5A 2C0OA 3FI2A 5ANIA 2WU7A 2ZV8A 4JQEA 1XBAA 4O7NA 4FV3A 4CMOA 5EDPA 2V7OA 1UVRA 3MVHA 4Z7GA 3QD2B 4UV0A 4L6QA 3EFWA 1FGKA 4KNBA 4O83A 3GFEA 3MTFA 3RCDA 4DG3E 2YERA 3UO4A 3QKKA 5L6OA 1Q8ZA 1V0OA 4MVFA 4DTAA 2H34A 3OEZA 4F4PA 2CCIA 1Z57A 4C58A 1KOBA 2PK9A 2RFDA 1H4LA 2C3JA 4ZSEA 3FXWA 4EH2A 3ZUUA 3PDTA 4J53A 4KS8A 4PRJA 4O0RA 4WA9A 3UP2A 3OWKA 1W82A 2YIQA 2VWUA 4U43A 3WI6A 3SOAA 2IVUA 4YMJA 4X3FB 2V0DA 3ULZA 5GIOE 1GY3A 2JDOA 2J0LA 4ERKA 3KN6A 3MIYA 3I60A 3JUHA 1Q99A 4FG7A 1QPJA 3UPZA 4IVBA 5GJFA 2XJ2A 5KZIA 3UNZA 1O9UA 3PZEA 4GG5A 5K0XA 4KSPA 4DG0E 3MH0A 4BGGA 2GMXA 2X7GA 4IZAA 4U40A 2H6DA 2IWIA 3FE3A 2ZDTA 4KS7A 4OBPA 3OWLA 4FTQA 1JQHA 5CU4A 4AA4A 4G2FA 1NA7A 4YZMA 5HORA 3PY3A 2WMTA 4AOJA 1JSTA 5HD7A 2HOGA 3DAEA 1GNGA 3MB7A 4I0RA 4AW1A 4CQGA 3Q96A 4I5PA 3GCSA 3PYYA 2EUFB 1ZYLA 3AG9A 3I79A 4Y46A 4FTRA 2X2LA 4BWPA 3DJ6A 4UX9A 2E9PA 4KBCA 4WG5A 1NT2A 4QMLA 5D7AA 4EKLA 5ANDA 3TCPA 4BR3A 4M14A 3OROA 1KOAA 3QCYA 1RW8A 4GK2A 4RIWB 2CKQA 4FTNA 4FT0A 1FMKA 4EK4A 1U46A 3OZ6A 4GVAA 2WMRA 4I4FA 2VGPA 4KRDA 5IEVA 3ZCLA 1Y91A 4FV9A 2V62A 3VBYA 2GDOA 1ZMVA 3A7JA 5LCJA 4W8DA 3WYXA 5IU2A 2O2UA 3TACA 4L53A 4F65A 4MX9A 4FTIA 4PP7A 4OAVB 3NUAA 4FT5A 1UU8A 1G8SA 1W7HA 5E9EA 4USDA 3DK3A 2BAJA 5ANOA 4MBLA 4FV7A 4MTAA 4TTHB 3VW8A 3BHYA 4XBUA 5BMMA 5A6OA 1IRKA 4LUEA 3ZFYA 3V6RA 2ESMA 4FV6A 4OBOA 2YDKA 2VNYA 5A46A 5LXMA 4IDTA 2UUEA 1XH9A 2H8HA 2QOLA 3PG3A 4YC8A 4FTKA 4TWPA 5CY3A 3PSDA 3H30A 1TVOA 1XO2B 4I41A 3F3TA 3S4QA 4D58A 4A07A 4M7IA 3WF8A 4M13A 3TWJA 5BVOA 3Q2MA 5T68A 1KUTA 3GCVA 4PNIA 3P86A 2PVNA 4AAAA 5J7HA 4FG9A 4MF1A 3JR1A 4O0UA 3D7TA 3IECA 3K5UA 3QL8A 3BYVA 5CT7A 3VBXA 3ANQA 3RM7A 3W8LA 5F9EA 4EQUA 4FE2A 4GYGA 4D1XA 3ZM9A 5M09A 4TPTA 3P0MA 2ERKA 5J7BA 1O6KA 3RKBA 3O8TA 1MQ4A 4CTBA 2XIRA 3HEGA 4PX6A 2R7BA 4XG9A 5EI2A 5ETCA 3JS2A 3PJCA 4GT3A 2C3KA 1J3HA 4GMYA 5DBXA 5FDXA 4F7JA 3VBWA 3QBNA 1XBBA 5EI8A 5M4CA 3G5DA 2JIVA 3E3BX 4HOKA 3CTHA 2UW7A 4N70A 4QMWA 4ZTMA 5AV4A 1DI9A 2FVDA 4AA5A 4JR7A 3KMWA 3ATSA 3ZSGA 5E92A 4QMUA 2QQ7A 3IS5A 3MWUA 3HP5A 5HBHA 3UMXA 3OG7A 2BAKA 5IQFA 1PXPA 2DS1A 2F57A 3H10A 3KXZA 2J9MA 3U87A 3WBLA 3KVXA 5J87A 3QHWA 3PLSA 3DBCA 3GVUA 2BTRA 2XVDA 3NZ0A 4YSMA 3H3CA 3NEWA 5K5NA 5CVGA 2HXQA 4LUDA 4IH8A 3PJ3A 4I6FA 3F2NA 3R7VA 3C0IA 5JFWA 4R77A 3TL8A 3G0EA 5CU3A 4U81A 2BRGA 2UZDA 3DT1A 4JX3A 2W06A 3ZS5A 3UO5A 3QZFA 3O8PA 2B52A 4ITHA 4IXPA 3NCZA 3IK3A 4M66A 2W96B 2HZIA 3RK7A 3P7AA 4WRSA 2V22A 4O7RA 4FG8A 5AP1A 2W4KA 3NYVA 2Z7SA 4K11A 1V0PA 2J50A 4QNAA 3ZRMA 5HO7A 3GC7A 3HRBA 5EW9A 3GUBA 2CMWA 5E8TA 4FIFA 5DT4A 3C9WA 3NNWA 2VUWA 4PUZA 2XRUA 4YJSA 3TV7A 4L7FA 4YSJA 4O7TA 2BZJA 3T3VA 3BYUA 1Q3DA 1A48A 2WQBA 2RSVA 5IA1A 5ANEA 4ACCA 5AR7A 1DM2A 3AT4A 4LOQA 4ZTHA 4BB4A 3WF9A 4FZ6A 3QCSA 2QO9A 5DEWA 3AC8A 4AZTA 5CSWA 4FMQA 4ZTRA 4AZVA 1XBCA 3ANRA 5J8IA 4EONA 2PY3A 1G8AA 4GJ2A 3NUUA 2WMXA 3F5PA 4QO9A 4DGOA 2HK5A 2J0IA 5CEOA 1JSVA 5GNKA 2VD5A 5E1EA 4GV1A 3EH9A 3UODA 5H8BA 3WF5A 4DT8A 2QOOA 2RFSA 5ITAA 5CQUA 2E9OA 4EQMA 4PP9A 3SDJA 4R5SA 3QFVA 2B53A 3CIKA 4C36A 3T3UA 4XMOA 5KMJA 2G2FA 5CX9A 4ZXTA 4R3RA 4O27B 2VTLA 3NPCA 4FKOA 5IA5A 1H01A 3IW5A 4BZDA 1J1CA 1Y8GA 4LL0A 4ENXA 1OL7A 3C1XA 4K2RA 3GB2A 4YNOA 5IQBA 2C3LA 3R22A 4CXAA 3OW4A 4YJVA 4RJ5A 2WQMA 1ZYJA 5IQIA 2JC6A 4M69B 5TE0A 2Q0BA 3SXSA 3AT3A 4BIDA 4FGBA 2QONA 3SKCA 4C57A 1A06A 3GGFA 3QU0A 1H08A 2W1GA 3MN3A 4BCOA 3W32A 2VTTA 4MNFA 1M7NA 4MQ1A 3A8XA 5CAOA 2WOTA 2IZUA 3E92A 3OCGA 1EH4A 2PVLA 4ITIA 3E87A 4QMQA 3TZ8A 4J52A 1GZKA 4RX7A 1BI7A 3VRZA 3CJGA 4YJUA 5C1QB 1PXLA 3BX5A 3QWKA 3OXTA 1Y6AA 4FSNA 3V5WA 