4CVNA

Structure of the fap7-rps14 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
b'GMLIAITGTPGVGKTTIAKLLAEKLGYEYVNLRDFALEKGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHLSHLMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENVIEVDTTNKTPEEIVEEIIGLIKSGVKRRVGIVDWSEVYDEIIPYLRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ADENYLATE KINASE
molecule tags Transferase
source organism Pyrococcus abyssi ge5
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
total genus 68
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4cvnA00
4TMWA 2F3RA 4DHEA 3Q72A 2J46A 4FCTA 4CDGA 5L3SB 3U44B 3I32A 5FUXA 3VKHA 5EXXA 3DZ8A 4DSNA 3SYKA 4ASUD 2H7VA 3FB4A 3K9GA 3M0EA 3PUVA 2PT7A 1KZGB 4KBFA 5C4MA 4GL2A 3THYB 2DR3A 2QP3A 2XX3A 4EQ6B 4XOIA 5BYKA 2YNMA 4JVMA 2D7DA 3WNBA 2IHYA 2DFLA 3EC1A 5K8TA 4AWXA 3GLGB 4WXRA 2OE2A 4IFEA 1GL7A 1D2EA 1JI0A 3K0SA 2BJWA 2WOJA 2GVZC 3L0SA 4XVUA 4QXAA 1QBKC 3HU1A 1II9A 4MYUA 1UM8A 2DPXA 2ZXUA 2JCSA 1QHNA 4QG7A 2IUSA 2ZI6A 4US2R 3UG7A 3AV0B 4UNRA 1XCPA 3U3KA 1OF1A 4LZZA 4Q4AA 3GLHB 3SYLA 2JGNA 4DT1A 3EC2A 3ADCA 1A2KC 1CRPA 1FZQA 4NP6A 3WNDA 3MAAC 1J7KA 3W5JA 3THYA 4IDQA 4EQ6A 2XGJA 1ZUHA 3UMSA 1EFTA 3UWKA 4URWR 5CYPA 2DWOA 2FSIA 4UXIA 1CJKC 4ZDWA 3NH9A 1OV4A 3K09A 2QE7D 3EWAA 1P9NA 1S3GA 3TSWA 4DB4A 1MH1A 1VKJA 2PT5A 3R20A 4KYIB 3EPHA 4QKQA 2GCNA 1OH6A 1G8FA 1LTQA 4M22A 4IVRA 3V4RA 2AN9A 4OI4A 2JLZA 1E99A 4YQFA 2GBLC 1FX0B 521PA 4EDHA 2D2FA 3R8FA 3ZVNA 5SZKB 2UZ3A 2ZRPA 4LJ6A 2ZU6A 1ZJ6A 3A4MA 2QSZA 3EA0A 2B8TA 4JLNA 4Q4HB 1KMHA 3AB3A 1P3JA 4XSGA 3BH6A 3WP1B 3HR8A 1KK3A 5C46F 1U81A 2NZJA 1KO4A 1FUUA 3VHLB 3MRSA 2WZQA 3JVUA 4DDVA 1HV8A 2DBYA 2RKOA 2CL7X 1XJCA 2GA8A 3PV0A 1CR0A 3KTAA 5BW8A 3NXSA 1TAGA 2LKCA 3GMTA 3RC8A 1G41A 3KX2A 3HP1A 4FIDA 4US1R 2ZANA 5EQTA 4EUNA 1CJTC 3HPRA 5DI3A 4KV9A 4Q7MB 1AQYA 1E2FA 3B5JA 4NONA 1KSHA 1AA9A 1UBGA 1SXJD 2ZQ5A 5LB4A 1COWD 4G5SA 4Q47A 1SVSA 4Q00A 1YRAA 1MABB 4DIEA 4JLVA 4IW3B 4JLMA 5LD2B 1XD8A 2Q9AA 1IM2A 3K9NA 2OHFA 4DLXA 1B23P 1S9DA 1NMYA 4A0RA 1RYHA 3NDPA 2WPDA 3LVRE 4JBWA 4KODA 3WMGA 3ZZ0A 3MJRA 5KSPA 3RWMB 3F8TA 2ANBA 3LFUA 1JPJA 2P5SA 4AC9A 1Z0JA 3QG5A 3CNLA 3U6KA 2OFXA 1VG0B 5FUYA 1CR1A 2W0SA 3TJZA 1NG9A 4QHTA 3CH4B 3VR2A 2RGEA 2IT1A 2IHBA 2VRWA 4IVQA 3IO5A 5E4FA 5CK5A 5LD2C 1OB2A 2QM7A 3MSXA 3QBVA 3I1FA 3TBKA 1E2KA 4TTQA 3CNOA 4JZKA 5HTKA 4DWJA 4URXR 4X8MA 5KSOA 1NMZA 3CZQA 3NKVA 4BFVA 4Q66C 1M6NA 2ZRBA 1E2HA 4R2IA 5FL7D 2ZRKA 4Y0AA 2XOKA 4JLDA 1C1YA 3EZ2A 2RGGA 5L3QA 3WYFA 2IXEA 4MRSA 5EP3A 4D2IA 4Z54A 3DOFA 4FMCB 1PV4A 2J7KA 2AKYA 1VECA 2F3TA 4UJ5A 2BBWA 2QTVB 1LNZA 3HJNA 3GLIB 2QMOA 1OW3B 1R8SA 4LJYA 3FHTA 4RVCA 3RAPR 4B3CA 2ZRDA 2GJSA 3LDAA 2ZJ5A 3DPUA 4O2LA 2MSDB 3QIAA 2GKSA 2VH5R 4OJKA 4R2HA 1DAHA 4LHYA 4JSTA 3ZJYA 5G41A 3U5ZB 4W7SA 4B43A 2REBA 1JR3A 4HYYA 3K0FA 4Z51A 2ZJOA 2IYQA 2QI9C 3FFAA 2OV2A 4B3DA 4BZXA 2QMHA 2OT3B 2RGCA 1H8ED 2IYZA 4G3XA 4DXAA 5BQ5A 3VU9A 3B7GA 2GXSA 2FDCA 2OILA 4Q1AA 3C16C 1KSGA 2TMKA 3GLFE 4NYIQ 2VHUA 1VHTA 4KI0A 1ZCAA 2QSYA 4M1SA 2WWXA 2KB0A 3RS3A 3TUIC 3ZYCA 3TNFA 5E7IA 2OEPA 3RS2A 2JLVA 2PCJA 4QOSA 1E2MA 4U00A 1KI1A 4XWOA 3OIYA 5FOUA 4PZYA 3DEFA 4LV8B 2NG1A 3LXXA 4WIAA 4YLGA 3GLGA 5EE3A 3RYTC 1IN5A 2VSOA 1Z08A 1Q12A 4BLTA 2X2EA 4ABYA 1DTSA 4DLWA 4L16A 5KU1A 4E03A 4EJSC 3B1YA 1KJYA 2NTYC 4QJ3A 4NYIR 3FGNA 4MRPA 1JXOA 2OESA 3HPQA 1GIAA 3MMPA 3QY0A 2D62A 4O2RA 3RANA 2FSHA 2CL6X 1NMXA 4UKDA 4B73A 5JEEA 1FMJA 1OHHA 3H4MA 2QROA 3RHFA 2PBRA 2IA5A 3L82B 4LJ5A 1A82A 3L2OB 3QVUA 5JRJA 3DDCA 1VCOA 1FNNA 4PAOA 2H92A 3GJ3A 1H65A 2IYLD 3P27A 2XZLA 1IN6A 3GEHA 3C14C 1GP2A 1OFUX 1TNDA 2KBEA 5DN6D 1Z07A 3I61A 1KI6A 2BJVA 1KOFA 3OAAD 5EUQB 4KAXA 4B76A 5J4YA 1PLKA 5CJ2A 1ZUIA 3ZQ6A 4D0NA 1QDEA 1R5OA 4HB3A 2J0UB 2IS2A 1RFLA 4IJMA 2KE5A 2LWIA 5FUWA 4C0KA 4C30A 4ZDJA 3B8HA 1F2UB 1L2TA 1OHHD 1JQLB 3OF5A 3BB1A 4PHHA 2O8FB 3DM9B 2RGNA 4NCKA 1A1VA 1L4UA 2NPFA 5BXQC 5J4VA 2BCGY 1TF5A 1OFIA 3DM5A 1OPXA 2J45A 4YDSA 1NKSA 1UBFA 2G1KA 2OLJA 5GVRA 5FBLB 3GLFA 3OZXA 4MRVA 2VP9A 4Q21A 3N5CA 5FR2A 3EX7C 2YC4C 1KI7A 2CLCX 2QP9X 3RRNA 3CRQA 4HUTA 1R2QA 1E1RD 2J0SA 3NDBB 4XWAA 4HEJA 2QL6A 2QNRA 4ON9A 4D26A 1P9WA 3K9LA 1IXZA 4Q4AB 4URUR 2ODNA 3UATA 5FPYA 1E2GA 3AF1A 3P1JA 2F55A 3KQHA 5FTMA 2WMOB 2AK3A 2OCYC 421PA 1XX6A 3AVOA 2BV3A 2GK6A 1U90A 2G1JA 2BBSA 3BB3A 5B64A 4C2TA 3QE0A 4V0LA 1F48A 1M7HA 2ZRFA 5AWFC 4RY2A 2O52A 2RMKA 2ZRMA 1E2QA 3AKCA 2IWRA 1DS6A 4AKEA 4A0GA 3H84A 4M1TA 5LBIA 3NH6A 1ZVQA 2J3EA 3MGCA 3VR3A 4LJ8A 2R2AA 5GVSA 1GKYA 2PJRA 2YZ2A 3U61B 4EPXA 2ZSEA 4RFVA 1Y63A 4L9WA 1D8TA 4LUCA 1P4SA 1TADA 3L8ZA 1YZGA 1IXRC 4FN5A 1OT3A 3UXMA 1JJ7A 1E2PA 1Z29A 1J70A 4B2LA 1YQTA 5F2EA 4ZCIA 5CIQA 4BFXA 1HH4A 1W5TA 2EYUA 2W0MA 4HDQB 4G1UC 4DUGD 3CX7A 2VP0A 2BDTA 4QJ4A 2QT0A 4K46A 1Q1BA 4C0HA 2HJVA 4JVSB 3GJ0A 1W44A 4P33A 3BWDD 2WVJA 3UKDA 2RGNC 2FU5C 3A1WA 2CLDX 2NGRA 721PA 3UPUA 4BFZA 3SJBA 1W4AA 1R0ZA 1XEWX 1ZAKA 5LB2A 3SU8A 1R8QA 3X1XA 1E1QD 1ESMA 1P62B 4QBGB 2BEKA 1LF5A 1RKBA 1AS2A 2F43A 4U7DA 1NN5A 3C41J 4OHYA 2IYYA 1CJMA 3EG5A 4ASUA 2H57A 2JATA 4DCVA 