4CVNA

Structure of the fap7-rps14 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
GMLIAITGTPGVGKTTIAKLLAEKLGYEYVNLRDFALEKGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHLSHLMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENVIEVDTTNKTPEEIVEEIIGLIKSGVKRRVGIVDWSEVYDEIIPYLRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
total genus 68
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4cvnA00
3SEAA 3WXMA 2HV8A 1OXVA 1QRAA 3KXKA 5AR1A 4PHHA 4LJ4A 2REXB 4Q1AA 2QPAA 2JLYA 1VPLA 1M34E 2C2HA 3LVQE 1IY0A 4HAUA 4C7OA 3B5JA 2DPXA 1EFUA 1WMSA 2FF7A 1TF5A 3SYNA 1XEXB 3VKWA 1XTRA 4PC6A 3QEOA 3KQNA 4F4CA 1D8TA 3AF4A 4WA7A 1FP6A 1EXMA 2IS2A 4A82A 4M1TA 5DH9A 1NN3A 3RYTC 1NN0A 4C0QC 4EJSC 4LYJA 1N6RA 1FQJA 4R2IA 2O8EB 1JNYA 4BFXA 1P2UA 1KI8A 2B8TA 4YC7A 1U99A 2CEAA 3DVLA 4BQSA 1DELA 2H7VA 4B44A 3A8TA 3LBIA 5GJBA 3Q3JB 4RFSB 2BWJA 1K5DA 3N70A 2YOHA 2QP9X 1W1WA 3PENA 4KSCA 4Q7JB 2WMOB 3BBPA 1NKSA 3X1XA 4Q66C 4A1FA 2V1XA 3ZD7A 4TLEA 1D2MA 4FMDF 4B33A 2NO0A 1IJEA 4Q1CA 4GZLA 3T5GA 2C78A 3W6OA 1DAMA 1HV8A 4S2EA 5EE0A 2D7DA 4NYMR 4PO9A 1NNEA 2JCSA 2RGXA 5FUVA 4Q4JA 1GVNB 2GJSA 3RVBA 4MDFA 3FKQA 2P65A 2QE7A 1D9ZA 3VR6A 2G0TA 4A2WA 2HXSA 1QHSA 1FFHA 1KO5A 4KLNA 4LC0A 4M53A 2QAGC 3MCAA 4AKIA 1NLFA 3B1YA 3B78A 5AJXA 5AUOB 5KSZA 1C1YA 1YU9A 3VR2A 4JVMA 2DB3A 4CEJA 2WPDD 2ZVPX 4C0BA 2JJ8A 5LB4A 4TQAA 4LJAA 3IEVA 3B2EA 2LCFA 3O8BA 2V4ZA 3CR7A 1MR3F 1T91A 2YYZA 3PUWA 3AGPA 2FJUA 2HLDD 4Q21A 1DAFA 3KFXA 3M6AA 5AWFC 2OE2A 2QT1A 1G7TA 1Z6TA 3RS0A 1F2TA 2E9SA 1SVWA 4URYR 1DS6A 4LHZA 3L2OB 3VNUA 1E6CA 1M7GA 2ZRJA 2E1RA 3GJ7A 2O8CA 3GFPA 3JVUA 3QKSB 3TQCA 3KKNA 2RAPA 4NYIR 3UXMA 4ARZA 2ZRLA 1GRRA 2Q9BA 1SVLA 3QKRB 1L7VC 2R65A 5DE3A 4BLRA 4AKHA 2IS6A 2ZXUA 4CGZA 4I1VA 1JPJA 1PLJA 5DHFA 3DEFA 1TUEA 5HR5A 2FPKA 1NVXQ 1VMAA 5KYKA 1DG3A 1TEVA 4EPXA 5JWOA 3C7KA 3CONA 4NL4H 4FCWA 3OIUA 3AVWA 2F43B 2OCBA 2VP4A 3CRQA 4LDJA 3THOA 3KQUA 3U60B 4MKFA 4EFMA 1GRNA 5J40A 1OSNA 3ZZTA 1EFCA 1G5TA 4D0LB 3UK6A 4NZYA 2P6RA 3I73A 1SXJD 3UANA 2H8KA 1QG2A 2CNWA 2PEYA 4CEHB 4NH0A 1CR4A 3QXJA 5CIWA 3NIBA 4ZDKA 1T0JB 2H1LA 4R7ZA 4I1UA 2IBMA 4IOJA 3TKLA 1L2TA 1GP2A 5AUPB 2ZM5A 2C96A 1R0ZA 1ZM2A 5SZJA 2EYUA 4F91B 4MITA 2QT0A 3RS4A 3WYAA 3QENA 4XSHA 5BYJA 1M7BA 4FMCB 2D06A 3EA5A 3BXZA 3PEUA 4M1WA 4WZBE 1LY1A 1VHLA 4PHFA 3ADBA 5F9HA 1BYUA 4RD4A 2IYXA 2OILA 1RPZA 4Q18A 1VG0B 2VSXA 5FPHA 5DI3A 1KI3A 3U7EB 4RJLA 1BYIA 2JAQA 2OV2A 2QTHA 1OT3A 4LJ6A 2YV5A 1GL7A 1XEWX 3CPEA 3CO5A 1VIYA 3LNCA 4A92A 2AL7A 3V4FA 1P72A 3T34A 3TUIC 1SVIA 2VP0A 3GFTA 2GILA 1VDZA 1Z0JA 4HDQB 1G3RA 5DNYB 4TLDA 3SDZA 3AF0A 3CH5A 4DDTA 1YRBA 5JLJA 1W5TA 4D4JA 4JLOA 521PA 2QROA 3FHCB 1E2LA 2ERXA 2HDNB 5L3SA 4GDFA 4GPTA 3VKHA 1XCGB 4D81A 4FD2A 1VG1A 4TMXA 4TTRA 1CJVC 3VR4A 4F93B 2CBZA 1S2MA 4IHQA 4Q03A 2Q21A 2HJGA 3A58B 2QORA 2ZYWX 3B60A 4TYWA 3GEEA 4TT3D 2GEDA 2EYQA 2DHRA 3E1SA 3NG1A 5G3ZA 1DARA 3UPUA 1XTQA 3OIWA 2PJZA 4FCTA 4LJYA 5SZIA 5TVKA 3VQTA 2XX3A 1CF4A 3TSOA 1X1RA 1FL9A 4JYCA 1XMJA 1XU4A 2QPOA 3JVVA 2CHQA 2HLDA 1CR1A 1ZBDA 3FMPB 3P4XA 1ZUNB 1XD9A 5BYKA 2RH5A 2O8FB 2J7PA 5EZ5A 1XDBA 1LNZA 3L82B 3BB3A 4JMPA 5A0FA 3TUZC 4FWTA 5FPTA 3AKYA 3TQFA 1N6HA 2DWQA 1QVAA 4LHYA 2GTPA 3RS3A 1E1QA 1KDPA 1U8YA 4NP6A 3TW8B 4DZZA 4A36A 2RHMA 3EPKA 5TB5A 1B23P 1LB1B 1TQDA 3LQRA 4JLDA 4WAUA 3CWZA 1SULA 1MO4A 2I3BA 4Q1DA 2QP4A 1KK2A 1IXSB 1DO0A 3QE0A 1I2DA 4V0MA 4KAXA 1E2KA 2ANBA 4IXNA 4PC3A 3KQKA 1KAGA 2KJQA 3TAHA 3MWLA 3RRNA 1SQ5A 4EPVA 3IUYA 4OK5A 3T12A 2AK3A 4ILEA 4QNMA 3PQCA 4KVGA 3K0FA 4F4JA 2O8DA 5HPYB 1E2EA 4M2LA 2J41A 1G5PA 2ZS7A 3P4YA 4G3XA 3FOZA 2ZE7A 3KB2A 4XSGA 1DVRA 2QMUA 1R0XA 2H92A 4OI1A 2ZTSA 4W5WA 1WP9A 2J1LA 4AK9A 1G4AE 4DDWA 3SQWA 4NMMA 2GCOB 2QAJA 1EFRD 2FSHA 4B71A 2IWRA 1RRFA 4AKGA 1Z0FA 3SZRA 1CJUC 4P3YA 2WJVA 3CF6R 3UWKA 3B6EA 3ADDA 4IRUB 1P2SA 2ZETA 4DB2A 3QOFA 1CS4C 4A8JC 2MMGA 4QJ3A 3ASYA 3U4QA 1SKYE 2ORWA 1M2OB 4PZLA 1XMIA 3QG5A 4HAYA 4P0TA 3AQ4A 3I5YA 2XJ9A 1KK1A 2IUUA 4ZDJA 1H8ED 1LVGA 4RFSA 4IOMA 3LQQA 2ZRKA 1U94A 3SJZA 4DLWA 2OBNA 5LD2B 1QDEA 4IDHA 4C0JA 4EFNA 1DO2A 1ZW6A 3E70C 5B58C 4P32A 1N2CE 1SHZA 2VYFA 4EQ6A 2VRWA 1OHHA 3QSYA 1ZC3A 4OK6A 5AK0A 3QNUA 4FMDB 4V02A 4BPBA 2C99A 1X8LA 4DLUA 2X1VA 4QBFA 5CB6A 1ZYUA 4FXPA 4TQUS 2PCLA 2CJWA 4RD2A 2A5JA 4B3XA 3FYHA 4OQLA 4LCBA 4V03A 1KJZA 3FWYA 1UF9A 4B48A 3NH6A 3K9HA 4L15A 2GJKA 3B8HA 2BM0A 1AS2A 4UNNA 2ERYA 4CEIA 2JLVA 4KJZA 2A9KA 3AVVA 3LY5A 1QBKC 3CB4A 1A7JA 5E7JA 2O0KA 3EW9A 3MWJA 2IEYA 3ZQ6A 1KMQA 1FTNA 2G77B 1BKDR 4PANA 2VHJA 4JKYA 4DIDA 1KI6B 2OESA 5AJYA 4OJKA 1QF9A 2VEDA 3GEHA 5TARA 2XTMA 2WJIA 3B1ZA 3DMNA 1JXOA 4D25A 3K0AB 1MH1A 4OHWA 4LV6A 1S1MA 2DWPA 2XB2A 2GJAA 1GNQA 3BS4A 2OUKA 2QGNA 4MGYR 2C9OA 4YXWA 1LW7A 4L8GA 3U2QA 2QTFA 5EXPA 4MH0R 1HY3A 3LO5A 3OIYA 5B2ZA 5J4HA 2VHTA 3W34A 1ZP6A 1YZUA 2WOJA 4A2QA 3T06B 1ZINA 3DOEA 3EZ9A 3K0EA 4XWAA 2HT1A 1UEJA 2LKDA 4D4MA 4A0FA 4OI4A 4EJSB 1BO6A 4MRRA 4URXR 2XNSA 1ZMXA 2FZ4A 3HJNA 3I92A 5G40A 1X1SA 2P3SA 2F55A 3PUVA 1CIPA 2OO7A 4TL8A 2QBYB 2EWVA 4OL0A 2GXQA 2W6JD 2XXAA 