1R0EA 4HGLA 4QP8A 2I1MA 3TXOA 3PY1A 4MYGA 3VS2A 4FSYA 4ANMA 1Y8YA 1SM2A 2LGCA 4Q5EA 4YTCA 4G34A 3FXZA 3QZGA 3UYTA 2VTOA 4J7BA 3RK5A 4QYEA 5IDPA 5AUVA 4OLIA 4X6QC 2WEVA 4B4LA 2CN5A 2JKMA 4JAIA 4W9XA 1XKKA 3QCQA 2W1EA 4X21A 3ORIA 3ODZX 4ZTLA 1P4FA 4ASXA 3D5UA 5CSHA 3U6JA 2PVHA 3F5XA 1KWPA 5AP6A 3VF8A 4CLJA 4OAUC 4KA3A 4K6ZA 4BDKA 2HCKA 4EUTA 3FLZA 4CFWA 4GKIA 2XK6A 3FLQA 3L9NA 1S9IA 4FSRA 2XNEA 1WAKA 3Q32A 4UWBA 3CS9A 4CEGA 4JR3A 5JEBA 1SVGA 3A4PA 3PG1A 4QQ5A 4QMZA 3Q4UA 4LRKA 4EZ7A 3QRTA 2F7XE 3NIZA 4AZWA 1GIIA 4EH9A 4HYSA 4L68A 5C4KA 1WBVA 3QZHA 3UIBA 4FL3A 1WBOA 1PJKA 3UPXA 5K9IA 3AOXA 4I5MA 5EK7A 5IMXA 4O82A 5J1WA 5AR8A 2CKPA 3Q2JA 4GUEA 4BCJA 4YZDA 4D4RA 5HTCA 2HW6A 3ZLYA 2OGVA 4O0VA 3TJDA 4CNHA 2YCQA 1G3NA 1PXNA 3U4WA 3NYNA 3TG1A 5H3QA 4NM0A 1OPLA 1GAGA 2B54A 4FV4A 4N0SA 1H1PA 3ZONA 4WOVA 4AT5A 3VWAA 3ZLWA 2DWBA 4E3CA 3R7OA 4BCMA 4CG8A 3GBZA 5ETFA 3RPRA 3UC4A 4XOZA 4XUFA 3EYGA 2PZPA 5CEIA 2BHHA 3DOGA 4H3BA 4AOIA 4L46A 4NTSA 3HVCA 2HW7A 3T8OA 1GIHA 4P4CA 5D41A 2YISA 3QUPA 4FT7A 4OTFA 3VS7A 4RFMA 4PTGA 4Z9LA 1BYGA 5ICPA 4BCQA 1BL6A 5KMKA 2PZYA 1KE9A 1TQIA 4A4OA 5LMAA 3T9TA 4AXAA 4CFMA 3T9IA 1BMKA 1OVEA 4IWQA 4HVHA 4BCIA 1E1VA 2XKEA 3DKFA 3ZLXA 2R2PA 5I4NA 4CTCA 3OC1A 4DFZE 3C7QA 3R1QA 4E1ZA 1KE5A 3BQRA 4F9YA 2WPAA 5EHOA 4XBRA 2BRMA 3EZRA 2UZLA 3QD4A 3SW4A 4ANOA 3R2YA 1UU3A 4B0GA 2W05A 3C5UA 3ENMA 4FIGA 2ZB1A 4KD1A 4LRJA 4XP3A 5BVEA 5KUPA 5BYZA 4NSTA 3U6HA 3V6SA 4DYMA 4C37A 3HAMA 5M06A 5BX0A 3VAPA 3GQIA 1U4DA 2GTMA 3ZSIA 3HV6A 3PRIA 3SHEA 4G9CA 4PTCA 3NNXA 3O7LB 1XH6A 2X9EA 3MFTA 4OR5A 4DCEA 3EFKA 4E20A 3NIEA 4HYHA 3DB8A 4MXZA 4FX3A 4EH4A 2R3OA 4YJQA 1OIQA 2JKQA 4AQCA 4GIIA 4NJ3A 3CC6A 3QCXA 2PMIA 4OW8A 4IB3A 3WE4A 4Z7HA 4KWPA 4QOXA 3SW7A 2UW4A 3I0QA 2AC3A 3NDMA 3P5KA 4R6VA 4G9RA 4FNXA 5TOZA 5A3XA 1CKJA 3NW6A 4QMOA 5E8SA 2ITNA 2EXCX 1E9HA 4GCJA 4KKEA 3ZRKA 4AG8A 3IO7A 3NW5A 4FI1A 4I4EA 4CQEA 5CXZA 3SG9A 3P08A 4NW6A 4IAKA 4LRMA 4A9UA 1ZAOA 2WTWA 4DA5A 3VHKA 3NCGA 2YWVA 2R3NA 4IM3A 3F2RA 3QLGA 2PVKA 2O8YA 2R3LA 4XG2A 4ZSJA 2ZB0A 3U51A 3DXNA 3LHJA 3QRJA 3BWFA 4DF3A 3G51A 4C0TA 3I7CA 4G3CA 4IVDA 2ITOA 4A7CA 2OICA 4FEQA 3RPYA 2VTNA 4FEVA 2C6LA 4MK0A 3PRFA 4A4XA 1UKIA 3RJCA 4XV9A 2W1ZA 3QTRA 3Q9ZA 2OFVA 4UWYA 5HOAA 4EC8A 5DRDA 4E5BA 4NK9A 4L8MA 4M0ZA 5HGIA 4E5WA 1UV5A 5HE3A 1VZOA 2BPMA 2REIA 1MP8A 1FVVA 1SYKA 4CYJA 4O1OA 4PNKA 4ERWA 5CWZA 3ORTA 3P9JA 4KIPA 4U42A 4EORA 4EOQA 1YI3A 4LMNA 3TUBA 2UW6A 3DKGA 3W2PA 3IOPA 4UMTA 3HAVA 1Z5MA 3FZTA 2YEXA 2OG8A 2J6MA 3CGFA 3CQUA 4QP9A 5HNIX 4HCUA 3W2QA 2CCHA 3UZTA 2WTIA 3C4WA 3D5VA 3GU8A 1OBGA 4IWOA 4YPSA 5AAFA 3BYOA 3FZRA 3F7WA 3DFAA 3UG1A 5CF8A 4D2RA 2JIUA 5JRQA 4FSQA 4PWNA 2OKRA 3SOCA 5EH0A 3BGPA 4ANBA 4NFMA 5FTQA 2FSLX 4RZVA 4BCGA 2BILB 2OLCA 2CLXA 4WSQA 3IONA 1GJOA 1YKRA 1QPDA 2YCFA 4JIAA 4TWNA 5M55A 4YO6A 4L52A 4IBMA 1UU7A 4UXQA 2R3HA 4JNWA 4U41A 2C47A 4L42A 2CPKE 2Q83A 2X2MA 5HG5A 4PDPA 2R3PA 2BIKB 3JYAA 4U0IA 3SX9A 3ORXA 3OCSA 4RWIA 4BYJA 5JH6A 5AP7A 4PMSA 2OFUA 3QYZA 3QWJA 4ZS0A 5JRSA 5HIEA 4O7WA 4AP7A 5HZNA 5E91A 1U54B 4DBXA 2CSNA 1Y57A 3MY5A 3SG8A 3FMDA 3PVWA 3FAAA 4DG2E 5A4LA 1WVXA 4NUSA 4CLIA 2C1BA 3R9DA 4F9CA 3ULIA 5CAUA 3QHRA 2C6IA 3NSZA 4IJ9A 4KKHA 2QOHA 4I20A 2XYNA 1IEPA 3EQRA 2XEYA 4MD7E 5EDRA 4OTWA 1PXMA 3ZFXA 4EH6A 3NNUA 3ERKA 3FJQE 3WF6A 3KMUA 2WOUA 3DK6A 3VS1A 4C2VA 2VO7A 4E6CA 4EKKA 4W4VA 1PW2A 3EZVA 2PMNX 2WTCA 4C4FA 2QOCA 3PXYA 2GNGA 2QOBA 3PA4A 2QOKA 3E8EA 3FQEA 3Q53A 3R7IA 5KHWA 2FGIA 4QP6A 4WBBB 5CS6A 4BCFA 2XNPA 5LARA 4E26A 5IEXA 2Y7JA 3PIXA 3VUTA 2JD5A 4D4VA 3SLSA 4YLJA 2RFNA 