5AJXA 2JLWA 4V03A 1Z0AA 4IOMA 5DYIA 4KHZA 3O8BA 4ESVA 4F93B 2A5FA 1KO8A 5BN3A 1T3LA 1Z63A 3ICQB 1JR3E 2AXPA 4NTZA 4JLJA 5GJVC 2NIPA 3F0TA 1ELOA 3TAUA 2OAP1 2ORIA 4AYTA 1OB5A 1TUEA 2AR7A 2IL1A 4D4JA 4WZBE 4F4CA 2ZJ2A 2YINC 3AVPA 4LHVA 4DC9A 5C18A 5JRZA 1AN0A 1DPFA 1VG1A 4E09A 3CO5A 5TARA 1GM5A 2WICA 5FR1A 2O8BA 4KVAA 5DO9A 5J40A 5BN4A 4IDPA 2HCBA 5JSZB 1MO3A 4KSCA 1KMQA 4V0MA 3P32A 1W5SA 1XTJA 2QTFA 1IN7A 4A2PA 3B1WA 1GILA 1OE0A 1NBMA 2NQ2C 3R8CA 2RGAA 1H8EA 5L3QB 2CEAA 3LLUA 4WW0A 2IYWA 2JEOA 2ODEA 1UBCA 2GXAA 4N0EA 4Q03A 2W6JD 2GRJA 3QVVA 3EZFA 2FNAA 3IEUA 3ONWA 4HAVA 5FFMA 1XJQA 3W5IA 3W3ZB 1CF4A 1BMFD 1E32A 1QHHB 3IPXA 2QY9A 2ZSFA 2IC5A 1KDOA 2O8BB 3OESA 1RRCA 1ZM7A 4HB2A 4Q18A 4I1UA 3W6NA 2GNOA 5L3SA 3U44A 1KDRA 1AQUA 1ANKA 1MT0A 1Z6YA 2F1JA 4CT4B 5B30A 5JMTA 1Z0KA 4WA7A 5KPDA 2H17A 5J4LA 5IDVA 2EFGA 1N0WA 3QKSB 4TSFD 1SVIA 1TL7C 3K9HA 3CF6R 3ZVRA 5F9FA 2OUKA 1PJRA 1YZKA 1FMLA 2FA9A 4Q4LA 3C5HA 4Q9LA 5JWHA 1US8B 3ZIAA 1ZBDA 1GSIA 1OXVA 1UBEA 4W9MC 4B3FX 3HU3A 4RZUA 3AH8A 1XEXB 3GFOA 8OHMA 1NVXQ 4HUQB 2V54A 3VR4A 4PAQA 1EFRA 2W2TA 5ANRB 2ZRHA 3I72A 2MSEB 3FMFA 3HR7A 3BERA 3KKMA 4XH9B 2O0HA 1KIMA 1W1WA 3D6TB 4V0NA 3T5GA 3CLVA 5D3QA 2GAOA 2DYKA 3WHKA 5FUVA 4L5BA 2XTNA 4KFRA 2IS4A 1F2TA 2IS6A 2GVDC 2DB3A 3EAQA 3WYGA 3CPEA 2QPAA 4A92A 5BWMA 1KAGA 2PZGA 4UNSA 4MUBA 5JECA 1U99A 3SBDA 2FGKA 2Y8EA 4TQUS 3LX8A 3P4XA 3OIUA 1GNQA 4B47A 1KGDA 4B48A 1W36D 4GP6A 2ZAMA 4JLBA 3EIHA 5FBQB 1G3UA 2ZJYA 3CR8A 3NEYA 2PZEA 1G8GA 2GZHA 3B6EA 4D6PA 2P67A 4DCNA 3PEVA 1P9RA 1Q57A 2AKAB 3I4LA 3NVAA 1K5GA 3ZZTA 1G4AE 2O0KA 1OH7A 3A58B 2OBLA 3IGFA 2QG6A 4E22A 3REGA 2ZYUX 4MGIR 1KY3A 4NCNA 3CWZA 2QZ4A 5FPSA 1UAAA 4A36A 2G83A 4Q7JB 1KI6B 3L0IB 1LW7A 5EE9A 1HY3A 2R9VA 1KO5A 4BLPA 4E5UA 4M9ZA 1XMSA 2C9CA 4BUJA 2YJTD 1EGAA 1XJ0A 1M1YE 1C9KA 5G3YA 3RC3A 1TEXA 4BFSA 3DKVA 1QHIA 2XOKD 5EE1A 5JBQA 5K8IA 3B9PA 2QENA 4MRRA 3FKQA 4TL6A 4YMWA 1EESA 1T3HA 1P6XA 3FMPB 4LYAA 4YONB 3R9XA 1E1QA 3QPVA 3RS0A 3MJHA 4DCSA 3CR7A 3M6AA 1BKDR 2GDJA 3VFDA 3SQXA 1QRAA 5BN5A 1KNXA 1II8B 4IVPA 4QL3A 5IK2D 4CIDA 5CITA 2OCPA 1R4AA 4LPSA 1ZNZA 2Q21A 3U7EB 1N25A 2ASEA 4TLDA 4B2IA 5KPJA 1KI3A 1XDBA 2OZEA 5DHFA 4Z8XA 4AG6A 4BPBA 2BVNA 3KB1A 5EP4A 2D3WA 2GEDA 1KSFX 5TDHA 2ZE8A 1UEJA 3UIEA 1SVOA 4JLKA 1S8FA 4EFMA 4LI0A 1I2DA 3W3AA 4DCTA 2VO1A 1D2NA 5HE8A 4Q1FA 4MGZR 3DL0A 2ZROA 4PHGA 2DWPA 2QT1A 4KSBA 1J2JA 3RRMA 2JJ1A 5FBRB 2VYFA 3KKNA 1BH2A 3ZGXA 3PITA 5C1BA 2NO9A 4M0LA 4OI0A 2GF0A 4CF7A 2EU8A 3H86A 1KDTA 2QAJA 4PO8A 2GJAA 5CLQA 1CXZA 3T1OA 4X8HA 1FPMA 2RAPA 4FMDF 2AD1A 2E9SA 4KLNA 1OFTA 4LBYA 1DADA 4B75A 3RSLA 1WP9A 5FPKA 3K70D 3ECCA 1S9HA 3RS7A 2AWNA 1ZM2A 4A6XA 1W4RA 4RZ2A 1L4YA 2P2LA 3QJYA 3W90A 5FL7A 3H2YA 2GJ9A 3GJ5A 4WZ6A 2V6IA 3LW8A 4M2LA 4RD6A 1W2HA 4GFDA 3ASZA 4POAA 3KDSE 3N2IA 2WJJA 2BM0A 1OFHA 3T34A 1LS1A 1UPTA 2X2FA 1Z06A 5HPYB 1GRQA 4AY2A 3BH0A 4B71A 4CEJA 3GFTA 4MKGA 3X1WA 5IK2A 2BEJA 4ERNA 1UF9A 1D9XA 3O8DA 4A4DA 1ZD1A 4N1AA 3AF2A 2RB4A 1ZW6A 2PX0A 4FCWA 1PLLA 3CUEF 4UNPA 1YKSA 2ZR0A 1DOAA 2ERXA 1GRNA 3RDPA 2WHXA 2WSSD 3BH7A 3MD0A 3VX4A 1FFHA 2FG5A 1LY1A 1N6KA 1XNJA 3B9QA 3DMDA 3KXIA 4MYHA 4I1OA 1F60A 2KJQA 2SHKA 3KL4A 5FTNA 3SYNA 2FWRA 2ZRAA 1AS3A 1G18A 2HLDA 2RGDA 4JLPA 3IBGA 1H8HA 4CGZA 4B34A 1G7SA 3CB4A 4DEYA 3AF4A 3TIFA 3Q5EA 3FMIA 4MKIA 1VYTA 4HB4A 2O8DB 1JBKA 2C98A 3I8SA 2V1UA 4YMUA 2F1IA 2J7PA 1PUJA 1XCMA 1FP7A 2ZRIA 4HUQA 3EPKA 4MQBA 1U98A 1I4DD 2GESA 3L43A 3VR6A 1GKIA 2GEVA 1KI9A 1X8LA 4GT1A 5L3RA 1DO0A 3IIJA 3UK6A 1B0UA 2X8AA 1SXJA 4HDCA 3LV8A 4CRWB 2FPKA 4AK9A 1YRBA 2WKQA 3EZ6A 2IUUA 4LDJA 2Q6TA 4FW9A 4KU4A 4ZPXA 2AFIE 2OO7A 3KZ1E 1ZD9A 3RWOA 4Q7LA 2CMKA 2FFAA 2YYZA 4M9QA 5JS7A 5J47A 1XXHE 2GK7A 2QUZA 4AIIA 2C04A 3AVTA 1VG8A 1VCIA 2NOAA 2QEQA 1RPZA 4Z8YA 3L0PA 1GDDA 4P4SA 4WOPA 2FJUA 3KUCA 3T15A 3K53A 1VIAA 2EYQA 4DB2A 2I1QA 5HCNA 2OAQ1 4L15A 3N2EA 2W00A 4DLRA 2Z6VA 4KCGA 1XZPA 1N5IA 3N70A 5DNYB 3TGPA 3MWJA 3CX8A 1P75A 2PZFA 4S35A 1MRNA 1FNMA 2IYRA 5SZHB 2I3BA 1WBBA 5JWRA 221PA 3W8NA 4DUGA 3LY5A 1M2OB 2FE4A 1E79A 4Q4HA 4KJZA 1NIPA 2N42A 1CLUA 4AKHA 2R62A 4EPYA 4Q01A 1EFHA 2GHIA 2CE2X 4TMZA 4B3GA 4XWKA 3P20A 1E69A 3PUZA 4BEBA 3TQCA 3PJRA 4LGMA 5IRCD 3IHLA 4RD3A 3O8RA 2D74A 2WJHA 2A5DA 1G3QA 2ZI7A 3QXJA 5FOTA 1L8QA 4MKHA 2XB2A 3TE6A 1W49A 4NBSA 1X8KA 2C78A 5AUOB 2ERYA 4YMVA 2J7PD 1E9SA 2ZS7A 4DSOA 5F98A 3U3JA 4C2UA 4QFMA 4YMSA 4C4PA 1E9BA 1G8YA 3QENA 4PAMA 1ZU4A 4RD0A 4EFLA 4GZMA 3TR0A 4P4UA 3LQQA 4D4MA 2QRNA 2G88A 1XTQA 5KOYA 4BLQA 2N1BA 1IJEA 4LOAA 4X8LA 2O8EA 5J5CA 2A5JA 4XSHA 1NSTA 4NMMA 4GBMA 4I81A 2C2HA 2V6JA 3F3YA 4AURA 1JEEA 4QNMA 1FQJA 1HQCA 2F7SA 4K81B 4QRHA 1RRFA 1YE8A 4QM6A 2G0NA 1S1MA 2CHGA 2H16A 4D80A 2BWJA 2ZJZA 1CR2A 1NIJA 3VU9B 1XPUA 1CRQA 1CR4A 3B1VA 1N6RA 4A2WA 1SHKA 3FTQA 3P4YA 4O3MA 2AX4A 1IXSB 1NF3A 3PQCA 4M1YA 1VCNA 2J87A 121PA 2D06A 1TU3A 1E0KA 1YVDA 3GJ4A 1CP2A 4G5RA 4JBXA 3A1UA 4CYMA 4LHZA 3SFZA 4PQRA 1KK1A 4MDEA 3THWB 2G9NA 1QZXA 2EFCB 3QSYA 1G5RA 2EW1A 2KBFA 2GCOA 2DFKB 2XITA 1YZUA 1Z83A 3CM0A 4LK2A 2DFTA 5EP2A 3VTKA 3E1SA 4EFNA 1NLYA 