4CVAA

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
254
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
total genus 80
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cvaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cvaA01
3KULB 1NVRA 1H8FA 3ZLSA 4Y73A 5CS6A 2PMNX 2XNGA 2F7XE 1YXVA 2E9UA 1QPEA 3E63A 5EW3A 1JSVA 5HKMA 2YZAA 1DI9A 4J99A 4DBXA 3VS7A 5CLPA 5I3OA 3QRTA 4QTAA 4BN1A 3MFSA 1DAWA 4LMUA 4A7CA 5HGIA 5E91A 3CEKA 5D41A 3HVCA 5GJGA 3HDMA 1Q8YA 3LXKA 4FSYA 4KS8A 3TT0A 3OVVA 4BHNA 4FBXA 5CT7A 4C37A 4RX8A 4ZJIA 4EQUA 3R8UA 5D1JA 3QKLA 4YC8A 4ZSJA 1WBNA 5JRQA 4EH5A 4F1OA 4W8EA 2VTOA 4PL3A 5E8XA 3ZOSA 3CQEA 3IDPA 4GVJA 4P4CA 4TL0A 4QP4A 3GU4A 1J1BA 4DITA 4LOQA 4F7LA 3NVMB 3AOXA 1ZZ2A 3B2TA 1QMZA 3HKOA 4C61A 4U7ZA 3SXSA 4YZCA 2UW7A 3AQVA 3VRYA 3IW7A 4FKVA 5C9CA 2EB2A 3OC1A 3PJCA 3R1QA 3W1FA 5JFSA 3WYYA 2F2CB 4FV7A 2QR7A 5LVNA 3EKKA 2PMLX 4RX9A 2VTQA 4G5JA 4ZS4A 1MRYA 4AW0A 4WUAA 3T3UA 4C3FA 4I3ZA 4JR3A 3COHA 1RQQA 3BPRA 4S34A 4APCA 5JH6A 3G9NA 4M68A 3AMBA 4FV1A 3DAEA 5KCVA 3NAXA 1YW2A 4FG8A 4G6OA 3R6XA 1LPUA 4XEYA 1ZRZA 3O50A 1U54A 1PXLA 2BPMA 2PMIA 5DYJA 2XYUA 3QGYA 4BZDA 1UNGA 4EORA 3WZJA 5CVHA 2C6TA 2QOLA 3MSSA 4QMNA 4AN3A 1E1VA 3SA0A 2J0KA 1W7HA 4GUEA 4ZSEA 3BRBA 4J97A 5G1XA 4YJQA 4DEEA 4O7VA 2FSLX 3NNWA 4TT7A 3UO6A 4A9YA 2HZIA 5JT2A 4Z16A 3A8XA 3AC3A 4I23A 3WE4A 4NZWB 5CSWA 4ZSLA 5DGZA 3SQQA 1FBNA 5AX9A 4CV8A 3ORZA 2W1IA 3F3ZA 4HPTE 4CQEA 1Q41A 4RFZA 2XJ2A 4QMZA 3KXGA 3O51A 3S4QA 4FIFA 1ZOGA 4EWQA 3PJ8A 1KE5A 4EBWA 4CT2A 2VO7A 3E7VA 3HV6A 4EI4A 3CJFA 3R7VA 1B6CB 1E9HA 4M97A 3ZRKA 3TUCA 3GVUA 3HAMA 2R3IA 5FUTA 4CT1A 4CCUA 4LOPA 5DA3A 2H96A 3NZ0A 4L68A 3FHIA 3VF9A 3D2KA 3QRUA 3GCVA 3PUPA 2YERA 4F9WA 4BCNA 2ERZE 3WYXA 2PE1A 4EOPA 4GT3A 4TPTA 1YRPA 5HTBA 5A6OA 2YM7A 4EUTA 5BYZA 1NA7A 1ZOEA 2Y8OA 3OMVA 4IVAA 2QNJA 1Q4LA 5HE2A 1XR1A 4E6QA 3M42A 3MA6A 4OTWA 3QLFA 4I4FA 4USDA 4ITIA 5B7VA 2J0LA 2GNGA 4OTRA 4MWIA 2VWYA 3WBLA 4C4HA 2VTMA 2HZ0A 1LEWA 1QL6A 2OZAB 4ID7A 1OPJA 4WT6A 3HAVA 3CQUA 3DK7A 4QMUA 4ZJJA 4MH7A 3L8SA 1QPDA 4BDHA 3AC1A 4BCMA 4FUXA 2XIYA 4EYMA 5GZ8A 1G8SA 4DT9A 3Q52A 3A61A 4QMYA 1JQHA 2ITOA 2Y7JA 3PPKA 4CD0A 4JBOA 3JPVA 2GS6A 3UG1A 1IA8A 3NW5A 4S32A 4YHTA 3A7IA 4FV3A 4ZTMA 1XHAA 4QYHA 5AUVA 1XH6A 3QTXA 1M14A 5KMKA 3GFEA 2O65A 3ZYAA 1ZOHA 1F0QA 3DT1A 2FB8A 3E87A 3G6GA 5B0XA 2WTWA 3MPTA 2RFDA 3AG9A 4JOAA 3C13A 2OG8A 4KBCA 3NYOA 4FIHA 1Q8WA 4GIHA 5AIRA 5ETFA 2WU7A 4XNEA 4GG5A 3COIA 4GT5A 5BVNA 3G90X 1ZMVA 3LCSA 2XJ1A 3Q53A 3RMFA 2RL5A 2XCHA 3K54A 2OIQA 2PVMA 5ANKA 4MF1A 5FEDA 4O2PA 4IM3A 4X2KA 1IEPA 4RIOA 4U0IA 2J50A 3OCTA 1YDRE 4OTDA 4RJ6A 3V5QA 4AT3A 5BUJA 4J1RA 4DG0E 2IVUA 5CENA 2PTKA 3HV7A 4I92A 2YLEA 3ZH8A 1OIUA 4R3CA 3W55A 1KE6A 1Q24A 3HYHA 3KY2A 3EFWA 3RJCA 3GCSA 4BIDA 5M06A 2C6MA 3PXQA 2OLCA 1Q5KA 3KXNA 4YC6A 1MUOA 1ZYLA 3ZZEA 5EI6A 1WBTA 4DYMA 2X7OA 2PVJA 3QQUA 3QTRA 3HUCA 4RA4A 3NYXA 4BB4A 4FVRA 1W0XC 1OL6A 4E73A 4P2KA 3WZKA 2BZJA 4V0GB 2HCKA 3ULIA 2PZYA 5CNNA 4CGAA 2IWIA 2WTDA 2FH9A 2X0GA 4M67A 1JAMA 2IZTA 2V7OA 3BGPA 3G2FA 4KKHA 3Q9XA 4F1TA 4AP7A 3AD6A 2OBJA 2BALA 2Z7QA 3KULA 4NM5A 3RAWA 3TZ7A 1UU9A 3MH1A 3FPMA 4X3FC 5EW9A 4CFNA 3CGOA 4P5QA 2ETKA 2W1HA 3TIZA 2PU8A 4F09A 5A54A 4DH3A 4LUEA 4X2FA 4Z7GA 2B9IA 3BYVA 4N4SA 5J9ZA 3AXWA 3QUDA 2CHLA 4FKTA 3MFTA 3R63A 2G9XA 3FYKX 3FKLA 3HP5A 4KWPA 3W2QA 3VS2A 4ANMA 3Q9WA 3GT8A 1JLUE 5EK7A 5KZIA 4FZDB 4BCGA 3UQGA 4HVDA 5IA3A 5HZNA 3R7OA 4O7ZA 4KKGA 4O1PA 4FEUA 4FL1A 4YJUA 4F4PA 5CU2A 1J7LA 3Q4CA 1OVEA 5HOAA 4YJSA 3GQLA 2JIVA 4L7FA 3NUSA 4FEVA 4O7TA 3U4UA 3O2MA 1JKLA 3QF9A 4IXPA 3C4ZA 3DLZA 2HW6A 3E8DA 4GMYA 2YISA 4UMTA 4ERKA 4CG8A 5AP5A 3LQ5A 4AAAA 1K3AA 3MPAA 2B9HA 4O27B 2WMTA 3HV4A 5ETCA 4BI1A 4C3PA 3R9HA 3PJ2A 4FV4A 4BY9E 1VYWA 4FSTA 2XBAA 5FXRA 5CWZA 1ZLTA 4D55A 2PHKA 5HG5A 1JSTA 1YI6A 3NNUA 5DFPA 2R9SA 3WF5A 3OT8A 3FV8A 3BKBA 3JVSA 2VX3A 1QCFA 3E92A 4D9UA 2W9ZB 2VWXA 4FTIA 3RALA 3MFUA 5M53A 4ALVA 4E1ZA 4CFWA 4APPA 3FZTA 5HIBA 2Y6OA 4E7WA 4U42A 2XKCA 1YI4A 4A4XA 2ITYA 2R3FA 4IMYA 4FZFB 3NLBA 3BBWA 5FRIA 4GK4A 2C6OA 4PY1A 4ZTLA 1OBDA 5LVOA 3TV4A 2IVTA 1XH5A 4HGEA 4AGUA 4BCQA 3CTJA 3B2WA 3RP9A 4C59A 4QTEA 1M7NA 4ALUA 2B1PA 2C6IA 1OUYA 3HDNA 1YDTE 4NCTA 4D4RA 5CAQA 2PUIA 3HV3A 3KRWA 3O8TA 4MTAA 5GINE 1IA9A 2VGPA 3Q4UA 3TACA 5LVMA 3LZBA 5HTCA 2R64A 2WQMA 3E64A 4NEUA 4FL2A 3PE1A 2WFYA 4AGDA 2WXVA 3BLQA 2JITA 3BYUA 4ALWA 4YZ9A 4TNBA 3FUPA 4LMNA 2YJRA 3PVGA 4F7SA 5HVKA 2C5OA 3NPCA 3CTQA 4OAUC 2XRWA 3DAKA 5AR4A 5BVDA 2PY3A 4E6AA 3SW7A 3IQ7A 4H39A 3EB0A 4FTQA 5J87A 5HX6A 4D28A 4IAYA 2VTLA 2GS7A 4IZ7A 1XH8A 3NUUA 5L4QA 2CJMA 4RWIA 2VU3A 5IQFA 1YWRA 4FTJA 4H58A 3QTSA 3V6RA 3UIUA 3VHEA 3FMHA 4Y5QA 3ZSHA 3VIDA 5LMBA 5LOHA 4RJ8A 4V05A 1VJYA 5AR2A 2WMSA 2JDSA 5KX8A 2YIQA 3DKCA 3DNEA 5IEYA 5CF4A 4D4YA 3I79A 3IG7A 3OXZA 4OW8A 3ID6C 4TY1A 4LQMA 3ENMA 3FQSA 3UDBA 4F9CA 5KMJA 4YU2A 2J2IB 3TKUA 3QALE 2OJIA 4C7TA 1YHSA 3OWJA 2YA9A 4FTCA 5KBQA 1VR2A 4ZLZA 3LCTA 4MHAA 5FTGA 4JRVA 5ANDA 3EJ1A 3CD8A 3HP2A 2W1GA 4O0RA 2YAKA 1ZYDA 4WIHA 3MTFA 