4FKVA 2YM3A 3PWDA 4S2ZA 3A99A 4MNEB 4R78A 3DNDA 1OB3A 4NWMA 4UBAA 5G1XA 5AR4A 3ZBFA 5DEYA 1J7IA 2IZRA 4DTBA 5EM7A 2GSFA 3EL8A 3ORMA 5DFPA 2PUPA 3C50A 4X2GA 1YWRA 2ZV2A 4G6NA 4I92A 5H8EA 3R7EA 1W83A 4PV0A 3VULA 4B8MA 1UKHA 4KRCA 3KY2A 3ZC6A 4CFUA 4G31A 4QP7A 2C0IA 3LQ3A 4U97A 4C4GA 5LQFA 1B6CB 4ACDA 5CU2A 1Q24A 2VTMA 3C51A 4KABA 3LFBA 4FTLA 3DGKA 3NR9A 2PPQA 4RVLA 4QTDA 3ZSHA 4IDVA 3QA8A 3JXWA 2BZHB 3OMVA 4AGUA 2GHMA 2BHEA 3TDWA 2I40A 5DN3A 5DR2A 4MD8E 1CM8A 1PXIA 4CKJA 5BVWA 1YWVA 2XMYA 5FWKK 5CZHA 3U55A 3V8SA 3FMEA 4FEWA 3EMGA 3KXMA 1KE6A 4F1MA 4FZDB 4MF0A 4R5YA 2R7IA 3WZJA 3G15A 3R21A 3D15A 3R1NA 5I9ZA 2OSCA 3AD5A 2XCKA 3ALNA 5HO8A 4P5ZA 1YXVA 3AMAA 4I21A 3OTUA 2OIQA 4KIKB 4WSYA 4I93A 4YHTA 1YWNA 3DY7A 4QD6A 2ITXA 4QTEA 4QQTA 2EXEA 3HV7A 4IAAA 3ZO4A 3HMOA 4K18A 5DWRA 2HENA 5LMKA 2YM6A 3DFCB 1E1XA 2UZVA 4FV1A 2XYUA 3K3IA 1QPEA 4FYOA 2IO6A 4ITJA 4TWCA 4WKQA 3QALE 3KU2A 3D4QA 3S2PA 2ITZA 2W1CA 3RPOA 3QX4A 4EK8A 2BDFA 3O96A 5JQ5A 3U6IA 4J98A 4RIXB 2I6LA 4L3PA 4NFNA 4QPAA 3ZEWA 2R3IA 2X4ZA 4O0SA 3ZEPA 2RGPA 3UOKA 3BCEA 3LMGA 4EBWA 5HE0A 2JKKA 2VTAA 4N6ZA 5CI7A 3R8ZA 4IWPA 3FMJA 3GU6A 4JL9A 1OI9A 5AEPA 4EOSA 2B9IA 3RGFA 2O63A 2UZOA 4Y72A 3FSFA 5EOLA 2GQGA 2HZNA 4F6WA 2PUNA 3L8SA 4U44A 3VC4A 3LFFA 4AGCA 4O2PA 4ACGA 4BDBA 4GT4A 2YJSA 3GU4A 4FKQA 4QMXA 4XLIA 5K0KA 4BI2A 1TKIA 4RVMA 4BKYA 2YACA 4UYNA 1Q8TA 1QMZA 4C4JA 5GZAA 2SRCA 5AUWA 3QTIA 3VJOA 5CEKA 3VS5A 4OTIA 3E8DA 4B9DA 3D14A 5TF9A 1HCKA 2OZAB 4I23A 2BZKB 4C8BA 3KCKA 4QMNA 5IA2A 3QKLA 2J0MB 5LVPA 3MFSA 4EH3A 3F3ZA 1MRVA 2BTSA 4E93A 3W16A 5M53A 4TYHA 2CGWA 4O0YA 5L8LA 4HCTA 3F61A 5HO6A 2ITUA 4JRNA 2RG6A 2ACXA 2WXVA 3O8UA 3CPBA 2W4OA 2PVJA 2C6DA 2VWIA 4KBKA 3TKUA 3MPAA 4U80A 3LXPA 4R1YA 3NUPA 4IW0A 4ZK5A 1KV1A 2XK7A 4EYMA 4NJDA 5AM6A 2B55A 2O5KA 1U5QA 1OIYA 3LFSA 5C4LA 2WMBA 1OMWA 5LMBA 5FBOA 2WMVA 4TYEA 5GIPE 2WO6A 4E6QA 4O7LA 4U6RA 3C13A 2FO0A 2Y6OA 3OWJA 4BWXA 3OP5A 4UB7A 4CMTA 2O0UA 5CSPA 2QR8A 3S1HA 2I0YA 4JS8A 2QG5A 3BHVA 2XIZA 3KXHA 5HLWA 4BF2A 4IZ5A 4OTHA 3QX2A 5DRBA 5IH4A 2ITTA 2B9JA 3GCUA 3HMIA 5HNGA 3D83A 1P4OA 4BTKA 5IQAA 3LFAA 3EQDA 2IJMA 2IZSA 4G3FA 4HVSA 5I9YA 3DA6A 2VWBA 3QQKA 2X8EA 4FOBA 4YBJA 4G6LA 5M4FA 5EQPA 5CU6A 3PSBA 3R7GA 4M67A 3C5IA 4X0MA 3BE2A 4IB1A 4WT6A 3O0GA 3DAKA 4H05A 4I22A 3TJCA 3A7HA 2Y0AA 5I5ZA 3QLFA 3RCJA 4K77A 3S00A 3IOKA 4W8EA 2R5TA 4WD5A 2BRBA 3TV4A 3KGAA 3UJGA 3FV8A 3UTOA 4JT3A 4EEVA 4F7LA 2JIIA 3RZBA 5AFVA 2A0CX 4X3FA 2C6MA 4JXFA 3PVBA 4BDCA 1OL2A 3RAIA 2RIOA 3QQJA 2ZYBA 3JVSA 3D2IA 4HYUA 2Y8OA 2IVTA 3B2WA 2O64A 2PMLX 1MUOA 3VUIA 1H0WA 4YTHA 3CSVA 2BR1A 3G6HA 3N4VA 4IC7A 5L4QA 4JG6A 5FXQA 4YJPA 3UIXA 3G9LX 4DBNA 3M1SA 1OUKA 3G33A 2ZJWA 1H1RA 2VU3A 1R3CA 4BZNA 2GHGA 4IHPA 1SNUA 1PXKA 1SZMA 3SQQA 2P33A 5ANKA 5IF1A 3E63A 1CMKE 2XCHA 4O81A 4BKJA 4O21A 4H3PA 4D9TA 2OXDA 2PE2A 3K54A 4ANSA 4L7SA 3F66A 5ETIA 1M14A 2RFEA 4GG7A 4XJ0A 5T6KA 3RM6A 4DINA 2XNGA 1ZRZA 4RJ8A 5J9ZA 5CASA 5IUGA 4FUXA 2P2IA 1JKSA 4QTBA 3WARA 4CSVA 4OT6A 4RIWA 4WNMA 2ZAZA 3EYHA 5KKRB 4DH5A 4BDIA 4F6UA 3UC3A 3N9XA 4QTAA 5CLPA 3VS4A 1KSWA 2A2AA 2PZ5A 4MXYA 4FIHA 3OOMA 3AC4A 4C3PA 3NVMB 3KXNA 3OT3A 4EK3A 3P78A 5TO8A 5E90A 3MIAA 3OEFX 3LQ8A 1AD5A 3E88A 4BWKA 2I0EA 4G3GA 5AV2A 3AGMA 4FIEA 1ZOGA 5C9CA 3PXZA 3JVRA 4FVPA 3L8XA 2ETKA 1PKGA 2IW8A 4E6AA 2XIKA 4UEUA 1PKDA 3DLSA 4EZ5A 2UW3A 3QZIA 5AMNA 1L8TA 3FYJX 4MXXA 3W2OA 5C8KA 3F88A 2FSTX 4H39A 4CZTA 5FGKA 1XH8A 4BHNA 3QTZA 2OH0E 2C3IB 4EH8A 1JWHA 4H3QA 4RC3A 1CSNA 1M2QA 1ZZLA 3OXZA 4X2KA 1ZARA 4D55A 3JY9A 4RWLA 4A9RA 2X6EA 4JDHA 2WU6A 4BGQA 1LEZA 