1GVNB 2WKPA 5DISB 5FOVA 1Z8FA 4I4LA 3O8CA 1N0UA 2BOVA 3EW9A 4LY6A 1S96A 4QBIA 1OH8A 2QTHA 3DZDA 1G6HA 2OM2A 3CRVA 2ZYTX 2QMEA 1R0XA 4Q9HA 3GJ8A 3Q3JB 2ZYWX 4LYHA 1EFCA 3BE4A 4IOJA 4JVNA 4PO1A 4UJ3A 3O47A 3MCAA 4IRUB 4FMCF 5JZVA 3GPLA 4M21A 2YWHA 2IYUA 5HKKA 4D4LA 2CHQA 2GJKA 2QBYA 2ZI4A 4ZKDA 2WIAA 2OFOA 3AKDA 2Q3MA 3ETLA 3WP0A 4DSTA 1FOEB 3A1TA 4OHXA 1SKQA 3KKOA 2CE7A 3HDTA 1KMHB 3AEZA 4PO9A 1Y3AA 2F1RA 3I8XA 3U4QB 1XTSA 3A4LA 3GJXC 2HXSA 2REOA 5FTJA 1I2MA 2XTZA 5JSZA 4B6FA 1KHTA 1U8ZA 3W6PA 3R9WA 3RVBA 1UADA 4TMVA 3TUJC 3VAAA 2GBLA 3IHWA 1YR6A 1Z6TA 4MITA 5EXSA 1XTIA 2ZREA 4BZQA 2ZTSA 2FGJA 1NVUQ 2BMDA 3OEED 2QBYB 2ONJA 5FOSA 4OKSA 4ZIRA 3K0CA 4FMDB 4OQXA 2J5XA 1U0HC 4Q48A 4RZXA 3NTUA 1M7BA 4AKIA 3U7FB 3EIEA 1N3BA 1ETUA 1BYUA 1Z5ZA 4YMTA 2G0TA 1LB1B 2CCJA 5FI0B 3GD7A 4PQFA 1QG2A 1ZC3A 3JZAA 2NO0A 5DN6A 3FOZA 1COWA 4HZUA 5TB5A 1PLJA 1VMAA 3AF3A 2IUTA 3NG1A 4DCUA 2V3CC 2WKRA 2YC2C 5KNDA 1NN1A 3PVSA 3QKSA 1N6OA 4DLZA 1F3OA 1KK0A 5FTLA 2IXFA 2P6UA 2EFEB 3MLEA 4KFTA 3A37A 3PENA 4OK6A 1QHGA 2ZRGA 5CK4A 2FPLA 3SE0A 5KYKA 3GLIE 5JJKA 5JI2E 2ZAOA 2QQEA 1G1MA 1NVVR 4P4SB 3CONA 4KO8A 1NL3A 4DEXA 3QXCA 1FQKA 5KTYA 1JECA 1BMFA 1JJVA 5GJBA 3CWQA 3KTAB 1J90A 3TR5A 3MUFA 4JBYA 1S1CA 2VP5A 1L7VC 3CPJB 2GZAA 1G291 4DLYA 2QAGB 3Q5DA 4F4JA 4NKRA 1HE8B 5CB6A 1Q3TA 1E9EA 3FVQA 2JIZD 1TUIA 4W5WA 4F91B 4EIWA 1W4CA 4JVLA 2B8WA 3H1TA 1R5NA 3IEVA 4CW7A 4JKYA 5DI3B 2D4HA 1VPLA 3B82A 3LRPA 4OI2A 5AJZA 2V55B 4B35A 4TLBA 4TYQA 1YZNA 3OFNA 1NSFA 4QBHA 3GLIA 2J0QA 2HV8A 4CEHB 4IDOA 2C5LA 3CF0A 4U5XA 1S4QA 1Z3IX 3QKRA 4MH0R 2ZU0C 4S2EA 2JLXA 1XWIA 2XAUA 3B13B 1LFDB 5EZ5A 4QM7A 3IQXA 4JLOA 1W0KD 3LD9A 5FBVB 2ZITA 1QHSA 2EFHB 3LBIA 1KK2A 2QRZA 4DZZA 2BKEA 4PZZA 4NCIA 4YC7A 1U94A 2JJ2A 2PL3A 4TLAA 1NJGA 3A8TA 2ZPTX 1R6BX 2R6DA 1FTNA 2V8OA 4RZ3A 3QF7A 3G0HA 1SVKA 5KNCA 5J4HA 2J1LA 1ZIPA 2YWFA 2J41A 2QE7A 1WBDA 3MWLA 3ZDQA 3IQWA 3VQTA 4DLVA 2AL7A 5FPHA 4B3BA 5DIFA 1T5IA 1TEVA 3QKRB 4LC0A 1NRJB 4Q7KA 4DLSA 4GNKA 5C2JB 5KSYA 2VP4A 1VHLA 2ZSAA 3HU2A 4PC3A 2AHOA 5CJPA 4A6PA 3QG1A 4RFSA 4CEIA 2FFQA 4C7OA 1JEDA 3BXZA 3VX3A 1WQ1R 3V9PA 5H70A 4FD2A 1HA3A 4PTLA 4TTPA 2GAAA 1U9IC 2RHMA 4HLUA 2KSQA 4HZIA 3I92A 2UVQA 4ZCMA 1DO2A 4R9UC 3IUYA 4ESHA 4DDWA 3SQWA 2QPOA 2Z43A 2WAYA 3FYHA 4N0DA 2DY1A 5P21A 4A8JC 3B78A 3KJGA 1R0YA 2C99A 3A4NA 3AUYA 3FKSA 1QG4A 5JFGA 3SZRA 5LDDC 5JLJA 2R6FA 1XTKA 1EX7A 1TQ2A 4ARZA 5GADl 2BIFA 2BBOA 2ZR9A 4PC1A 2QMUA 2WPDD 4RFSB 1Q1ZA 2C9OA 2GCOB 3JZMA 1RJ9B 3Q85A 2B6HA 3ZS9A 3KKPA 1ZINA 5IT5A 2WWYA 1KAOA 1Q20A 4MYTA 1OKKA 4PXAA 2ZI9A 3GQBA 3PUWA 2CCGA 3THOA 4D81A 3PIRA 2VF8A 1OYYA 1T0JB 2ZUBA 5L8VA 3ND9A 4XVQA 1HTWA 3B85A 4F38A 1WF3A 4R98A 4Q4JB 4HATA 4GOJA 1NVVQ 4D25A 3V4FA 4HB0A 3I5XA 1NN3A 4X8OA 4URZR 2D7CA 2XXAA 2O8FA 3W9YA 1MO6A 1EWRA 4NDZA 2F1HA 2O8CA 3WY9A 1E0JA 5JWOA 3QXSA 1G16A 2IEZA 3FMOB 2V7QA 2H18A 1U0LA 1CBUA 1XEWY 2OBNA 5KSZA 2YV5A 4FI3C 1TF7A 1W36B 2JJ8A 3CW2A 1SVWA 1N5JA 3IIKA 1OXUA 3BBPA 4ITRC 1G8HA 4HAWA 3GFPA 5AUPB 1AK2A 2Z4SA 3Q8XB 4IKEA 4C0QC 1ESNA 2ZEJA 2O8CB 1DVRA 5KNBA 2BBTA 2JLYA 3GJ7A 1AIPA 1Q1QA 3NBFA 1CEEA 2C96A 4EPVA 1P61B 4B74A 3IILA 3SNHA 5HR5A 2L0XA 4M8NE 1MR3F 4Z1MA 2ZSBA 3U60B 1G7TA 2VP2A 1AZSC 3BFXA 2RHDA 1E2LA 1XEFA 2O0JA 4LYJA 5DGXA 4RCYA 2WJIA 2YVUA 3T35A 2FZ4A 2JAQA 4OBEA 2OXRA 2F9MA 3RRYA 3CNNA 4DJTA 3C15C 4RCZA 4DT1B 2QU8A 2F9LA 4DBLC 1PZNA 1OKKD 1KDPA 3C8UA 1P73A 2HF8A 3I5YA 2A3RA 5CDFE 2A7QA 1G17A 4BLRA 3EZ7A 5K8LA 2GILA 1MOZA 3AP3A 1MO5A 3KQLA 1H8HD 2W2VA 1A5TA 1ZM4A 4DVGA 4BFYA 4WZAE 1IY2A 4TYPA 1NN0A 2F6RA 1VIYA 5EP1A 3AM1A 3LQRA 4QGFA 1ZU5A 3SHWA 3H0KA 2XJ4A 3U7HB 2H5EA 2QAGA 3A1SA 1S0UA 1D9ZA 1N6LA 4K8OA 1R10A 5JHGB 1JR6A 1XMJA 5F9HA 4MGYR 4IDHA 2R6AA 3EASA 3T5DA 3ZS8A 2GEUA 2VPPA 1G8PA 2FN4A 3IO3A 1X8JA 1MRSA 2GTPA 4G5OA 4P4TA 4QJ5A 3S1AB 3AP1A 4PFSA 4OHZA 1KKLA 2YWGA 4L8GA 1P2UA 1ZUNB 2VQSA 1DAFA 4J0QA 2A9KA 1FL9A 3ZQJA 1E1RA 2JIZA 3QNUA 4F92B 1JB1A 4UNNA 1IOZA 1P2TA 2ZE5A 4LBVA 3MWYW 1CU1A 4HLQB 1DBSA 2PJZA 1T8TA 1XPRA 3AGQA 1GG2A 1IY1A 4DSUA 2K5UA 1AKYA 1NJFA 1J8YF 3SEAA 1P5ZB 2HCJB 4RD2A 4NCHA 3FKSD 1E9CA 4D0GA 1TTTA 1VYVA 3B2EA 3F5FA 5TVKA 4HLUC 2IF2A 4JIMA 4PHTA 4PQYA 3X1ZA 2B7BA 2LKDA 3NC0C 3KQUA 3OEEA 1M74A 2XB4A 4OQFA 4RKFA 3KUDA 2X19A 1UDXA 1E98A 3EWSA 1ZM9A 2NO7A 2FEMA 3GCGA 1TQDA 4TYYA 2IS1A 4JS0A 4TZ6A 3TKLA 6Q21A 4LPKA 3WRYC 2W83A 4Q02A 2OBMA 4P32A 2DHRA 4LWZA 4C0LA 4ZKEA 3EPLA 2C9YA 1CKEA 5A5GA 2VA8A 3ZVLA 1ZCBA 1FW6A 2YOHA 5FBWB 3AQ4A 3K0AB 4P31A 2XSZA 4ILEA 1QHHA 1G3RA 1DAGA 1E79D 4KYUA 4GDFA 2OLKA 1XPOA 2PCLA 2V4ZA 1G6OA 3ZZUA 4W5JA 2O8EB 2CK3D 2C03A 4TT3A 4YXWA 3QXHA 4YDHB 5JEDA 4D82A 3KB2A 2XEXA 4NL4H 3C4JA 3BIFA 3WMEA 4LX0A 4GSYA 1G21E 5D3MB 2OCBA 5FOXA 1HT1E 1SXJE 2BCJQ 2ONKA 2FSGA 1NVWQ 3U3MA 1N6PA 4RD1A 2WJYA 4WVFA 4MGKR 3RNLA 1VYUA 4C0JA 1XEXA 2IK8A 4B44A 3AF0A 4HAYA 1Q21A 4IDNA 4C9BA 1MABA 1N5LA 1BS1A 1R0WA 2YOGA 5CIWA 1HE1C 4PC7A 2YWEA 3BAFA 1AKEA 1JQJC 3QEJA 1CTQA 1BOFA 1Z6GA 2DFNA 5GJWC 1E4VA 1G7CA 1W47A 2VHCA 2IF0A 3PUXA 4MUAA 4TQ9A 1ZNWA 3V00A 1AGPA 5TV2A 2Z83A 1WE2A 3DMNA 4XIGS 