4CVNA

Structure of the fap7-rps14 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
GMLIAITGTPGVGKTTIAKLLAEKLGYEYVNLRDFALEKGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHLSHLMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENVIEVDTTNKTPEEIVEEIIGLIKSGVKRRVGIVDWSEVYDEIIPYLRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
molecule keywords PUTATIVE ADENYLATE KINASE
total genus 68
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4cvnA00
1WXQA 1XRJA 2VRWA 3CLVA 1AA9A 3G0HA 1ZIPA 1E4YA 4B3DA 4HAVA 3EPHA 4QBFA 1E1RD 2R2AA 1R2QA 1NVVQ 3RS7A 2V3CC 3AV0B 4EJSA 1HV8A 4M1SA 1IJFA 4OK6A 4POAA 2CHVA 2RGCA 4TTRA 3L0SA 3MUFA 5B30A 2YWEA 2H8KA 2WOJA 1OF1A 3B1VA 2C03A 1Q57A 3DMNA 3PFIA 2IX3A 2YC2C 3MWJA 2C77A 1XU4A 4DCTA 3VR2A 4QJ4A 3I73A 2KE5A 3DKPA 1YZQA 4Q00A 3KL4A 4HAXA 3BH6A 4HZUA 1UBEA 2DCUA 3QF4B 2X2FA 1ELOA 3R9IA 1XJCA 3B7GA 4IVPA 2QTVB 1FNNA 3QENA 3P27A 1YHNA 3AF1A 2ZRCA 1E1QA 3OIWA 4Q4HB 2BOVA 2RGGA 4AC9A 3SS8A 4IOLA 4W7SA 2QENA 1TF7A 3U4QA 3EZ7A 3M1IA 3HR8A 2HF9A 3GJ4A 2IBMA 2OSBA 4B6FA 1T3LA 3FMOB 2QN6A 2YC4C 1R7RA 4PTLA 5KNCA 3Q9LA 3EASA 3GLFE 2NZ8A 1DPFA 4FCTA 4UNRA 5J47A 1R0WA 3AH8A 3WP0A 4NKRA 1E0AA 1R5BA 1G8FA 121PA 2GJ9A 2VP6A 3BE4A 2BVNA 3W3AA 3OEED 1XZPA 1YR6A 2ZRAA 4ASUA 2HDNB 1KI9A 1NLFA 1X1SA 5AUOB 4JKYA 4ZO4A 5B64A 1TUEA 4ERNA 2HCJB 1TTTA 2WJYA 3AM1A 2FJUA 2RHDA 3Q5EA 4G3XA 1QHNA 3DO6A 4JLJA 4TL8A 5AK0A 1GITA 3Q3JB 5FOUA 3VAAA 5JHGB 5JS8A 4PC6A 1F48A 4AKGA 2WICA 1T5IA 1P2VA 4C2UA 2J45A 2OFWA 1I4DD 1TPZA 3TJZA 2G9NA 1OXSC 1PV4A 1XF9A 3B78A 4TYWA 1J99A 2MSDB 4WBSA 1IHUA 1L8QA 1ONBA 3I1FA 4D4LA 4HSEA 4IJMA 4DCSA 5H1YA 3RVBA 1IN7A 5FBRB 2CL0X 2X8AA 2MMGA 2RGXA 3EPJA 4NPHA 5FPKA 2BJVA 2QMUA 1WQ1R 3D3QA 2TMKA 2ZRMA 1F3OA 1RE0A 3SJCA 3B6EA 3CW2A 5HCNA 5AUPB 1KJYA 1YJ5A 2IW3A 1VKJA 2JDIA 3NBZC 1JAIA 3NBYC 1RRCA 3H4MA 1P2SA 1DG1G 4FXPA 1Z6AA 4YMWA 1XD2A 1DAKA 1W4BA 721PA 2D62A 2OBMA 3O8BA 2JLUA 4EPYA 3EC1A 5AUNB 1RYFA 3EAQA 5JWHA 