4PTEA 4QT1A 3DZOA 4FKJA 5CXHA 4GFOA 2OK1A 5M07A 4FT9A 3KN5A 4JI9A 5KE0A 1MQBA 4EOIA 2OXXA 3PP1A 2YZAA 4RIYB 2WTKB 4ANQA 3QUEA 3V5TA 3VUMA 3ZZWA 4FSZA 2Y4IC 4G6OA 2VAGA 3TI1A 3BHUA 2OIDA 3WZKA 4ZLZA 3MFUA 3ZHPC 1PYEA 1TQPA 5LMKC 3PP0A 5KO1A 2VX1A 3VBQA 4HNIA 1M2PA 3F5GA 2UZTA 5M4UA 3UOJA 1PY5A 4RQVA 4EBVA 3F3UA 1QL6A 3HRFA 2GNJA 1FQ1B 3MY1A 3OY3A 3R0TA 3R63A 4GSBA 4MH7A 4F64A 2EB3A 4IX4A 4JBPA 2R3MA 1PMEA 2AC5A 2QO7A 3DS6A 3EFJA 4RRVA 5EW3A 5E8UA 5F1ZA 5EYMA 3SRVB 3TEIA 4F0GA 2HYYA 2PTKA 3NRMA 4F63A 2XBAA 5IISA 2WTJA 3MDYA 4TYIA 4BDGA 5HIBA 2JDTA 5M51A 3VNTA 1PMVA 3F3WA 4E4XA 3UVPA 1OBDA 3GC0A 1L3RE 2W1HA 1ERKA 4RIYA 1LEWA 3CD3A 4F09A 2UV2A 4I24A 4RT7A 4XS2A 3RAWA 4AE9A 4ARKA 4F0FA 3NUNA 5L2IA 4D1ZA 2Z7LA 3QKMA 4RWKA 4RA5A 5AADA 4EI4A 4DFYA 2F7ZE 2PVFA 4B7TA 2WMWA 3EQIA 1JPAA 1SNXA 4QMMA 1H27A 3OF0A 3KKVA 4XG3A 5CSVA 5EDQA 4UN0C 5JGDA 2G2HA 3HL7A 3R30A 5D10A 4MD9E 2IW6A 3ATTA 3HUCA 3RVGA 2P0CA 3DK7A 5AJQA 3H0ZA 3WZUA 3ORNA 3QRIA 1W98A 3CTQA 3PE2A 2XNMA 2XJ1A 4G5PA 4GUBA 3REPA 4AOTA 5JFSA 4CGAA 1J7LA 2BIYA 5HX8A 2WTDA 1JNKA 1OKZA 4YJRA 2CGUA 5FTOA 3BIZA 4PQNA 1BLXA 3OXIA 4C4EA 3EL7A 4DH8A 5KMMA 5L8KA 1YOJA 3RNIA 1AQ1A 3ODYX 4NU1A 4AT4A 4MAOA 4L3LA 3OW3A 3JPVA 1U59A 4S31A 1NVRA 1ZLTA 1YDRE 2KULA 3DQWA 1BX6A 2OF4A 4M15A 3ZBXA 5HLNA 3U54A 3FQHA 1JOWB 3HZTA 1U5RA 4HW7A 4AZSA 4ZTSA 5FDPA 3G2FA 3F7ZA 4ACHA 5LWMA 4PL3A 4BDFA 5KBQA 3O2MA 4E7WA 3QD3A 3BWJA 4EHGA 3KRXA 4DLJA 3KK9A 4D28A 3UBDA 4FTMA 4IZYA 2W1IA 3THBA 2X2KA 5HG9A 4U8ZA 3Q6UA 5DT3A 1PHKA 5C8MA 2JKOA 5HCXA 1Q5KA 4EHZA 2O65A 2WHBA 2YITA 3F82A 3LFCA 4C3RA 2ERZE 3DLZA 2JFMA 5KMIA 2X1NA 4I94A 4NIFB 4KUJA 3BHHA 4E4LA 4R1VA 1ND4A 2X8IA 4F1OA 3OBJA 4JIKA 5DVRA 3GCQA 5EG3A 4LOOA 3A7FA 3QUDA 4M69A 4TYJA 5BUEA 4DEHA 2OI4X 2RG5A 3CY3A 3Q6WA 3Q9XA 4J97A 3D5XA 3R9HA 2XIXA 2QHMA 1YVJA 3LLTA 2OU7A 3KREA 2R3RA 1ZYSA 3VJNA 3N4UA 4BHZA 4DH7A 4BCKA 2HXLA 3KRLA 3ETAA 3PVUA 3R2BA 3O7LD 4LOPA 4RJ3A 4JDJA 4X7QA 2PUIA 3NAXA 4CRLA 5AR5A 4ORKA 4TRLA 4OTRA 4WUAA 5TKDA 4L9IA 1Q8WA 1T46A 5AV1A 4RX5A 4C3FA 4X3FC 5B0XA 4AZFA 2BRHA 2YAAA 3QQUA 3IG7A 3SGCA 2O3PA 4RG0A 5DPVA 4A9SA 4EJNA 3BBWA 4O7YA 1PXOA 3CP9A 3UNJA 3VUHA 2C0TA 1A9UA 4F99A 5BPYA 5FTGA 3F69A 1YI4A 4L44A 4F7NA 3DAJA 5JN2A 4O7SA 3POOA 3C4CA 2ONLA 4P5QA 2QURA 4U3ZA 4NKAA 3ID6C 3U4UA 4KSQA 3KCFA 4MBJA 4DEIA 1OPJA 4WNKA 4DEBA 2QOIA 5IUHA 1BI8A 2DQ7X 3NGAA 4RIOA 4ACMA 3MVLA 2XZSA 4K33A 5EHYA 2JDSA 3QXOA 4D2TA 5BQ0A 3SXRA 3LFEA 3OVVA 4IX6A 3UP7A 1FINA 3PPJA 2FH9A 2PZIA 5DA3A 4EL9A 2VTSA 2X6DA 3FKOA 3UO6A 3FC1X 2Z02A 3GU7A 1P2AA 4Q5HA 3Q4CA 3EKKA 5GZ9A 4OUCA 3LMHA 3IW8A 4PL5A 3DU8A 4W4WA 2UW9A 3W2CA 3KEXA 4GYIA 3VO3A 5ETAA 4E6DA 3VUDA 4JBVA 4C35A 1ZY5A 3LM5A 4HGTA 3HA6A 5AP5A 2RL5A 3GQLA 2OJJA 4FTCA 2BZIB 5FXRA 2BROA 5M57A 2FSMX 4YHFA 5HESA 4CFNA 3EQFA 4IADA 2VTRA 2JAVA 4ANNA 5HI2A 4FV2A 5CEMA 4ZJIA 4XP2A 3C4ZA 1H1WA 3ORZA 4MCVA 1VEBA 3DDPA 4RX9A 3A61A 2PYWA 4APCA 5HHWA 2OJ9A 2P55A 3GXLA 4YLKA 2GQSA 1H28A 3ORKA 5D11A 3I6WA 1R1WA 3AD6A 3FLNC 3PXQA 3HKOA 3I5ZA 4FTTA 2CDZA 3TIZA 2UZBA 4GVJA 1BKXA 3DBDA 3ZUVA 2XK9A 3WE8A 5L6WL 1HOWA 2YZLA 4FV8A 4FKWA 3A2CA 4JQ7A 4PPCA 4UMRA 3R8LA 5FXSA 3CLYA 3SD0A 2BKZA 4FA2A 1O6LA 2ITYA 2VTPA 5GJGA 3E8CA 2IG7A 2VTJA 4AACA 4OBQA 4BFMA 2XP2A 2JFLA 4FNYA 4QYHA 5IQDA 1YOLA 4O84A 2BRNA 5JZJA 4LL5A 1URCA 1FVRA 2GQRA 4S30A 5L3AA 3B8RA 1NY3A 4GK4A 4ZOGA 4FKPA 5IQGA 4HNFA 2QU5A 2BKKA 1M7QA 2G15A 1F3MC 3LXLA 3QA0A 1XH5A 3VQUA 2W5BA 4GK3A 4F9BA 3RPVA 3PWYA 4DGLC 3R1SA 5IUIA 2GNFA 2UW8A 3QD0A 4NT4A 3GFWA 4YTIA 5AX9A 4KKGA 4PDSA 4DFUA 5CVHA 3HDMA 5FLFA 2XKDA 2XNBA 1H8FA 3QQFA 4IAIA 2EU9A 3KRWA 3C0HA 4J8NA 4LM5A 3VF9A 3IDPA 1OIUA 3D7ZA 4IFGA 2WIHA 1BL7A 1P5EA 1OKVA 3ORLA 4YU2A 3MB6A 3OS3A 3PFQA 2XK3A 4BCNA 4LQMA 2JLDA 4IFCA 2G01A 4RVTA 4TYGA 4EUUA 2XJ0A 3F9NA 2YDIA 4AZEA 3DV3A 4WNPA 1XQZA 3KFAA 4FKSA 4D4YA 3FI8A 5CAPA 4O96A 3BZ3A 5G6VA 3ZC5A 5E8VA 4EOOA 3R7UA 4FR4A 2BDJA 3MPMA 2J7TA 5EQEA 3VBTA 3FZ1A 4ZP5A 4G1WA 2ZMCA 2OIBA 4CG9A 5I3OA 1PRYA 2F9GA 4FIJA 3AXWA 4CV9A 1FOTA 2JDVA 1Q8UA 1H0VA 1ZOHA 3I4BA 3O51A 4BI1A 2HWOA 2HZ0A 4DH1A 3KULB