3UANA 4BQSA 5D3MA 1IHUA 2NPIA 2VHQA 5E7JA 4LJ4A 4L4UA 4HAXA 2O5VA 1N0VC 1T91A 3RABA 2CNWD 2QQ0A 1RE0A 1SXJC 2GETA 3BGWA 3U7GA 4UXHA 2PH1A 3MWKA 2QN6A 4QNRA 2P0EA 1WXQA 2FF7A 1XD2A 4P0TA 1ZRHA 4PANA 2VP6A 1KSJA 3TW4A 1LF0A 2W6ID 3TRFA 2RH5A 3KJEA 2KI5A 2WSSA 4DIDA 2FEOA 3BFVA 4FINA 1XB2A 5AUQA 3M1IA 2ZSDA 1RC8A 2J0VA 4G5QA 2WMNB 5CM8B 2ZJ8A 4B2PA 1Z28A 2VLIA 4TN1A 3UWOA 1AJEA 1QVAA 3E70C 4OL0A 2IYTA 2JLSA 2B92A 5TMPA 1SVMA 2OG2A 1JPNA 4FWTA 3C5CA 2CK3A 2PEZA 3ADKA 1U0JA 3DOEA 3TMKA 4F4IA 4Q1BA 4OI1A 1FP6A 2VBCA 3AVQA 3EXAA 3CPHA 5FTKA 1K5DA 1P2SA 821PA 3EIQA 5M04A 1HT2E 4RJLA 3TW8B 4O0MA 2XXAB 1G3IA 2JJ1D 5J4KA 4AI6A 1F2TB 2IYXA 2JASA 1EXMA 2A5YB 3L0OA 4BECA 2OCAA 3K0FB 4C0BA 3IDQA 3RS4A 2WJVA 1NBME 1IN8A 4KITB 4AD8A 2EWVA 2Z0MA 1AS0A 4TMTA 3SOPA 2ORWA 1Q22A 4V0ME 3VR1A 2Q0HA 1N6NA 3K0EA 1W0JA 1XMVA 2RCNA 4BRWA 1GAJA 1NLZA 4UQOA 3B60A 4U02A 1RIFA 2J0UA 5EJEA 3DHWC 4C0AC 4OHWA 4ZV4A 3EARA 3QEOA 4TZ0A 3HYRA 4TWZA 1F2UA 1NBMD 2IEYA 3UMRA 2OFWA 1GTVA 5A4JA 3PEWA 5K8UA 2BM1A 5HZKA 3G5UA 3QPWA 5TY0A 4LJAA 4XD7D 1T6NA 1T5LA 3AP2A 2CBZA 4RD4A 3TSZA 1RRGA 3TUZC 1MV5A 3ASYA 3QKUA 4M4SA 2XNDA 5H1YA 4KXFB 2WIBA 4V0OA 1E94E 2JDIA 3LBNA 4UNQA 4B32A 1J8MF 3U3OA 3SBEA 4EJSA 1F6BA 3LH5A 1G7RA 1DARA 1SGWA 1NLFA 3ICEA 4KFSA 2Q9BA 1JR3D 1YZTA 4I1VA 5CYOA 1SHZA 2HYDA 3U3RA 4JYBA 4A0HA 4RSGA 1UFQA 3LAWA 4TQAA 2HDNB 3BOSA 1HURA 2VL7A 3C7KA 1K8RA 3AKYA 4GOKA 1N6IA 4IFBA 4M1KA 4Q19A 3GP8A 3LNCA 2XNDD 1TX4B 2XZPA 2PX3A 2JDID 2P65A 3CKLA 3E2IA 2BKUA 3LW7A 1IBRA 4GRAA 4M1OA 3KXLA 2Z5FA 4Y0VA 3K1JA 3KJIA 1QHXA 1E9AA 4KFUA 3TK1A 1T4GA 1WRBA 4OQLA 4EJSB 3M4YA 2GF9A 2MSCB 4Q9KA 1J99A 4C3ZA 4ZI2A 1HQYE 2BHRA 3LBHA 1G19A 2HEIA 1IY0A 1UEIA 2XTMA 2E87A 3X1YA 3QUSA 2WWHA 1HUQA 3EPJA 1F5NA 3ZH9B 4EPRA 5BYJA 4NYJQ 4BEJA 1ZP6A 5G3ZA 2WJGA 5A0FA 2PMKA 4Q9IA 1XXHB 3CH5A 4BGDA 1E2JA 1E0SA 2CDNA 4BZPA 3QI2A 4EPTA 2VEDA 1SZPA 2Z4RA 2FOLA 3QXXA 3WBKA 5KDDA 4BFTA 3THXB 2ZI5A 1X1RA 4DDUA 1GRRA 4HLDA 3OFND 2JJ2D 3VR5A 1NKTA 1RZ3A 4BASA 4PC6A 4EKDA 1OXSC 4PPQA 1NY6A 2GZDA 4B33A 4A15A 4L9SA 1E96A 4GOXA 3SHFA 1R5BA 4GMDA 1TF2A 4PR0A 2ODWA 3VNUA 1WB9A 2YHSA 2GXUA 4H1UA 2XNSA 1M7GA 2O8DA 4N3NA 3TSOA 4JT2A 2A5GA 3UMFA 2Q3HA 3NWJA 4MRNA 5KDOA 1XXHA 4R71A 4MKFA 5G53C 2WWWA 2BMEA 4F7WA 2ZETA 3PG5A 3OHMA 3THXA 1Z2CA 2Q3FA 3SJCA 3PR1A 3KJHA 1UKEA 3OE7A 5AJWA 1ZNXA 4CZ2A 4BRUA 4DKXA 4TSFA 1LV7A 3LX5A 1WDTA 4D4KA 3RLFA 4QC2A 1YZQA 2HJGA 3IKJA 3LXRA 1M34E 1VCMA 1CIPA 1OYWA 2YKGA 2R6CA 5DH9A 2IXGA 1KI8A 3CF2A 1W4BA 2NZ8A 2UKDA 1GUAA 3KKQA 4A0FA 1U9IA 4B3XA 4RKEA 1TQ4A 2ZE6A 1JALA 3E5HA 3JVVA 4JMPA 1IONA 5EE0A 4G5GA 4Q4JA 1W7AA 1E2DA 1MKYA 4HSEA 2WWGA 3NEJA 3OE7D 2J9RA 3EZ9A 1P72A 1G20E 2I1VB 2HT1A 1D5CA 2OXCA 5EXPA 1YJ5A 2CLSA 2E1RA 5JS8A 4JJZA 2RGBA 2XJ9A 4TL8A 1KI4A 1KZ7B 3BORA 4LBWA 1ODFA 1SQ5A 1YR9A 1X1SA 2VTKA 3RRZA 4ZCLA 1K6MA 1OLOA 5UKDA 5AR1A 2ZJBA 3QF4B 4I99A 2QGNA 1RYFA 5CB8A 5E95A 3PEYA 4LRWA 5JJIA 1I4LD 4PSAA 2LCFA 1CS4C 3AVXA 2FMXA 2R6GA 4LBZA 1SKYE 4BWYA 1OSNA 4PSKA 1U8AA 1PVOA 2C77A 3AVUA 2WWFA 3TQFA 5FPTA 4A82A 3QQ5A 1GL9B 4XD7A 1E4YA 4GMXA 2ZRNA 4CVNA 2R44A 3OAAA 3FPAA 1X86B 1BYIA 5DHAA 4HI0E 1US8A 1X6VA 4WAUA 4A8JA 3GLFB 4NPHA 3U6BA 1W2GA 1OXXK 3D7MA 3QKTA 4DLTA 2ZYVX 5LPNA 3OEHD 1BIFA 3ZVMA 1W46A 1X3SA 1XD2B 5AJYA 4I1SA 2ZVQX 1ZYUA 2V9PA 2B21A 1D2MA 3J81k 621PA 1EG7A 5HCIA 3KQNA 3BC1A 1I4TD 3K09C 3BK7A 2P6RA 3K8YA 5DI9A 4NE2A 4PX9A 4II7A 2ODBA 1DE0A 4W5HA 5KDLA 2W6JA 1CULC 2R65A 4IEIA 2EVWX 2ZUDA 1SVLA 2BMJA 4MDFA 2WAXA 3PUYA 4AYWA 2QA5A 4IXNA 3VHXA 1IQPA 1U8YA 2G6BA 4AYXA 2JLRA 2BC9A 4JLAA 2FZLA 1G4UR 3OEHA 3AVYA 4ZDKA 4PZLA 2WV9A 4H1VA 2FFBA 1T8UA 2MMGA 2ZI3A 4OK5A 5EZ6B 4TL7A 4TMKA 3D3QA 4PSVA 4XTRA 3WHLA 3T1TA 3D31A 3FHCB 4FCVA 1OJLA 4LV6A 4TLCA 3UG6A 1XF9A 2HYIC 3ZD7A 4JJKA 4NYMQ 3THWA 3DVLA 2EQBA 5AJVB 1HEIA 5L3VA 2ZE7A 5GJCA 3BB4A 1UJ2A 3FFBA 3WRXC 1W48A 1QVRA 4C0SA 1NG1A 2XSZD 2UZIR 1WA5A 3TVTA 3CRRA 3L8YA 5JHHB 4G0NA 3ADDA 1GL6A 1W0KA 3PXGA 2REXB 3MG9A 1DELA 3SJAA 1XTRA 3SJZA 1E9DA 2WM9B 4E07A 1JNYA 1N2CE 3K0CC 2CCKA 2ZRCA 3KFVA 3S1AA 4PPGA 3DO6A 4M9SA 2D2EA 4CEHA 4IEEA 4AG5A 4DLUA 1IJFA 4NCJA 4JYCA 5F3WB 4NYMR 3I3SR 2FV8A 2BMFA 5H68A 5FH9A 1Q3HA 1CJUC 1MO4A 1Z6XA 2VSXA 3CX6A 2AXNA 1TQ6A 3IBYA 4HAZA 3T1QA 3CRW1 1Z2AA 5DSZA 1FTSA 3MFYA 3QOFA 3FDIA 3LVQE 2KWIA 1GZSA 1WMSA 1DG1G 3B1XA 3OIVA 3I62A 5DE3A 2VIIA 3U4QA 1YR7A 5IHPA 2AK2A 2IX3A 2MMCA 2ZRLA 3LLMA 1IAQA 2OSBA 4QHYA 1DAIA 4V0KA 1LVGA 1OH5A 4Q5IA 1Z0DA 1JAHA 2IW3A 3HWSA 4HLCA 3VMFA 4BLSA 5KHOC 4NZYA 1G5TA 3W8RA 3GEEA 4H9GA 3KQKA 2Q9CA 1GITA 5HE9A 2RGXA 4NYJR 4DRZA 3WXMA 1FUKA 1NY5A 4LV5B 4LCBA 3AVWA 1WCV1 2CVHA 4XTCS 3Q7QA 1W0JD 1RVDA 4ZIRB 5KUTA 1OIXA 4ZDIA 4UXJA 2VF7A 1KKMA 4M9XA 3TVDA 4CT5A 5EE5B 4URYR 3K70C 3R9IA 5AUNB 1LS6A 3CRMA 3WNCA 4FWIB 4M1MA 3K70B 1KTVA 4P3YA 5ELXA 1UKYA 1D6JA 1GOTA 1ZNYA 4IOKA 1AGRA 4HZUB 5E7MA 3X2SA 5C4GB 5B57C 1V43A 2QGZA 2ZR7A 5SZIA 1G9XA 1ONBA 3GLHA 1R7RA 1CJVC 3WBJA 2GWHA 3NBXX 3FWYA 4PHFA 2C8VA 4M53A 1C4OA 3TH5A 2VSFA 4NH0A 3BS4A 4LSGA 3I73A 4JKIA 1E6CA 5FL3A 3IIMA 1U2RA 2GCPA 