2E87A 1X8KA 5AJWA 3L0OA 3U3RA 2ZRAA 1GAJA 2N1BA 1OH5A 4OJQA 3K09A 3OEED 3BJIC 4PC7A 1Q0UA 4DRZA 3QY0A 2C98A 2IS1A 4HLUA 5ELXA 4HYYA 2PH1A 4G5QA 2GXAA 1DOAA 2BOVA 2B21A 3EZFA 4M0LA 1AS3A 1ZNYA 2ZSAA 3VHXA 4YDHB 1KDRA 2C03A 3CF0A 1DTSA 3CPHA 2VH5R 2ZI9A 1J70A 3F5FA 3K9LA 4PR0A 2FNAA 2CXXA 5JWHA 1CJTC 1G19A 3C8UA 3RLFA 4D26A 3X1ZA 4IFBA 2QAGB 4GMDA 4JBYA 4LYHA 5JJKA 1J90A 3UG6A 4E03A 1PUJA 2AD1A 1UDWA 1G18A 1Z6YA 3SYLA 4YMVA 1X6VA 4HI0E 4BASA 1Z2AA 2ZI5A 5JZVA 1CKEA 1GDDA 1YR6A 3KX2A 2VF7A 2ZYUX 2BV3A 4PAOA 4EAQA 1ZJ6A 4CEJB 2ZI6A 3NBFA 1E0JA 1TU4A 4C4PA 2IYWA 2ZR9A 1W0KD 2FV8A 1XEFA 3BC1A 1UKVY 3OFND 4FINA 4W5HA 1EX7A 1BMFA 1E96A 3GFOA 1RRCA 2GK6A 1SKQA 1Z08A 1ZNZA 1WDTA 1TF7A 2BIFA 4HB2A 1FMLA 1KO7A 3NWJA 4HLDA 1CR2A 1W4RA 1OXSC 2B8WA 2WWYA 4N0DA 3Q7PA 2P67A 1JXMA 2HCBA 2F1IA 2ZREA 3EWSA 1VCOA 1R0YA 4QBHA 2NO9A 3QXCA 1IN6A 2O8CB 2GK7A 5FFMA 1G17A 4D0NA 5UKDA 3OAAD 3OEHD 2JLWA 5IT5A 1ZUHA 2GXUA 3MRSA 4ARZB 2WSSD 4OBEA 1CU1A 2CCJA 1AS0A 1AA9A 2GNOA 2F3RA 4G01B 1NJFA 3PEWA 3TH5A 5D3MB 5BQ5A 3KXLA 1RKBA 1NIPA 1YHNA 2RGGA 4WVFA 4LJ7A 4OHVA 3A1WA 1ZM9A 2W0MA 4IXMA 3PV0A 3TSZA 3LXRA 2GAAA 2ORIA 1JJVA 2JATA 1N6OA 4A4DA 1HE1C 2JJ2A 4I1SA 4ACAA 1P75A 4C0LA 3ZYCA 3L43A 1AGRA 2KSQA 4JVNA 2V6JA 1E2FA 1NJGA 2D62A 3PXGA 3GD7A 3SQXA 2YWEA 5KU1A 3I8SA 2VP6A 1GUAA 1G3QA 1KI7A 4FMCF 4Q7MB 2ONJA 1CTQA 4YLGA 5LBIA 1DEKA 4Q4AB 2W83A 5FR2A 3TK1A 2CHGA 3I5XA 4B2PA 5G53C 5L3RA 2CHVA 2A5GA 3SJBA 2XTNA 4NU0A 3DOFA 1QHNA 3HPRA 1KKMA 3QBVA 3ZVNA 1G1MA 3NHBA 2WAXA 5DN6A 5DI3B 2G0NA 1XTKA 2IK8A 2RGNA 1LS1A 3SHFA 2GCOA 3X1YA 5IF9A 4A0GA 2G1KA 3SU8A 1KI9A 5FTKA 1F48A 1KJYA 2BMFA 2RGNC 1G6HA 2NTYC 4KHZA 4KFRA 1KDOA 4M9SA 2JIZA 3HYTA 1EFTA 4IEIA 3T61A 1Z47A 3EAQA 4EPYA 4MQBA 4RZXA 3EG5A 4QG7A 3IBYA 3V00A 2RGDA 4P4SA 2UKDA 1OPXA 2DFTA 2FPLA 2QM8A 3ZH9B 4DLZA 4B6EA 1JQJC 5KSOA 1XJCA 2Q9AA 5DYIA 2W00A 1U8AA 3L0IB 2Q6TA 5F2EA 5SZKB 1DAGA 3QUSA 1JALA 3ECCA 4DCSA 1II0A 3THWA 1KHTA 3C4JA 5CB8A 3EIHA 1BH2A 3A4LA 2QE7D 4A9AA 1W2HA 3TGPA 1JR3A 1G7SA 3TR5A 3EPJA 1J8YF 4CDGA 1K6MA 6Q21A 4HLQB 3W3ZB 4Q47A 5JMTA 1EGAA 3G5UA 1R0WA 4MYHA 1I4TD 2GKSA 1ZM7A 4KLZA 4C9BA 5IDVA 4RD0A 2EFHB 3AP1A 3IEUA 3LW7A 5IK2A 1Q3TA 3D31A 1AM4D 3ZJYA 1MRSA 4UJ3A 5C2JB 2BM1A 1WQ1R 2KI5A 3V9PA 1GITA 4KBFA 1XXHE 4UXHA 3SOPA 2JLZA 2C9CA 1P3JA 4CZ2A 3GJ3A 3W6PA 4Q5IA 1N5LA 1Z28A 4HUTA 1S8FA 3Q72A 2QN6A 1Z6XA 1XXHB 2J59A 3BH7A 3K70C 3I1FA 2HXYA 2ZYTX 1TQ4A 4OQXA 1KK0A 4V0ME 2BJWA 3VX3A 4UJ5A 1BIFA 3EPHA 1JAIA 2BJVA 2VPPA 1WCV1 3Q7QA 3RC8A 1T8TA 3WRYC 5L3VA 3EASA 1UEIA 3IILA 4YDSA 1G8HA 4LBVA 1KI4A 2AXNA 3GLHA 3K0AA 3QF7A 2R62A 4GOJA 4IW3B 1P9RA 2OCYC 2F7SA 4JLPA 1T3SA 3FPAA 5FH9A 2BBSA 3K0FB 3T1OA 4C30A 2DFNA 1Y63A 4TLCA 3K0CC 4JT4A 5J4YA 2XOKA 3IHLA 4PO8A 1P73A 1YQTA 4URWR 3N2EA 4JLVA 1HA3A 1Q3HA 1OW3B 4JLNA 3VR1A 1Z63A 3FDIA 4QBGB 2FWRA 1JBKA 2CNWD 2ZR0A 4LRWA 3BK7A 1E2HA 3B1WA 4EJSA 1FW6A 4DLRA 1AKEA 3TR0A 4YMSA 1KZ7B 3KQLA 2F9MA 2UZ3A 2GXSA 4DB4A 2QBYA 5EZ6B 4YMUA 3U4QB 5CJPA 2J0VA 2ZEJA 3KJHA 221PA 3N5CA 3LBHA 1ZD1A 1W4CA 2ZJ2A 1CULC 5J4KA 4JKIA 2BEKA 2Y8EA 1P60A 1FTSA 4LSGA 4Q01A 5BW8A 1P62B 4B76A 1SVMA 2WJGA 1SVKA 2BDTA 3C41J 4Q4LA 3UMFA 2I4IA 4PPNA 4HSEA 1VCMA 4Q1FA 4AC9A 4MYTA 2BMEA 3R9WA 1NF3A 1PJRA 3BFXA 2BBWA 4C0SA 1PVOA 1NN5A 4DCTA 4HZUB 5KNDA 1IQPA 1X3SA 4IKEA 1VCIA 4EQ6B 1IXZA 2G83A 3PUYA 1E94E 2FEMA 1AJEA 3ZQJA 2ZROA 3IKJA 4JL8A 1YR7A 1Q20A 5C4MA 4V0OA 1MKYA 2AWNA 2GZHA 2YVUA 3B82A 5JHHB 3BOSA 2QAGA 4GL2A 5EUMA 2R6DA 2CJWB 1KI2A 4A0HA 1AQUA 4UQOA 3QI2A 1VG8A 2VP5A 3A1SA 1KSHA 4X8OA 2QQ0A 3CNNA 5FPSA 4L16A 4AYTA 4URVR 4XVUA 4O0MA 2ZAOA 3AVPA 3EC1A 2ATVA 4CEIB 1ZNWA 3LDAA 4L5BA 3UIEA 4NHOA 1G16A 2YZ2A 1UKZA 2VQSA 1W36C 2QMEA 3QEJA 2GJ9A 2ZRIA 3PITA 3ZIAA 2XEXA 3MJRA 4B3DA 4E22A 2XGJA 1G8PA 1RVDA 5KO2A 4PAQA 3SC3A 1RE0A 2OM2A 4OHZA 1Z3IX 1FNMA 1VYUA 2PL3A 2WJYA 1F60A 121PA 4U5XA 2QSYA 3ICQB 5FTNA 3RSLA 2J7PD 2EFCB 3EA0A 3IDQA 4DDUA 3MG9A 1TQ2A 2J9RA 2ZJYA 4PHGA 1G41A 2QP3A 4JBXA 1R7RA 2RB4A 1E1QD 1GWNA 1DAEA 3TAUA 1UM8A 2AFIE 2NGRA 4XH9B 3HU1A 1CJMA 5D3MA 1TPZA 2CCGA 721PA 1P9WA 2VP9A 3FGNA 4P4TA 3A4MA 3B9QA 4UNSA 3SBDA 4BLTA 3GLIA 4KYIB 2QTVB 4W7SA 2FSGA 2K5UA 4JL5A 4M8NE 4R2HA 4A2PA 2MSCB 2GRJA 2X2FA 1GNPA 1J99A 1Q1EA 2WOOA 4ESVA 2BHRA 2LWIA 3RWMB 1KY2A 3IPXA 3I72A 1E98A 5CM9C 3DZDA 4A0RA 2XXAB 2IXFA 5EE5B 5C46F 4R98A 3E2IA 3QPVA 3U6BA 3LX5A 3FFBA 4HAWA 5HCIA 4DEYA 3HPQA 3QXXA 5L3QB 4EPRA 4Q4AA 4HAXA 3CNOA 1VECA 4JJKA 4RY2A 2AKAB 4LJ8A 4LWZA 3LA6A 4M1OA 4H9GA 2CCKA 4ZIRA 2ODNA 4QKQA 3EZ6A 2WJHA 2WWIA 5CYOA 4DSTA 4YMTA 2DFKB 4NCKA 2ZSBA 4HEJA 3MGCA 5KDLA 2A30A 3OIVA 3U7GA 1FQKA 3BE4A 4QM6A 2CE7A 2EFDB 2IHYA 4QFMA 2XTZA 1OXTA 2YWFA 5CLQA 1OLOA 4KYUA 2IX3A 1KSFX 1HT1E 3KDSE 4DIEA 5FTJA 1Z2CA 3MWKA 2XZOA 1XD8A 4JS0A 2D4HA 3R20A 2NIPA 2P0EA 3U3JA 1OIWA 2AK2A 3SJAA 3WMEA 2B6HA 4F92B 3GMTA 4AURA 1YZKA 3WMFA 1OHHD 2AX4A 4LHXA 2REOA 4TMKA 5CM8B 2YKGA 1EESA 4M9XA 2OLKA 1NVWQ 4GP7A 2BMJA 2IYTA 2FOLA 4G5RA 2VSFA 3OE7A 3THXA 1YRAA 1D2EA 3RWOA 3TVDA 1II9A 4G0NA 3BAFA 5J47A 1R5NA 2YWGA 1F3OA 