chains in the Genus database with same CATH superfamily
3A8WA 4E73A 3DTWA 2OXYA 5JKGA 1PXJA 3RMFA 5HX6A 3MH1A 5DHJA 5EOBA 4EH7A 4DFXE 3WILA 2IPXA 2EXMA 2HWPA 5EW8A 5L2QA 1JVPP 5B2MA 4DFBA 4DGNA 3D2KA 4I6QA 4UWCA 2F4JA 2B9FA 4BYIA 4EHVA 3AC5A 4K0YA 3OCTA 4LGGA 5K3YA 4QP3A 4FYNA 5FRIA 5E8XA 2QVSE 2WQNA 4UYAA 5AP0A 4B99A 1W2CA 3O71A 4KBAA 4PL4A 5CAQA 3UOHA 1H07A 2W5HA 1UNGA 3S3IA 4D0WA 2Z7RA 3TNPC 2X8DA 3FDNA 4FV0A 2PZRA 3W33A 1I44A 3IDCA 1LP4A 3WF7A 3KF4A 4EOJA 1DAYA 2JBOA 3FI4A 3MVJA 3RTPA 1YHWA 1G5SA 4WHZA 1H1SA 4QYFA 3BL9A 5HVJA 3PIYA 3EJ1A 1M2RA 5AP3A 4MWIA 1FBNA 2G9XA 4KIQA 2BMCA 2WB8A 5M08A 4IC8A 3DZQA 4ZMEA 4HYIA 5LOHA 2AYPA 4JG8A 3QF9A 4V0GB 5CZIA 2VNWA 2GNLA 3SVVA 3FMHA 3ZYAA 3MBLA 5HIDA 5CTPA 3COMA 3PZHA 4PDOA 4UZHA 2WGJA 3HP2A 4BRXA 2W1DA 4OTPA 1U54A 4FKIA 3RWQA 2C68A 2OF2A 3R83A 5KNJA 1G8KA 1ZMWA 4J96A 2YN8A 3GC8A 4JDIA 3V5QA 5LWNA 3LXNA 3MESA 4AAYA 4YNEA 5I9VA 3R00A 4QDEA 1RQQA 1IAHA 2ZM4A 4BI0A 4RC2A 5HVKA 5EI6A 3UQGA 3CPCA 1JSUA 1F5QA 2R3FA 4DN5A 3UQFA 2HZ4A 3AQVA 4L3JA 4PY1A 4ONAA 5IDNA 4Z55A 4MKCA 4USEA 4FNWA 3H9FA 2H9VA 3UG2A 1R0PA 3BGZA 5BVKA 3W10A 4CYIA 4NCTA 4ZTQA 5DI1A 3VS3A 3R73A 2FUMA 4DEGA 2RF9A 3CY2A 3LLAA 4CT2A 4MHAA 2FYSA 4WRGA 4YP8A 4HVIA 1OITA 2GS7A 2ONLC 4IJPA 3EHAA 4WIHA 4A9TA 1KE8A 4DH3A 4EK5A 3PXKA 4IZ7A 4DGGA 3CD8A 4G3EA 2C5YA 2JGZA 4YGAA 5DOSA 4ZZNA 4MNEA 5DGZA 4Y5QA 5LJJA 4R7BA 4IMYA 5C01A 2BCJA 5K5XA 3G90X 2YCSA 5A4QA 2ETRA 5LVLA 5IA4A 2HY0A 5CNOA 4R3PA 5CANA 4ZSAA 4J1RA 5AUZA 2J90A 5IA0A 3AC2A 3PA3A 4XV3A 3L9LA 3MS9A 3MW1A 1MRUA 2QKWB 4O2ZA 3OCBA 4FEUA 3FLYA 3EFLA 3AMYA 4RSSA 4Q9SA 5IA3A 2VGOA 4LMUA 2WQOA 2YWPA 4QQJA 1URWA 1H24A 4I3ZA 3D94A 2WMSA 2YJRA 2BALA 3BKBA 2WMQA 4ZSLA 3L1SA 4ASEA 4OTDA 2QD9A 4BN1A 4N57A 3OTVA 2C30A 1Q61A 5C8NA 4M97A 3IDBA 5LVNA 2IW9A 5FM2A 4OT5A 3OD6X 4AW0A 3FKLA 4ZJVA 2B9HA 3OFMA 3VIDA 1CTPE 3W1FA 4C34A 3NUXA 4IIRA 3QC9A 2QO2A 4JOAA 4FSTA 3G0FA 4FVQA 4G16A 4U79A 4YZ9A 1OIRA 3QTWA 5BYYA 5IEYA 2NO3A 3PIZA 3TZMA 3EQPA 2H96A 4O6EA 4D2VA 4MXOA 4PPAA 3BYMA 1Q62A 5TR6A 3DTCA 3P4KA 5HG8A 4DE4A 4KIKA 1PMUA 4ZTNA 4TN6A 5CF5A 4V04A 1UU9A 3II5A 4P90A 3ZO2A 4MXCA 2Z8CA 4DTKA 4XLVA 4YJNA 2YM8A 4FSUA 1YXXA 3HUBA 4NTTA 1SMHA 4XCUA 5DR9A 1WBWA 4NH1A 5CVFA 5CQWA 3FMNA 5F95A 4YURA 5IQHA 4QPSA 2ZV7A 3ZOSA 5AUUA 3TDVA 2W5AA 2HAKA 4HGSA 3HX4A 5CEPA 1YXSA 3MH3A 3W2SA 5HCYA 4EH5A 2W0JA 3LW0A 2WEIA 2YA9A 4NM7A 4RIXA 4XRJA 5LCKA 5GZ8A 4CFFA 3BHTA 2XBJA 2ITVA 4QP1A 3QAME 1WBNA 5JT2A 1NW1A 5J5SA 4K8AA 3H0YA 5AR2A 2DUVA 5HQ0A 1NXKA 2QLQA 3LFDA 5L6PA 1ST0A 4YPDA 3BLQA 2EVAA 3Q4TA 5LVOA 2KTYA 3QXPA 4GL9A 4H1MA 3E93A 2BAQA 5CU0A 2CKEA 2WMUA 3OY1A 2C6EA 4TNDA 5EQYA 2BVAA 2CGVA 1IASA 4ZAUA 2A19B 4EWHA 4S32A 1STCE 1V1KA 2GS6A 2XH5A 3BGQA 3VS0A 4CKRA 4FOCA 3NUYA 4I6HA 4C4IA 4D9UA 3FUPA 3KK8A 5DMZA 2F2UA 2QOQA 3EOCA 4I0TA 2V5QA 5J79A 4GFMA 1YDTE 3RK9A 3MTLA 3AKJA 2W1FA 4OTGA 3RHXA 3SXFA 2GFSA 2X7OA 1ZY4A 4Y5HA 4E8AA 3AT2A 1Q4LA 1R39A 3GP0A 1WBPA 2YIXA 5DYJA 2XK4A 3CKWA 2UVZA 3TTJA 3LXKA 3R9NA 2OZAA 3GENA 5L8JA 3E8NA 1WVYA 