1T9HA 3T1VA 4TLEA 4URVR 4OQNA 1EFUA 3LO5A 3ADBA 1E2EA 1Q44A 1A4RA 1OXTA 2WWIA 3NHAA 1P60A 4LHWA 2QAGC 3PCRB 2A2ZA 2V7QD 5FI1B 1P2VA 1XZQA 1N5KA 3A36A 1ZD8A 4ZO4A 3REFA 3ZLJA 5JCZA 4BLOA 2V1XA 2WOOA 4FXPA 5FOWA 3SC3A 1DAEA 3AGPA 1FX0A 2A30A 2NMVA 2PLRA 4AKGA 3Q7PA 2N46A 2HUPA 1EK0A 3SN6A 4PC2A 1KI2A 4DDTA 1TPZA 1G64A 5JCPA 4TT3D 4KLZA 2P5TB 4PPNA 3GLHE 4YXWD 1AZTA 5AK0A 2CXXA 2ZJAA 3EA5A 3SS8A 4A9AA 4Q1DA 1XD9A 3LWNA 3NC1C 3QF4A 4TYNA 1PUIA 5CM9C 5CDFA 3A6PC 3DKPA 4QHSA 3GJ6A 3U2QA 3TAHA 4D0LB 2ANCA 3KXKA 5G40A 3CBQA 5SZJA 1E9FA 4Z1MD 3CZPA 4US0R 2QPTA 2AFHE 1GNRA 2EFDB 2PLFA 2A78A 1ZIOA 2CNWA 2CJWA 2ORVA 3W34A 4TTRA 3OIWA 2ATVA 1YU9A 2FFHA 5DLQC 3VNVA 2FPMA 3BJIC 3X1DA 4A8JB 2W6IA 1XMIA 2JLQA 2IWHA 3BFKA 2ZM5A 2DCUA 2J59A 3BD9A 3NBZC 2G3YA 2ZIAA 1DAKA 1ZMXA 1E2IA 1DEKA 1JXMA 2GXQA 4OHVA 1E0AA 1KO7A 4EAQA 3A1VA 4IOLA 2HF9A 1HYQA 1QF9A 1UKZA 5CLLA 3QPUA 4ACBA 2EWWA 3GEIA 3VKWA 2H8KA 1A2BA 1VDZA 4HDOB 4LJ7A 4C7OB 4PPFA 1QHYA 2CJWB 2DWQA 4QGAA 4TYWA 2NO6A 4V02A 1T3SA 1M8PA 2X1VA 1O3YA 3WYAA 2HXYA 3VKGA 4IXMA 3PFIA 1G5PA 4XVRA 1VG9B 5JI3E 4M1WA 5HZHA 1W36C 4JL8A 1YZLA 4LHXA 4EPWA 1KJWA 2FH5B 4GP7A 5B58C 2FX3A 2FSFA 3ZD6A 1XP8A 1OIVA 4XJXA 5JJLA 4JL6A 1TU4A 1Z0FA 2IYSA 1N6HA 3ND8A 1S3SA 3R7WA 5E3HA 1YHNA 3D8BA 3SR0A 2I4IA 4NHOA 4LYFA 5EXTA 2WTUA 3AVVA 1P7CA 1RJ9A 1E3MA 1EFRD 4Q9JA 1KO1A 4NU0A 1V5WA 1ZC4A 2W58A 4JL5A 4R7ZA 2ZVPX 3IPYA 2VHJA 1DAMA 1KJZA 1SULA 1JAIA 3NIBA 4G01B 4JT4A 1Q1EA 2W2XA 5EUMA 1EWQA 5B2ZA 3T61A 4LC1A 1DG3A 1KYIA 4Q1EA 2PMDA 4WXPA 3GLGE 4O25A 4QGGA 3AKEA 5H8WA 1S2MA 1SXJB 1XRJA 2ECKA 2P6NA 1Z47A 2B7CA 3R7WB 3T06B 1RW4A 3AUXA 2XZOA 4CEIB 3SDZA 2CHVA 1GWNA 2ZRJA 2JLUA 1BO6A 1OIWA 1UDWA 3FHOA 3HYTA 4OJQA 4OQMA 2G77B 2VHTA 3KFXA 1KNQA 1YR8A 1Z0IA 4A2QA 2F43B 4GZLA 4WBSA 1NNEA 1EX6A 1VTKA 2CL0X 3T12A 1SKYB 4MA4A 4KBGA 2HLDD 4HAUA 2QORA 3PEUA 1ZM3A 2GJ8A 4ARZB 2ZS9A 2IBMA 2R8RA 1A7JA 1RRPA 4A1FA 2AD5A 2WBLC 1NI3A 1XCGB 4Q1CA 3LA6A 3WMFA 4IHQA 1GNPA 5TXGA 2YOFA 3NBYC 5HKKD 2CVFA 4BE7B 1T0HB 3P26A 4MYCA 1G3MA 4BFUA 4BFWA 3TLXA 1II8A 4TMXA 3CIOA 3K0AA 4GI7A 2QM8A 1E9RA 4FMBB 1KY2A 4KVGA 4OK3A 2X77A 3QBTA 4OYHA 3SFVA 4LJ9A 1II0A 2JA1A 1UKVY 1XU4A 1XFAA 1GKUB 3B1ZA 4QGHA 5IF9A 2ZS8A 2H1LA 2NO1A 3BRWD 3ZIAD 4ACAA 1XBTA 5DYGA 2ATXA 4B6EA 2P3SA 1GFIA 2AWOA 2C95A 1AM4D 2IYVA 3W6OA 3SI7A 4ZI3A 1O87A 4CEJB 2QP4A 3Q9LA 1NP6A 4TL9A 1TMKA 2HT6A 3G82C 4JSYA 2WSMA 4QBFA 3RS5A 5KO2A 3RSOA 2ZUCA 3FE2A 1E2NA 3NHBA 1IN4A 1Z22A 2PEYA 4GPTA 1Z6AA 1Q0UA
chains in the Genus database with same CATH superfamily
4NBNA 4TMWA 1BN6A 4FXOA 3RFXA 5KWVA 4DHEA 3VKHA 2J46A 3G0IA 4CDGA 3TF5A 1UQTA 3BTVA 4BNDB 3MXTA 1ZD3A 4U3JA 3W3AD 2ZYIA 3GR6A 1W88B 1B7GO 3PUVA 1O96A 2PT7A 1VI6A 3ADPA 2HHHB 1H2RS 3C74A 2J9XB 4L85A 4EQ6B 5LDHA 1D07A 1I3NA 1QZ3A 4PTZA 4O6VA 4XOIA 3MHTA 4YXFA 4XM0A 1XHEA 4FN4A 1QPGA 2GSDA 2WTBA 4CKYA 4D5EA 5K8TA 3JD4A 3OBIA 2GJ4A 1P5FA 3BMQB 4ZPJA 1QX3A 4P86A 1IMJA 2B1IA 3AYZB 3I2JA 3IQDB 3RVOA 1V39A 1DJQA 2CNKA 2R47A 1W6UA 1QBKC 2IQ5A 4QXAA 4MYUA 1UM8A 4CMIB 1MZPA 1QP8A 4C7MA 1KMIY 1WCIB 2JCSA 4HN9A 1EHYA 2IUSA 3PGVA 4QJIA 2HSZA 1JIKA 2B4AA 3DW3X 3IDFA 2XY4A 1Z5NA 4Z0NA 4UNRA 1T26A 2G70A 1L4HA 1V3QE 1WVMA 2EJVA 1N57A 2BELA 4LZZA 2E37A 1QQBA 2P9ZA 4TS1A 4DT1A 5BQOA 2LDBA 2OMEA 1CRPA 4OOEA 1SCUB 1ZRNA 1IDOA 2VAWA 3MAAC 2OQ2A 4HH1A 1VPVA 1O1YA 3G68A 3KZCA 4EQ6A 2XGJA 5LQSA 1NFQA 3V48A 1KJNA 5CYPA 2I8CA 4C89A 3M82A 5ESXA 2GHRA 3DWFA 2VJMA 3G7UA 1Y3IA 4UXIA 5JTTA 1PL0A 3LP8A 3K09A 3ITNA 3EWAA 5IT4A 1S3GA 3GLTA 1NLUA 2PS9A 5CNJA 3R20A 4QX6A 1TIBA 4X0EA 2Q5CA 2QKYA 2C07A 1FFGA 4H31A 3BWEA 4KNWA 1G8FA 1LTQA 5I7VA 1RPNA 3KAPA 1KXZA 5KTSA 3CXUA 5EPOA 3RVRA 4DBZA 3LLCA 5THKA 3GRUA 4NFYA 1DXQA 1M8JA 1FX0B 1ZZEA 4CMJA 1HL7A 4AXXA 3WA7A 1UBJS 1IUPA 5K3FB 2ZRPA 2QR5A 4L78A 3RIXA 1NVEA 4C06A 5B1IA 1OAKA 4XIFA 2Y1FA 1BCSA 1EJ2A 2B8TA 3T5MA 5AK5A 3HVIA 1KMHA 3AB3A 3LYUA 5CHYA 3KEQA 3M9WA 1HO3A 3DYBA 2VZ8A 3WP1B 3TPFA 2HX1A 3FW1A 4KQMA 3S2UA 5ALQA 1JDVA 1KK3A 3X0DA 5C46F 1U81A 3KE8A 4BKMA 1KO4A 1I1HA 2PTGA 5GV7A 4LNAA 3P0JA 3WO0A 3HCRA 2LDXA 2H0QA 2NWQA 1ZRSA 1BDMA 4CLRA 1Z6PA 4DDVA 2WQ6A 3O3MB 3VPAA 4E0BA 4MQ6A 4I4CA 4ZMBA 1XJCA 4D6XA 3P0HA 5BRJA 5BV7A 2A4MA 1A4XA 1YZFA 3KTAA 4PYOA 1NVGA 3VZBA 5B1HA 1TAGA 2QWXA 4EA9A 3JALB 5K3FA 3HCDA 2YWXA 2GYUA 4R68A 4X3OA 1EK5A 3U81A 1WDKA 1KBOA 5B36A 3WKDA 2ZANA 4EUNA 1MJGA 3HDGA 1CJTC 5DI3A 2VDMB 3IQIX 1E2FA 3OF2A 3I05A 1KSHA 1UBGA 1JJBA 2PH7A 1SXJD 2ZQ5A 3DE0X 2CFRA 3M89A 4Y2QA 3WLQA 4EMBA 1SVSA 2D0PB 1QTIA 1PEKE 4DIEA 4BO7A 4ADSG 3FTPA 1P29A 3IAFA 3MJCA 4DJJA 4LF9B 1B1AA 4HX2A 4XYGA 1JWAB 2H5IA 2XVMA 3KVRA 5IAGA 5DXAA 4EA7A 5KQGA 1CQZA 3QLVC 1XD8A 3EDOA 5J63A 3OOYA 1Z17A 1KFBB 3R0ZA 3KOZA 3WWZA 2J08A 4L4XA 4KL8S 4EGCB 5EMMA 5KSPA 4AC9A 1SC4A 2ANBA 4MEAA 1KZHA 3FUWA 3M4XA 3R5JA 3U6KA 3PRJA 5J43A 2ODAA 1I24A 3TJZA 1XDZA 2DH6A 3VR2A 2RGEA 2IT1A 1ITZA 1C2YA 1Y81A 1Z3CA 3GD5A 1JG1A 1JHAA 3FYDA 4NOMA 2AFRA 5AFSA 1R37A 2HFJA 2QM7A 1X1QA 2EJCA 3KCNA 3DVAB 1KEPA 3MSXA 1OR8A 3ROPA 1PT5A 2XCIA 3SIRA 4JZKA 4N6OA 4DWJA 3JZDA 