4RT7A 5ANEA 2CKQA 3WARA 3UMXA 4L46A 1FVVA 3HMMA 5L8KA 4DFLA 2OZAA 3DBFA 3GC7A 4BCIA 4O7NA 4A4OA 1J7UA 4BR3A 4QPAA 4O38A 5L2TA 4KABA 3A7GA 3I5ZA 4WNPA 4L9IA 3CS9A 3UTOA 4JQ8A 4XCUA 5HIDA 1OMWA 3FY0A 4TN6A 4EC9A 5M07A 3RGFA 4FT5A 4MQ2A 4C57A 3H10A 4YZNA 4KSQA 3BLHA 2VD5A 4BBEA 3R21A 4I6HA 1H24A 3MWUA 5FP6A 4RQVA 3UE4A 4NFMA 4AUAA 4MD9E 4E6CA 5I9WA 3QQKA 3QYWA 5IH5A 5AMNA 3RPSA 2QOFA 3UZPA 3ZRLA 1IG1A 2VO0A 3KK9A 4RLKA 3ERKA 4IFCA 3W2RA 5I9ZA 1JKSA 3GB2A 2BRHA 4WNMA 1OM1A 4AZSA 2JD5A 2Y6MA 2WTIA 2GSFA 4LL5A 4HVHA 4FSWA 4PL4A 4KUJA 3COMA 4TWPA 4N70A 3NEWA 5C8NA 3T9TA 1Q61A 4KIKB 1BI8A 5LXMA 1GAGA 4FSRA 4ZXTA 4GYGA 3HECA 3JY0A 4O0YA 4TYEA 4YNEA 5CEPA 5I4NA 5IQHA 4YC3A 1WBPA 2QVSE 4ACHA 5AEPA 5I3RA 1GZKA 2QI8A 3PP1A 1OI9A 1PY5A 4PP9A 4IW0A 4EOLA 5M56A 4KBAA 3TNHA 5F1ZA 5HNGA 5CEIA 5C4LA 4BCFA 5CALA 3VBTA 3FXXA 2QO2A 4L6QA 4BICA 5CU4A 3R83A 4KD1A 2VWWA 2VZ6A 3MB7A 2UZVA 3E3BX 1ZZLA 1Y6BA 4O81A 4N0SA 3W16A 3SG9A 4OR5A 4BBMA 5L3AA 1STCE 4XBUA 3DBDA 3DTWA 3GFWA 5D10A 4BCHA 3QC4A 3ORTA 4B9DA 2NRYA 1F5QA 1Q8UA 2W1EA 3QKKA 3OCGA 1PKGA 1Q8ZA 4D0WA 2UUEA 4YMJA 3I81A 3MB6A 4QMSA 2HWOA 3E88A 2EXMA 3ROYA 5BPYA 5CF8A 4M3QA 4V0GA 3MY0A 1H01A 2OWBA 2Z8CA 4XG9A 5EDRA 4UXLA 4IIRA 4KIQA 4BKYA 2CN8A 3UIXA 2XNPA 2XNEA 3ZSGA 3H0YA 1ZMWA 2C6KA 2J5FA 3LJ1A 4OBQA 3W8LA 4GJ2A 2RKUA 3IW4A 4FEQA 3W33A 3AT3A 3BHHA 5IQDA 1QPJA 2EWAA 4LFIA 3TG1A 3VJOA 2NRUA 5IPJA 2VTHA 3QTIA 2O63A 4TNDA 4XJ0A 1WMKA 4RVTA 4HOKA 2VNWA 2JEDA 2B9FA 2PMOX 2XYNA 3Q2MA 4MX9A 2YLFA 5TO8A 3N9XA 1Q3DA 1WVWA 3LMIA 3NAYA 3NUPA 2GQRA 4DCEA 4CCBA 3CY2A 3F5GA 3VUMA 4E4LA 5C4KA 1PHKA 1NT2A 2R0UA 3F3UA 1XH9A 1OKWA 4ZMFA 1WBWA 4M8TA 4AF3A 4QP3A 4UMQA 1ZY4A 1DM2A 3LLAA 5GNKA 2B53A 4DN5A 3NUAA 4FV0A 1SVHA 1ZY5A 4AFEA 4H3PA 4HNFA 4UMPA 1J3HA 2VUWA 2AC5A 3ORNA 4IX6A 3MS9A 1XO2B 2HXQA 4M0ZA 2JC6A 3E62A 1MP8A 3LFSA 4I4EA 4ACMA 5HQ0A 3GC0A 3N4UA 2WTCA 3DAJA 4XMOA 4LRJA 3P79A 4IEBA 3DBEA 5HBJA 2ETRA 3WZUA 2WMUA 3CKWA 3HMIA 4W4VA 4HGLA 1LUFA 4RA5A 2X8IA 4IWQA 5HI2A 2OH0E 2W06A 4Q2AA 4YZBA 3TXOA 3QL8A 4G2FA 2ONLA 5HG9A 3ZBXA 4MF0A 4JJRA 5E8UA 3UNKA 3TL8A 4D1XA 5IQBA 2V0DA 2OXDA 2NP8A 1UU8A 2UW8A 2UW4A 4L42A 3ZTXA 1H1RA 2YIXA 4TW9A 1NXKA 3NUXA 4RLLA 2IW8A 4HZRA 2Y4IB 1JSUA 3DK3A 3UP7A 5BMMA 2OI4X 4Q5HA 3S3IA 5AAGA 1OL2A 5AR7A 4R78A 2H34A 2X9FA 2ITUA 2FO0A 4PL5A 4A07A 2FSTX 1EH4A 2XIKA 4CTCA 3F9NA 1GZ8A 5BVKA 1CSNA 4RWKA 3CQWA 4IB3A 3HMOA 4TYJA 5CX9A 2XS0A 2WIPA 4AA5A 3BEGA 3KVWA 3BWJA 4UZDA 2ZMDA 3EN7A 2UZTA 2ZV9A 3MPMA 5IQIA 5ANGA 4DEIA 2FA2A 1SNXA 1JKTA 2HWPA 3CPBA 3IECA 5H8GA 4EYJA 5JQ8A 3AC5A 1CM8A 1H1SA 3ODZX 4IQ6A 3QAME 4ZY4A 3GC8A 4AT5A 1GJOA 4GU6A 2W9FB 2ZAZA 1M52A 5J1VA 3EMGA 4AGCA 1U59A 3GBZA 2GHMA 2DS1A 4JIKA 5DE2A 4JAJA 4OGRA 5AUUA 2QKWB 5BQ0A 5L2SA 4X6QC 4U3ZA 5AA8A 4ZAUA 3U87A 4A9TA 1FGIA 1MRVA 2DQ7X 3CY3A 3KCFA 3KKVA 3QRJA 5IQEA 2B0QA 1W83A 4NU1A 2JFMA 2VV9A 3LHJA 2PVNA 1BI7A 4BWXA 4RMZA 4BGHA 1P2AA 3F3TA 4I5MA 4O1OA 3F2AA 2YDKA 2DWBA 2BILB 4BCOA 4FT7A 1SVGA 4U79A 2A4LA 4I6QA 4KRCA 3NW7A 4FZ7A 4QOXA 3BGQA 1OB3A 4A9UA 2O8YA 3MY1A 4K6ZA 5HLWA 3Q9ZA 2QO9A 1E1XA 4IANA 5LMAA 3UPZA 4HGSA 4KKEA 3W10A 2CGVA 3UIMA 2UVYA 4IZ5A 4XV3A 2W17A 3UC4A 2HENA 5LCJA 3DKFA 4USFA 2VWUA 4QMOA 4RSSA 2XNMA 2GTMA 1CKIA 4NW5A 2B52A 1BX6A 4FKSA 3PXRA 5KE0A 5ACKA 4FGRA 3PY0A 1UNHA 4FNZA 4U41A 5ANIA 2PVHA 5IQCA 4G34A 2X7FA 3RAHA 5BNJA 3VUTA 3I60A 3KRLA 4EH4A 3OCSA 4QNAA 3PDTA 4PMSA 1WCCA 4CV9A 2C1AA 1WFCA 4FV9A 4FYNA 5HE1A 1ZYJA 4IAAA 3ITZA 4R1VA 4IFGA 4YPDA 2LAVA 5J7HA 2R3LA 2BFYA 4RC4A 2WMXA 5T6KA 3RK9A 4BIBA 1TQIA 4C02A 3RWPA 1OIQA 2WTKC 2BZHB 3FL4A 3OD6X 3QBNA 4RG0A 4C4IA 1O6KA 3VBQA 3LLTA 4FTKA 4NL0A 5HEZA 3PZEA 3WI6A 4HYIA 3SC1A 3SW4A 2IZUA 3VS6A 5LVPA 4O7RA 3HMNA 4I93A 1M7QA 3RHXA 1MQBA 3QC9A 4GKHA 4S30A 3WF6A 4FV2A 3W8QA 4DINA 2EB3A 2FYSA 3CE3A 4IHPA 2VRXA 4RGJA 3SRVB 2GNLA 4DLIA 3QQGA 4QYFA 2F2UA 2XF0A 4YSJA 4CTBA 3P5KA 4C4EA 1RW8A 3QGWA 4FSQA 3UVRA 5JGAA 2BDJA 3CC6A 4XG7A 4D2WA 2V7AA 5H8EA 2PYWA 3EQPA 2HYYA 5AV2A 5A6NA 3ORMA 3CKXA 2YDIA 4XUFA 4UEUA 4OTQA 2C5VA 4FIIA 4R1YA 4EH7A 5EYDA 2X4FA 5FEQA 2JBOA 2WEVA 4BYJA 4ANLA 2ZV8A 3C0HA 4I0RA 3S95A 3TM0A 4OAVB 2XKFA 2I0HA 3DBQA 4FTRA 2XB7A 3FMJA 3D5UA 3SOCA 4OUCA 5FGKA 2JAMA 4WUNA 4AX8A 3DDPA 2BHEA 2UVXA 4KSPA 4C0TA 3PVBA 2VGOA 2V62A 3KU2A 5T3QA 3EYHA 1NW1A 1A9UA 1JNKA 5HBHA 1P4FA 3ZU7A 1XBAA 2X2MA 5AP0A 2A27A 4AE9A 4FX3A 4MEDA 3VUDA 2BKKA 3ORLA 3OXTA 2ITNA 3JR1A 3ALOA 2X6EA 3Q4TA 4JDHA 5AAFA 4AFJA 2HZ4A 4BDJA 4F08A 3TZ8A 2XIZA 2GHGA 3C7QA 5EYMA 3R7EA 4DGOA 4NTSA 4RFYA 4F0FA 3DY7A 2UW5A 2XEYA 4E3CA 4C62A 1PXKA 5FBNC 2ITQA 3P9JA 2CPKE 4R6VA 3BU6A 2VTRA 1G3NA 3TDVA 2BDWA 1PYXA 4IM0A 3BU5A 4L53A 4G6LA 5F94A 2CLQA 5M55A 2BDFA 3PVUA 5DT4A 1L8TA 1ZYCA 4XP0A 5D11A 3V5LA 3ZO2A 3N4VA 3MDYA 3QTWA 2C3IB 2OJJA 2YM4A 4U9AA 5CEOA 1V1KA 3R2YA 5CNOA 5DWRA 1KE7A 4Z55A 3NS9A 2WMRA 2J0IA 2JFLA 5E1SA 5AADA 4O86A 1AGWA 3R0TA 3CTHA 2LGCA 4FK6A 5L6WL 1H00A 4KRDA 3BELA 2JDVA 3BE2A 4NKSA 3LJ0A 4RX5A 3L9MA 3D0EA 3ANQA 3OY3A 5CEMA 3UYSA 2R3PA 4MBIA 4W9WA 4KS7A 2RG6A 