4JG7A 5AWMA 4R8QA 4Z16A 2VTQA 2XNNA 3W8QA 3W0RA 3EN9A 2Y4PA 2XEZA 4FIIA 5CF6A 3HV3A 4CZYB 2C5XA 4N4SA 1F0QA 2CHLA 3Q9YA 3GCPA 1M17A 4C4HA 4CCUA 3UDZA 5CF4A 4ZLOA 3FMMA 2YAKA 1HCLA 3V5PA 4DDIA 4YJOA 2IVSA 3RNYA 4KAOA 4ZY4A 1OZ1A 4N6YA 2HELA 4RVKA 5AV3A 4IEBA 4RZWA 2NP8A 3UGCA 2C5OA 2XS0A 3MA3A 3P23A 4I5HA 3LKMA 2B4SB 1Q3WA 4EOLA 4S33A 2C6KA 3FZOA 3Q04A 5J9YA 3O50A 3FPQA 4ENYA 3ALOA 3W2RA 4BBFA 4RPVA 5KMLA 2VX0A 4D4SA 1O6YA 3VW6A 5TT7A 4C38A 4DEDA 2Z60A 4LGDA 5FUTA 4GH2A 3NYOA 2PU8A 1YRPA 3LCOA 1XMMA 1W2FA 1JKLA 4JMQA 2XKCA 3UZRA 4HVGA 3Q5IA 3PSCA 5FG8A 4DCAA 5DT0A 3P1AA 3LM0A 5JFXA 3UIMA 1DAWA 2GCDA 2QR7A 3PXFA 4ASZA 3UZPA 1J91A 1SVEA 3DPKA 3SV0A 4BCPA 3PPKA 5LVMA 4B6LA 5EM5A 2PUUA 2YCRA 2YLEA 3HRCA 4ID7A 3W18A 4PDYA 3NLBA 2WNTA 5E1SA 4FV5A 3DNEA 3EN6A 4DT9A 3S0OA 1PF8A 3TT0A 1LUFA 3D7TB 3R28A 4X6RA 2GNIA 5E8YA 3I6UA 5AP2A 1UNHA 4MXAA 2XKFA 4PPBA 5ANJA 4BIBA 4O91A 5AA9A 4CV8A 1AGWA 1ZYCA 1Q97A 3OWPA 4CD0A 3F3VA 4DAWA 2G1TA 2QG7A 4G5JA 4RJ7A 3CE3A 4O0XA 3NVKI 1WZYA 3BYSA 4FEXA 3V5LA 4H36A 4O1PA 3ZFMA 1IAJA 4LV7A 3BLAA 2PE1A 1K3AA 2VTIA 3AC1A 3ZXZA 3CTJA 3Q4ZA 4LI5A 1LR4A 2IN6A 4XH6A 2E2BA 3COIA 5H8GA 5FD2A 3BEAA 4A9YA 3DCVA 3NUSA 4A4LA 5IH6A 3ROYA 4HJOA 2XAMA 5DNRA 5AAGA 3OHTA 5DR6A 2J2IB 3BQCA 2CJMA 2WFYA 5F4NA 5HICA 2E9NA 3H9RA 4QRCA 3QTXA 1SVHA 1K9AA 4M0YA 3U8WA 3PE1A 3R02A 4FTOA 3ZTXA 4CFXA 1OKYA 4GFGA 4FSWA 2JDRA 4TNBA 3TUCA 4NCTC 2A27A 1CKPA 3W0PA 2VN9A 2XIYA 1YHSA 4FT3A 4FVRA 3VUKA 4D1SA 3AC3A 1ZWSA 4FJVA 4E5AX 3N51A 4K9YA 5JMSA 3RWPA 4F7SA 3PFYA 3PJ1A 2UVYA 2QCSA 1GZOA 3BELA 3CJFA 4WUNA 5D7VA 3RBWA 4R3CA 4QYGA 2J5EA 4RGJA 1H25A 2GPHA 3AMBA 5C26A 3Q3BA 4GU9A 4QMVA 4JBQA 5M4IA 1ZXEA 1ZZ2A 5AX3A 2J0JA 4IANA 4CVAA 1XH4A 4UY9A 4D2WA 1CKIA 1J1BA 3FL5A 4KINA 2XB7A 2OJIA 5M56A 4NM3A 2WAJA 5JSMA 3FMLA 5KBRA 1OKWA 2XK8A 2YHVA 4C02A 5JFVA 3KB7A 4XX9A 1WMKA 2YIYA 1NVSA 2GFCA 1R78A 4Y73A 1IG1A 4IM2A 3B2TA 4RLKA 4RQKA 3TKHA 5A4EA 1JAMA 3DQXA 3EB0A 4IQ6A 5FEEA 3O17A 2BDWA 2R3GA 3MJ2A 4QTCA 3HV5A 4G17A 4U7ZA 4CKIA 1YHVA 4AUAA 4U45A 4Y85A 5L2TA 3W0QA 2P3GX 5A4CA 2X7FA 3POZA 2I0VA 2WQEA 4FNZA 4XG8A 3PJ8A 4NEUA 4YO4A 3PXRA 5HU9A 4AFEA 4GW8A 4DGMA 2W4JA 4BCHA 2I7QA 4FICA 3EQGA 4JJRA 3CEKA 3GC9A 4GEOA 4XRLA 4FBXA 3OT8A 4FK3A 4IX3A 4QMTA 4V01A 5CEQA 4F70A 4LDTA 3NWWA 4QP2A 4JDKA 2XNOA 3UMWA 2E9VA 5IG1A 1UWJA 3ORPA 3L8VA 3TTIA 4WNOA 4DEAA 5BVNA 3VUGA 3LFQA 3RP9A 4DFNA 2VWXA 3KRJA 1YDSE 4LYNA 3K5VA 2VO6A 3DJ5A 4LFIA 5J95A 2JAMA 3FSKA 3P7BA 4ZZOA 5IH5A 2Y9QA 2NPQA 4FODA 3TNHA 2VWZA 2CNVA 3PPZA 3QGYA 4AXEA 5HBEA 3ZU7A 5HG7A 4BL1A 2VO3A 3U9NA 3ET7A 1M52A 3L8PA 2EB2A 2F49A 3CBLA 4BGHA 4O4BB 4L00A 2B1PA 3MPTA 3Q52A 5EFQA 5H9BA 2FSOX 5EM6A 4AA0A 4ANLA 4EJ7A 4YLLA 2VZ6A 2VTHA 2X0GA 1TFFA 1YW2A 4QP4A 1ZOEA 4UZDA 4R7IA 2AUHA 5HEZA 3VONA 3A7IA 4GIHA 2GHLA 4IACA 2NRYA 4NKSA 3ZRLA 5BVDA 2RKUA 3BEGA 2OJFE 4C2WA 2QLUA 2UW0A 2GS2A 2XF0A 3QC4A 5C03A 3LCTA 5HTBA 1OL5A 2PHKA 4F6SA 4Q9ZA 3OBGA 3SRVA 1WVWA 4FKLA 5EKNA 4ZIMA 4NZWB 4R7HA 3TNIA 4O7ZA 3Q60A 3FL4A 3IQ7A 3HMMA 2LAVA 4J71A 3HNGA 4QMYA 2BFYA 3BLRA 1Q8YA 3A60A 3ACJA 3WZEA 5A4TA 5M44A 4C59A 4FL2A 5BMSA 3IW7A 4JLCA 4AU8A 5FQDC 4PMPA 2OH4A 3ITZA 4TW9A 3LAUA 5B2LA 3DXPA 3HECA 2YM7A 3LIJA 3IGGA 1IR3A 3NMUF 1B39A 1PYXA 2UZUE 5CAVA 2B0QA 4DFLA 1I09A 2C6TA 4V05A 3NFGB 1YXTA 5AA8A 4ZMFA 2V7AA 2UZEA 2YABA 1K2PA 4FSMA 4L43A 2FA2A 3R04A 4XG4A 3MSSA 3DBEA 3EQCA 3B8QA 3R7YA 5BVFA 3IW6A 4O4CA 4WG4A 1B38A 2OWBA 3VVHA 4BDAA 3CKXA 5F94A 4ZS4A 3MJ1A 2ITQA 3U9CA 3MA6A 4XV1A 1RDQE 2NRUA 3PUPA 4FKTA 2QNJA 4BDJA 3A4OX 4U5JA 5HE2A 3WYYA 4O86A 5JK3A 