4Q9KA 3RS5A 1NSTA 2CVHA 3T35A 1J2JA 5EJEA 4OKSA 3PUZA 1G7CA 4RZ3A 3REFA 1XZPA 1ESNA 5GADl 5JS7A 1HQCA 3TBKA 1OB2A 1GIAA 4V0LA 2ONKA 2QMOA 4BFSA 4TMWA 3LH5A 2VA8A 1XMSA 2DBYA 2HYDA 1I4LD 3PEVA 3QPUA 2AD5A 1XXHA 3WY9A 4TTPA 4DLXA 1U0JA 3KTAB 1S4QA 1FOEB 3IGFA 1UBEA 2HCJB 3IIMA 5FBVB 3NBZC 2FEOA 1IHUA 2HT6A 3I61A 2KBEA 3B1XA 4YXWD 3GJ5A 4E07A 4WZ6A 3N2IA 4LGMA 1GFIA 1ZUIA 1WF3A 2JLQA 4DSUA 1YKSA 1W5SA 3C15C 4RZUA 4GRAA 2W6IA 3QPWA 4PQFA 2QQEA 3BH6A 1W46A 4TL9A 4LOAA 5FTMA 2A2ZA 4DT1B 4QOSA 3QF4B 3ZS8A 4UXIA 2A78A 1UPTA 3U7HB 2P2LA 2RKOA 5DISB 1FNNA 1C4OA 1OXXK 3CH4B 5JHGB 5KDOA 2C5LA 4Q9JA 5CDFE 1UBCA 1E2JA 4D6PA 5BXQC 2VTKA 4UKDA 4TMTA 2G9NA 1YR9A 3JZAA 3O47A 4EKDA 3KJEA 1P6XA 4A8JA 3ZVRA 2OBLA 3CW2A 2NPIA 4Y0AA 2BVNA 2J0SA 1Z6AA 5FR1A 1AZTA 2ZUCA 2ZSFA 5BN4A 3BFKA 4Z8YA 1NLZA 3X2SA 2EFEB 2V54A 4ZCIA 4NKRA 5EP4A 1G3UA 2YJTD 1II8A 2GEVA 4P4SB 3AUYA 1BOFA 3MWYW 4DLYA 2OSBA 4XJXA 1SXJC 1GKIA 3QXSA 5EXXA 1XB2A 3TMKA 4MDEA 3LFUA 3NBXX 2O0HA 2QPTA 3PIRA 4TN1A 1RRPA 5GVRA 4DBLC 1JR3E 3RS2A 1N0WA 3F8TA 2V7QA 3THWB 1DPFA 4B75A 3VU9A 3G82C 1IXRC 3AKCA 2X2EA 2ZE8A 3NBYC 4BE7B 4K8OA 1E9FA 1XZQA 5JCPA 4HZUA 2IA5A 1A4RA 3WP0A 1XTIA 4IDQA 1NBME 2VHQA 3RAPR 4TZ6A 4I1OA 3HWSA 1FMJA 3QG1A 5J4LA 4M21A 1FZQA 3GQBA 2MMCA 1GILA 5EE1A 3ZVMA 1S96A 1BMFD 2J87A 3DO6A 2OHFA 3CRVA 4MGZR 4DCNA 4B43A 4Z1MA 2I1QA 1OE0A 1N6LA 4V0NA 2O8BB 3CLVA 2ZYVX 3I32A 1E4VA 1KJWA 1HTWA 2AHOA 2HEIA 3FHTA 3B1VA 1OXUA 5EP1A 1SGWA 3BD9A 2FDCA 3I3SR 4KI0A 4MRSA 2ZJ8A 4PHTA 3IHWA 1MO6A 4O2RA 1Z6GA 1ZD8A 3H2YA 1HEIA 4QGAA 1KSGA 4ZDIA 3CKLA 2IS4A 1X86B 3MFYA 1RZ3A 3GLHE 3D7MA 3OZXA 3X1DA 4HZIA 2PZEA 1HUQA 1Q22A 4US0R 3R8CA 4QGHA 4OHYA 4E09A 3VNVA 2O5VA 3CZPA 3GLHB 2OFOA 5SZHB 2CLSA 1IY2A 2ZS9A 3L0PA 1P2TA 5JRJA 4DSOA 1Z0AA 2H16A 2GZDA 4FIDA 1NVVQ 3KKMA 2JJ2D 4ON9A 4RD3A 3ZS9A 1Q1QA 3CNLA 3BGWA 3Q9LA 4AWXA 4TYNA 1P5ZB 2EWWA 3WHLA 1KIMA 2A5FA 2FFQA 1TNDA 2ZJ5A 3T5DA 3AF2A 4M22A 1XPUA 1MABB 2YOGA 2VP2A 2ZRMA 3R9XA 4U7DA 1XJ0A 1XPRA 1KAOA 2IW3A 1IONA 1MRNA 4OK3A 4D4KA 3Q85A 1MV5A 4MGKR 3U3KA 1LS6A 1K8RA 4G5SA 4ASUA 5E3HA 5F9FA 4LPSA 3CPJB 1JJ7A 3U61B 2MSDB 4JVSB 3HU3A 4OQFA 3AB3A 1E4YA 1KKLA 3VR5A 5DN6D 1NG1A 3GCGA 5L3QA 3T15A 2NO1A 3NC1C 4G5GA 1LV7A 3A37A 4II7A 2FFHA 4TSFA 3RRZA 1KY3A 1KO8A 1N6PA 3C16C 3HP1A 2I1VB 1T4GA 4POAA 4V0KA 4XWKA 2GJ8A 2JIZD 3CWQA 1OKKA 1G5RA 3AVYA 2WIBA 3K53A 3H84A 2EW1A 4JIMA 2ZJZA 3CRW1 621PA 2IXGA 1KDTA 5B30A 1HE8B 1F5NA 4LJ9A 4DHEA 1WXQA 3DL0A 4BFVA 3Q5EA 2VO1A 4UXJA 1P2VA 1P4SA 2QSZA 1RRGA 1DAIA 3HR8A 1CR0A 2O0JA 1R4AA 2CK3A 2EVWX 3W90A 2GETA 4CF7A 4UNPA 4B6FA 2QGZA 1DAHA 1W36B 2Z6VA 3AF3A 1XPOA 1JR3D 4LYFA 1FUKA 4PTLA 4WIAA 4N3NA 4Q19A 3AVXA 1WA5A 1OIVA 5F3WB 1NRJB 2DY1A 2WJJA 3OHMA 2NZJA 5J5CA 5JI2E 2QNRA 4HUQA 2FU5C 5DGXA 4MYUA 1RYHA 3KJIA 4NBSA 1E0KA 5AJVB 3TE6A 1YZTA 1UJ2A 2J7KA 3L8ZA 2PT5A 5JRZA 4AIIA 1XEWY 2IUTA 1UDXA 1NBMD 2BMDA 4EUNA 5IK2D 3KUDA 4CVNA 2XSZA 4RZ2A 1E2PA 3BB1A 4D4LA 3AP2A 1TTTA 4TL7A 1KTVA 1MO5A 1U8ZA 1PUIA 4B35A 2OCPA 2IHBA 3AVQA 2ZRNA 1A2BA 1FX0B 5GJCA 1XP8A 4ITRC 4TYPA 2IC5A 3X1WA 1QG4A 3GLIE 2YOFA 2ZE6A 5TMPA 3LLMA 2CDNA 3BFVA 2W2XA 4PFSA 4PC1A 5EP2A 3ND8A 4M9QA 4F4IA 3I8XA 2Z43A 4EDHA 3GLIB 2VL7A 4NDZA 5FUWA 1W0JA 4BFYA 3P1JA 4KODA 5JFGA 1ZNXA 3WP1B 1M1YE 3L0SA 3FTQA 1KNXA 2AXPA 2C8VA 4WZAE 4B74A 4LYAA 1TL7C 4RSGA 3AKDA 4MGIR 4N0EA 3KTAA 4TYQA 3O8DA 4JLAA 4L9SA 2HF9A 4IVQA 1Z06A 5J4VA 2PLFA 2XOKD 5EP3A 5GJVC 4RKEA 2OXRA 3AH8A 3PFIA 1E79A 1R8SA 5JEEA 1E9DA 1CXZA 1IN5A 1OB5A 2QM7A 3LWNA 1G8GA 3FMOB 2J46A 3HDTA 1E9SA 1R10A 2OLJA 4MUBA 4DT1A 4TYYA 1E2IA 4CT4B 1Z29A 3QF4A 1T5IA 4ZIRB 4XD7A 1OYWA 1U9IC 4S35A 5JI3E 2F6RA 3WBKA 5K8IA 4N1AA 3KKQA 3REGA 3ONWA 2PLRA 5KNCA 1XX6A 2PEZA 4F7WA 5IHPA 3AUXA 3DPUA 2X8AA 3DMDA 2IXEA 4DLSA 3ND9A 1ANKA 4ABYA 5FL7D 2D7CA 5CDFA 3FVQA 3KKOA 2FG5A 1U90A 2ZAMA 3JZMA 4OHXA 4TLBA 1N6KA 1RW4A 4E5UA 2IYYA 5TV2A 3DKPA 4QC2A 2GBLA 1TQ6A 1Z0DA 1W2GA 3R7WA 2BCGY 3T1TA 3SS8A 5FOUA 4DWJA 3LXXA 5FBRB 2GBLC 4U00A 3SR0A 3BH0A 3SN6A 1LTQA 2NPFA 4BRUA 2R8RA 1IN8A 1XD2A 4BFUA 2QMHA 4MRNA 5G3YA 1EK0A 5DI9A 1G21E 4LJ5A 2W0SA 3THXB 4RVCA 3A6PC 2OFXA 1Q1ZA 1O87A 5JWRA 1KK3A 4IVPA 1CLUA 1P9NA 4ZO4A 2CL6X 1S0UA 3WHKA 4C2TA 1ZU4A 3LAWA 3NHAA 2IYLD 4BEBA 3DDCA 1M6NA 4MYCA 1E2NA 3THYA 5E95A 1W36D 5TY0A 3BRWD 5HE9A 4DLVA 2N46A 1EFHA 1TAGA 5C1BA 3FKSA 3GJ0A 1NBMA 2ZS8A 1NMZA 4RD1A 3ZIAD 2J5XA 4LV5B 1HT2E 1T3HA 4GT1A 3WBJA 5A4JA 4DXAA 1DE0A 2O8BA 4M1KA 1E2DA 3QVVA 1OFTA 4NCHA 2Z4RA 1O3YA 3H0KA 3I4LA 5LD2C 4JJZA 4X8MA 3FHOA 1SHKA 4BLSA 4P33A 4P31A 4TWZA 5KSPA 4FN5A 1NMYA 3SNHA 4B34A 3FMFA 3L8YA 1IM2A 2JGNA 1COWA 1D5CA 3G0HA 1R8QA 2MSEB 1I4DD 1XWIA 3NDPA 4LHVA 1IJFA 2ODEA 4FCVA 2D3WA 1XNJA 4JT2A 1G4UR 1KO4A 1IOZA 2X77A 2C04A 1F2UB 4URZR 4XIGS 1FP7A 1XTJA 4PX9A 4F38A 1GKYA 3K0CA 3MMPA 5FUXA 1MT0A 1K5GA 4PAMA 4X8LA 3B13B 2NG1A 2OBMA 4C0AC 4JSTA 2HYIC 4FW9A 1E99A 1IBRA 3NEJA 5BN3A 3EPLA 2H5EA 4C2UA 2ZJOA 2FSFA 3RRMA 1U2RA 2KB0A 3GEIA 1MABA 4DUGD 4NCNA 1QHHA 1OH6A 2AKYA 2EU8A 1IN7A 2D2EA 3A4NA 4A8JB 2FN4A 1OIXA 1LF5A 