2GETA 1L2TA 3EZ6A 2N1BA 4FMBB 1CXZA 1MO3A 1QG4A 3QEJA 4F91B 2NGRA 3THWB 1N6PA 3ECCA 3QXXA 2IS6A 1T0JB 2H17A 4MYUA 1DAHA 2HV8A 4MKIA 2A5YB 2J0UA 2CLSA 2G3YA 4FCWA 1K8RA 1AS0A 3AKEA 3P26A 3U7FB 1G3QA 4AKHA 4N0DA 2GEUA 2VO1A 3G5UA 2PEYA 3Q7PA 4NYIQ 1OV4A 1ZAKA 2JEOA 1JB1A 2XAUA 4UXIA 4UNNA 2UZ3A 3SR0A 1C4OA 4LZZA 3ZS9A 3I5XA 1G7CA 2H16A 1F2TB 3VX4A 3X1WA 3GLHB 5K8UA 2JASA 3HJNA 4P4SA 4IOMA 4YMTA 3OAAA 4HUQB 4LJ5A 3GEEA 4R7ZA 3RSLA 3W5JA 4OYHA 3TH5A 3LO5A 4GRAA 2P0EA 3AVUA 2GVZC 4TL9A 2OLKA 2GCOA 3CNNA 4JKIA 3TSOA 1E2LA 2VIIA 2H57A 4ARZB 2AD5A 1U81A 2ZRBA 2ZSDA 2UVQA 4KLZA 4YDSA 3U3JA 3RSOA 1PLLA 3PQCA 1SKQA 2WHXA 4TYQA 1MABA 4BFUA 1RC8A 3I8XA 3U3RA 3RS0A 2BBWA 4TMKA 1KSHA 2BEKA 3SC3A 1E9SA 3PITA 4F92B 4P3YA 2O8EA 3GLFA 1A2KC 3Q7QA 4ASUD 2C04A 4GOKA 2J46A 1U8YA 5IK2A 1KYIA 3WYFA 1TQDA 4PHFA 5DI3B 4V0KA 1T5LA 1KJWA 2GTPA 4I1OA 4RFSA 1TAGA 4LHXA 2XNDA 2EU8A 2QE7D 2QMHA 3RS2A 5CIWA 1W36C 2FX3A 2ZSFA 1AM4D 2B21A 3CO5A 4UXHA 4PAMA 4YMUA 2CJWA 5KHOC 3H1TA 1XTRA 4IEIA 4WZAE 3UMSA 3DOFA 3NKVA 4Q7MB 1Q1BA 2OG2A 2CLDX 3AVTA 1QHYA 1AQYA 1T4GA 5TY0A 3A8TA 3RS3A 2DFLA 3ND8A 1RRGA 1E9RA 1RZ3A 3KFXA 2EFCB 2OAQ1 4L8GA 5AJYA 2QAGC 4KSBA 3W8NA 4TZ0A 1FW6A 4BLQA 1II9A 2IXEA 4EUNA 3EZ9A 1GL7A 3K09A 4C0BA 5JI3E 1U8ZA 3LQRA 3VKGA 1BH2A 4L15A 4NYJR 4A6XA 2RGDA 3L0IB 1EFRA 2JJ1D 4B71A 2CHQA 4DXAA 1UKZA 3O8RA 3OEHA 4TWZA 2IUTA 1KZ7B 2HT6A 4NHOA 4IHQA 4AI6A 1P72A 3QG1A 1PZNA 5J4LA 4TSFD 1NVXQ 2WMNB 2ZIAA 4IKEA 4TLCA 2FZLA 4JLMA 1XTIA 3EG5A 3U4QB 2Q6TA 1NSTA 2VHTA 1T6NA 5A4JA 5FUXA 5C46F 1FQJA 3TSWA 3ICQB 3KQUA 1X8KA 1OE0A 2AWNA 4JZKA 4Q18A 5D3QA 2ZSAA 4KI0A 4DSUA 3S1AA 4B32A 3AUYA 3QVUA 4KYUA 621PA 4G5SA 3KXLA 1II8B 1ZRHA 2HXSA 2XTNA 4C0HA 4F4IA 2EWWA 3ZIAA 4XD7A 2OT3B 3AEZA 4LYAA 4MRVA 3AKCA 5CM8B 1MR3F 1G3RA 2RKOA 3CF2A 1Z0KA 4OK5A 1KY2A 5LB2A 4CYMA 3W34A 3ADCA 3MMPA 1XCMA 3DHWC 2QROA 3LA6A 3THWA 1I2DA 4YXWD 2QTHA 3GEHA 4R2IA 4UJ3A 2W6JA 3QKRB 4OKSA 4A15A 1FX0A 2DFKB 4JYBA 1DAFA 