1YKRA 5CSVA 4UYNA 1K9AA 3FHRA 3EFJA 2YM3A 2IN6A 2J51A 5AUTA 4J53A 5CVGA 2OU7A 5AX3A 4AW1A 2E9VA 4RJ4A 4DH1A 4BDCA 4DGNA 4WD5A 5JSMA 3TNQB 3KB7A 3Q04A 3QTZA 5JGBA 3MVMA 2W99B 3EQIA 1FVRA 3PVWA 4G17A 4BI0A 3PPJA 3FI2A 4ACCA 4G16A 3QZGA 4M69B 3OT3A 4H3QA 3HA8A 2YCRA 4NH1A 3RZFA 1PMVA 4B0GA 3REPA 1UU3A 3ZC5A 3V8SA 3FZSA 2UW0A 1ZYSA 5AR5A 4BI2A 4F9YA 2IZSA 2QURA 2UW9A 2YDJA 3PG3A 3VQHA 5HIEA 4BZOA 3HA6A 1OUKA 3ORXA 5JN2A 2HOGA 3R1NA 5G6VA 3AD4A 3DDQA 4WHZA 2XIXA 2Z2WA 4EHZA 1MQ4A 4FTOA 3EN6A 4JNWA 5HICA 5GZ9A 4QMWA 5K4IA 2R3HA 3HGKA 5HO7A 2UZLA 5FM2A 2Q0NA 4UX9A 3TZMA 4FT9A 5TE0A 2VO3A 3R9DA 3MJ2A 2C0TA 4XHKB 1GZNA 3I0QA 3GOPA 3F5UA 4QT1A 3KMUA 4QMVA 5FP5A 2VTIA 4LYNA 3MN3A 5T68A 5EHLA 5HO6A 4ZEGA 1NVQA 2YWVA 4EZ7A 2CLXA 2XUUA 4IVBA 4D1ZA 2ZM4A 4ZLYA 3SXRA 2QODA 3OBGA 4PPAA 3OG7A 4ZY6A 3ZLWA 3HX4A 3MVLA 2JKMA 3HRBA 1Y57A 4M12A 4AZEA 3CBLA 2G2IA 3QCYA 4MXCA 4EONA 1O6LA 4NCTC 4XYFA 3II5A 5KZ0A 5JFXA 4X3JA 1HCLA 3JY9A 2UZOA 4G3EA 5HLPA 3QZIA 3TI1A 3GUBA 1H1WA 3EQGA 4GH2A 4JXFA 5DI1A 3PJ3A 2C47A 4L45A 1BL6A 5BVOA 3M11A 1YVJA 3EQBA 4NM7A 5J9YA 4LV5A 4C3RA 4GJ3A 4DLJA 4TYGA 3UQCA 2R3GA 5F20A 4QP8A 1ZMUA 2ZDTA 4D2PA 4QTDA 1APME 3MY5A 3PIZA 5DRBA 3ZO3A 3PPZA 4AZVA 1M2QA 4QTBA 5DOSA 5DH3A 3BWFA 2Z7LA 4L00A 5KKRB 3LQ3A 4GSBA 3KRXA 3OZ6A 4QMLA 4I0SA 4BDEA 5AR8A 3V01A 4DTKA 2C69A 3L9LA 5CSXA 5M4UA 4PTGA 3CSVA 4EK8A 3A2CA 1GIHA 3JYAA 3A7JA 4I41A 5I9UA 3SOAA 5EQEA 4IDVA 1OL5A 4DE4A 2C4GA 3ZEPA 3QZFA 3V5PA 3B8RA 3Q32A 3KCKA 4PDSA 3FC2A 5J1WA 2P4IA 1YHWA 3M2WA 3SRVA 3DCVA 1Q99A 3RPRA 3L9PA 2EXEA 3FDNA 2YM8A 3PSBA 3R2BA 2W1FA 3CCNA 4UALA 3I6UA 3LMHA 1OITA 4NUSA 3BLRA 4DH7A 4QMTA 3LFFA 2V22A 5M4IA 4MAOA 1PRYA 2NPQA 3H0ZA 2WQNA 3OUNB 5DT0A 4DG3E 4F99A 1L3RE 2H6DA 3EIDA 1OGUA 4U40A 4RJ5A 1U46A 2SRCA 4DEGA 3D5VA 2VTNA 3Q9YA 4EHEA 4UYAA 4PRJA 4MXYA 5EDPA 3NVKI 4LI5A 4I94A 3R04A 2C6DA 4ONAA 3PP0A 4FODA 5HNBA 5KHXA 4QTCA 4GEOA 1R39A 3R28A 4IVCA 4F9BA 3PZHA 5CU3A 3DXQA 4AZWA 2PUUA 1U5QA 1FQ1B 4QPSA 1NY3A 4GG7A 4YZDA 4JLCA 3E93A 4XV9A 3SLSA 1P14A 3GNIB 4I21A 4HVIA 3UOJA 3P4KA 5CSPA 3MJ1A 3OTVA 4EQMA 4F6SA 2AC3A 3PLSA 3FC1X 1F3MC 2F57A 3C4EA 3C4XA 2C3JA 3NW6A 3UGCA 4FNXA 3ZXTA 2XIRA 3BE9A 4G3GA 4AT4A 3NDMA 3Q6WA 4FKWA 4AACA 5BMSA 1OL7A 3R7GA 4OTFA 5EQYA 4B6LA 3UYTA 2A19B 1UKHA 2P2HA 3HRFA 2GS2A 3RHKA 5M44A 4ASZA 2Z7SA 2JIIA 3VUGA 3QA8A 4DEHA 1XH7A 4N6YA 4FL3A 4ZTHA 4YO4A 4FGBA 4W8DA 2YIWA 2NO3A 5HO8A 5DNRA 4GT4A 5CU0A 3G6HA 3AC4A 3HL7A 3K5VA 4CZYB 5AP3A 4YTFA 5GIOE 3DPKA 4HCTA 4FTTA 5M08A 4Y46A 3V3VA 5C8MA 3IGOA 4UN0C 2XK9A 1FMOE 5H2UA 4OT5A 1PXJA 3C1XA 1Q8TA 3KXMA 3MVHA 3NIZA 4Z9LA 3VHKA 3O96A 4CFFA 3GP0A 3R02A 5GJFA 2CGWA 4JAIA 3F2RA 2PVRA 2XEZA 3ZXZA 4IWOA 3AGMA 4XP3A 2ZJWA 4MBLA 2X81A 3RINA 4PMMA 3DLSA 4GUBA 4CFXA 5KMOA 1SM2A 3EFLA 3TN8A 2R0IA 3HNGA 5HE3A 2B7AA 4D4VA 5E92A 3R9RA 2IPXA 4O83A 4QMPA 1H25A 5CQWA 2IVSA 3MA3A 3F2NA 4UWCA 3CR0A 4XG2A 4XV2A 3ZUUA 4USEA 5L6PA 3OHTA 1SNUA 3P08A 4O0UA 4UWBA 2REIA 2VO6A 3ZMMA 5CF5A 2F9GA 2BKZA 4YURA 2QC6A 1IRKA 3ZLXA 3NYVA 2JDRA 1XH4A 3AT2A 2OK1A 2PZPA 3LFCA 4C2VA 4XLVA 3F5PA 5L6OA 5CI6A 4D4SA 4EKKA 2QOBA 3VS5A 4DEAA 3R00A 3PRIA 5H3QA 2QOCA 3EQCA 2R7IA 1YXTA 4UWYA 4IB1A 4M69A 3AGLA 5DR9A 1VYZA 2C5XA 3LQ8A 5M57A 5AFVA 1GIIA 5J79A 5M09A 4D58A 4DGGA 5K5NA 4HYHA 4C4FA 4G3FA 3FLZA 3CJGA 4L3LA 4XV1A 4AXAA 5E4HA 2PSQA 4DH5A 4GFOA 5IZFA 2XKEA 5DPVA 4ZMEA 4GFMA 4ZSGA 5CASA 3KL8A 4AU8A 3QD2B 3A99A 4BTJA 1O9UA 4DC2A 1PYEA 2CKPA 4YHJA 5AV0A 3POOA 2BIYA 2CGUA 2X6DA 5EHYA 1KE9A 3C5UA 5EKNA 1OL1A 4YJNA 4HNIA 1Y8GA 2E2BA 4QD6A 5I9XA 5HX8A 5IA2A 3S00A 4QP9A 2P3GX 5GHVA 3KK8A 2ONLC 1RDQE 3FMNA 5EOLA 4HCUA 3OEZA 5AUWA 3OBJA 2BCJA 3ETAA 3R7UA 2G2HA 2J7TA 3EHAA 4WA9A 4ZK5A 3KN6A 2WOTA 3R01A 3L8PA 2CNVA 4EZ5A 1W98A 2C0OA 2IJMA 4K1BA 4TWNA 4YO6A 3P7BA 5M4CA 4I20A 2YAAA 2RFNA 4XP2A 3RNYA 1O6YA 3DXPA 1B38A 3QHRA 4L8MA 4J98A 4EK5A 5FTQA 1SMHA 2W5HA 2UZWE 3HEGA 3LE6A 3PTGA 3PFQA 3LXPA 4H1JA 4TYIA 3RCJA 5JEBA 3Q5IA 1R3CA 3IGGA 1H1QA 4HJOA 4NT4A 5EW8A 2QOOA 3MIYA 1URCA 3O71A 2Y0AA 3Q6UA 5E8WA 5BX0A 3AMAA 1RE8A 2QR8A 2QOQA 4NIFA 2X7GA 4RZVA 5E8VA 1KE8A 4ZZMA 4C36A 2ZM3A 4D5KA 5KMIA 5LJJA 1GY3A 3BI6A 4FZAB 4JBPA 5K4JA 4XBRA 4H36A 1SZMA 3VUIA 2BZKB 4GCJA 2XMYA 5EI8A 3A7HA 4EZ3A 4YR8A 1V0OA 4GW8A 4FOBA 3FJQE 3SHEA 1UVRA 2OZOA 4RPVA 4YHFA 4MVFA 4OTPA 4UZHA 4E4MA 3TJCA 2G15A 2GQGA 1SYKA 3BYSA 1XBBA 3VJNA 5FTOA 2G2FA 2BHHA 3LXNA 4CMOA 5A14A 2RGPA 2YJSA 4G5PA 4YP8A 1XQZA 2R7BA 3R8LA 3S2PA 4R5YA 2GPHA 2BIKB 5DVRA 3ZSIA 2VTAA 4FKQA 3UO5A 3VS3A 3EKNA 2QKRA 2IZRA 3OWPA 3W2OA 4YJVA 3HV5A 3EL7A 3QQHA 4YBJA 3ULZA 5KMMA 3PYYA 2ZV7A 4EH6A 3HZTA 2BRMA 3A8WA 5E90A 5AP2A 3PG1A 4PNIA 4NJDA 2XA4A 1OPLA 4PTCA 2C30A 4IDTA 3O17A 3QWKA 4XRLA 4WG5A 5J9LA 4CYJA 4QPMA 5CVFA 5HHWA 3DOGA 4E5WA 2YWPA 4GVAA 3CP9A 3V51A 4JBQA 4TWOA 3EYGA 4CVAA 4EHGA 1LP4A 4AW2A 1YI3A 3I6WA 3OW3A 4BCKA 4FIJA 4RBLA 5JFVA 3LM5A 3OY1A 4NM0A 2RF9A 2WMBA 1KV1A 5IF1A 1A48A 4E5AX 4XS2A 2C6LA 2OXXA 3H30A 3KRJA 3QX2A 3MH3A 4RIXB 3UNJA 1J7IA 3ZBFA 2IW9A 2JDTA 3LW0A 2HXLA 4FVQA 5FLFA 