5T3QA 3RZFA 3UDBA 2PE0A 3V3VA 1Y6BA 4GJ3A 2JEDA 4EYJA 1FGIA 3BPRA 3LCKA 4AT3A 4FRFA 3WIGA 4J99A 2WKMA 3UVQA 4NM5A 2PMOX 1NVQA 1WBSA 1X8BA 1GZ8A 2CLQA 2HY81 1LPUA 5D1JA 5DIAA 3QQLA 5FP5A 4IAFA 3COKA 4JQ8A 1VYZA 2E9UA 2F7EE 2QODA 3CCNA 5FBNC 1GIJA 1OPKA 4H1JA 2Q0NA 4HPUE 4EHEA 5BNJA 2XM9A 2Z7QA 2I0HA 3KRRA 3VS6A 4HVDA 3MYGA 5J1VA 4EC9A 5AIKA 5JQ8A 3VN9A 2DYLA 4GRBA 3GOKA 3O23A 1TQMA 4NIFA 5IKWA 2W17A 3O5AA 2A4LA 4D5KA 4CT1A 4ASDA 4GS6A 3I5NA 2OBJA 4PF4A 4I0SA 3BLHA 3EN4A 3FC2A 1XHAA 4XG7A 4JVGA 2R0IA 2YM4A 5ACKA 5HBJA 4Y83A 5CT0A 5A6NA 2OO8X 3KMMA 2ZMDA 2CN8A 4TT7A 3FY2A 5KHXA 3FEGA 4AFJA 4D5HA 3CGOA 2CKOA 3FZSA 4FZ7A 3ZMMA 5E7RA 3QTQA 2C4GA 4W4XA 2Z2WA 3FY0A 1OL1A 5FM3A 1H1QA 3R1YA 5DE2A 2WZJA 5J5TA 3R9OA 4RA4A 2B7AA 2BFXA 5E4HA 3E64A 4EOPA 4UMPA 2PWLA 3LVPA 2ZDUA 4P2KA 3ZM4A 5A14A 1FMOE 5HLPA 3RAHA 2WTVA 3FKNA 4RBLA 4BVUA 4E4MA 3BU6A 4WG3A 4AWIA 2NNWB 5IQEA 3EKNA 2IZTA 4FKRA 4NL0A 4DHZA 1GOLA 2OW3A 4PMTA 3FMKA 3RPSA 2X39A 5I9WA 4FC0A 2CGXA 5JGAA 4IM0A 3LZBA 4TWOA 4F9WA 1REKA 3R9RA 3M11A 2QHNA 5IQCA 2ZV9A 1YOMA 4IVCA 4RJ6A 2PULA 4I6BA 1UA2A 4NYEA 1ZYDA 3AGLA 2OJGA 3DKCA 3M2WA 1VJYA 3VBVA 4NW5A 4CFVA 3DJ7A 1JKKA 1W84A 4M12A 4M3QA 4EWQA 2XARA 2OZOA 3BRBA 4ZJJA 4YR8A 2YIWA 3QRKA 2X0QA 2WIPA 3RINA 3G9NA 5K4IA 4FGRA 5HKMA 4IAYA 3NAYA 1PMNA 4J8MA 4Y8DA 4YZBA 3HMPA 3VHEA 5AM7A 2JITA 3SC1A 4CRSA 3M42A 5D12A 1WFCA 3FYKX 2GU8A 3KXXA 2J0KA 3BU5A 2YFXA 2XM8A 3F2AA 3QGWA 5ACBC 5KKRC 4I6LA 4F78A 3H9OA 2ZM1A 4OGRA 4KB8A 4W9WA 1W0XC 3A7GA 2ZFYA 4BY9E 1REJA 3SAYA 3VRYA 4EZ3A 4M68A 3BU3A 1KV2A 2QOFA 4E4NA 4AN3A 2CNQA 2YM5A 2J51A 1QPCA 2QI8A 4FKGA 3GNIB 5D9HA 5DH3A 3ZO3A 4EK6A 3TNWA 2PVYA 3HMNA 3KXGA 3UE4A 5CYIA 2CNUA 4QPMA 4B8LA 4XP0A 4O6LA 3FXXA 4X2FA 4XOYA 4OTQA 3HGKA 2R9SA 3DDQA 2X9FA 5E8WA 3V04A 4BTJA 3N4TA 5HTIA 4TKSA 5ANGA 4TXCA 3EQBA 3BV3A 4ZEGA 3R8VA 3C0GA 3IW4A 4UXLA 4YZCA 4L67A 4TL0A 5GHVA 3LCDA 3ACKA 3FHIA 3AKLA 1YQJA 2HIWA 2C69A 2UZWE 3EN5A 3F6XA 4O4FA 3TKIA 1XH7A 3LQ5A 1IA9A 4W4YA 3FLSA 5I3RA 2ZOQA 1QCFA 4YHJA 3C4FA 4BICA 3V01A 1W8CA 1FPUA 2C5VA 3CQWA 3G6GA 4QYYA 2WTKC 4ZY5A 2P2HA 3FI3A 4FKUA 3GI3A 3RALA 4AW5A 3OOGA 4X3JA 5KMNA 4L45A 2ZVAA 2R64A 5H2UA 3QTUA 3C4EA 1OUYA 1P14A 5AR3A 5IZFA 1J7UA 2R4BA 3CXWA 3LPBA 4JBOA 5B7VA 4RWJA 5CALA 3SA0A 4GKHA 5HU3A 2J4ZA 5FEDA 5L2WA 5HD4A 4AF3A 3FBVA 1DS5A 3IGOA 3MI9A 3ZO1A 4BTFA 4X2NA 3TNQB 2VRXA 3R6XA 3W0OA 4BTMA 3BBTB 4D2PA 4F9AA 4XEYA 4I1ZA 3ZXTA 3UQCA 4WO5A 2ITPA 3RAKA 4F08A 2YLFA 4M84A 3EN7A 5KCVA 1BUHA 4AGWA 3QYWA 5CI6A 1OM1A 5C27A 4IB0A 3Q9WA 3HA8A 4TZRA 1XR1A 2FB8A 2G2IA 3NYXA 4IVAA 3CR0A 2VWYA 4TY1A 4F0IA 2QU6A 3HV4A 5J9LA 4UALA 4C33A 3ZUTA 5A9UA 3K2LA 5CSXA 2R0UA 4PMMA 4RJ4A 4YJTA 3FQSA 3EWHA 4J95A 3ZLSA 4I5CA 4EOMA 3DKOA 3ZZEA 3IPHA 4XV2A 4C61A 4DEEA 5A54A 5K4JA 3DBQA 4Q2AA 5HE1A 4DHFA 3W55A 3UNKA 5AAEA 3MFRA 4U9AA 3FZPA 3R71A 5AUTA 4F1TA 3KULA 2JBPA 5I9UA 4IWDA 4M8TA 2IVVA 3PA5A 5JZNA 3FHRA 5I0BA 3A62A 2XA4A 4HZRA 4MEDA 5DLSA 1OL6A 2YIRA 4UMUA 1GZNA 3QRUA 4HCVA 5EYKA 4H58A 1UNLA 5AV0A 2XAOA 3COHA 3MH2A 3MY0A 5BYLA 4ALUA 2C1AA 1XWSA 2UZNA 3LJ1A 3EIDA 2W7XA 3GU5A 3PY0A 3Q5ZA 4FZAB 4K1BA 2PVMA 3KL8A 4YC6A 4MWHA 4JX7A 5EYDA 3ZDIA 4ZLYA 2P4IA 2Y6MA 3S95A 3L9MA 3DXQA 2PSQA 4D2SA 4P7EA 3D9VA 4CMUA 3R8MA 2PVRA 4JRVA 5AP4A 5DG5A 3HYHA 4ZSGA 4ZZMA 5IMEA 4CZUA 5EKOA 2ZM3A 4YC3A 2C6OA 3EQHA 4FTJA 2WMAA 5HNBA 4FF8A 4RMZA 4RFYA 3OUNB 2PL0A 4AN9A 3TV6A 4FL1A 4RC4A 4FTUA 4YBKA 4U3YA 5IPJA 4DITA 2F2CB 3K3JA 3LE6A 3R8UA 2QC6A 3F5UA 3V8TA 4LV5A 4O22A 5F20A 4LG4A 3TZ9A 3KVWA 3ZDUA 4D0XA 3I7BA 3I1AA 3D5WA 1OGUA 4V0GA 