4ZDWA 1YZGA 5K8LA 2SHKA 1QHGA 5DO9A 2Z5FA 1FPMA 2IF0A 1H8HA 1TU3A 3ZZ0A 1VYVA 1NY5A 4H1UA 1OFHA 1Z0KA 2G1JA 1SXJB 4BUJA 3K9NA 1II8B 2Z0MA 3MAAC 4ZPXA 5G41A 2F1JA 2ZRBA 4W5JA 5AJZA 1E1RA 4IEEA 5A5GA 2HJVA 1S3GA 1ESMA 5JSZA 1NIJA 3SI7A 5FL7A 4QHSA 1JEEA 4IFEA 1Q57A 3RABA 4QM7A 5JJIA 4PZYA 3O8CA 2W2TA 3VU9B 1BS1A 2KWIA 3B7GA 4KFTA 1MOZA 1Z0IA 2R44A 3PR1A 1E2MA 3K9GA 1G3IA 2ZI4A 3Q5DA 1YVDA 5FOVA 3UMSA 1YZLA 1JR6A 1G20E 3CR8A 3T1VA 1ZCBA 3WMGA 1VKJA 2J0QA 3TJZA 1G7RA 1WBDA 3VKGA 4LBWA 1P61B 4BFTA 4EFLA 2JDID 4ERNA 2RGAA 4PSVA 1RC8A 2OZEA 2FA9A 2WBLC 3J81k 5KPDA 5HKKA 5P21A 3GJ4A 4BRWA 1E9CA 4KXFB 2VBCA 4UNQA 5FUYA 3OE7D 4MKIA 1SVOA 4KSBA 2WKRA 2FMXA 3QKUA 4M1SA 3U7FB 1W47A 3BB4A 3W5IA 5EQTA 1IN4A 2CL0X 4EPWA 1GSIA 2PT7A 3NEYA 2VLIA 4ZI2A 4LC1A 2ODBA 1JECA 3WNDA 5KNBA 2R6CA 3H1TA 2G6BA 2JJ1A 2DFLA 4QNRA 1W48A 3SHWA 2IYVA 2RGBA 1GTVA 2OFWA 2IWHA 1R2QA 5FOSA 2ZE5A 3HU2A 3W8NA 1OH8A 4D82A 1E0SA 1H65A 2FZLA 2WKPA 2FPMA 3MSXA 4UNRA 2H57A 4PXAA 3BORA 2WWWA 3ZDQA 1NG9A 3CBQA 3VAAA 1WB9A 1GKUB 1LFDB 2F1HA 1HH4A 1G3MA 1XMVA 421PA 1FX0A 3ZVLA 3CM0A 1P7CA 4QHTA 4JL6A 2W58A 2WICA 2CL7X 4B47A 2IEZA 4HDCA 3C5HA 2F3TA 1GM5A 4LHWA 1KYIA 3DKVA 2ZU6A 3WNBA 2VHCA 2XNDA 1RYFA 3O8RA 3TNFA 1N0VC 4GP6A 2WKQA 2VSOA 3D8BA 1KMHA 4ZI3A 3GLFA 5DIFA 4OI0A 2CE2X 1ZRHA 4Q7KA 1TADA 2PCJA 4QBIA 1JI0A 1G6OA 2R9VA 2ZRPA 1E9RA 4G5OA 4IOKA 3ZZUA 2W6ID 1QHXA 3HR7A 5KOYA 1V43A 1EX6A 3LV8A 4ACBA 4WBSA 5FPYA 4DUGA 2GVZC 4I4LA 2NQ2C 2ZQ5A 4CYMA 2ZJBA 4QJ5A 4DSNA 1A82A 3AM1A 1D9XA 1DG1G 2WWXA 5CJ2A 1XFAA 3K1JA 1U98A 2WAYA 5KPJA 2NMVA 2ZRDA 3U44A 5F98A 1Q12A 5JS8A 2FFAA 2ZRCA 3CRMA 3MUFA 1RJ9B 1ZCAA 2CLCX 3KL4A 4H1VA 4MA4A 1E9EA 2VIIA 3PUXA 4FI3C 4DCVA 1ZVQA 2V8OA 3R9IA 4O3MA 1N6IA 2ZSEA 4WXPA 1Z83A 3SE0A 1US8A 2V55B 4EIWA 2UVQA 3PEYA 1WE2A 1PV4A 2DWOA 1QHYA 2EFGA 2QRZA 2ANCA 1OJLA 4D2IA 3KQHA 2ZITA 5FPKA 3MLEA 1OV4A 2DR3A 5KDDA 4JLKA 2QI9C 2ZRGA 4D0GA 2WMNB 3CZQA 3AVOA 1CRQA 2V7QD 4LBZA 2BKEA 1TMKA 4NYMQ 1TX4B 1ELOA 2FE4A 5CK4A 3DZ8A 3WNCA 5JECA 4XVQA 2PZFA 4KITB 4QGFA 3M4YA 2ZANA 1SVSA 1AKYA 1AQYA 3RNLA 1CEEA 2G88A 2JDIA 2JA1A 2C77A 3NH9A 3KJGA 1GZSA 4K46A 3W5JA 4OQMA 1UKYA 4HUQB 5DSZA 2D2FA 2GCPA 5JEDA 1NSFA 3NXSA 2AR7A 2JLSA 2ZIAA 4RFVA 2FH5B 1U0HC 5KTYA 1Q1BA 5M04A 3GLGA 1ONBA 1XCMA 3S1AA 4JLJA 4Z51A 4Z1MD 2Z4SA 2J0UA 4JVLA 3AVTA 2TMKA 2FFBA 4URUR 2IYZA 4DCUA 2ZJAA 1UBFA 1R5BA 3KZ1E 4I99A 1HQYE 1JPNA 1ODFA 3W3AA 5E7IA 2V1UA 1PLKA 2WWFA 4M1MA 3VHLB 1XTSA 1OF1A 4LX0A 4BFWA 3EX7C 3B9PA 4XOIA 4NCIA 2ZPTX 4C0KA 2IYQA 1MO3A 4YONB 2QY9A 1G291 4NYIQ 1JAHA 2WPDA 1JB1A 5JCZA 5C18A 1GL9B 3D3QA 4A6PA 1T5LA 3NKVA 1A2KC 2LKCA 3ZD6A 5FOTA 2WZQA 4OQNA 3RS7A 3WRXC 2WV9A 1W44A 3QXHA 4QJ4A 4BZXA 3KB1A 4B2IA 5EXTA 3QJYA 2UZIR 5FL3A 5CIQA 5HCNA 2ECKA 2BCJQ 2R6FA 4JZKA 3QBTA 4AG6A 2XAUA 1F2UA 5KUTA 5EE9A 2FGKA 4PSKA 4AD8A 4MRVA 4AYXA 1L4UA 1E2QA 3CX7A 4BGDA 2GF0A 2B7BA 3VFDA 1XJQA 2REBA 3T1QA 2CMKA 4Q4HB 2RGEA 2OG2A 1QHIA 1JQLB 3IQWA 4TMZA 4ASUD 2YNMA 4HB0A 2PZGA 4YQFA 1QZXA 1OFIA 1XF9A 4JBWA 2GESA 1NVVR 1XRJA 1R5OA 2HF8A 1D6JA 2Q3FA 5FI1B 2Q9CA 4LY6A 1GNRA 5GJWC 4KFUA 3W6NA 2QENA 3W8RA 5BN5A 3UWOA 1F6BA 4TMVA 1S1CA 1E69A 1S9HA 4TSFD 2WTUA 3LBNA 3P26A 4NTZA 1NMXA 2GA8A 4ESHA 4ZV4A 1SXJA 1Z22A 1Q44A 2GCNA 3K0SA 5JJLA 3R7WB 3ADCA 4GNKA 2IUSA 1G64A 4LBYA 1OKKD 3EWAA 2V3CC 2O52A 5DYGA 2ZRFA 3H86A 5GVSA 1VG9B 4IOLA 5B64A 5AUQA 1XD2B 1XEXA 4C3ZA 3C14C 1T8UA 2FGJA 2BBTA 4FMBB 5FBQB 4B2LA 1DADA 2Q0HA 4QRHA 1V5WA 3IQXA 2OEPA 3NC0C 2FX3A 1AK2A 2CK3D 3K8YA 3A1VA 3IBGA 1B0UA 3LD9A 5IRCD 3AVUA 2O8EA 4KBGA 4Q9LA 1W7AA 4NONA 4Q1BA 3THYB 3P32A 2R6GA 4GFDA 4Q1EA 1G9XA 1SKYB 2KE5A 3ADKA 2XZLA 4GBMA 1J7KA 1YR8A 3IPYA 1AN0A 3H4MA 4XWOA 3P20A 1NKTA 2OT3B 4HDOB 4DDVA 2F9LA 2VF8A 3BWDD 3EC2A 1E32A 1J8MF 1YE8A 4I81A 1S9DA 1Z8FA 2YC4C 4IJMA 1AGPA 4BFZA 2XSZD 4B3FX 3K70B 2GAOA 3FFAA 3UKDA 2ZSDA 2B92A 3LW8A 3OF5A 4NYJR 5CITA 4RCZA 5JBQA 4BZQA 3OESA 2A7QA 4GZMA 2QZ4A 4XVRA 2WVJA 3PJRA 3VR3A 4DC9A 1ZAKA 4DEXA 1UADA 3GP8A 1N5KA 4TT3A 1E9BA 5HZKA 2GF9A 2H17A 1CRPA 1CJKC 3NVAA 3B85A 4IVRA 1VYTA 2QL6A 3SJCA 4HATA 1E0AA 1W0JD 2ZRHA 3U3MA 3R8FA 2OCAA 2A3RA 4R71A 4BLPA 3LLUA 3IO5A 1W4BA 4MKGA 2ZUBA 4Z54A 2NO7A 3RHFA 1U81A 1HYQA 4CW7A 1T6NA 5K8TA 1NN1A 1KOFA 3C5CA 1VIAA 4LI0A 4MRPA 5E7MA 5HTKA 2P6NA 3E5HA 1ZD9A 4RD6A 2ORVA 5CYPA 4PZZA 1GL6A 1ETUA 1QHHB 3QVUA 4L4UA 3ZLJA 4AYWA 4Q02A 3DM9B 1E79D 3I62A 2Z83A 3AV0B 5FI0B 2GEUA 2FSIA 3CX6A 2R6AA 4Q9HA 3UMRA 3PG5A 3QKSA 2ZUDA 5KSYA 1OFUX 4B32A 5EXSA 1U0LA 3PCRB 2CLDX 3D6TB 4XD7D 3U5ZB 1ZM3A 3QKRA 1N0UA 4NE2A 5FOWA 4US1R 2AWOA 2ZU0C 5JSZB 1PZNA 3U6KA 4C7OB 1CP2A 1ZIOA 2IYSA 4C0HA 1ZIPA 4GSYA 1KGDA 2Q3MA 1IY1A 5C4GB 4CT5A 2JEOA 3VTKA 2ZR7A 3ETLA 5H8WA 4TZ0A 1RJ9A 3KFVA 1DAKA 3AP3A 1GG2A 2QG6A 4RKFA 2F43A 1N6NA 3RRYA 2OAQ1 4M1YA 1QVRA 3BIFA 3TW4A 5HZHA 5CLLA 2WHXA 2BEJA 1VCNA 1EFRA 2DYKA 2GZAA 1KI1A 3EZ2A 4HAVA 2C95A 8OHMA 2IT1A 4CEHA 4QL3A 1M74A 2QRNA 1AIPA 4PPQA 3SFVA 3DM5A 1N3BA 1X8JA 4NYJQ 3K09C 2ODWA 4W9MC 3RDPA 3Q8XB 4QHYA 1W49A 4QGGA 3TRFA 4OI2A 4XTCS 4FWIB 4HLUC 