4H1MA 3W2PA 2ITPA 3G33A 4PDYA 3QRIA 3NWWA 4FZ6A 2PVLA 3V8WA 2WIHA 2XK3A 4ASDA 5A46A 4HPUE 3C0IA 4BF2A 5L2WA 5CANA 1GOLA 4DGMA 2C3KA 3FZOA 4I1ZA 5HCZA 3QWJA 5TR6A 3SD0A 4FF8A 5CAPA 3BHVA 2VX1A 4GL9A 3VQUA 4X6RA 2R2PA 1JOWB 1T46A 4P90A 4TKSA 4AQCA 5HD4A 2W1CA 2O0UA 4RX7A 4ZTRA 1IAHA 2XK4A 4S2ZA 2J4ZA 4WOVA 2E9PA 1OPKA 2HELA 3FBVA 3JXWA 3OWLA 4L01A 3PXKA 4O7SA 5EM5A 4BZNA 3BIZA 1VEBA 5HCXA 3ZDUA 4AOIA 3G9LX 1CKPA 2WO6A 4IWPA 4AA4A 3Q2JA 1JPAA 4CKJA 3KMWA 3IW8A 4FVPA 4ZSAA 4GU9A 3FSFA 2O64A 2QLUA 4YZMA 4WKQA 4CKIA 3HUBA 5DG5A 1AD5A 2F7EE 4GIIA 1GIJA 3KXZA 3R1YA 5CZHA 5JKGA 3LJ2A 4RZWA 4LM5A 3V5TA 3BX5A 4C38A 1KSWA 1PMNA 2X8EA 2XM8A 3FY2A 3GCUA 1OKVA 3E8EA 4ZS0A 3ZEWA 4KIPA 5CY3A 5C8KA 1BUHA 1REKA 3CXWA 4YTHA 3DZOA 3R22A 3UG2A 3ZM9A 3CIKA 3ODYX 5J5SA 5KHWA 4KAOA 4L43A 2WQBA 1U5RA 4YJRA 4MCVA 1UV5A 4Z7HA 3EN9A 3EN5A 3LM0A 4PWNA 3U9NA 3F61A 4F0IA 2J6MA 3VC4A 3VNTA 5HESA 4I5CA 5B2KA 4XOZA 4ENYA 1CDKA 2PZRA 4YBKA 3POZA 3D5XA 1TQPA 2YFXA 2R3OA 2WKMA 2Z7RA 4XG4A 5D7VA 2CKOA 3ZFYA 3ACKA 5ACBC 4JL9A 2RFSA 5E8YA 4FUYA 5EH0A 3LFAA 5AV1A 3BYMA 4XH6A 4QRCA 4R3PA 1J91A 2F49A 3FKOA 2UZBA 4K9YA 4EUUA 2YN8A 2GMXA 2XNOA 2GNHA 3LCKA 4HCVA 4JRNA 5KNJA 3TIYA 4J7BA 4ZTQA 5A4CA 4K8AA 2OXYA 3KQ7A 4F7NA 1JVPP 5ITAA 3ZM4A 5IQAA 3DQXA 3LAUA 3QXOA 3MI9A 4BTFA 2QCSA 2YABA 5C03A 4EH9A 5HORA 5IUGA 4E5BA 5IA4A 2HAKA 4DFNA 3ANRA 2PE2A 3FLSA 5LMKA 4I0TA 5JZNA 4I6BA 4GS6A 3F69A 3IS5A 4BCPA 5KUPA 1LR4A 4TZRA 1TVOA 3TV6A 5DEYA 2IW6A 3AMYA 3BZ3A 4XOYA 2AUHA 1KV2A 1H08A 5AIKA 4J96A 5C26A 2OF2A 4TRLA 3O8UA 4DAWA 4JDKA 1DS5A 4ERWA 3FLYA 3OW4A 4M7IA 3FMKA 4QP7A 3W2SA 4MNEB 4XX9A 4EH2A 2W05A 3OF0A 4O7WA 3IOPA 3U9CA 2BZIB 3QX4A 4EJNA 3PWYA 3VULA 2CGXA 3OP5A 4UB7A 3EZVA 3HRCA 3MIAA 3NSZA 2I1MA 3RI1A 2Y4IC 4D2RA 3U8WA 4TWCA 2B4SB 5AR3A 3MW1A 2XK7A 4TTHB 1R0PA 4E6DA 4K2RA 5AAEA 4ASXA 5E1EA 2VWBA 3TKHA 3QTQA 2UW3A 3DGKA 4V01A 4A9RA 4F70A 5ETIA 3GU7A 3S1HA 4N6ZA 2ITWA 1H0WA 3R9NA 3RVGA 5LWNA 3MYGA 5CXZA 4O82A 4UV0A 4RJ3A 3TNIA 4C34A 1XKKA 5JMSA 3QKMA 3W32A 4LGHA 4LRMA 3UVPA 4HVSA 4AOTA 4F63A 1UA2A 2R5TA 3FWQA 2RG5A 3H9RA 4DF3A 3PWDA 4JG6A 4X2GA 4RC3A 4WRGA 3R7YA 2CSNA 4ANBA 2WEIA 3EL8A 3QFVA 3WILA 5BVFA 2Y9QA 4CMTA 4X21A 4XLIA 2JKOA 5J7BA 1K2PA 5FEEA 2VWIA 1Y91A 2I7QA 4QQJA 3GU8A 3P86A 3LCOA 3U51A 3TCPA 4GRBA 3ZUTA 1I44A 3C4WA 3RWQA 5HNIX 2R3MA 4FR4A 1IASA 2EXCX 3D83A 4MXAA 4BGQA 4ZLOA 5CEKA 2C6EA 3F66A 5AP4A 4F65A 3FKNA 2OW3A 4MK0A 5IKWA 2BAJA 4MKCA 3PA4A 3Q3BA 4K18A 3ATSA 3QA0A 1ND4A 3QZHA 2RSVA 3K3IA 1QPCA 2ZMCA 2ITVA 5JFWA 4IB5A 2WZJA 2OGVA 2PVKA 4FOCA 3T3VA 4D0XA 4EQCA 2YCQA 5CAOA 3D2IA 3U4WA 2WMVA 4GK2A 4ZTNA 4CLIA 5A4EA 5CXHA 3SAYA 4BKZA 5AUZA 4A9SA 3THBA 5CZIA 4FSZA 3EQRA 5IA5A 3TV7A 4FKOA 3F3VA 2Q83A 3GC9A 4R77A 2C0IA 1BKXA 4DFXE 4DTAA 2F7ZE 4RIWB 3I1AA 4RIXA 2ZB1A 4YTCA 3MH0A 2UZUE 3NCZA 4QMMA 2IG7A 2Y4PA 3NYNA 3UP2A 2DUVA 3UO4A 4DFUA 1PXIA 1W82A 2BAQA 4QP2A 5AV3A 2ZVAA 4K33A 1YXUA 3L8VA 4ARKA 4BTKA 4G6NA 4ITJA 3LVPA 4UMUA 5DR2A 2ZDUA 3SXFA 4CSVA 3D9VA 5KMNA 2JKQA 4U81A 3GU5A 5AP6A 2ZV2A 3ZLYA 4HW7A 2F4JA 2JLDA 4WO5A 4LV8A 2VWVA 2PL0A 2DYLA 5HLNA 2GDOA 1BMKA 1DI8A 4YLJA 4FEWA 5JQ5A 4W4XA 4WRSA 4YJPA 3NR9A 4QNYA 1AQ1A 4QO9A 2OJFE 4IAIA 4C58A 5BUEA 3OXIA 5IA0A 5IDPA 4C33A 1J1CA 1UWHA 5ANJA 4B8MA 5IUHA 5AWMA 3Q96A 3P7AA 4KB8A 5IMXA 2W1DA 1YXSA 1G8AA 3L1SA 2WNTA 4U97A 4BCJA 4AG8A 2JBPA 5TT7A 4U6RA 5CEQA 1OBGA 2XRUA 3IPHA 3QYZA 2OICA 5DEWA 4EL9A 5JGDA 2CCIA 5DLSA 4YLKA 4AZTA 2WGJA 4FTNA 4D2TA 3C0GA 3VVHA 2ESMA 4G3CA 4MXOA 5AM6A 4P7EA 5D9HA 5AP7A 4A06A 2WB8A 4BDKA 3KN5A 4CQGA 4CFMA 4FTUA 3O8PA 3BV3A 3R8MA 4C35A 3PJ1A 4O84A 1PXMA 3TNWA 4HYSA 3SV0A 4PV0A 2WMWA 4CKRA 4II5A 3KVXA 1Q3WA 4O0XA 4Z3VA 2W0JA 5DBXA 3BHUA 3LFDA 5FDXA 3SDJA 3RPVA 5LQFA 5DRDA 4U3YA 4E20A 3D7TB 4AW5A 3OS3A 3EZRA 3PSDA 4IBMA 4Y8DA 1LEZA 3QU0A 5L2QA 2YIRA 4FKLA 3U6JA 3RPOA 5HG8A 3BCEA 3OOMA 3NGAA 4I5PA 4FKGA 4ACDA 1H1PA 4Y72A 4BRXA 5IEVA 3C4CA 3ORKA 3F5XA 4U44A 3WF7A 3N51A 4K0YA 3PY1A 4AOJA 4MXZA 4YGAA 3G0EA 4D2VA 4BDGA 4BC6A 3RPYA 1UKIA 3I0OA 2HY81 2UW6A 5HG7A 5E7RA 2HW7A 1P4OA 2UZNA 5AM7A 1FGKA 4NJ3A 4HGTA 5E8SA 2QHMA 3PE2A 4FT0A 2PPQA 1BYGA 3FMDA 2I0VA 2BROA 2FSOX 5IH4A 4S33A 1XWSA 3VF8A 5DN3A 2KTYA 2GFSA 4IADA 2OKRA 3OFMA 5LWMA 2QD9A 3DJ6A 1YOJA 5K0KA 4F64A 2YACA 2J90A 3LXLA 4H3BA 4J95A 4QYYA 4RWJA 4ZTSA 2C5YA 4O0TA 2PVFA 4CRSA 4UY9A 2VNYA 3COKA 5FXQA 3R8VA 5CQUA 1H07A 2CDZA 3H4JA 4X3FB 4LGDA 5CSHA 4GKIA 4GV1A 4MNEA 1PF8A 3MESA 5DR6A 4PUZA 3UOLA 4NIFB 3D5WA 4NM3A 4F6UA 4M0YA 5HCYA 4BTMA 4EH8A 3EOCA 2PVYA 3IK3A 3IW6A 4I6FA 4IAKA 5TOZA 4BL1A 5I0BA 5IH6A 3TEIA 5GIPE 5DMZA 1T45A 4W4WA 3C50A 3QD0A 3T9IA 4E4XA 3RKBA 3JVRA 4DEDA 4EOJA 5EG3A 3LCDA 2ZM1A 3QD3A 4WBBB 1PXNA 1KWPA 4HYUA 5JK3A 3K5UA 3PIXA 4EC8A 3ENHA 3TNPC 4JX3A 2OFUA 2QHNA 3NX8A 4O6EA 4MD8E 1YOLA 2OIBA 4HVGA 4F9AA 4PX6A 2ACXA 2X1NA 1JKKA 3GCPA 3GU6A 5E8ZA 3ZFMA 3W18A 4I24A 3ZO4A 3HMPA 3MGYA 2FGIA 3Q5ZA 3OEFX 4BYIA 2WQOA 3A4OX 4YJTA 5KO1A 3CGFA 4CMUA 3VUHA 1W8CA 4JX7A 4BDAA 4D5HA 3G51A 4XG3A 1H28A 4EHVA 4O0VA 3FXZA 3V5WA 