1BXRA 4X8MA 1M2GA 3SSOA 1JR4A 4MHOA 3AESA 3NKVA 3II6X 1EXNA 1PQ4A 2J3KA 2CV1A 1DKLA 1Z56C 2IZ5A 3C3MA 4MW0A 4D8VA 2ZRBA 4DAEA 3QMWA 5FL7D 4PN7A 3PDHA 1U1CA 2ZRKA 1X9GA 2EATA 5FUMA 2XOKA 3B3AA 4OX9Y 2VTEA 3RT9A 3RYHB 2QXYA 2IXEA 3K31A 2D0DA 2R2GA 1NV8A 2QB5A 1R4NA 3DPIA 3KR1A 3LVFO 3R3ZA 2J7KA 3VOAA 3FETA 1VIDA 1C4XA 2FRXA 3LIPA 2VZ9A 4QEDA 4REQA 2LXNA 4GDMA 4IHKA 1Q15A 1S7GA 3Q8WA 5FBHA 3IB6A 3T38A 1P1RA 2QMOA 1OW3B 1IRXA 3QVSA 3LZDA 4PYNA 4X95A 3RAPR 4B3CA 3W4IA 2ZRDA 2GJSA 1P3DA 2ZCVA 4O2LA 1NP7A 1RJEA 3UA3A 1HFKA 4YYZA 1TIKA 5JRDS 1B8OA 5IJZA 1L8AA 2B2XA 3MGAA 1GNLA 1BH6A 1DBIA 4R2MA 4DC1A 2PUBA 3MIZA 4QPPA 3HO6A 5ALUA 1GPUA 2FJPA 1Z8DA 4FYIA 3TXYA 1UBNA 3LF2A 2J3MA 1C9MA 3TTWA 1UOEA 4HY3A 3R3JA 1RWWA 5ENZA 2R751 3FH0A 3IR5A 1Y8CA 4G3XA 1N8TA 1OI7A 3BXEA 4RF4A 1UBTS 2C94A 4EJ2A 4C08A 4D9JA 5JAZA 1DDOA 3L6OO 4GECA 4B3TB 4Q1AA 4QQFA 3HJUA 4GWKA 2MSLA 1U04A 2IEBA 2P2CA 2XQJA 1C0KA 1JH9A 3BK2A 4OO3A 4HDSA 2WIGA 5AW9A 4XLLA 3H5RA 5F5LA 2HU7A 2KLHA 4NOLA 3RS3A 2NU6B 2OBYA 3UJ8A 3ZYCA 3CTMA 3ILSA 1K5HA 1LWNA 2OEPA 3MUOA 4DNQA 2J3QA 2RHRA 4EJ6A 4XYEA 3WLTA 3W5DA 3U40A 2VSQA 3H7IA 3O38A 5J23A 4KK4A 3OIYA 4CL8A 4MVJA 4G97A 4G81A 1NXXA 4GGOA 1G66A 4PIMA 5FOUA 4MWZA 3VR2D 4YPOA 5BQXA 3T3EA 3TGLA 3ZDAA 2WU1A 3U37A 5EE3A 1Z39A 2FQQA 4RE5A 5CD9A 5IMSA 4BLTA 2ZIFA 5DSXA 4TV9B 1J97A 2X2EA 1RXUA 3TZCA 1N2CB 4JQCA 3RNOA 3E53A 4E03A 4EJSC 2NTYC 3HRHA 3LLVA 1YVUA 3B8EA 1JXOA 2O4UX 1P31A 3IOBA 3D6NB 4P6VF 4YDQA 2CL6X 5F1OA 1SFRA 1XLTC 3E22B 3FI9A 4ZD6A 2HW8A 3FOAA 4B73A 4RSRA 3O9MA 3NDRA 4WBNF 1C9YA 3CS3A 4LTNA 4X6LA 4Z6KA 5JALA 3RHFA 2PBRA 3GMDA 4LJ5A 3GB9A 4WQMA 3L2OB 4EW2A 4TM7A 4PAOA 5HDQA 4LF8B 1NUAA 1H65A 1KP9A 1QANA 2JGJA 3R4VA 1V6AA 3GEHA 4TXJA 3WK6A 1G2QA 3W2TA 3GROA 1Z07A 5DW0A 1G5FA 3I61A 2UYCA 1KI6A 3DJFA 1KOFA 4U2FA 5EUQB 4KAXA 4LZWA 2HRBA 3D8SA 1GG5A 1R5OA 2AI2A 3I0NA 2J0UB 3I5MA 3OO0A 4YJHA 4IJMA 2H4WA 2KE5A 4IWXA 1XNGA 2YNMC 1QZUA 4OL9A 1P2GA 2V5UA 3SIPA 1F2UB 3WGIA 1VL0A 2BGNA 1JQLB 2NXWA 4MVJE 4CN8A 2O2DA 4X45A 5I7FA 3DM9B 2NT3A 2N1MA 5LQRA 1L5VA 5I9IA 3WB9A 4NE7A 3BZBA 1ODSA 1PJ4A 3GUUA 4JYAB 3L6BA 3LKDA 2J45A 3M3HA 4OX9B 4XDGA 2G1KA 2Z57A 2YVLA 4HT3B 1TYZA 3KKLA 3RUAA 1MC4A 2PZKA 2XUIA 5BN5B 3ROEA 3OY7A 5FR2A 3H1EA 2CLCX 2QP9X 3HB0A 1H4TA 1QS0A 1ZH0A 4Z99A 4HUTA 1Y1QA 2AQIA 1E1RD 4XWAA 3QUQA 3CSSA 2O8VA 1EBFA 2QNRA 1P9WA 1T9GS 3F47A 3DAOA 1APBA 5HWSA 1F12A 4WCDA 4PXSA 3IQFA 3ENZA 1EWVA 1ZJYA 2GK3A 4B40A 4Y2SA 2N0SA 3AILA 2ZIZA 5FP0A 1KAHA 4FDAA 4M7RA 2WMOB 3UAYA 1GA6A 1OLSB 1K8QA 4XB6B 1ZGCA 3N0TA 5IKOA 3NAMA 4OJMX 4CUZA 3GLQA 5KYVA 1DOZA 1T13A 2BBSA 3BB3A 3EXEB 4RADA 5EHQA 1ZONA 3WWEA 4CUJA 1JFTA 1F48A 1M7HA 1YL5A 2OM6A 1Z36A 1UMKA 3FLEA 3NIGB 2RMKA 3AKCA 1E2QA 1XVLA 2C8LA 5L51A 3HCBA 2ATCA 2FWJA 3H84A 1PO7A 5FT9A 1L0BA 3QW2A 1ZVQA 2J3EA 3MGCA 3VR3A 1FQOA 4GQAA 5LZ8A 4DKJA 4TTVA 4DIBA 5GVSA 1NXVA 2YZ2A 4CM3A 1IJKA 4II3A 4ZVOA 4DQDA 1N32B 1EXVA 4R0VA 3KBOA 1SBHA 2IIPA 4FN5A 2PL9A 2W2KA 3JU3A 3UXMA 2QW8A 1XKQA 1E2PA 1Z29A 4PLZA 4EATA 5F2EA 1CS0B 3UYKA 3TNJA 1VMDA 3IT2A 4XX0A 1E7QA 5DASA 4NARA 2W0MA 2WAOA 3KYJB 4UEKA 4ERXA 1UKCA 4ARBA 3SY8A 2ZTMA 4QUKA 1SBZA 4HDQB 5AM1A 2M6KA 2VP0A 2BDTA 3BTSA 2HK6A 4QJ4A 3AR3A 3JQ9A 3QFFA 5FWYB 4F85A 4AICA 2HJVA 2AN5A 1W44A 2SKEA 3F1LA 3BWDD 3UKDA 4F71A 3AJEA 3M6FA 1JSZA 2FU5C 2I3DA 2CLDX 3A1WA 5FWDA 1Y4DE 1GZUA 3ABOB 1ECFA 3HLYA 3GGGA 5FF9A 2OCKA 4Q12A 3HH8A 2ZVJA 2JI8A 2FZVA 2AZ4A 2Y1LA 3BIWA 3F49S 3NYQA 3QFTA 5DLDA 4ED9A 3O2JA 3JVDA 5ALTA 3W2FA 2F43A 5JO0A 4CT0A 4U7DA 3HLTA 1NN5A 1NI4A 3C41J 3TECE 2XWBF 1MFZA 1WR8A 3WWYA 4ALMA 1LPAB 5IF3A 3DLAA 4U8HA 4MS1A 1RQ7A 3EG5A 5CCXA 1ZEJA 5AJXA 3R7DA 1SQ6A 5I4IA 1EJBA 1RAIA 4KHZA 2VDKB 4P7KA 1KY5A 1HE5A 4F93B 1EUDB 1ABFA 1KO8A 5JOQA 5KNCH 1GPLA 2OC4A 1GU0A 3V55A 3VPCA 1KWKA 1DXOA 4NTZA 2I2BA 2YW9A 3IT0A 4H7HA 5GJVC 3WK4A 2OYSA 4US2R 2BGLA 2OAP1 3TW6A 3AONB 3Q88A 2AG1A 2HA5A 4QEKA 1Y4ZA 1UDAA 2VJQA 4UM5A 1B3BA 1DX4A 1Z4NA 2HREA 2IL1A 3GG2A 5BT9A 2VTBA 1QJCA 3GC6A 4YCDA 4LHVA 4DC9A 1YC2A 5I8PA 1RWOA 1VBNA 3P0IA 4X44A 4F11A 1ULTA 1ISRA 4K05A 3ZV5A 2WICA 5IXJA 5FR1A 4MUHA 1JF8A 1QHEA 3S7TA 1PJLA 5J40A 1Y37A 1U2DA 3OPMA 5C5IA 1V2GA 3QHAA 1MO3A 3QYAA 2PYDA 4F9EA 1N75A 3LBYA 2FDXA 1GDHA 1GNSA 4PYKA 2QTFA 1A7UA 4C6SA 3Q4GA 1OE0A 2JCXA 1WCYA 2YWRA 2QRUA 1DT3A 2ZIEA 3QPDA 4EUKA 3ANLA 5DWVA 1D4OA 2XQFA 5FORA 3RRXA 1W9MA 4JXKA 1U7XA 3ZCTA 1EWTA 2RGUA 4BNFA 1QKKA 3DV0A 4LOIA 2VTBB 2ODEA 2ZUVA 2BN4A 4DHWA 1V47A 1UR5A 4H0CA 4Q03A 1PYDA 3ONWA 4YJ2F 5K45A 3IT3A 2Z8YM 3W3ZB 2NQTA 2I4OA 1VHQA 2L18A 1Y34E 5AKYA 5AVJA 3IPXA 4YMGA 4DCMA 3RD5A 5EL0A 3MGGA 2IC5A 1QTNA 2ZK7A 4I19A 4J4BA 3V80A 1YCGA 3A3YA 4G0YA 1RMQA 2BGTA 4GMFA 1Z2EA 1T4CA 3KJXA 4ROSA 3FG9A 4UCQA 4BO2A 4NOKA 4R7TA 4ZEWA 3P9QA 1Z38A 2XVAA 4FFBB 2XCTB 5KPDA 3F5MA 1U2GA 2PU7A 1QFXA 1S8OA 2VNKA 4XQ0A 1N0WA 1X7ZA 3AEQB 4QT4A 1JYEA 3LT4A 3JWHA 4DLAA 3Q7IA 4ZFNA 2B83A 1PEAA 1FYVA 2QLFA 5F9FA 3IRUA 3R0IA 3IRVA 2C2KA 1YZKA 2JIDA 5FFFA 3BK1A 3C5HA 4Q9LA 4RS4A 1ZBDA 1UBEA 3HU3A 3PJGA 1X80B 3DCJA 4RLFA 1EHCA 2Q4EA 2COEA 