4BZPA 4GOKA 1Y3AA 3VX4A 1W4AA 4IDNA 3KXIA 2IYRA 1H8EA 2D74A 3WYGA 4O2LA 2W2VA 4PQRA 2AFHE 2KBFA 4G1UC 1WRBA 4TL6A 4KV9A 3RC3A 4AKEA 2RHDA 2JLUA 2R2AA 4KFSA 4Q4JB 2VHUA 2X19A 4WXRA 4CRWB 1T9HA 3EARA 5E4FA 1C9KA 2PBRA 3FKSD 5CK5A 3HYRA 4BEJA 1VTKA 4HLCA 2JLXA 4NCJA 5BWMA 2PMDA 3FMIA 4BWYA 1AZSC 1ZM4A 3KUCA 1OYYA 4MKHA 3TSWA 2N42A 2P5TB 4PPGA 3K70D 5DHAA 2QU8A 5H68A 5K8UA 2P5SA 2ZI3A 3GLFE 4OYHA 2RCNA 1T3LA 3IIKA 2AN9A 1UBGA 2V6IA 4BECA 3CX8A 4LPKA 1COWD 1TEXA 3ZGXA 3V4RA 2XZPA 4GOXA 3GLFB 1KMHB 1KNQA 2IYUA 1Z5ZA 3SFZA 1TF2A 4KVAA 1YZNA 3TVTA 1F2TB 5TDHA 4M9ZA 3NTUA 1GOTA 5H70A 4YMWA 1RFLA 1E9AA 1A5TA 2OXCA 1N5IA 1EWQA 1N25A 3IIJA 4EPTA 3LX8A 3GJ6A 2XJ4A 4Q7LA 2QA5A 1NP6A 1HURA 3PVSA 4DLTA 1R6BX 4US2R 2O8FA 2G3YA 3EIQA 1UAAA 2IF2A 3AF1A 3U44B 3TLXA 5KHOC 3QIAA 1EWRA 2DCUA 2HUPA 4XTRA 1U9IA 2PJRA 3F3YA 1UFQA 1M8PA 1ZU5A 1S3SA 2YWHA 3CUEF 1KZGB 2EQBA 4AY2A 4ZCMA 2V9PA 4Q4HA 3MJHA 2J45A 4Q48A 3W9YA 4MUAA 1H8HD 4PSAA 1US8B 3TUJC 2P6UA 5LB2A 2NOAA 3MD0A 4Y0VA 2H18A 3VMFA 3UATA 2F1RA 2QEQA 2J3EA 1E1RD 4JSYA 4HAZA 5FOXA 3AEZA 3P27A 3QQ5A 4Q9IA 2C9YA 821PA 4K81B 4BLOA 3CF2A 4R9UC 3CIOA 2ZVQX 2A5DA 3ICEA 3EIEA 4L9WA 4AI6A 2WIAA 1YJ5A 4D80A 4CIDA 2W6JA 3A36A 4LUCA 4DKXA 4B3BA 5LPNA 4LK2A 4Z8XA 2BKUA 3GJXC 2XITA 3AKEA 3QKTA 2A5YB 1L8QA 4P4UA 2PX3A 4ZKDA 1YZQA 2JLRA 3SYKA 3OEEA 1NLYA 3GLGE 3UG7A 5B57C 4RCYA 3DHWC 2NZ8A 1Q21A 4WOPA 4TLAA 1M7HA 2IL1A 2NO6A 2JASA 3ASZA 4PO1A 5DLQC 3GLGB 1D2NA 1I2MA 3S1AB 3U3OA 2B7CA 3KKPA 1RIFA 5HKKD 2BC9A 2J0UB 2QUZA 1L4YA 4B3CA 2OAP1 1IAQA 2GHIA 5L3SB 1VHTA 4A6XA 3FB4A 5H1YA 5FBLB 2L0XA 2WWGA 5FBWB 1G8YA 1E2GA 2GVDC 2JJ1D 2ZI7A 4DVGA 2CVFA 4WW0A 4KCGA 2WWHA 4HB3A 3GJ8A 1SZPA 4M4SA 5L8VA 3M1IA 3CRRA 4TTQA 1E3MA 2RGCA 1OH7A 4AG5A 4ZKEA 2YINC 3GPLA 2ASEA 1W0KA 1NI3A 3OFNA 4KU4A 4PQYA 5TXGA 3RSOA 2Q3HA 4JLBA 5ANRB 3F0TA 1Z07A 1A1VA 5HE8A 1NY6A 3IO3A 3LRPA 2XB4A 5FTLA 3AGQA 1XBTA 4QXAA 1FUUA 1TUIA 2RMKA 1UKEA 4IDPA 5AUNB 2XNDD 4BLQA 5D3QA 2YHSA 4U02A 4PC2A 2BBOA 3A1UA 3A1TA 3TIFA 1NL3A 3OAAA 3EZ7A 2WSMA 2WM9B 3EXAA 3OEHA 4A15A 4KO8A 1T0HB 3SBEA 1KO1A 1JEDA 2WSSA 1EG7A 4IDOA 3M0EA 4B73A 4TQ9A 3BERA 1ZC4A 1DBSA 2YC2C 4JLMA 4X8HA 1N5JA 5LDDC 4J0QA 4LZZA 1KI6A 4GMXA 1KSJA 4JYBA 4PPFA 3WYFA 3FE2A 4LV8B 1WBBA 1LF0A 3LVRE 4DJTA 2PX0A 3NDBB 4B3GA 1XCPA 4Q00A 4NPHA 1PLLA 1SXJE 2ATXA 2PMKA 3RANA 5EE3A 5EUQB 4HB4A 2O8DB 1G8FA 1GRQA 4GI7A 4O25A 4ZCLA 2GDJA 2GWHA 1NVUQ 1CBUA
chains in the Genus database with same CATH superfamily
4M99A 3AL0C 2HV8A 4G07A 1OXVA 3C3PA 3IDZA 1XE3A 4PLCA 4OP2A 3ILSA 4Y0NA 5AR1A 4NE7A 3MQFA 1PFKA 1RYDA 1O2DA 1R6TA 1IY0A 2OB1A 2OR3A 2PMCA 3PQ4A 2HNAA 3QYFA 3RGGA 1EFUA 3ZV7A 4CIBA 2FF7A 3QK7A 1TF5A 4DPLA 5BNZA 2WAAA 4TROA 3VO8A 2V74B 3KQQA 4C6TA 3KQNA 4F4CA 3OJXA 2R6ZA 1O8CA 1BOOA 1M34B 5FJIA 1OBCA 4HQ6A 1VPEA 4WA7A 4BNFA 1NQ5A 4PR3A 3GPDG 3WGKA 4FYKA 2VPZA 4JB2A 4M1TA 3UJAA 3G9QA 5FWNA 1QUEA 1NN0A 3HQ4O 3AFIA 3O8OA 1JKFA 3OQMA 1FQJA 5JVDB 1SBZA 4BO1A 4S12A 2O8EB 2RI0A 2ABWA 3TL2A 4BQSA 4D4HA 3CSSA 5KOIA 1KFEB 4N12A 2H7VA 3H5RA 3I9FA 4MWEA 5IAEA 1WXFA 3LBIA 4YAFA 4S24A 4UCXA 4ROTA 3KPUA 3G2OA 5IARA 1K5DA 3QVKA 5AKJA 4ZRMA 4RTJA 4ND5A 1W1WA 3PENA 3U31A 4YRDA 3T0FA 1NKSA 1UC9A 2ET6A 5D7BA 5T8KA 4MVJI 3P71T 3S2SA 4B09A 2ZATA 2QW1A 1O5IA 4EYKA 2Y3IA 2IVFA 1RC0A 3N7AA 5DXFA 5BMVA 2NO0A 5DXJA 5ALIA 2Z9CA 3ULKA 1JQAA 4F60A 3AETA 4GZLA 3QU7A 4I8IA 4BB0A 1JHVA 3W6OA 1HV8A 4M0PA 2COEA 4RWEA 3E7PA 4UAJA 1GUBA 3UTCA 2DCMA 2JCSA 2RGXA 4LFCB 4NMWA 1CUVA 5FUVA 1EE9A 1X7XB 1E5LA 4MDFA 1BXRA 3FKQA 5CFMA 4HFJA 4QOJA 1EJ0A 1Y8RA 3BIWA 3L84A 4KPUA 3OT1A 2JCBA 4RABA 1YDWA 4P0QB 3IUBA 4WCFC 3QOWA 2R6HA 1I6LA 2FDRA 2H63A 5AUOB 1JHZA 3TMYA 1R18A 4N5MA 3TCXB 2OHVA 3U7QA 1SJ9A 2WPDD 2ZVPX 4C0BA 4AJIA 2Q4EA 3TM4A 4NEHB 3R7AA 3Q11A 4J1TC 2H2GA 3AO0B 4LJAA 4E08A 3ORQA 1EFPA 1M0SA 1C2YA 2P2CA 3KVYA 3PR3A 2JG3A 4LX8A 4PZPA 2CEKA 1NBIA 1T91A 1GGEA 3NHZA 1KZ6A 1QLWA 4N03A 2YYZA 1RJFA 4O8ZA 5JSHA 2ZUFA 4UHFA 4JZYA 2FJUA 3MT9A 4ZYWA 2HLDD 4KWTA 1IB0A 4H4EA 1MIOB 4JC4A 2QT1A 1Z6TA 4HWTA 3A4TA 3QY9A 5KYNA 1W1IA 1SVWA 1MTZA 1DS6A 3M6IA 5FFNA 3L2OB 3PD1A 3TXXA 1M7GA 2ZRJA 4ER0A 4JUAA 5FKJA 1QOPB 1WSWA 1ZOLA 2Z2ZA 1JX6A 1ZMRA 3GFPA 1L7BA 4AECA 4UU7A 3KKNA 4ID3A 3FAZA 2QYTA 2WYIA 4G4IA 4Q4DA 4XIJA 3UXMA 2ZRLA 4V1CA 3B51X 3O3CA 1SVLA 3QKRB 2NUAA 2R65A 2R8OA 3R3YA 5DE3A 4BTEA 3VDMA 5IPFA 3QE3A 3L7LA 2FWAA 1JPJA 1JFSA 4CTMA 4W5QA 4R9SA 3RWBA 4DJAA 3PE4A 3GB9A 1PNOA 2V7VA 1BW9B 1N57A 5J9FA 3OQOA 4KTVE 5KYKA 1NQOA 5JS2A 2N75A 4EPXA 3L7BA 1EP9A 1QJ4A 4MUGA 5I8PA 5K0TA 2P77A 3OIUA 3OQNA 2VP4A 3THOA 5JD5A 2O8NA 3KQUA 1NVFA 3U60B 1HEYA 1VBNA 4EFMA 1S3FA 2YW9A 3TEFA 1FFSA 1EFCA 5F51A 3CVVA 5FI5A 2HSZA 1D09A 2JHFA 3MILA 1QG2A 2CNWA 4Q3AA 5FTWA 4QLBA 4X65B 2HJSA 2HJ9A 2EW8A 3H6HA 3QXJA 2WG2A 3AEQA 3NIBA 3C43A 4F11A 1T0JB 3G7UA 5HK9A 1E6KA 2DRIA 4I1UA 1NUUA 1L4MA 2CMHA 3BTUA 4HTAA 1MV8A 9MHTA 2NWQA 1Q83A 1IZ0A 1NVMB 3H2JA 3KEMA 3B3AA 4I4TB 3RVKA 1FLNA 2EYUA 4L72A 5HCUA 3NUQA 2HK6A 1GXSB 3RS4A 4YRTA 4DGSA 3WYAA 2I22A 3KETA 2WFZA 2I4RA 2GD1O 