5AUYA 2XUUA 4IB5A 5BUIA 1JKTA 1WCCA 3KQ7A 3BE9A 3OUKA 5FEQA 5EM8A 5AUXA 3R01A 1Z9XA 1VR2A 1APME 1OECA 3E7VA 3MVMA 3MV5A 3V51A 3BV2A 2YDJA 2BUJA 2QKRA 1H00A 3HLLA 3MGYA 4QMPA 2J5FA 4O7VA 4QQCA 3BI6A 2WELA 2Y4IB 3ELJA 4FUYA 5CNNA 3QQGA 2XRWA 1JBPE 4DLIA 3NS9A 4A06A 4BDHA 2VX3A 1T45A 4BBMA 3NW7A 3KC3A 4BZOA 1ZMUA 2X81A 3DBFA 4HGEA 3RI1A 4BDDA 4BBEA 4GU6A 5JGBA 1ATPE 4XG6A 1WBTA 4LV8A 5KX8A 5E8ZA 2EWAA 3PVGA 2ETMA 4QMSA 3WIKA 4BIEA 1Q41A 3D0EA 1VYWA 2C5NA 3PJ2A 3P79A 4L01A 4MBIA 4GT5A 3TZ7A 2A1AB 4YUQA 5L2SA 4RX8A 4BC6A 4DDGA 3QQHA 1KE7A 4FTAA 2IEWA 4HZSA 3LFNA 3LCSA 3UIUA 3V8WA 3TUDA 3TN8A 3LOKA 4MQ2A 5EYCA 1UWHA 5HVYA 4CCBA 3GEQA 4XHKB 3GOPA 3H4JA 5KZ0A 4AGDA 3NX8A 3PTGA 3IKAA 1XJDA 1V0BA 4WBOA 3E3PA 4O0WA 4JAJA 4HPTE 1DI8A 4YTFA 3E62A 2W99B 3E5AA 2UW5A 3JY0A 3GT8A 4Y95A 5HCZA 3KF7A 4IE9A 3E7OA 3UOLA 1RJBA 2WD1A 4AS0A 4LGHA 4X2JA 2R3KA 4USFA 2GTNA 2V55A 2VWWA 3KA0A 1H26A 4UMQA 4YZNA 4C62A 3FLWA 5I9XA 4S34A 5GINE 2W9FB 4XYFA 3QTSA 4ALWA 1IA8A 3FWQA 3L9PA 4FK6A 2X4FA 3ENHA 4C7TA 3LJ2A 1YXUA 3NNVA 4TYHB 4O38A 5FP6A 4AW2A 3TM0A 1S9JA 2UVXA 4G3DA 4XNEA 4BDEA 2VO0A 3FPMA 4II5A 3HDNA 3V5JA 3P7CA 3WOWA 3LJ0A 2VWVA 1RE8A 4AX8A 3VQHA 3AD4A 4O0TA 3I81A 5CENA 1MRYA 4AN2A 5KMOA 3TIYA 4ZY6A 4KIOA 5AIRA 4Z3VA 2W9ZB 3RHKA 4APPA 3I0OA 3DB6A 5GJDA 4EQCA 4RLLA 3WZDA 1CDKA 3C4XA 3ZH8A 2VV9A 3ROCA 4FZFB 5BUJA 4DC2A 3R8PA 3CQEA 3UYSA 3UVRA 5EHLA 1YI6A 2R3QA 2X0OA 4QNYA 4AE6A 2GNHA 2R3JA 4IAZA 4RFZA 4BKZA 3PLAE 3LMIA 5B2KA 4ALVA 4EOKA 1FVTA 1JLUE 2ITWA 4IX5A 2C0OA 3FI2A 5ANIA 2WU7A 2ZV8A 4JQEA 1XBAA 4O7NA 4FV3A 4CMOA 5EDPA 2V7OA 1UVRA 3MVHA 4Z7GA 3QD2B 4UV0A 4L6QA 3EFWA 1FGKA 4KNBA 4O83A 3GFEA 3MTFA 3RCDA 4DG3E 2YERA 3UO4A 3QKKA 5L6OA 1Q8ZA 1V0OA 4MVFA 4DTAA 2H34A 3OEZA 4F4PA 2CCIA 1Z57A 4C58A 1KOBA 2PK9A 2RFDA 1H4LA 2C3JA 4ZSEA 3FXWA 4EH2A 3ZUUA 3PDTA 4J53A 4KS8A 4PRJA 4O0RA 4WA9A 3UP2A 3OWKA 1W82A 2YIQA 2VWUA 4U43A 3WI6A 3SOAA 2IVUA 4YMJA 4X3FB 2AQXA 2V0DA 3ULZA 5GIOE 1GY3A 2JDOA 2J0LA 4ERKA 3KN6A 3MIYA 3I60A 3JUHA 1Q99A 4FG7A 1QPJA 3UPZA 4IVBA 5GJFA 2XJ2A 5KZIA 3UNZA 1O9UA 3PZEA 4GG5A 5K0XA 4KSPA 4DG0E 3MH0A 4BGGA 2GMXA 2X7GA 4IZAA 4U40A 2H6DA 2IWIA 3FE3A 4AXCA 2ZDTA 4KS7A 4OBPA 3OWLA 4FTQA 1JQHA 5CU4A 4AA4A 4G2FA 1NA7A 4YZMA 5HORA 3PY3A 2WMTA 4AOJA 1JSTA 5HD7A 2HOGA 3DAEA 1GNGA 3MB7A 4I0RA 4AW1A 4CQGA 3Q96A 4I5PA 3GCSA 3PYYA 2EUFB 1ZYLA 3AG9A 3I79A 4BJJB 4Y46A 4FTRA 2X2LA 4BWPA 3DJ6A 4UX9A 2E9PA 4KBCA 4WG5A 1NT2A 4QMLA 5D7AA 4EKLA 5ANDA 3TCPA 4BR3A 4M14A 3OROA 1KOAA 3QCYA 1RW8A 4GK2A 4RIWB 2CKQA 4FTNA 4FT0A 1FMKA 4EK4A 1U46A 3OZ6A 4GVAA 2WMRA 4I4FA 2VGPA 4KRDA 5IEVA 3ZCLA 1Y91A 4FV9A 2V62A 3VBYA 2GDOA 1ZMVA 3A7JA 5LCJA 4W8DA 3WYXA 5IU2A 4DHIB 2O2UA 3TACA 4L53A 4F65A 4MX9A 4FTIA 4PP7A 4OAVB 3NUAA 4FT5A 1UU8A 1G8SA 1W7HA 5E9EA 4USDA 3DK3A 2BAJA 5ANOA 4AXDA 4MBLA 4FV7A 4MTAA 4TTHB 3VW8A 3BHYA 4XBUA 5BMMA 5A6OA 1IRKA 4LUEA 3ZFYA 3V6RA 2ESMA 4FV6A 4OBOA 2YDKA 2VNYA 5A46A 5LXMA 4IDTA 2UUEA 4MUQA 1XH9A 2H8HA 2QOLA 3PG3A 4YC8A 4FTKA 4TWPA 5CY3A 3PSDA 3H30A 1TVOA 1XO2B 4I41A 3F3TA 3S4QA 4D58A 4A07A 4M7IA 3WF8A 4M13A 3TWJA 5BVOA 3Q2MA 5T68A 1KUTA 3GCVA 4PNIA 3P86A 2PVNA 4AAAA 5J7HA 4FG9A 4MF1A 3JR1A 4O0UA 3D7TA 3IECA 3K5UA 3QL8A 3BYVA 5CT7A 3VBXA 3ANQA 3RM7A 3W8LA 5F9EA 4EQUA 4FE2A 4GYGA 4D1XA 3ZM9A 5M09A 4TPTA 3P0MA 2ERKA 5J7BA 1O6KA 3RKBA 3O8TA 1MQ4A 4CTBA 2XIRA 3HEGA 4PX6A 2R7BA 4XG9A 5EI2A 5ETCA 3JS2A 3PJCA 4GT3A 2C3KA 1J3HA 4GMYA 5DBXA 5FDXA 4F7JA 3VBWA 3QBNA 1XBBA 5EI8A 5M4CA 3G5DA 2JIVA 3E3BX 4HOKA 3CTHA 2UW7A 4N70A 4QMWA 4ZTMA 5AV4A 1DI9A 2FVDA 4AA5A 4JR7A 3KMW