5IG1A 2YIYA 1FVTA 4LRKA 1IR3A 3H9FA 3LIJA 4C4GA 2OJGA 4K11A 4BIEA 3F7ZA 3C51A 1NVSA 2VTJA 3MBLA 4MYGA 4B4LA 4L52A 3V04A 2FSMX 5CYIA 2X4ZA 4DFYA 4FG9A 3EQFA 5AA9A 2R3KA 3VS1A 4AN2A 2OIDA 4MWHA 5EI2A 5J95A 4GYIA 4ACGA 2WHBA 3K3JA 4FKJA 1OIRA 1YXXA 3TTIA 2B54A 2JIUA 4Q5EA 3VO3A 2ZYBA 5KMLA 1UWJA 2X8DA 4FNYA 4C8BA 4E93A 3FLNC 4O0WA 1ATPE 3D14A 2A2AA 2WTVA 3DQWA 4EOMA 3O23A 2XH5A 4DCAA 3A7FA 2BVAA 3BHTA 5FDPA 1OKZA 4Q9ZA 1WAKA 4D2SA 3A60A 5AV4A 3RK5A 3FMEA 4EK3A 3I7CA 4B7TA 2OFVA 3OCBA 2VAGA 3GQIA 4FTLA 2QG7A 4NFNA 4KIOA 2W1ZA 2R3JA 2A1AB 5L8LA 4R7BA 4CLJA 5LARA 5EDQA 4CFUA 2QG5A 4R7IA 3IONA 4RIYB 4B8LA 5CT0A 5IEXA 4EKLA 4PQNA 3VBXA 4RC2A 4RVKA 4FV8A 3F7WA 2VX0A 5AUYA 3ORIA 3I4BA 1GNGA 3DXNA 4UBAA 5A9UA 4PPCA 2P0CA 2WD1A 3RK7A 3PY3A 4JQ7A 5TF9A 3U6IA 2O3PA 3AT4A 3UZRA 2P33A 5HVJA 4I22A 1M17A 2I40A 3EN4A 4RIWA 1H27A 2I0YA 4PNKA 3GGFA 5M51A 2GFCA 4YLLA 3QD4A 3GEQA 4L3JA 2XVDA 4O22A 5DHJA 1HOWA 3IOKA 4WG3A 1KUTA 4U43A 4R3RA 4JI9A 1R0EA 2J5EA 2JKKA 4XG8A 3RM7A 5B2MA 2BAKA 1WBSA 3G5DA 5CU6A 3UODA 2YEXA 4NWMA 3VAPA 2QOIA 4UXQA 5BVEA 4R7HA 3BHYA 4QYEA 3QQFA 4U80A 2UZDA 5KKRC 4S31A 1H26A 2C5NA 2GNJA 3ROCA 4E8AA 4FKUA 4IJ9A 5D7AA 2CNQA 3QQJA 4L44A 2GQSA 4AE6A 3I7BA 3P1AA 4U5JA 5ICPA 4NK9A 3OWKA 4X2JA 5H8BA 5AP1A 3W2CA 4BDBA 2BFXA 4MD7E 2XNNA 5HVYA 1VZOA 4I5HA 5EFQA 2WMAA 4L67A 5K0XA 2W4OA 5GJDA 4U45A 3QUPA 3FPQA 5K9IA 3FE3A 3BV2A 3E8CA 4BGGA 2HZNA 5EM6A 2OO8X 1UU7A 2GU8A 3KEXA 4RVMA 2PWLA 3UBDA 4JDIA 3PA3A 5ETAA 4DEBA 3ZUVA 3DBCA 1URWA 3D15A 4IWDA 4DGLC 2QQ7A 1PXOA 3AC2A 1IAJA 4RFMA 2G01A 1PW2A 4IVDA 4MQ1A 2AYPA 3OROA 4BBFA 1H4LA 4DFZE 1Y6AA 4F7JA 3WF9A 4IB0A 3KA0A 5A3XA 1MRUA 3VS4A 3F88A 2C1BA 3DKGA 4D9TA 5F4NA 2H9VA 1X8BA 1Z5MA 2C3LA 3CLYA 3QHWA 4HZSA 5LCKA 4NSTA 2WMQA 3A62A 4X0MA 5EM8A 4O21A 3MVJA 4IAZA 5CAUA 1R1WA 4WNKA 2ERKA 5I9VA 1YDSE 4G1WA 2BR1A 4O2ZA 4JS8A 4FG7A 4AA0A 4WSQA 3UVQA 2ETMA 2RFEA 4DTBA 4J8MA 2YM6A 3DK6A 3NUNA 2XK8A 4JVGA 4YPSA 4JG7A 5IDNA 5EM7A 3FZRA 3GENA 3D7TA 2VTPA 3D94A 4PMTA 2PE0A 2XKDA 4JG8A 2BMCA 4YSMA 4J8NA 5E9EA 3QCSA 3UQFA 4ITHA 4L7SA 4ZOGA 1PJKA 3R73A 4G9CA 3UPXA 4LG4A 4DT8A 4FSNA 4OTGA 1RJBA 3F82A 3DNDA 3UC3A 4FTAA 3P7CA 2Z02A 4PP7A 5CTPA 5DIAA 2XJ0A 3O7LD 3TJDA 3ZRMA 4QP1A 4LUDA 3GOKA 2Z60A 3VRZA 5E8TA 3V6SA 2W4JA 3FZ1A 1ZWSA 2J9MA 4IACA 4JBVA 5HU3A 2YITA 3FZPA 4FEXA 3LMGA 3DA6A 4MBJA 4QYGA 4E4NA 5ANOA 4IJPA 4CEGA 4IAFA 4H05A 2FUMA 4EWHA 1PKDA 4IE9A 1TKIA 2ITZA 2G1TA 1XBCA 4CG9A 3R7IA 3LFNA 2GTNA 2XK6A 3VN9A 3IDCA 5A4LA 3QCQA 3C4FA 3PLAE 2GHLA 2EUFB 5C1QB 1Y8YA 2PZ5A 2R3NA 3KRRA 5GZAA 3DZQA 5B2LA 3KXXA 3TUDA 2ZOQA 4EK4A 1Q97A 1YQJA 3NMUF 4X3FA 2XCKA 2GNIA 3MTLA 2X2KA 2WOUA 1XJDA 3TZ9A 3D4QA 5BUIA 2BTRA 5DT3A 3F3WA 3ZCLA 5EQPA 2C68A 1OKYA 4IC8A 4FMQA 4Y5HA 3N4TA 1WBVA 3F6XA 3WE8A 3R71A 4EOKA 5I9YA 2EU9A 2QO7A 3PIYA 4ASEA 3KXHA 3FLWA 3OTUA 3PXYA 4OT6A 2CKEA 2B55A 3R8ZA 1KOBA 3NNVA 3LFBA 1S9JA 4IC7A 2JDOA 4YTIA 2W5AA 1CTPE 1SVEA 4EOOA 2XZSA 4EH3A 3H3CA 4K77A 4RWLA 4O96A 3S0OA 3RCDA 2E9OA 2W7XA 4V04A 2ZB0A 3WZDA 5C01A 4Y95A 2CMWA 4Q9SA 5IMEA 1FMKA 3NUYA 4NKAA 3WF8A 3ACJA 1WVYA 4RVLA 1BLXA 1Q62A 4BDFA 1HCKA 1YHVA 2I6LA 4Y85A 5FG8A 4NYEA 4FICA 3GCQA 5HD7A 5D12A 4CRLA 2W96B 2UV2A 4WNOA 5FXSA 2WTJA 3RZBA 4RJ7A 4TYHB 3RBWA 3VWAA 5LMKC 3H9OA 3UJGA 3FI8A 3KREA 3DV3A 2HK5A 3E5AA 1REJA 3DFCB 4FKIA 3ORPA 4FTMA 4WSYA 3FQEA 4BDDA 3LFQA 3Q4ZA 4IM2A 3IKAA 2JAVA 3LFEA 1TQMA 4DH8A 5J5TA 2PULA 3A4PA 5FD2A 4JDJA 4ZY5A 4EJ7A 2XM9A 3SVVA 4J52A 3HLLA 4YJOA 4JT3A 3R9OA 4MNFA 4E26A 1FPUA 2YHVA 3AC8A 3AD5A 3TTJA 5HTIA 1CKJA 5JZJA 4CYIA 1OZ1A 2KULA 5KBRA 3ET7A 1PXPA 2UZEA 3ATTA 4LGGA 3PA5A 3FL5A 3PRFA 4FSUA 3U6HA 2FVDA 4UMRA 2WQEA 4JR7A 4DFBA 4ORKA 3RTPA 3E7OA 3KGAA 3UOKA 1YWNA 3QRKA 4PDPA 2R3QA 3O7LB 1R78A 3BQRA 3CPCA 3KFAA 3UMWA 4CXAA 3FXWA 4WBOA 4OTHA 2PUPA 3R30A 3K2LA 4FK3A 2H8HA 5TKDA 4F0GA 3EWHA 2A0CX 3V8TA 4RIYA 2YCSA 5IUIA 4L3PA 4ZJVA 3B8QA 2J0MB 5A4TA 1YWVA 2ITXA 4Y83A 5IU2A 3SG8A 1PMUA 2NNWB 3VS0A 3L8XA 1WZYA 3WOWA 4N57A 2OF4A 1S9IA 2UVZA 1GZOA 2YM5A 1H0VA 3PXFA 3QLGA 3E8NA 4O6LA 3LPBA 3TUBA 2IO6A 4FIEA 4FV5A 4FA2A 4KBKA 4FV6A 4ZZNA 3QCXA 4QQ5A 2QU6A 3Q60A 1OECA 3ZFXA 4XRJA 3L9NA 2JGZA 1KOAA 1B39A 3DFAA 1W84A 3BGZA 3QQLA 3ZS5A 2CNUA 4DHFA 4ANQA 4O7YA 1FINA 3D7ZA 3MV5A 3RAKA 2E9NA 1ZARA 4A4LA 1V0PA 2BRBA 5CI7A 4M84A 3G0FA 4EBVA 2EVAA 4FKRA 3RM6A 4ANNA 4M15A 4PTEA 3FMMA 4FI1A 3RAIA 3R1SA 3VW8A 5F9EA 2O2UA 3WIKA 5FQDC 3BBTB 4M13A 3DS6A 3EQHA 3KF7A 4ZP5A 1U54B 3EQDA 4BFMA 4PPBA 1DAYA 3ZC6A 4QQTA 4GK3A 1M2RA 2V5QA 4QMXA 5H9BA 5BVWA 3C5IA 5FBOA 4F1MA 4BVUA 4M14A 2BRGA 4PDOA 5EHOA 1M2PA 5CAVA 2VWZA 2PK9A 4BWKA 3KC3A 2ITTA 5AJQA 5EYKA 4FIGA 3ZONA 4AS0A 4OBPA 3DKOA 3FLQA 3NIEA 4IX3A 4WG4A 4YNOA 2GNFA 5IQGA 3P78A 3FI4A 3KF4A 5EKOA 2X39A 3UIBA 3VBWA 4R8QA 5HE0A 5IISA 3CD3A 4IH8A 4NW6A 4PF4A 5HU9A 3ALNA 3MFRA 3IW5A 4JQEA 5FWKK 5EYCA 1PMEA 3ELJA 3SKCA 3U54A 4W4YA 5IA1A 3BU3A 3P23A 2WTKB 2GCDA 4M66A 2P2IA 3BQCA 3QUEA 4IZAA 4DBNA 3G15A 2B9JA 1CMKE 4KINA 3VUKA 1OIYA 2PZIA 4P5ZA 4ANSA 3SGCA 4CZTA 3DJ7A 4IZYA 3DTCA 4KA3A 