3H3JA 3A14A 1A96A 1C30B 4IL5A 4WZBE 3OKAA 1WO8A 1LY1A 1OI4A 1UFVA 1VHLA 1YK1A 2IDZA 1CQJA 1F0PA 2HH9A 2P6PA 3WQBA 1VG0B 1WMBA 2PK3A 1S2DA 4RAOA 1FP4B 1MRZA 5DI3A 1MC5A 5FPHA 2BJHA 4JJ4A 4RJLA 5LCXA 3U7EB 5A4IS 1HG0A 3EF3A 3NCHA 4M0UA 1BYIA 1VXOA 4W6QA 1RDFA 2VUUA 1F0NA 3C6ZA 3UGKA 1X7ZA 3I1IA 4A8TA 4P5EA 3CO5A 3LNCA 3LPMA 1Y7HA 5IKOA 3V4FA 4Q7QA 1TYAE 4YUYA 4KPEC 1SVIA 1CUDA 3OOJA 3GFTA 4UTXA 4X85A 4ARIA 3EVAA 3L7NA 1VDZA 1K68A 4EY8A 1G3RA 3HXTA 4TLDA 1LGYA 3SDZA 4EZBA 3U7IA 3ZBPA 3HJRA 1Y6RA 1I0ZA 3NT2A 4UBNA 1Y8ZA 4BNMA 3I2GA 4JLOA 1EPUA 3FHCB 2HDNB 2BGRA 3EDRA 1S5PA 3PNLA 4GPTA 4GDFA 2Q0XA 1IUNA 3AEUB 5HZMA 1XCGB 4BZZA 1BN6A 4IIEA 4D81A 1T2AA 2XMGA 3RNOA 4P86A 2I2AA 3L5KA 2P9JA 4F93B 1FQWA 2CBZA 1S2MA 3DZKA 2Q21A 3Q7IA 3D8NA 1N3LA 5IWCA 1SCKA 5DBEX 3U9SA 3SBOA 4TYWA 2R1UA 2DP4E 2DHRA 3E1SA 3TZEA 4AY5A 4QDOA 1E66A 1P29A 4UMDA 1G6KA 3UPUA 2Z98A 3KAKA 1NXPA 1TIKA 2DM6A 2PJZA 3V1UA 2XX3A 2QD4A 1X1RA 1DDGA 1JVSA 3KV1A 5F2OA 5JPDA 2W6QA 3DC7A 4RMJA 5FO1A 5ILOA 4OYLA 2HLDA 1H9BA 3EDOA 4M54A 3VJRA 1Y3FE 5CPBA 2I3AA 1W6RA 2PYDA 3OJEA 3TZQA 1LNZA 3R0ZA 5A0FA 3WGOA 1JT9A 1YD7A 2J31A 3DCNA 3VPCA 4MHTA 2WHEA 1LW6E 1UFOA 4FJ0A 1N6HA 3TQFA 4FEEA 1QVAA 3I23A 3M6LA 3KHUA 2BR5A 1HFEL 1KDPA 2PBZA 2QI9F 3N8IA 1MHTA 1B0PA 4A36A 3EPKA 1PL7A 3B2QA 5GWXA 3BGIA 3SIRA 1TQDA 2XAAA 4FSDA 4RHUA 3ODGA 3CWZA 3ZK9A 2XW6A 1DU4A 4IEFB 4YT2A 4HNGA 1CW2B 5L4SA 2FUEA 2I3BA 4MV8A 2XUFA 4PRKA 3L40A 4QJIA 4ZFNA 4Z4EA 5B58T 1DCFA 1YFKA 3DG9A 1P1IA 2KJQA 1KQNA 3TAHA 4AZTA 3MWLA 4G09A 2XMCA 2VJCA 5ES4B 2BFAA 2YHIB 3S81A 3NT5A 3H2KA 3B53X 4OK5A 4WK6A 2AK3A 4OQZA 4ILEA 5ISMA 2BR3A 2XLCA 4CT0A 2XVZA 4WGFA 2VCYA 3N0TA 1BE0A 4EEKA 4XDHA 5IT0A 1V7PC 3T9CA 3PTZA 4MYRA 3TEJA 1WP9A 4AK9A 1JSCA 2GCOB 1EFRD 2L18A 2QAJA 2X0NA 4XX1A 4B71A 2XA2A 1RRFA 2BE9A 3DMPA 4J0EA 4C2BA 4D8YA 4AKGA 2PT9A 5LQNA 1TMYA 2NVUB 3DZGA 3KUXA 2J6BA 4P3YA 2WJVA 4ZREA 4G1BA 1M8FA 1L4FA 5GV8A 3EC7A 4AW9A 4OGFA 4DQVA 2XD4A 3MWFA 2V3VA 4DVJA 3QIVA 5CJJA 4A8JC 2D00A 4AJ1A 4C1BA 4LK3A 4QJ3A 1GAQA 1NWHA 4WOCA 3MBOA 2FJPA 2X8JB 1H5QA 4K26A 1E4OA 4CMIA 4DNXA 2HI0A 2ODPA 1KK1A 2IJGX 2OECA 4RDHA 2FQ1A 1H8ED 3JQ8A 3PDUA 3ZCTA 1Z75A 1JKIA 1MENA 3RVOA 3ABOB 2ZUEA 1XQ9A 1U5BA 5EHNA 3VVMA 2E7ZA 5CXSA 4CF4A 4ZMRA 1PL6A 1YOVA 2QE6A 2E82A 2ZRKA 2AOTB 3OTQA 5E6RB 4ATNA 5LD2B 4KWCA 3AINA 2D2VA 4RH1A 3T3MB 5HUQA 3MGAA 1PNTA 2Z2JA 4MK4A 3WA6A 4JUIA 2O7NA 2JVKA 4IP0A 1SHZA 3ZWXA 4Z0PA 3HDYA 1N5MA 1OHHA 5FYQA 4BO2A 3QSYA 1DC4A 3LT1A 4R2KA 5HKLA 1JWBB 3BF8A 3RTCA 3BWXA 5ECYA 5ICEA 2EJWA 2Z1NA 4TZTA 2C99A 1X8LA 1SBNE 2IODA 4J8PA 5CHYA 1ZYUA 4I55A 4ZO7A 3SHOA 3WQHA 2WJAA 4ENQA 1XLTA 1U3DA 2A5JA 2CJWA 1XL1A 3QVGA 1MJNA 3DAOA 4HRYA 4CG2A 4KN5A 4OQLA 1KJZA 2HF7A 2GJKA 2KX7A 3B8HA 1CPYA 4H0NA 2ERYA 4CEIA 2R97A 3UUGA 3AVVA 1QBKC 3CB4A 3TRHA 1F8GA 3PQ8A 4QDKA 2O0KA 5E7JA 1BNCA 1B14A 5AW9A 3WSTA 1J97A 2IEYA 3QSGA 3EPPA 3QLUA 4YCBA 4JKYA 4DIDA 2Y2UA 1KI6B 5AJYA 2MIIA 3CA8A 3O7WA 4BKPA 2PRSA 2FN7A 3ITDA 3JQ9A 4CXMA 3DGEC 1O9HA 2IQ5A 2WJIA 2FPRA 2GS9A 3EF1A 2Y0DA 4EHBA 1I7LA 1QYXA 1VFPA 5CX4A 1PSZA 3WGGA 3JQ9C 4M0EA 1H05A 2XB2A 1YR3A 1GNQA 2H1RA 1HE3A 3BS4A 3QVMA 4M1EA 2GRAA 1SVUA 1XZCA 2QGNA 3CVJA 3LXMA 4AJJA 4B4UA 3O95A 2LP4Y 4MS1A 1UJBA 1HY3A 1TO1E 4ZU1X 5HEKA 2O54A 4DJJA 1ECFA 3EF0A 1SPBS 4TRRA 3VZRA 1UMBB 4MZXA 3FCAA 3OIYA 1NPDA 2BEUA 2PKQO 4FSHA 5DFAA 5J4HA 3IXMA 5IVHA 4XQCA 1W4LA 3N58A 3TSCA 3W34A 2QTVA 4PYKA 3PNVA 4A2QA 3T06B 2FX5A 3LCJA 3M9LA 4YRPA 3E27A 4LNUA 4MI6A 4XWAA 2C00A 4C04A 5AW0A 1UEJA 2E37A 4BKRA 4D4MA 3T5MA 2VTBB 4EJSB 2YWJA 4AO6A 4YFYA 1CEXA 1ZMXA 2FZ4A 2XVAA 5C3UA 3H4IA 2P3SA 1CIPA 3RADC 2E6UX 1YL6A 3F5MA 4MCAA 5DNCA 2GXQA 1R0BA 4KQXA 5K4HA 4YRBA 4R9RA 5TSDA 1IRIA 1T2DA 3MTIA 1SC6A 1U9YA 2YS6A 3O4FA 4GE3A 2XUOA 2G5PA 2WEKA 4IJ5A 1RI5A 1VYHA 3RM3A 4TXNA 2PUCA 3S68A 1GAJA 2N1BA 4FHDA 3ZE6A 1L4EA 3K09A 1V5IA 2PYIA 4G1CA 3ITKA 3R7SA 4FJ1A 4Y7DA 4DRZA 1M76A 1PDWA 3WTBA 4HYYA 3O84A 1KIAA 4FOOA 2H07A 1GUDA 1YBMA 3IKMB 3RAJA 2ZSAA 4I55F 3VHXA 2CXQA 4C29A 1WXDA 1EHIA 1YRWA 2KM1A 2C03A 4IS3A 3CF0A 1DTSA 3RG2A 1RLIA 2VH5R 1A5ZA 3AWIA 3BDVA 1JA9A 3Q0EA 3ZY4A 1ZGBA 4ENVA 2CHEA 4QDJA 4RXMA 3FCXA 1JN0A 3MLBA 4MQUA 4TM7A 4MVJM 3EXG2 2JAUA 2IDMA 2X22A 1XCLA 4IFBA 4QOFA 4UQPA 2R79A 3X1ZA 5A4FS 5I4BA 5I7WA 3I2HA 4IY1A 3UG6A 5KJFA 4DMCA 3IBFA 2J33A 1PUJA 2GBFA 4MVJD 1UDWA 2QM3A 3ET4A 4H7FA 4RKYA 1O96A 3ZV6A 2KHZA 1Z2AA 3IJEB 1E3TA 4KIFA 2PMEA 1JV2B 1RWNA 3Q8KA 1YR6A 3KX2A 3Q3CA 3MYYA 4QUBA 1A27A 4INZA 1TTPB 1NF9A 3JASA 3DUFA 1EXWA 2ZI6A 2PKRA 5EQDA 2GZSA 3JW8A 2ZR9A 2IU4A 4RY0A 2FV8A 3BC1A 1XEFA 3OA2A 3OFND 4FINA 3L1VA 2ZBPA 3GFOA 3VKVA 4EKEA 9GPBA 2GK6A 1ABBA 1FDSA 2C8LA 4OQYA 4AM8A 3PDJA 1JHDA 4ZI7A 1KO7A 3NWJA 2EOAA 3KYIB 5IKEA 1X1EA 4UMVA 2B8WA 4TV8A 4MEBA 3BRSA 3ITEA 3L7KA 3Q7PA 1JSRA 2G7ZA 2F1IA 2J3KA 4YWJA 2NNWB 2ZREA 2AA3A 3HXKA 5IVPA 1I8TA 5I7UA 1T9BA 5B7NA 1IN6A 2O8CB 2PDAA 5FFMA 1G17A 1U3FA 1QTNA 4P36A 2XKKA 3RIEA 2YICA 2NU6B 1FEZA 1CY2A 1VKOA 3MRSA 1T25A 1FS5A 2WSSD 4OBEA 3HYSA 3U17A 2GNOA 2WTMA 3SOZA 3O74A 