8OHMA 2C7QA 1EQUA 1V5IA 2G76A 4HUQB 3VYSB 1O9GA 5C7YA 4RACA 1EFRA 2IZ1A 1R8JA 3H2IA 5ANRB 2ZRHA 3I72A 3BERA 4XGQA 4BNKA 1D8AA 2OYRA 3MTIA 4YJ3F 1KIMA 2FP3A 4RMHA 5DSTA 1XG5A 4BX9A 5D3QA 3WMXA 4EO4A 3VJRA 3ORSA 1M34A 2I4NA 5JNSA 2XTNA 1SKBA 3NKFA 4P98A 2AE1A 2IS4A 4B81A 2JI6A 3CPEA 1L4MA 2HL6A 5BWMA 5IZCA 3FPGA 3LRXA 3PQ8A 4R51A 3AZPA 2ALJA 1RCUA 1C3OB 5KBYA 1L5YA 4ZOEA 1E66A 3RHTA 2M1ZA 2ZAMA 4G0PA 4G26A 4HPWA 1HFEL 2ZJYA 2V98A 3GO4A 1IOVA 1G8GA 4QFDA 4RZSA 1A9RA 2GZHA 1MBZA 2SECE 1TTPB 3B6EA 1WULS 4FNAA 2PLNA 2WSLA 2V59A 4DYDA 1PZMA 3KQMA 3JQGA 3QVJA 4KO2S 1P7WA 4KMMA 3WGZA 7ABPA 4TVSA 1G63A 3NWEA 4YBRA 3V4PB 2AEJA 5IT0A 4CQLA 4J9VA 3E4CA 4HD8A 2OBLA 3LHKA 3EPPA 4LVNA 3IGFA 3LC7O 2IE8A 1QAMA 1TT5A 3REGA 3SJUA 4M0PA 1UUFA 4XYBA 2EJTA 1UAAA 2EDAA 2G9UA 1U3GA 2G83A 4Y6LA 3PKIA 2W70A 2XKKA 5TMEA 1KI6B 3JD3A 3CLSC 5C5EA 2O2IA 1PWHA 5K09A 2C2YA 3FYUB 3KEOA 1M1YE 1C9KA 5BPHA 2PTHA 5MFZA 3SC6A 5HM8A 1PE0A 3DTNA 5TIIA 4YHHB 3ZXYA 2XOKD 3UJHA 4ZI7F 3HB7A 2WAAA 3CNBA 2LZ0A 4QRDA 5H7XA 4MRRA 3AY0A 4Z0PA 1T3HA 2ET6A 3QE9Y 4EOGA 1FFXA 1XVTA 1IHXA 4MVJD 3S1LA 4PNPA 4Y1FA 3UOAB 3K1AA 3R9XA 5BOSA 2UUOA 3OUTA 3DFUA 4JJ6A 1NR5A 3LCJA 1K8XB 3CR7A 3KD3A 4P4GA 1Q7BA 4I6EA 5D5QA 4BMSA 1BHJA 4QDUA 1AKVA 1C0PA 3G0GA 5BN5A 4Z4GA 1U02A 2CJPA 2QZSA 4M88A 3AXTA 4UDNA 5IK2D 1ZH4A 2EBFX 4M49A 4CIDA 5CITA 2JPDA 2PUJA 4FBGA 5FADA 5BMVB 5JCOC 2CLHB 3H6KA 3EYWA 2Q21A 2Q0QA 1I7PA 4G4IA 4AJIA 4MS4B 5M29A 5JDCA 5MFPA 2OZEA 4QT0A 2Q6IA 2R85A 2BVNA 2D3WA 2GEDA 2VSYA 3EHDA 3M3PA 5E6RB 5TDHA 4H08A 1X7XA 4EWLA 1AK9A 3LU1A 4JLKA 4MVXA 4Q7QA 3VSAA 1P77A 3FCXA 4W63A 1RQ2A 4KAAA 3QW4B 2ECQA 4OBWA 4EF4A 1D2RA 4DCTA 5K7SA 2KLBA 3ZWWA 2QMYA 4D0RA 4ZEMA 1NE7A 3RYCA 2WUEA 1Y4AE 3PPVA 5CVVA 2I55A 2ZROA 5C3UA 1EZ1A 4PHGA 5FBKA 2DWPA 4WLUA 1Z5VA 4RAOA 2BGGA 1J2JA 3IV9A 4O4IF 5EWLB 2VYFA 5HF6A 1BH2A 4EGSA 3ZGXA 1E8MA 1GRCA 5I3ZA 1P7YA 2NO9A 2WRZA 1KJ8A 1V8DA 3H86A 3JQBC 4RJTA 1K3FA 3QELB 1KQNA 4PO8A 4B6QA 1RAAA 2GJAA 1FPMA 4KQFA 1YOVA 3GX1A 4CDMA 3SE7A 2C7VA 4IMJB 2RAPA 1UXHA 4I2VA 5EHZA 2YXBA 3MJVA 4J2HA 1OBFO 3T7KA 4RK5A 4B75A 3SXJA 2HIMA 2WF7A 5B1EA 3MRVA 2PGDA 1K86A 5CB4F 5IFLA 1UZAA 1L4YA 1FRNA 4RZ2A 2VDUE 3W90A 4CM9A 3MTEA 2O8BB 1J0AA 2GJ9A 2WJ4A 3ULKA 4WZ6A 4AN1A 4C03A 2V6IA 4NNPA 2R8OA 4MVJG 4P92A 3SBXA 1EM8A 3HJGA 1WVGA 4M46A 5BWNA 3LSYA 2IZZA 3TZEA 2AUTA 2CZCA 4JC8A 3T34A 3Q11A 3TEFA 1P8AA 3DP9A 4K9OA 2X2FA 1KZ1A 1GRQA 1L8LA 3CZ5A 1ZGJA 3ZI4A 2QJFA 3MAJA 4H6VA 5LFAA 2OC9A 1YOVB 2C4VA 3E7WA 4ERNA 1D9XA 2W4QA 2ZCJA 1NI4B 4WOBA 5DT2A 3MW8A 3KYBA 2FEAA 4QFBA 4B7ZA 2WSSD 2ZSUA 4R4JA 4REOA 3MD0A 4D41A 4JITA 4JDPA 2YICA 4DR6B 1KYQA 2KJQA 2SHKA 5FTNA 5CT6A 4I8XA 2FQYA 2PJDA 4JUFA 1QORA 3Q7TA 1LK0A 3T4XA 1EGVB 1F14A 5LCXA 4B34A 1SCBA 3CB4A 3V8VA 1YFJA 1A9PA 3B12A 2B25A 2H48A 3O1HB 1JJFA 4OIFA 5AJTA 3OQ6A 1VYTA 5BYBA 1YIOA 4XGIA 2I5PO 1JE0A 1T6BY 1F8GA 1U2TA 1JDPA 1WQ4A 4G0ZA 4N3AA 3UJ6A 1QE0A 2GRAA 4K9PA 4EVSA 1FP7A 2OGTA 3A04A 4CKZA 5JT1A 1T8YA 1VL8A 3UWSA 4MQBA 2VTDA 4EDFA 3U1BA 3F67A 4X65B 1K3TA 4LMPA 4A2CA 2W2LA 1U0OC 2UVPB 2AH5A 3LZ6A 4HRVA 1SCQA 2WYUA 3QLUC 4RXUA 5EIXA 3VR6A 2Y27A 4J90A 1I6KA 3ZNQA 1X8LA 1O5IA 4ZV9A 2XNKA 1B0UA 2X8AA 4RETA 1KOLA 2QD1A 1SXJA 1U0FA 2VAPA 1XAHA 3AEUB 2YWBA 3IEKA 1BSVA 3UJBA 1OX4A 3O3CA 3U5TA 1YRBA 3AV3A 1IN1A 2P3QA 4INJA 2IUUA 3RADC 3L0DA 4LFBB 1GLNA 4LDJA 1EUCA 1LV8A 2Q6TA 4KU4A 4AU1A 5A9SA 1W96A 1ZD9A 1ZH2A 2BP7A 3GVCA 3H5LA 4AULA 1OAOC 1A7AA 5BR1A 3GP3A 2CMKA 4N6NA 5CFOA 2AX3A 4M9QA 5T8KC 3DAPA 2QUZA 3GJQA 4AIIA 4DSZA 4MW7A 3ABZA 3L6CA 1RABA 2NOAA 3STHA 4AZTA 5DXFA 1RPZA 2HK8A 3L0PA 3KO8A 4WOPA 3T15A 8LDHA 4FLFA 4DQVA 3K53A 3ROGA 2EYQA 2EW2A 1TCUA 2JRCA 5HCNA 1DQPA 1ODIA 4D9NA 3N2EA 3JV7A 5JD5A 1DL5A 4Y2PA 4DLRA 4CLEA 2Z6VA 3ANTA 4I5EA 5DNYB 5DCLA 3CX8A 1VKRA 3CEJA 2WF8A 3RTGA 1CJBA 1QB8A 1QH1A 4IJUA 4PCAA 1RI2A 1JQBA 1FNMA 1K27A 1CJCA 1WXFA 1Y3HA 2YVQA 3BCSA 3G9XA 4J0IA 4NVRA 1WBBA 4GKKB 4MO2A 1R50A 2FE4A 4NU6A 3FCOA 3WLMA 1QCZA 3I58A 4DQLA 2CDRA 4MVJM 1CLUA 1ZSNA 2E4VA 3I6IA 4HJRA 4S24A 5ESDA 4P3KA 4EPYA 3T54A 4D43A 1EFHA 2PLAA 2E3JA 2GHIA 4TMZA 3TINA 1R15A 2IZ7A 4LMAA 3L1UA 1A96A 1RM5A 3HB9A 4OEHA 4V3BA 1HNWB 1V95A 4AF7A 3O8RA 3NUGA 1PR2A 4IPTA 4CDRA 3HXOA 3GPIA 3TBFA 3FYSA 4HVLA 5DTJA 4FFSA 1YZHA 2A5DA 2ZI7A 4R8KA 5ECYA 3PKZA 3QXJA 2G4VA 4JI4B 2BTEA 3VKUA 3EMBA 1U7UA 1L1FA 1W49A 4UCFA 1ADBA 2H31A 1WUJS 2IPLA 5C5DA 5E3JA 3I04M 5AUOB 2ERYA 2BM9A 4L4YA 3I2FA 4X9XA 4DSOA 1E3IA 1XU9A 4P80A 1ENZA 3MQFA 2E6UX 3QX3A 3U3JA 2I91A 2YMMA 3AB7A 3KCQA 1MLDA 1CUUA 2J85A 1HDYA 4L08A 4PAMA 2FUG1 5D5HA 3W1EA 4REQB 3F1KA 5B7NA 1UFVA 4RD0A 4DZTA 5F73A 4OFBA 5KJ6A 4J49A 2G9RA 1EI9A 1EFLA 2IH2A 1IEXA 1O94D 3P4UA 1DIAA 1RDFA 3JQCA 4LOAA 4X8LA 2CHUA 4LDQA 1GA1A 4MGHA 1JDSA 1V2HE 1QFJA 1CNMA 5LQMA 4AURA 1HWYA 1R4MA 1T29A 3R3VA 4QNMA 3HDJA 5GGYA 2O2HA 2X14A 3PTAA 1AY0A 1FQJA 1HQCA 3E5MA 1M5UA 1RRFA 4FHCA 3ITDA 4MPJA 3VI4B 1KFKB 2VRBA 1OFUA 3N1UA 2H16A 3DH0A 4BMOB 2G28A 2BWJA 3BCUA 3D5QA 1NIJA 4WERA 4D80A 2HFKA 2WP8J 5LA6A 1MT3A 1N6RA 3OCYA 4A2WA 4DMUB 4E5PA 2XR1A 3P4YA 