4W9XA 4KNBA 4AZFA 2WELA 4PMPA 4QQCA 4FE2A 5A4QA 1P5EA 2XBJA 4X2NA 4MXXA 2QOHA 5C27A 3TDWA 2YCFA 4AGWA 4BDIA 5I5ZA 3R8PA 3WIGA 3PXZA 3O0GA 5JRSA 3LOKA 5M4FA 2QOKA 3LKMA 3UOHA 1WVXA 4GFGA 4XG6A 1BL7A 3KMMA 3NRMA 3UZTA 2VTTA 4ZIMA 3EH9A 2WAJA 2PUNA 2WPAA 3IO7A 3ZDIA 4FKPA 1JWHA 3VW6A 4C4JA 4ZZOA 3BYOA 1ZAOA 2W5BA 2XP2A 3VBYA 3DJ5A 1FOTA 3FMLA 4TXCA 3C9WA 4EK6A 2YZLA 2RIOA 4DG2E 4O7LA 3UNZA 3FAAA 4FT3A 1ZXEA 3FQHA 3OOGA 2R3RA 3BEAA 4EOIA 2CCHA 3FI3A 5LVLA 1YOMA 1V0BA 2I0EA 3RNIA 3ZO1A 2OSCA 2CN5A 4J71A 4O0SA 3E3PA 3IDBA 5FM3A 4IX5A 3ZHPC 4BHZA 2IVVA 3GXLA 2R4BA 3I5NA 4IX4A 4ENXA 5F95A 4EEVA 1I09A 1G5SA 4X7QA 2WU6A 5L8JA 4G3DA 4BKJA 4U8ZA 3ZZWA 4NTTA 4CZUA 4CNHA 2V55A 5CF6A 3PSCA 4LOOA 2HY0A 1Z9XA 3T8OA 5EOBA 5K3YA 1A06A 4QMQA 4ANOA 2J0JA 2VN9A 3FEGA 4AN9A 5AUXA 2QLQA 4O91A 4F6WA 2XNBA 2OH4A 2QU5A 3WZEA 4G31A 3MH2A 3OUKA 5L2IA 3SX9A 3FYJX 2X2LA 4OBOA 3V5JA 2QONA 4EOSA 4FC0A 1UNLA 4FYOA 5J8IA 4OTIA 2O5KA 4FSMA 4BWPA 3DB8A 2OJ9A 3M1SA 3VBVA 4AWIA 4YUQA 2VTSA 3QXPA 4LL0A 4CFVA 4JIAA 3FSKA 5BYYA 1U4DA 2W4KA 3DB6A 4RRVA 1JBPE 2BTSA 2BUJA 2BRNA 5HBEA 3P0MA 4OLIA 1ERKA 3EFKA 3JUHA 4G9RA 4D1SA 4C2WA 3QTUA 4KIKA 3TWJA 4RQKA 5BYLA 3U55A 5K5XA 4B99A 1WBOA 3GI3A 2Q0BA 4DA5A 4TYHA 3TKIA 4FNWA 3DU8A 4QP6A 3JS2A 1Z57A 4R5SA 2X9EA 4EOQA 2HIWA 3NCGA 2P55A 3NNXA
chains in the Genus database with same CATH superfamily
3KULB 1NVRA 1H8FA 3ZLSA 4Y73A 2NYAA 5CS6A 2PMNX 2XNGA 3TYKA 2F7XE 1YXVA 2E9UA 4DHJA 1QPEA 3E63A 5EW3A 1JSVA 5HKMA 2YZAA 1DI9A 4J99A 4DBXA 3VS7A 5CLPA 5I3OA 3QRTA 4QTAA 4BN1A 3MFSA 1DAWA 4LMUA 4A7CA 5HGIA 5E91A 3CEKA 5D41A 3HVCA 5GJGA 3HDMA 1Q8YA 3LXKA 4FSYA 4KS8A 3TT0A 3OVVA 4BHNA 4LDTA 4FBXA 5CT7A 4C37A 4RX8A 4ZJIA 4EQUA 3R8UA 5D1JA 3QKLA 4YC8A 4ZSJA 1WBNA 5JRQA 4EH5A 4F1OA 4W8EA 2VTOA 4PL3A 5E8XA 3ZOSA 3CQEA 3IDPA 4GVJA 4P4CA 4TL0A 4QP4A 3GU4A 1J1BA 4DITA 4LOQA 4F7LA 3NVMB 3AOXA 1ZZ2A 3B2TA 2XARA 3AKLA 1QMZA 3HKOA 4C61A 4U7ZA 3SXSA 4YZCA 2UW7A 3AQVA 3VRYA 3IW7A 4FKVA 5C9CA 2EB2A 3OC1A 3PJCA 3R1QA 3W1FA 5JFSA 3WYYA 2F2CB 4FV7A 2QR7A 5LVNA 3EKKA 2PMLX 4RX9A 2VTQA 4G5JA 4ZS4A 1MRYA 4AW0A 4WUAA 3T3UA 4C3FA 4I3ZA 4JR3A 3COHA 1RQQA 3BPRA 4S34A 4APCA 5JH6A 3G9NA 4M68A 3AMBA 4FV1A 3DAEA 5KCVA 3NAXA 1YW2A 4FG8A 4G6OA 3R6XA 1LPUA 4XEYA 1ZRZA 3O50A 1U54A 1PXLA 2BPMA 2PMIA 5DYJA 2XYUA 3QGYA 4BZDA 1UNGA 4EORA 3WZJA 5CVHA 2C6TA 2QOLA 3MSSA 4QMNA 4AN3A 1E1VA 3SA0A 2J0KA 1W7HA 4GUEA 4ZSEA 3BRBA 4J97A 5G1XA 4YJQA 4DEEA 4O7VA 2FSLX 3NNWA 4TT7A 3UO6A 4A9YA 2HZIA 5JT2A 4Z16A 3A8XA 3AC3A 4I23A 3WE4A 4NZWB 5CSWA 4ZSLA 5DGZA 3SQQA 1FBNA 5AX9A 4CV8A 3ORZA 2W1IA 3F3ZA 4HPTE 4CQEA 1Q41A 4RFZA 2XJ2A 4QMZA 3KXGA 3O51A 3S4QA 4FIFA 1ZOGA 4EWQA 3PJ8A 1KE5A 4EBWA 4FJVA 4CT2A 2VO7A 3E7VA 3HV6A 4EI4A 3CJFA 3R7VA 1B6CB 1E9HA 4M97A 3ZRKA 3TUCA 3GVUA 3HAMA 2R3IA 5FUTA 4CT1A 4CCUA 4LOPA 5DA3A 2H96A 3NZ0A 4L68A 3FHIA 3VF9A 4O4FA 3D2KA 3QRUA 3GCVA 3PUPA 2YERA 4F9WA 4BCNA 2ERZE 3WYXA 2PE1A 4EOPA 4GT3A 4TPTA 1YRPA 5HTBA 5A6OA 2YM7A 4EUTA 5BYZA 1NA7A 1ZOEA 2Y8OA 3OMVA 4IVAA 2QNJA 1Q4LA 5HE2A 1XR1A 4E6QA 3M42A 3MA6A 4OTWA 3QLFA 4I4FA 4USDA 4ITIA 3BL7A 5B7VA 2J0LA 2GNGA 4OTRA 4MWIA 2VWYA 3WBLA 4C4HA 2VTMA 2HZ0A 1LEWA 1QL6A 2OZAB 4ID7A 1OPJA 4WT6A 3HAVA 3CQUA 3DK7A 4QMUA 4ZJJA 4MH7A 3L8SA 1QPDA 4BDHA 3AC1A 4BCMA 4FUXA 2XIYA 4EYMA 5GZ8A 1G8SA 4DT9A 3Q52A 3A61A 4QMYA 1JQHA 2ITOA 2Y7JA 3PPKA 4CD0A 4JBOA 3JPVA 2GS6A 3UG1A 1IA8A 3NW5A 4S32A 4YHTA 3A7IA 4FV3A 4ZTMA 1XHAA 4QYHA 5AUVA 1XH6A 3QTXA 1M14A 5KMKA 3GFEA 2O65A 3KIOC 3ZYAA 1ZOHA 1F0QA 3DT1A 2FB8A 3E87A 3W0OA 3G6GA 5B0XA 2WTWA 3MPTA 2RFDA 3AG9A 4JOAA 3C13A 2OG8A 4KBCA 3NYOA 4FIHA 1Q8WA 4GIHA 5AIRA 5ETFA 2WU7A 4XNEA 4GG5A 3COIA 4GT5A 5BVNA 3G90X 1ZMVA 3LCSA 2XJ1A 3Q53A 3RMFA 2RL5A 2XCHA 3K54A 2OIQA 2PVMA 5ANKA 4MF1A 5FEDA 4O2PA 4IM3A 4X2KA 1IEPA 4RIOA 4U0IA 2J50A 3OCTA 1YDRE 4OTDA 4RJ6A 3V5QA 4AT3A 5BUJA 4J1RA 4DG0E 2IVUA 5CENA 2PTKA 3HV7A 4I92A 2YLEA 3ZH8A 1OIUA 4R3CA 3W55A 1KE6A 1Q24A 3HYHA 3KY2A 3EFWA 3RJCA 3GCSA 4BIDA 5M06A 2C6MA 3PXQA 2OLCA 1Q5KA 3KXNA 4YC6A 1MUOA 1ZYLA 3ZZEA 5EI6A 1WBTA 4DYMA 2X7OA 2PVJA 3QQUA 3QTRA 3HUCA 4RA4A 3NYXA 4BB4A 4FVRA 1W0XC 1OL6A 4E73A 4P2KA 3WZKA 2BZJA 4V0GB 2HCKA 3ULIA 2PZYA 5CNNA 4CGAA 2IWIA 2WTDA 2FH9A 2X0GA 4M67A 1JAMA 2IZTA 2V7OA 3BGPA 3G2FA 4KKHA 3Q9XA 4F1TA 4AP7A 3AD6A 2OBJA 2BALA 2Z7QA 3KULA 4NM5A 3RAWA 3TZ7A 1UU9A 3MH1A 3FPMA 4X3FC 5EW9A 4CFNA 3CGOA 4P5QA 2ETKA 2W1HA 3TIZA 2PU8A 4F09A 5A54A 4DH3A 4LUEA 4X2FA 4Z7GA 2B9IA 3BYVA 4N4SA 5J9ZA 3AXWA 3QUDA 3BL9A 2CHLA 4FKTA 3MFTA 3R63A 2G9XA 3FYKX 3FKLA 3HP5A 4KWPA 3W2QA 3VS2A 4ANMA 3Q9WA 3GT8A 1JLUE 5EK7A 5KZIA 4FZDB 4BCGA 3UQGA 4HVDA 5IA3A 5HZNA 3R7OA 4O7ZA 4KKGA 4O1PA 4FEUA 4FL1A 4YJUA 4F4PA 5CU2A 1J7LA 3Q4CA 1OVEA 5HOAA 4YJSA 3GQLA 2JIVA 4L7FA 3NUSA 4FEVA 4O7TA 3U4UA 3O2MA 1JKLA 3QF9A 4IXPA 3C4ZA 3DLZA 2HW6A 3E8DA 4GMYA 2YISA 4UMTA 4ERKA 4CG8A 5AP5A 4F78A 3LQ5A 4AAAA 1K3AA 3MPAA 2B9HA 4O27B 2WMTA 3HV4A 5ETCA 4BI1A 4C3PA 3R9HA 3PJ2A 4FV4A 4BY9E 1VYWA 4FSTA 2XBAA 5FXRA 5CWZA 1ZLTA 4D55A 2PHKA 5HG5A 1JSTA 1YI6A 3NNUA 