2GFIA 2WTAA 3KYCB 1NJFA 3T9AA 1O97C 1LI4A 5A5DA 4IYJA 4JBLA 4UVDA 2J3IA 1YHNA 2J3DA 4KK4A 2TECE 2M9MA 4H7IA 4RORA 5COAA 4LF6B 1KETA 4IXMA 3PV0A 1VE5A 2DLNA 2GAAA 3FUXA 4A4DA 1HZJA 1KVUA 1HE1C 1L5WA 3GMIA 3E61A 3KZOA 3OLWA 1TQ8A 4GKVA 4U7HA 3KXPA 4ACAA 4ZZ1A 1HX7A 4PWZA 4XLLA 3QEAZ 1X0VA 4JXZA 2CJFA 3IBTA 5DF1A 4C0XA 2XRZA 3F73A 1F7UA 2Q29A 3OX3A 2Q99A 1NU6A 1SWVA 3RTAA 1Z36A 3EIXA 1MO2A 1ZNQO 4DQDA 4CTKA 3ANXA 3DHNA 4CM1A 3BAZA 2X13A 2ISCA 2ONJA 4Y2HA 3FCOA 1BXGB 2XUKA 1W9HA 4OHMA 1NBHA 1DEKA 1KH2A 3D6JA 2BUCA 3RTBA 2W83A 3H8WA 5FR2A 1LWOA 2CHGA 4XPIB 3WK4A 4B2PA 2SKDA 1AQNA 4MV7A 2YJNA 4YQZA 3HDHA 2BGMA 3EQ7A 4PZ9A 4RF2A 1U8FO 1A9OA 2G7MC 3LOQA 2HX1A 2ZDQA 1O9BA 1HL3A 1PBNA 3WBFA 2PGJA 2A0KA 4DANA 3DHYA 3PX7A 1KKMA 1UJ6A 4MGEA 5DP2A 2QZPA 1X9GA 3NHJA 3ANNA 3FNGA 4QTTB 4UC0A 5DHPA 3ZC3A 2RGNA 1K98A 2W2KA 1K7CA 2IXTA 4R0VA 5EJ2A 1ESCA 3IAM6 3RTDA 5K2OA 2DHCA 3TSYA 2RGNC 2IIBA 3D2AA 1ODJA 5AQEA 2VOJA 3F6BX 3OMWA 1PD1A 3MRTA 1N33B 4GNRA 1YHZA 2YVQA 1PYOA 1N7GA 2F59A 2ACKA 1Y4ZA 3NHWA 1PO7A 1Z47A 4LNHA 4UEKA 3T61A 2H0RA 4UASA 3ZE1B 3N39C 2P2NA 1RHKA 1RVV1 3SSAA 4BNDB 4ZI7F 1L7PA 2D59A 3ZH9B 3N2GB 2XIQA 3BWBA 4B6EA 2E48A 4C78A 5KSOA 1ISIA 4TV8F 4KYTA 3EODA 2BFBB 3L0IB 4PVCA 3VMMA 3ZGNA 3C4VA 3KOMA 2XDYA 5SZKB 3GN2A 4I1PA 4PLGA 4DV0B 1DAGA 1GNLA 4ZGGA 3ACDA 2CV2A 2XT0A 3TLGB 4C4AA 5JAMA 3VR6D 4A9AA 2QDXA 4RHXA 1L1QA 3VAZA 5KTOA 4GYWA 1JR3A 2JZCA 4UM7A 3WB1A 3SF0A 2J5RA 2O3TA 1K6MA 5FLXA 1EVQA 1WHSA 4L50A 4CF3A 2FF5A 4MYSA 1R0WA 4IHJB 4PRZA 3MUNA 2AT1A 1I4TD 2GKSA 1SQFA 2UVPB 3A32A 1ZM7A 2P30A 3OFSA 2VNJA 4MVCA 2DUMA 3GZNB 4RD0A 4ZAWA 1RYYA 3IEUA 1JG2A 1W8DA 2G4LA 4GKJB 5EWMA 3ZI7A 1JDPA 1RCTE 4UJ3A 2GLXA 2P2GA 2PG3A 2E4ZA 1Y9DA 3VJMA 1WQ1R 3ZHUA 2QLBA 1T6ZA 2HK9A 4IPTA 1K9SA 4J76A 3H1EA 2Y6UA 3GDHA 2C9CA 2ZJ0A 4UM9D 4CZ2A 3GJ3A 2JVIA 4Q5IA 1O5OA 3DZIA 5EVJA 3CH7A 4WCDA 3UCXA 1BMDA 1MT3A 4HUTA 4X1YB 2QN6A 1RAFA 2YIJA 3AXTA 1SQ6A 3BE8A 1U7HA 1M1ZA 2R00A 2R0QC 1OFUA 2HXYA 3FVTA 2CB0A 3I1FA 3LWBA 4HX2A 5JJIA 2UU9B 4IWNA 2I6UA 1BIFA 3SVZA 1GR1A 3EPHA 1FFBA 3DXXA 1QGZA 4JYMA 4XLZA 5DT2A 3ZJ5A 3P94A 5E1DA 5SYNA 3U16A 4RLHA 1L7AA 1WB4A 5ALWA 5L3ZA 3ZBTA 1IZ7A 1UEIA 3REOA 4YDSA 4YX9A 1G8HA 1N2IA 3V5NA 4EB6A 1KI4A 2WM2A 3QF7A 4ID9A 3UMMA 5CFLA 2REQA 2ZT6A 4JJAA 3TLEA 4IJKA 1YB1A 3A6DA 3K0FB 2G25A 5LOVB 2F3SA 4ZCRA 1JTFA 1IB6A 1PQ4A 5TMBA 4JWTA 3BCRA 4IIUA 4TLCA 4BVAA 4BX8A 3KB8A 1N2HA 3I2KA 1TTQB 1AZWA 2XOKA 4LTMA 4PIVA 4YT5A 3WK5A 4MYDA 4X7RA 1MFZA 4JLVA 1XLWA 1U28A 1J24A 2CZQA 2QU7A 4QBGB 1YZYA 4QWWA 2A94A 1E4EB 2X8LA 4J75A 4OU5A 4WFJA 3W5UA 2CZCA 3DVRX 2FW1A 1BD3A 1RU3A 4ZXPA 5JASA 4EQZA 3ROMA 1SEVA 2CL5A 1XROA 4U7FA 4DLRA 3FPKA 3L04A 1ICIA 3HE3A 3KWMA 1MZPA 4AZ3A 3KQLA 3HN6A 5CAEA 2UZ3A 2Q2OA 1UWCA 3S55A 5K0SA 1E8NA 5AFSA 4HGZA 3OQVA 3S29A 2J0VA 3KJHA 4PTZA 6CHYA 1Z8DA 3BIJA 3FA2A 3N5CA 4UHHA 3NC4A 4OIMA 5H9WA 1RM3A 1NI4A 1AC5A 1W4CA 5J4KA 4GLLA 3ZXSA 1HQKA 2QVCA 2VJQA 3RHZA 2C5FA 5KYWA 2JAHA 1K7SN 3IXQA 4U9IS 1I7PA 3C41J 1YRLA 3FSGD 2I4IA 3KT6A 3EAGA 3R3ZA 3G2NA 1XLVA 2JIBA 2Y99A 3OQ1A 1KZ1A 2QZ9A 2BGTA 3CVUA 3R9WA 4IXTA 1EK5A 1T8SA 1J4AA 1WJGA 3EMBA 3OURA 4LE1A 5JSYA 1NN5A 2FI1A 2FG7C 3R4CA 4HZUB 3R74A 4C0SA 1FVOA 1X3SA 1AKNA 2PUTA 5F5XA 3VZBA 3WICA 3CEHA 1IXZA 3IUMA 3ZHBA 2G83A 4ZYYA 3IKLA 2VLBA 2C83A 3LTEA 2UZ1B 1P2BA 3SF8B 2G07A 1PR2A 3TPZA 4D5GA 4G0UA 2FEMA 3HJAA 3Q1LA 2H5JA 2OQ2A 2ZROA 3ZQJA 5CBPA 1AV7A 1FDWA 2F17A 2I7TA 2OD7A 3LDHA 2ZTUA 1Y82A 1EAMA 2YVUA 3B82A 3BOSA 3VPBA 4DLNA 5JHHB 2ZTLA 4LSWA 5LQKA 4MV9A 4NENB 4PYIA 2R6DA 5EUMA 4GL2A 3G85A 3QW2A 4UQOA 3QI2A 4B84A 3DDOA 2IW1A 3SZOA 1TRKA 3HWX1 1R6AA 1NNUA 4XVUA 2CVQA 1M1XB 3JQAA 1ZLYA 2ZAOA 1ODTC 3JCZA 2ZW9A 3EC1A 4FLEA 2DJ5A 3WLPA 5LMUB 3IT3A 3RSFA 2VUIB 3UIEA 4NHOA 5CA0A 2YZ2A 3OJFA 4JFAA 3WGTA 3USZA 1DQYA 4KC0A 2R85A 4OUKX 3QX9A 2CV0A 1LPPA 2CFTA 1GYQA 1JLRA 2XEXA 3P9CA 3PQ7A 3NZEA 4QU9A 5CYFA 5P8WA 2A35A 5KO2A 4R1TA 1RE0A 1SA0A 1IQUA 2QJWA 2YXPX 3K5HA 1A9YA 4LRYA 3KC2A 1VYUA 3AILA 3K0HA 1DGQA 3DBHA 1F60A 2RSLA 3ICQB 4G8CA 4FLMA 2EFCB 1JHXA 4YJFA 4ZANA 1GU0A 1XTTA 3KEFA 4CG3A 4HWGA 3ZU4A 1G41A 4UUBA 4WTOA 3DMFA 1OZFA 4JBXA 2AEMA 1R7RA 3DCYA 2ZCVA 1E1QD 3LP6A 4YJ2B 4RK1A 1ZSVA 3CLKA 3HKEB 1ZRNA 3D3WA 3TAUA 1D03A 4D74A 3ELDA 2BTQA 2NGRA 4XH9B 2R1ZA 2HQBA 3T1YB 3KXDA 3IMKA 2O6LA 1UWKA 1N8NA 3B9QA 3TN7A 3SBDA 4H27A 1P45A 1MGPA 2HWUA 4UBLA 5ERGB 3KEOA 4AF8A 2FSGA 6LDHA 1A8UA 1L7NA 3MAGA 4M8NE 4A2PA 2MSCB 2RG1A 3G5LA 2C5BA 4OV6B 5IXSA 1J99A 1E7QA 4I6JA 1Q1EA 2HHCA 2WOOA 4LTNA 2RGRA 1OWOA 3KNZA 3RGWS 4QPZA 3D7SA 1CERA 1P1BA 5DX8A 1RJGA 5IMSA 3H9GA 2PJDA 4LGVA 2RHLA 4A0RA 2XXAB 1E62A 2IXFA 5EE5B 4CG0A 3MK31 4R98A 1Y7TA 1NE7A 4IZOA 2HQOA 3LX5A 3ZJTA 4HAWA 1LCIA 5GP1A 4YQEA 1MB2A 5DASA 8GPBA 4FQ5A 1DV1A 2XGJA 2O7QA 2W22A 4EPRA 2W43A 1WKVA 1JH8A 2YWRA 4JJKA 2OMKA 3ZTWA 3DKKA 2E85A 3LA6A 5JV5A 3QFCA 3U40A 4U7WA 3NONA 1TCAA 1ZX1A 3BMQA 1M2HA 4J90A 4FNOA 3V3TA 3EZ6A 4DSTA 1V3QE 1CNEA 2RIRA 2PXHA 1W59A 3MCVA 4NCKA 3ZKWB 2ZSBA 4B87A 5BMOA 3HNPA 1JHYA 4U6SA 2UUPA 3S2UA 3UAZA 4J9UE 