4JFAA 4Y6OA 4DMKA 3QOXA 1VCNA 4ND1A 2HNKA 1YVDA 2H2FA 3GJ4A 3HI4A 5K0NA 2WFAA 3A1UA 3UJ3X 3WNQA 4CYMA 3OZWA 4YJFA 4ZGWA 3DZBA 2Z3VA 3UAVA 4MDEA 2IW1A 5KB3A 2YIMA 3CY6A 1G5RA 3BHIA 2VDWB 1A5AB 1ESZA 1YS2X 2KBFA 5KVSA 2Q6VA 2DFKB 3L6DA 3LL4A 4XB1A 5AW4A 1Z83A 3CM0A 1GSAA 3Q12A 2OXEA 4KX5A 1ZHHA 4LK2A 5EKTA 1R00A 1KOJA 3RJZA 4H3HB 1GVNB 4QXQA 5FOVA 5GTDA 1Z8FA 3CLUC 2YWCA 3O8CA 1R6XA 2BOVA 2CFCA 3JQQA 1YDWA 4ID3A 5JXGA 4LY6A 4LRXA 4QBIA 3DZDA 2E49A 3GVPA 1J1UA 2OM2A 4WZAB 4BQRA 1J8FA 3OE4A 2C2BA 1CUFA 1C7IA 4S1PA 3INRA 4Z2AA 1CB7A 4DR7B 1NW9B 1LRJA 1YT5A 2QMEA 3UK2A 4EY8A 2W2MA 2WSIA 3Q3JB 3DDUA 4M87A 2G08A 4JVNA 3DE3X 2EBUA 2WVHA 1ZJJA 2RK6A 2BFEB 4M21A 3EVEA 5K20A 2XOEA 4UD6A 3GHYA 5IJ9B 3WGYA 2OHOA 2ZI4A 3MNFA 4JC5A 1IVNA 2OFOA 4HDKA 2NZVG 5T3YA 2JFHA 3NEPX 5ALDA 2V8BA 3S68A 3UBMA 1XRQA 5AQEA 3GRCA 3A1TA 3LO8A 5EY5B 1SKQA 3L02A 3HDTA 4WUVA 3IKTA 2MYUA 4M8SA 2FZCA 3I8XA 4XQ9A 3H19A 2PSFA 1ORRA 3MINB 2OHGA 4IHJA 4U7TB 1WNFA 2DEUA 4J1TC 2A0XA 4MWOA 1H2XA 3W8FA 1LXCA 3CVJA 3L0CA 4MVJP 3BQMB 1ESDA 5B7GA 2QN9A 3GV0A 4GRDA 4C4OA 4WCFC 1LEHA 2VQ3A 4OP2A 1DCTA 4JOCA 4TMVA 1PCXA 3TUJC 4C7BA 2Y0CA 3JPYA 4R9RA 5LM3A 3DLPX 1XTIA 1M6WA 2LVBA 4FZJA 2FGJA 3QTBA 3DB1A 3OCWA 3QELA 1ZG3A 1S5PA 3ED5A 3OEED 2YHIB 3TRDA 1WB5A 2X0IA 4F8EA 3EFHA 3EGWA 4OKSA 2PHZA 4ISBA 2F2TA 2DRIA 1L3IA 1HC7A 3K4HA 1NVMB 4HNSA 4OLFA 3K0CA 1O95C 3KT0A 2J5XA 1U0HC 4FMDB 4FYVA 4Q48A 1E3TA 4MRMB 1DRUA 1ORWA 2WKWA 4ZXPA 4C6HA 5A0TA 3NLLA 1Q83A 1BYUA 1V1MA 3U80A 1AVTA 2CCJA 2W6NA 5HQJA 4F5EA 3SZ3A 2WU0A 3JZAA 1SMKA 4LOKA 2NO0A 2W43A 4HZUA 1PLJA 2Q5JA 2WE7A 4XA8A 4FDVA 2CJXA 5TB5A 1W6RA 4UTVA 3G7NA 3H0EA 3SSAA 2VQFB 2WIJA 4RPJA 4B3SB 1LX6A 3GBSA 1A5ZA 3BRWA 4AY5A 1IXKA 3V1TC 2A0KA 2IXFA 3IAS6 3PTZA 3X1KA 5JQWA 1JI3A 1SU8A 5DEOA 5E6SA 1BCSB 3PENA 5T67A 3DBHB 1QHGA 2ZRGA 5LMZA 3UOGA 1BXGB 1V0JA 5EJIA 3TLBA 4KBYA 4WY5A 4KWEA 5I7UA 3GT7A 4LKRA 5JJKA 2RAUA 1PN3A 1VHJA 2Q4BA 2QTBA 4MDYA 1A1SA 3OZ7A 3UO8B 1XQ1A 2GO7A 3WTBA 1P8JA 3FPCA 2JCBA 5AVKA 2RGYA 3GMIA 1C9NA 2H52A 3RAJA 5KTYA 4ZOQI 1P4GA 3I4FA 3KTAB 4L0QA 1XPJA 1J90A 2IHVA 1BS9A 2NM0A 2OCXA 2ON6A 1GSHA 1NXQA 1UK8A 2ZSHA 2ZBDA 3IUSA 4JBYA 5EIWA 1L7VC 2V9CA 2GZAA 3ASVA 4ALJA 4F4JA 4ZZIA 3UAXA 5CB6A 1C7QA 4W5WA 5DK6A 3B9BA 2RBGA 4DNPA 1JDBB 1PGQA 2XDQB 3H1TA 4C05A 4C7XA 3DBHA 4PYIA 3OPYA 5DI3B 3LRPA 1GFSA 3CE6A 1SZDA 1L7AA 4L22A 1RZRD 1HYGA 1IZYA 4D46A 1N8NA 4J91A 1ORTA 4IQ0A 4D9KA 4QUEA 3ZY5A 3JPWA 4L9RA 3VBEA 5H83A 3EN0A 1Y6FA 4K2HA 2YV1A 3GLIA 1IY9A 4GPIB 2R60A 4CEHB 3U7IA 1S4QA 2TMGA 2FW0A 1O97C 2C31A 4ZI7A 2JLXA 2XAUA 3JTEA 5AHWA 5IYZA 2MSKA 3ONDA 5H3HA 4HO1X 5BQ3A 3HUFA 3LHSA 4HUJA 2FN7A 3KQSA 2ZITA 1AXEA 3KS9A 1QHSA 2B0CA 4P58A 3LBIA 2A94A 2H4XA 2QRZA 2PKQP 1UK7A 3AJAA 3HVUA 4WN9B 4YV0A 4YNBA 4RQUA 1S2NA 4PNHA 1U1FA 2O07A 3A8TA 2C0QA 2I0FA 2J6IA 1FTNA 2JRLA 1PSWA 1YJQA 1FDVA 3PC8A 1H93A 1H23A 2FZ5A 2VPWA 3CV3A 1RAHA 1M10A 1K88A 1SVKA 2JFPA 4HYQA 4RZ3A 4HN2A 5JH7A 3G0HA 4QXRA 3BL8A 1HLGA 3ELDA 3H4TA 3N59A 5HFAA 1RWXA 2QVCA 3E1GA 3EAFA 4ODIA 3TE7A 3CSDA 4RTKA 5AOBA 1WB6A 3VQTA 5JVDF 5FPHA 1JA9A 4OB8A 5DIFA 2P41A 1TEVA 4DLSA 5IDXA 3WRYA 1TCVA 4GNKA 1JIJA 3SG0A 4KMRA 5C2JB 4OM8A 1VHLA 2Q1UA 4C3UA 4K5QA 4A6PA 3CU5A 3QG1A 3JQ8B 3BXZA 4LJSA 3H1FA 4RUKA 1TPYA 3V9PA 2FSPA 1Q2UA 2E2WA 5H70A 4E3ZA 5H8WA 4KIWA 1PT8A 4L3VA 2BI4A 3PS9A 3C48A 1R4NB 5CNIA 1OZFA 3AERA 3O4IA 4W6ZA 1B0ZA 4JJ8A 4ESHA 4DDWA 3SQWA 3V3TA 1K68A 4D74A 3KXPA 2WAYA 4N0DA 1X9IA 3B78A 3KJGA 3G88A 3A4NA 4FUTA 4BB9A 3AUYA 2WD9A 4J4TA 4BHTA 1QG4A 3GPCA 3GH1A 2Q50A 5LDDC 3N9IA 1NR7A 3OT5A 4RPKA 5BNZA 3F2VA 3LIIA 3NHFA 5DOZA 2C4UA 4IF6A 2BBOA 1ZK4A 2CUZA 4BNTA 2WP0A 2QMUA 3EVNA 2QR3A 3H9BA 5LQDA 2C9OA 2CXNA 5K05A 1GNVA 3UFBA 1ZHOA 1RJ9B 3Q85A 3B7WA 1XNQB 2VNAA 5IWCA 2HU8A 2B6HA 1T2UA 4RC9A 3E3NA 1ZINA 3AWIA 4PGGA 5IT5A 3ZJ5A 3ZWYA 3LC1O 1KAOA 2WWTA 1KFEB 3BDIA 3BJRA 4EH1A 2ZI9A 2FG6C 1KBQA 2CCGA 3THOA 4D81A 2W37A 1M2WA 4X94A 3K70D 1K4YA 5EJMA 2Z2YA 4BO5A 2CT8A 1TZKA 5BV8A 1ID1A 4J1QA 1HTWA 3LT2A 3V4OA 4UNIA 4W5NA 1WF3A 2IDZA 3INTA 2YZMA 3TDKA 4EYEA 2X9LA 4R1NA 2XUDA 2DERA 4PGAA 3ZCVA 2BONA 4FSDA 4KO4S 2P7HA 4MUNA 3KSAC 4NHEA 3BA6A 1M6HA 4O4HF 4JGIA 3RIMA 4PS0A 2XE6A 2D7CA 4URZR 1NLMA 1EH5A 3W9YA 4F4DA 4NDZA 1D2GA 1JZSA 2IGBA 4L8WB 1OREA 2O8CA 1E0JA 2XGOA 4OHOA 4X84A 4RTPA 1ZN2A 1YZYA 2P9JA 3D81A 5G2OA 1GPH1 2RIRA 4EJFA 1C2TA 4XJVA 4HEHA 3ER8A 2H18A 1CBUA 3D9QX 3OQJA 4NCAA 2GM3A 1I0LA 2YV5A 1SURA 2ZDHA 4BO6A 2WYHA 5IDWA 5ITVA 3MZ0A 1EVIA 2W6MA 5K0BA 1TF7A 4MW6A 3QWIA 1DCMA 3FYCA 4K28A 4G9EA 2R25B 2BY4A 2DFPA 3FBTA 3BRQA 3IIKA 1OXUA 3FOBA 4RVHA 4ITRC 1K8ZB 4NU8X 2V65A 3OPYB 1OWLA 3QH4A 4H35A 5AUPB 3QU7A 5T57A 2B30A 3VNSA 3NCTA 4UEOA 1ESNA 3GT0A 2BI7A 2EGGA 1C9JA 4Q6WA 7ADHA 2O8CB 5HUQA 5BVGB 3OJOA 1DVRA 1CNEA 2JAUA 4CM9D 2BBTA 4DMRA 1OXMA 3GQVA 5CYFA 1AIPA 3NBFA 5E6UA 1O94A 4U2DA 3U0BA 1YFZA 4AG3A 4EPVA 1A50B 1T9ZA 4B74A 3IILA 3NETA 2WHYA 1G7TA 1AZSC 2H29A 3DT6A 3HFGA 5TLSA 1E2LA 2Z1NA 4C14A 1TAHA 9GPBA 4A8TA 5EXDA 4L28A 1QF7A 3GGDA 4OMFG 4P4LA 5KKCA 4NJMB 1ML3A 1Y80A 5IN4