5DFPA 2R9SA 3WF5A 3OT8A 3FV8A 3BKBA 3JVSA 2VX3A 1QCFA 3E92A 4D9UA 2W9ZB 2VWXA 4FTIA 3RALA 3MFUA 5M53A 4ALVA 4E1ZA 4QDEA 4CFWA 4APPA 3FZTA 5HIBA 2Y6OA 4E7WA 4U42A 2XKCA 1YI4A 4A4XA 2ITYA 2R3FA 4IMYA 4FZFB 3NLBA 3BBWA 5FRIA 4GK4A 2C6OA 4PY1A 4ZTLA 1OBDA 5LVOA 3TV4A 2IVTA 1XH5A 4HGEA 4AGUA 4BCQA 3CTJA 3B2WA 3RP9A 4C59A 4QTEA 1M7NA 4ALUA 2B1PA 2C6IA 1OUYA 3HDNA 1YDTE 4NCTA 4D4RA 5CAQA 2PUIA 3HV3A 3KRWA 3O8TA 4MTAA 5GINE 1IA9A 2VGPA 3Q4UA 3TACA 5LVMA 3LZBA 5HTCA 2R64A 2WQMA 3E64A 4NEUA 4FL2A 3PE1A 2WFYA 4AGDA 2WXVA 3BLQA 2JITA 3BYUA 4ALWA 4YZ9A 4TNBA 3FUPA 4LMNA 2YJRA 3PVGA 4F7SA 5HVKA 2C5OA 3NPCA 3CTQA 4OAUC 2XRWA 3DAKA 5AR4A 5BVDA 2PY3A 4E6AA 3SW7A 3IQ7A 4H39A 3EB0A 4FTQA 5J87A 5HX6A 4D28A 4IAYA 2VTLA 2GS7A 4IZ7A 1XH8A 3NUUA 5L4QA 2CJMA 4RWIA 2VU3A 5IQFA 1YWRA 4FTJA 4MUQA 4H58A 3QTSA 3V6RA 3UIUA 3VHEA 3FMHA 4Y5QA 3ZSHA 3VIDA 5LMBA 5LOHA 4RJ8A 4V05A 1VJYA 5AR2A 2WMSA 2JDSA 5KX8A 2YIQA 3DKCA 3DNEA 3NFGB 5IEYA 5CF4A 4D4YA 3I79A 3IG7A 3OXZA 4OW8A 3ID6C 4TY1A 4LQMA 3ENMA 3FQSA 3UDBA 4F9CA 5KMJA 4YU2A 2J2IB 3TKUA 3QALE 2OJIA 1W2DA 1YHSA 3OWJA 4C7TA 2YA9A 4FTCA 5KBQA 1VR2A 4ZLZA 3LCTA 4MHAA 5FTGA 4JRVA 5ANDA 3EJ1A 3CD8A 3HP2A 2W1GA 4O0RA 2YAKA 1ZYDA 4WIHA 3MTFA 4RT7A 5ANEA 2CKQA 3WARA 3UMXA 4L46A 1FVVA 3HMMA 5L8KA 4DFLA 2OZAA 3DBFA 3GC7A 4BCIA 4O7NA 4A4OA 1J7UA 4BR3A 4QPAA 4O38A 5L2TA 4KABA 3A7GA 3I5ZA 4WNPA 4L9IA 3CS9A 3UTOA 4JQ8A 4XCUA 5HIDA 1OMWA 3FY0A 4TN6A 4EC9A 5M07A 3RGFA 4FT5A 4MQ2A 4C57A 3H10A 4YZNA 4KSQA 3BLHA 2VD5A 4BBEA 3R21A 4I6HA 1H24A 3MWUA 5FP6A 4RQVA 3UE4A 4NFMA 4AUAA 4MD9E 4E6CA 5I9WA 3QQKA 3QYWA 5IH5A 5AMNA 3RPSA 2QOFA 3UZPA 3ZRLA 1IG1A 2VO0A 3KK9A 4RLKA 3ERKA 4IFCA 3W2RA 5I9ZA 1JKSA 3GB2A 2BRHA 4WNMA 1OM1A 4AZSA 2JD5A 2Y6MA 2WTIA 4O4EA 2GSFA 4LL5A 4HVHA 4FSWA 4PL4A 4KUJA 3COMA 4TWPA 4N70A 3NEWA 5C8NA 3T9TA 1Q61A 4KIKB 1BI8A 5LXMA 1GAGA 4FSRA 4ZXTA 4GYGA 3HECA 3JY0A 4O0YA 4TYEA 4YNEA 5CEPA 5I4NA 5IQHA 4YC3A 1WBPA 2QVSE 4ACHA 5AEPA 5I3RA 1GZKA 2QI8A 3PP1A 1OI9A 1PY5A 4PP9A 4IW0A 4EOLA 5M56A 4KBAA 3TNHA 5F1ZA 5HNGA 5CEIA 5C4LA 4BCFA 5CALA 3VBTA 3FXXA 2QO2A 4L6QA 4BICA 5CU4A 3R83A 4KD1A 2VWWA 2VZ6A 3MB7A 2UZVA 3E3BX 1ZZLA 1Y6BA 4O81A 4N0SA 3W16A 3SG9A 4OR5A 4BBMA 5L3AA 1STCE 4XBUA 3DBDA 3DTWA 3GFWA 5D10A 4BCHA 3QC4A 3ORTA 4B9DA 2NRYA 1F5QA 1Q8UA 2W1EA 3QKKA 3OCGA 1PKGA 1Q8ZA 4D0WA 2UUEA 4YMJA 3I81A 3MB6A 4QMSA 2HWOA 3E88A 2EXMA 3ROYA 5BPYA 5CF8A 4M3QA 4V0GA 3MY0A 1H01A 2OWBA 2Z8CA 4XG9A 5EDRA 4UXLA 4IIRA 4KIQA 4BKYA 2CN8A 3UIXA 2XNPA 2XNEA 3ZSGA 3H0YA 1ZMWA 2C6KA 2J5FA 3LJ1A 4OBQA 3W8LA 4GJ2A 2RKUA 3IW4A 4FEQA 3W33A 3AT3A 3BHHA 5IQDA 1QPJA 2EWAA 4LFIA 3TG1A 3VJOA 2NRUA 5IPJA 2VTHA 3QTIA 4DHZA 2O63A 4TNDA 4XJ0A 1WMKA 4RVTA 4HOKA 2VNWA 2JEDA 2B9FA 2PMOX 2XYNA 3Q2MA 4MX9A 2YLFA 5TO8A 3N9XA 1Q3DA 1WVWA 3LMIA 1ST4A 3NAYA 3NUPA 2GQRA 4DCEA 4CCBA 3CY2A 3F5GA 3VUMA 4E4LA 5C4KA 1PHKA 1NT2A 2XALA 2R0UA 3F3UA 1XH9A 1OKWA 4ZMFA 1WBWA 4M8TA 4AF3A 4QP3A 4UMQA 1ZY4A 1DM2A 3LLAA 5GNKA 2B53A 4DN5A 3NUAA 4FV0A 1SVHA 1ZY5A 4AFEA 4H3PA 4HNFA 4UMPA 1J3HA 2VUWA 2AC5A 3ORNA 4IX6A 3MS9A 1XO2B 2HXQA 4M0ZA 2JC6A 3E62A 1MP8A 3LFSA 4I4EA 4ACMA 5HQ0A 3GC0A 3N4UA 2WTCA 3DAJA 4XMOA 1XMMA 4LRJA 3P79A 4IEBA 3DBEA 5HBJA 2ETRA 3WZUA 2WMUA 3CKWA 3HMIA 4W4VA 4HGLA 1LUFA 4RA5A 2X8IA 4IWQA 5HI2A 2OH0E 2W06A 4Q2AA 4YZBA 3TXOA 3QL8A 4G2FA 2ONLA 5HG9A 3ZBXA 4MF0A 4JJRA 5E8UA 3UNKA 3TL8A 4D1XA 5IQBA 2V0DA 2OXDA 2NP8A 1UU8A 2UW8A 2UW4A 4L42A 3ZTXA 1H1RA 2YIXA 4TW9A 1NXKA 3NUXA 4RLLA 2IW8A 4HZRA 2Y4IB 1JSUA 3DK3A 3UP7A 5BMMA 2OI4X 4Q5HA 3S3IA 5AAGA 1OL2A 5AR7A 4R78A 2H34A 2X9FA 2ITUA 2FO0A 1VLRA 4PL5A 4A07A 2FSTX 1EH4A 2XIKA 4CTCA 3F9NA 1GZ8A 5BVKA 1G8KA 1CSNA 4RWKA 3CQWA 4IB3A 3HMOA 4TYJA 5CX9A 2XAOA 2XS0A 2WIPA 4AA5A 3BEGA 3KVWA 3BWJA 4UZDA 2ZMDA 3EN7A 2UZTA 2ZV9A 3MPMA 5IQIA 5ANGA 4DEIA 2FA2A 1SNXA 1JKTA 2HWPA 3CPBA 3IECA 5H8GA 4EYJA 5JQ8A 3AC5A 1CM8A 1H1SA 3ODZX 4IQ6A 3QAME 4ZY4A 3GC8A 4AT5A 1GJOA 4GU6A 2W9FB 2ZAZA 1M52A 5J1VA 3EMGA 4AGCA 1U59A 3GBZA 2GHMA 2DS1A 4JIKA 5DE2A 4JAJA 4OGRA 5AUUA 2QKWB 5BQ0A 5L2SA 4X6QC 4U3ZA 5AA8A 4ZAUA 3U87A 4A9TA 1FGIA 1MRVA 2DQ7X 3CY3A 3KCFA 3KKVA 3QRJA 5IQEA 2B0QA 1W83A 4NU1A 2JFMA 2VV9A 3LHJA 2PVNA 1BI7A 4BWXA 4RMZA 4BGHA 1P2AA 3F3TA 4I5MA 4O1OA 3F2AA 2YDKA 2DWBA 2BILB 4BCOA 4FT7A 1SVGA 4U79A 2A4LA 4I6QA 4KRCA 3NW7A 4FZ7A 4QOXA 3BGQA 1OB3A 4A9UA 2O8YA 3MY1A 4K6ZA 5HLWA 3Q9ZA 2QO9A 1E1XA 4IANA 5LMAA 3UPZA 4HGSA 4KKEA 3W10A 2CGVA 3UIMA 2UVYA 4IZ5A 4XV3A 2W17A 3UC4A 2HENA 5LCJA 3DKFA 4USFA 2VWUA 4QMOA 4RSSA 2XNMA 2GTMA 1CKIA 4NW5A 2B52A 1BX6A 4FKSA 3PXRA 5KE0A 5ACKA 4FGRA 3PY0A 1UNHA 4FNZA 4U41A 5ANIA 2PVHA 5IQCA 4G34A 2X7FA 3RAHA 5BNJA 3VUTA 3I60A 4I6LA 3KRLA 4EH4A 3TMOA 3OCSA 4QNAA 3PDTA 4PMSA 1WCCA 4CV9A 2C1AA 1WFCA 4FV9A 4FYNA 5HE1A 1ZYJA 4IAAA 3ITZA 4R1VA 4IFGA 4YPDA 2LAVA 5J7HA 2R3LA 2BFYA 4RC4A 2WMXA 5T6KA 3RK9A 4BIBA 1TQIA 4C02A 3RWPA 1OIQA 2WTKC 2BZHB 3FL4A 3OD6X 3QBNA 4RG0A 4C4IA 1O6KA 3VBQA 3LLTA 4FTKA 4NL0A 5HEZA 3PZEA 3WI6A 4HYIA 3SC1A 3SW4A 2IZUA 3VS6A 5LVPA 4O7RA 3HMNA 4I93A 1M7QA 3RHXA 