2RBGA 4PZ0A 4I0WB 2DKFA 3G0IA 5CT8A 4BJ5A 5CVVA 1YIOA 3K4HA 2GPSA 3E3AA 1RWVA 2IHYA 4QFMA 3KD3A 4GQBA 2XTZA 4KDCA 1HF3A 5CLQA 1B1AA 3AFOA 2GUGA 5CA0F 4FJ2A 3HRKA 3VOSA 1R00A 2FN9A 3CJTA 4MVJG 4LJRA 5FTJA 3JQGB 3MWKA 3D6UA 2ZKIA 3OIFA 4DQ0A 4PEVA 3CY6A 3EXIA 1PGOA 2LGJA 2ISQA 4WADA 1RADA 4MKRA 4LDRA 3FKJA 4ND4A 1CQPA 3NHPA 1QH1A 2AK2A 3FYUC 3SJAA 4KQJA 1A04A 3GMTA 6ADHA 2AVDA 2E18A 4LHXA 3TKAA 5KOJA 2YKGA 4BS9A 1NVWQ 2SCUB 4MW6A 1P1KA 4GP7A 1QQTA 4DNOA 1QP0A 2ODTX 3CX3A 4PG7A 1PEKE 5DM1A 1KJJA 5AI6A 1YRAA 3RWOA 4HBZA 3IJRA 5ELMA 2VT7A 3FUWA 1K75A 5KMGB 4DTIA 2UAGA 4I1RA 3M49A 5KTMA 2C5HA 4Q9KA 2I6QA 1PFQA 1NSTA 2B9VA 4LWOA 5FO0A 1J2JA 1KH3A 1U7WA 3PUZA 5FPPA 1B43A 1DTWA 1ESNA 4GG1A 4EHJA 5JS7A 1HQCA 2HNBA 1DUSA 3RG8A 3U9TA 5B4UA 1OB2A 5JALA 3PNYA 3TGWA 2IE8A 4HDRA 1JQBA 4QAQA 1D7AA 4R8RA 4X71A 2AEJA 3ILXA 5C34B 5F1OA 5T3UA 2VA8A 2HYDA 4OXXA 3BBLA 3G88A 4G9BA 4TWIA 4YP6A 3M1YA 3CYFA 3VJLA 3G1UA 3F6SA 2YMMA 3WQQA 2RD2A 1FRVA 3GRVA 4KL8S 1XXHA 2C2BA 3NLLA 3EGWA 3WWOA 4CIXA 2VHVA 3KDAA 4K9MA 3KTAB 1FOEB 2VBIA 4GX1A 4J0DA 4DZRA 3PLRA 5E0OA 2L42A 3SYTA 1H0KA 1WUHS 1SNYA 1JDSA 2CC2A 4WZ6A 2Z2YA 1U8EA 3N2IA 2WVHA 1H3EA 1H42A 1GFIA 1ZUIA 1P91A 1WF3A 2QQFA 5JZMA 4JI8B 1OX6A 3H5WA 1ENZA 3ESXA 2HM7A 4ZVTA 1KEKA 4G0PA 4KGDA 2QV0A 2WSBA 3FTFA 2Q4RA 5EJ6A 2J32A 2R7LA 3WGMA 3Q3IA 1JG6A 2D54A 2OLEA 2QQEA 3AIKA 2VK4A 4TL9A 3CURA 5AHRA 4LOAA 4Z9BA 5SYAA 1TLFA 3JU3A 3UXEA 1I3CA 4B7ZA 4AQ7A 1W34A 5I48A 4LGCA 5B1EA 2VKQA 3ZS8A 2A78A 1N7JA 1UPTA 2RKOA 5DISB 3U7HB 2O2IA 1FNNA 1QE0A 2VXYA 3LIPA 3QMVA 1KPGA 1FPQA 1XCOA 4FC7A 1EDZA 2E4XA 5JNUA 4IXDA 1HDGO 3D81A 5EIBD 3U0VA 4XGRA 3M6MD 5BOSB 3LECA 1E2JA 2DR0A 1I01A 1T34A 3KZVA 4GI1A 3UWSA 2YNMC 4I3FA 3RHSA 5B55A 5F7XA 3TECE 2R2GA 3JZAA 4P3NA 5A9SB 4DV5B 4ZC1A 1NATA 1YBAA 2RBEA 3FFWA 5BSGA 1GAXA 2FP3A 2NPIA 2CLHB 4FYYA 3DAHA 5EZQA 3DNPA 2VBGA 1QCDA 2ZUCA 2PUBA 4TV9A 3F6EX 4J9VA 4Z8YA 3X2SA 3IV9A 2V54A 3TLMA 3AL2A 2YJTD 1SR8A 3VSBA 3WO0A 3TSAA 5AKHA 1MVNA 4ZT4A 1BOFA 2PX8A 3MWYW 2OSBA 4R1MA 1QO0D 2XUAA 1Y9EA 4M83A 5AVWA 1Z0UA 4M9UA 1XZEA 1CETA 5EXXA 4C22A 4D96A 3RAGA 2BONA 4WEQA 2O57A 3TMKA 2O0HA 5J2TB 4MPRA 4EO9A 4X45A 1NXSA 4DBLC 4KQFA 4HKTA 1DPFA 4B75A 1UT6A 3GUUA 2XDAA 1E7WA 1IXRC 3G82C 1ZJZA 3PXAA 3SYRA 5HS4A 1QKKA 4ND2A 4BE7B 5B36A 1V2HE 4C5AA 5JT1A 1DC8A 1PL0A 4LVNA 1B8OA 1E9FA 1Q0QA 2P9QA 1QZ3A 3IUEA 3O2NA 3UJ6A 5JCPA 1DB3A 3FRIA 2IA5A 2GR9A 7MDHA 1T1IA 3A1EA 3DOUA 3WP0A 4HL6A 3SC2A 4BO3A 2A1IA 5DHTA 3FCEA 1CFZA 4MB0A 2FR8A 3W5SA 3DUWA 3RAPR 1TVEA 1WV1A 4PBRA 2QRVB 4E32A 4JI5B 4B7XA 3EGXB 1V2GA 2PRZA 1FFWA 4BNJA 2FR8C 4Q3OA 1E1CA 1NLMA 2FUG6 1GILA 1NVBA 1I5OA 4G65A 3RIXA 1S96A 1BMFD 1YFZA 2IUYA 2J87A 3FPGA 2OHFA 1T0UA 4DCNA 4Z1MA 2O06A 2I1QA 3P2IA 3LUCA 4LE0A 2C7BA 4V0NA 1XN1A 5CM2Z 1RKQA 5L9AA 4KR7A 5LXTB 5TT1A 2V0CA 4IG9A 4A0QA 4OJTA 1MW8X 3L9WA 1IPFA 3OU2A 1HTWA 2C20A 1GCUA 9ATCA 4XQ0A 2HEIA 3NTLA 3FHTA 1OOEA 3B1VA 1OXUA 3ECAA 3Q87B 3BD9A 3NEAA 3I3SR 1UP4A 1SN7A 3KK0A 3IHWA 1MO6A 4EGAA 4DG8A 3H2YA 1SM4A 4Y1GA 1JDVA 1PBTA 3T5CA 1FS4A 3GLHE 1CD5A 3D7MA 3F9IA 1DCKA 1F51E 3IKTA 3QVTA 4US0R 3R8CA 3LMKA 3VNVA 4E09A 5AP9A 3A6EA 5C8DA 2DBRA 4CCSA 1O7JA 3CPSA 3G2QA 5SZHB 4NG5A 1P2TA 4EZEA 1XZAA 2R87A 2AG8A 1A9RA 2H16A 3FUUA 4RLQA 1RS0A 1PEYA 1IY9A 1PJZA 2M1XA 3EXHB 2NXCA 4NOKA 4DY4A 3KKMA 4XUEA 4XCQA 2APJA 4RD3A 3JWEA 4WXYB 4YYEA 3ZS9A 2BELA 5B1YA 3TL6A 3U4MA 1YO6A 4N40A 4TKMA 5DDIP 4H7DA 5HHTA 1P5ZB 1VPDA 4FE3A 4KX3A 4XFKA 4B6OA 3IAM1 2A5FA 4YRIA 2ZJ5A 4K5QA 1SB9A 4TV9F 3V4SA 5LFAA 1E3SA 1MABB 2CFIA 3GZ4A 3U3ZA 5DM60 4LECA 3N8GA 3K32A 5AQ1A 2F64A 4L0CA 2JH3A 4Q24A 3C3JA 3SWWA 1VJ5A 1E77A 1A4IA 2GKGA 4OB6A 1T13A 2FRDA 2IW3A 5KNDA 3LPNA 1LNQA 4JFRA 1ULTA 1JUDA 3Q85A 4K9OA 3VYTB 1JSXA 1LS6A 2FRDC 2YZ7A 4UBIA 2V03A 3FTDA 5F9FA 1I94B 5FULA 3CPJB 5EUCA 3OQPA 3U09A 1PVDA 4ED9A 1OY1A 1JFLA 3L4KA 3FIJA 4J3FA 3ISTA 2I7XA 3CJQA 4OQFA 4P54A 1GPH1 1KKLA 3LO8A 2NU7A 3GCGA 2BHTA 1ISFA 4G5GA 2Y9PB 3DE4X 1LV7A 3D8HA 2D1FA 2FFHA 2VYND 2D7JA 3A1CA 4KXNA 4TSFA 3SHQA 5CEFA 7REQA 1HKUA 5EQJB 2B1IA 3ZW7A 3HP1A 1ZR4A 3A6HA 3NAQA 3FWPA 3WMWA 1LBTA 2JIZD 4WASA 4CIVA 4FP9A 4F04A 3IALA 5LM3A 1G5RA 3AVYA 1LBQA 3L01A 1Z7BA 3H84A 3IT2A 1ML3A 1NJ6A 2ZJZA 3CRW1 3H19A 4ITUA 4JIMA 5GM2A 4WINA 4HDMB 5B30A 1PJ3A 1F5NA 3RW9A 1WXQA 2H4HA 3IV7A 3DL0A 3GMDA 7ABPA 2I6SA 4TMWA 1P2VA 4UXJA 4MUYA 2HIGA 3HR8A 3U1TA 1JYSA 1XNGA 2HDHA 4NJEB 1GGMA 1V8PA 3E7WA 1AUOA 1K8XB 1HDXA 1PS8A 4GXTA 3W90A 4H3HB 5DXAA 2Q8NA 3B6MA 4N82A 4WI1A 1PGJA 1T4MA 4F2WA 4X93A 1TO6A 4BBPA 2CXTA 2R5NA 3USES 1ICEA 4Y6RA 2FPPA 2DY1A 4NBNA 1EFVB 2NZJA 4AXBA 3PNMA 3HUFA 3PKJA 5J5CA 5JI2E 4L8LA 2WWRA 5DGXA 4MYUA 1CVIA 3B3JA 1RYHA 4NBSA 3TE6A 2BRUA 1BDBA 1YC5A 5DCYA 3GP5A 2I7DA 1DC3A 1UJ2A 2H1CA 2PT5A 4WXHA 4PS0A 3G2JA 4LY0A 4W1RA 1KL7A 3CSUA 3VUEA 1NBMD 4YRKA 4EUNA 4CVNA 4R3WA 2V7XA 2WB2A 2HO5A 1SAYA 5DLPA 4TL7A 1MO5A 1JDJA 3KTFA 3NWEA 2Y1GA 3E2MA 2OCPA 2IHBA 3AVQA 5BQPA 1ZD4A 1C0LA 1D4OA 4IDBA 1A2BA 4G23A 1Q19A 1XP8A 4U8HA 4U1RA 3GLIE 1V4NA 1WXHA 2IZ6A 2YOFA 2WJPA