1MQBA 3QC9A 4GKHA 4S30A 3WF6A 4FV2A 3W8QA 4DINA 2EB3A 2FYSA 3CE3A 4IHPA 2VRXA 4RGJA 3SRVB 2GNLA 4DLIA 3QQGA 4QYFA 2F2UA 2XF0A 4YSJA 4CTBA 3P5KA 4C4EA 1RW8A 3QGWA 4FSQA 3UVRA 5JGAA 2BDJA 3CC6A 4XG7A 4D2WA 2V7AA 5H8EA 2PYWA 3EQPA 2HYYA 5AV2A 5A6NA 3ORMA 3CKXA 2YDIA 4XUFA 4UEUA 4OTQA 2C5VA 4FIIA 4R1YA 4EH7A 5EYDA 2X4FA 5FEQA 2JBOA 2WEVA 4BYJA 4ANLA 2ZV8A 3C0HA 4I0RA 3S95A 3TM0A 4OAVB 2XKFA 2I0HA 3DBQA 4FTRA 2XB7A 3FMJA 3D5UA 3SOCA 4OUCA 5FGKA 2JAMA 4WUNA 4AX8A 3DDPA 2BHEA 2UVXA 4KSPA 4C0TA 3PVBA 2VGOA 2V62A 3KU2A 5T3QA 3EYHA 1NW1A 1A9UA 1JNKA 5HBHA 1P4FA 3ZU7A 1XBAA 2X2MA 5AP0A 2A27A 4AE9A 4FX3A 4MEDA 3VUDA 2BKKA 3ORLA 3OXTA 2ITNA 3JR1A 3AKJA 3ALOA 2X6EA 3Q4TA 4JDHA 5AAFA 4AFJA 2HZ4A 4BDJA 4F08A 3TZ8A 2XIZA 2GHGA 3C7QA 5EYMA 3R7EA 4DGOA 4NTSA 4RFYA 4F0FA 3DY7A 2UW5A 2XEYA 4E3CA 4C62A 1PXKA 5FBNC 2ITQA 3P9JA 2CPKE 4R6VA 3BU6A 2VTRA 1G3NA 3TDVA 2BDWA 1PYXA 4IM0A 3BU5A 4L53A 4G6LA 5F94A 2CLQA 5M55A 2BDFA 3PVUA 5DT4A 1L8TA 1ZYCA 4XP0A 5D11A 3V5LA 3ZO2A 3N4VA 3MDYA 4DDIA 3QTWA 2C3IB 2OJJA 2YM4A 4U9AA 5CEOA 1V1KA 3R2YA 5CNOA 5DWRA 1KE7A 4Z55A 3NS9A 2WMRA 2J0IA 2JFLA 5E1SA 5AADA 4O86A 1AGWA 3R0TA 3CTHA 2LGCA 4FK6A 5L6WL 1H00A 4KRDA 3BELA 2JDVA 3BE2A 4NKSA 3LJ0A 4RX5A 3L9MA 3D0EA 3ANQA 3OY3A 5CEMA 3UYSA 2R3PA 4MBIA 4W9WA 4KS7A 2RG6A 1YKRA 5CSVA 4UYNA 1K9AA 3FHRA 3EFJA 2YM3A 2IN6A 2J51A 5AUTA 4J53A 5CVGA 2OU7A 5AX3A 4AW1A 2E9VA 4RJ4A 4DH1A 4BDCA 4DGNA 4WD5A 5JSMA 3TNQB 3KB7A 3Q04A 3QTZA 5JGBA 3MVMA 2W99B 3UDTA 3EQIA 1FVRA 3PVWA 4G17A 4BI0A 3PPJA 3FI2A 4ACCA 4G16A 3QZGA 4M69B 3OT3A 4H3QA 3HA8A 2YCRA 4NH1A 3RZFA 1PMVA 4B0GA 3REPA 1UU3A 3ZC5A 3V8SA 3FZSA 2UW0A 1ZYSA 5AR5A 4BI2A 4F9YA 2IZSA 2QURA 2UW9A 2YDJA 3PG3A 4AXCA 3VQHA 5HIEA 4BZOA 3HA6A 1OUKA 3ORXA 5JN2A 2HOGA 3R1NA 5G6VA 3AD4A 3DDQA 4WHZA 2XIXA 2Z2WA 4EHZA 1MQ4A 4FTOA 3EN6A 4JNWA 5HICA 5GZ9A 4QMWA 5K4IA 2R3HA 3HGKA 5HO7A 2UZLA 5FM2A 5BV3A 2Q0NA 4UX9A 3TZMA 4FT9A 5TE0A 2VO3A 3R9DA 3MJ2A 2C0TA 4XHKB 1GZNA 3I0QA 3GOPA 3F5UA 4QT1A 3KMUA 4QMVA 5FP5A 2VTIA 4LYNA 3MN3A 5T68A 5EHLA 5HO6A 4ZEGA 1NVQA 2YWVA 3VONA 4AXFA 4EZ7A 2CLXA 2XUUA 4IVBA 4D1ZA 2ZM4A 4ZLYA 3SXRA 2QODA 3OBGA 4PPAA 3OG7A 4ZY6A 3ZLWA 3HX4A 3MVLA 2JKMA 3HRBA 1Y57A 4M12A 4AZEA 3CBLA 2G2IA 3QCYA 4MXCA 4EONA 1O6LA 4NCTC 4XYFA 3II5A 5KZ0A 5JFXA 4X3JA 1HCLA 3JY9A 2UZOA 4G3EA 5HLPA 3QZIA 3TI1A 3GUBA 1H1WA 3EQGA 4GH2A 4JXFA 5DI1A 3PJ3A 2C47A 4L45A 1BL6A 5BVOA 3M11A 4DHIB 1YVJA 3EQBA 4NM7A 5J9YA 4LV5A 4C3RA 4GJ3A 4DLJA 4TYGA 3UQCA 2R3GA 5F20A 4QP8A 1ZMUA 2ZDTA 4D2PA 4QTDA 1APME 3MY5A 3PIZA 5DRBA 3ZO3A 3PPZA 4AZVA 1M2QA 4QTBA 5DOSA 5DH3A 3BWFA 2Z7LA 4L00A 5KKRB 3LQ3A 4GSBA 3KRXA 3OZ6A 4QMLA 4I0SA 4BDEA 5AR8A 3V01A 4DTKA 2C69A 3L9LA 5CSXA 5M4UA 4PTGA 3CSVA 4EK8A 3A2CA 1GIHA 3JYAA 3A7JA 4I41A 5I9UA 3SOAA 5EQEA 4IDVA 1OL5A 4DE4A 2C4GA 3ZEPA 3QZFA 3V5PA 3B8RA 3Q32A 3KCKA 4PDSA 3FC2A 5J1WA 2P4IA 1YHWA 3M2WA 3SRVA 3DCVA 1Q99A 3RPRA 3L9PA 2EXEA 3FDNA 2YM8A 3PSBA 3R2BA 2W1FA 3CCNA 4UALA 3I6UA 3LMHA 1OITA 4NUSA 3BLRA 4DH7A 4QMTA 3LFFA 2V22A 5M4IA 4MAOA 1PRYA 2NPQA 3H0ZA 2WQNA 3OUNB 5DT0A 4DG3E 4F99A 1L3RE 2H6DA 3EIDA 1OGUA 4U40A 4RJ5A 1U46A 2SRCA 4DEGA 3D5VA 2VTNA 3Q9YA 4EHEA 4UYAA 4PRJA 4MXYA 5EDPA 3NVKI 4LI5A 4I94A 3R04A 2C6DA 4ONAA 3PP0A 4FODA 5HNBA 5KHXA 4QTCA 4GEOA 1R39A 3R28A 4IVCA 4F9BA 3PZHA 5CU3A 3DXQA 4AZWA 2PUUA 1U5QA 1FQ1B 4QPSA 1NY3A 4GG7A 4YZDA 4JLCA 3E93A 4XV9A 3SLSA 1P14A 3GNIB 4I21A 4HVIA 3UOJA 3P4KA 5CSPA 3MJ1A 3OTVA 4EQMA 4F6SA 2AC3A 3PLSA 3FC1X 1F3MC 2F57A 3C4EA 3C4XA 2C3JA 3NW6A 3UGCA 4FNXA 3ZXTA 2XIRA 3BE9A 4G3GA 4AT4A 3NDMA 3Q6WA 4FKWA 4AACA 5BMSA 1OL7A 3R7GA 4OTFA 5EQYA 4B6LA 3UYTA 2A19B 1UKHA 2P2HA 3HRFA 2GS2A 3RHKA 5M44A 4ASZA 2Z7SA 2JIIA 3VUGA 3QA8A 4DEHA 1XH7A 4N6YA 4FL3A 4ZTHA 4YO4A 4FGBA 4W8DA 2YIWA 2NO3A 5HO8A 5DNRA 4GT4A 5CU0A 2IF8A 3G6HA 3AC4A 3HL7A 3K5VA 4CZYB 5AP3A 4YTFA 5GIOE 3DPKA 4HCTA 4FTTA 5M08A 4Y46A 3V3VA 5C8MA 3IGOA 4UN0C 2XK9A 1FMOE 5H2UA 4OT5A 1PXJA 3C1XA 1Q8TA 3KXMA 3MVHA 3NIZA 4Z9LA 3VHKA 3O96A 4CFFA 3GP0A 3R02A 5GJFA 2CGWA 4JAIA 3F2RA 2PVRA 2XEZA 3ZXZA 4IWOA 3AGMA 4XP3A 2ZJWA 4MBLA 2X81A 3RINA 4PMMA 3DLSA 4GUBA 4CFXA 5KMOA 1SM2A 3EFLA 3TN8A 2R0IA 3HNGA 5HE3A 2B7AA 4D4VA 5E92A 3R9RA 2IPXA 4O83A 4QMPA 1H25A 5CQWA 2IVSA 3MA3A 3F2NA 4UWCA 3CR0A 4XG2A 4XV2A 3ZUUA 4USEA 5L6PA 3OHTA 1SNUA 3P08A 4O0UA 4UWBA 2REIA 2VO6A 3ZMMA 5CF5A 2F9GA 2BKZA 4YURA 2QC6A 1IRKA 3ZLXA 3NYVA 2JDRA 1XH4A 3AT2A 2OK1A 2PZPA 3LFCA 4C2VA 4XLVA 3F5PA 5L6OA 5CI6A 4D4SA 4EKKA 2QOBA 3VS5A 4DEAA 3R00A 3PRIA 5H3QA 2QOCA 3EQCA 2R7IA 1YXTA 4UWYA 4IB1A 4M69A 3AGLA 5DR9A 1VYZA 2C5XA 3LQ8A 5M57A 5AFVA 1GIIA 5J79A 1G8JA 5M09A 4D58A 4DGGA 5K5NA 4HYHA 4C4FA 4G3FA 3FLZA 3CJGA 4L3LA 4XV1A 4AXAA 5E4HA 2PSQA 4O4CA 4DH5A 4GFOA 5IZFA 2XKEA 5DPVA 4ZMEA 4GFMA 4ZSGA 5CASA 3KL8A 4AU8A 3QD2B 3A99A 4BTJA 1O9UA 4DC2A 1PYEA 1TZDA 2CKPA 4YHJA 5AV0A 3POOA 2BIYA 2CGUA 2X6DA 5EHYA 1KE9A 3C5UA 5EKNA 1OL1A 4YJNA 4HNIA 1Y8GA 2E2BA 4QD6A 5I9XA 5HX8A 5IA2A 3S00A 4QP9A 2P3GX 5GHVA 3KK8A 2ONLC 1RDQE 3FMNA 5EOLA 4HCUA 3OEZA 5AUWA 3OBJA 2BCJA 3ET