4F93B 1KOFA 1ZVQA 2XITA 1OXUA 2EWVA 2ZPTX 4DIEA 5G3YA 3W9YA 1T3HA 4MRPA 1M74A 1KK2A 5DYGA 1ZD8A 2IXFA 4MRSA 4PO1A 2WKRA 3ZQ6A 2ONKA 4F7WA 5JZVA 1TADA 2WMOB 2ZJOA 1YRBA 4PQFA 3ZD6A 1E79D 4LJAA 5HKKD 2W2VA 4PSVA 4NONA 2CL7X 2FU5C 3LQQA 2QP3A 2Q0HA 5M04A 8OHMA 1OB5A 1N5KA 4URUR 1JJVA 3Q5DA 2ZETA 1LVGA 3BGWA 3BH0A 3VX3A 5FR1A 3HP1A 4ILEA 2AL7A 4ZIRA 3B1XA 1KMHB 4PX9A 3A1SA 2IYQA 4TL7A 3U44A 2GJSA 4TQ9A 4FCVA 2GBLA 1E6CA 1IBRA 3A6PC 5TARA 1FP6A 1DAGA 1XXHA 2W6IA 2WJJA 2FFBA 4DLUA 4DLZA 2HEIA 2ODNA 4LBVA 3SJAA 3EA0A 1QG2A 3NHAA 4GOJA 3K1JA 2MSCB 4FWIB 2FA9A 2NO1A 2QL6A 1X8JA 1ZM9A 5DLQC 5HE9A 3KTAB 2JAQA 1KKMA 1L7VC 1W48A 4UQOA 4RD2A 2O8EB 1E2MA 1HE8B 1IN8A 1XEFA 1OHHD 2VSOA 2OCBA 5FL7D 1IXZA 1T8TA 2J7PD 3SYNA 2AXPA 3X1YA 1IJEA 3I4LA 3LW7A 3U60B 1KK1A 2EFEB 4BRUA 5DYIA 5J4KA 1ZC3A 1J8MF 2D06A 1VG8A 3HYRA 4M1MA 4YDHB 3PEVA 3K0CC 1T8UA 2IT1A 3MCAA 3NC0C 1VIYA 5A5GA 2YZ2A 3A4LA 3WBJA 3T1VA 1UF9A 2ZE7A 4XJXA 1Q44A 2I1VB 1Z06A 4Q19A 4ZV4A 2FDCA 2R44A 1NVUQ 4RKFA 1B23P 1P9NA 2YOHA 4QJ5A 1W7AA 2QMEA 2FN4A 4QBHA 3VNUA 2ZYTX 5KSZA 1XPRA 3DVLA 4RD3A 3HPQA 1G7TA 1W49A 4HLDA 4D4MA 3RNLA 3MG9A 3KFVA 2QSZA 4UNQA 4OQXA 1CR1A 4ARZA 2BM0A 5EXTA 3KDSE 2OV2A 2Z83A 1JPNA 2REOA 4HUTA 2IS1A 1EFUA 1Q3HA 3I8SA 1Z2AA 2I4IA 3BAFA 1XMJA 5EE3A 3VTKA 2BMFA 1GTVA 1GRNA 1NBMD 1HT1E 2JJ2A 1E0SA 4Q9LA 2R6AA 2ANCA 1XFAA 1N6IA 2PJRA 1RFLA 2YNMA 2VH5R 2VSFA 2F1RA 5CM9C 1AS3A 3SDZA 3FGNA 4CEIB 3FTQA 5L3RA 4NBSA 3SFZA 4FD2A 1S8FA 2D3WA 1D2MA 2FSIA 2Q21A 1MRNA 2CVFA 1RJ9A 4OI4A 1WBDA 1VG9B 2ZR9A 4US1R 2YV5A 4OHYA 4TTQA 1KKLA 2WWFA 4XSGA 5SZJA 3CRVA 4W5WA 1E3MA 3FKQA 4H1VA 4LCBA 2ZQ5A 4BFWA 2G0NA 3EC2A 4JLNA 1W0JD 5KO2A 4Q7KA 2QAGA 3OZXA 2IXGA 1G3IA 3UWOA 4JLVA 2WWWA 2SHKA 4HDQB 1HUQA 5KPJA 2J5XA 1CJUC 4LBWA 1U9IA 3SBEA 2H18A 5JMTA 1W2GA 1XNJA 2OILA 2PMKA 4DRZA 1Y63A 5K8TA 3P4XA 2V55B 3R8FA 4ZCIA 1ZIOA 2ECKA 3NIBA 1E98A 3AP1A 4QNMA 5KU1A 2AN9A 3OFND 3QBTA 1ZC4A 3KKOA 4CGZA 2IEZA 4CT5A 2XXAA 3FE2A 4MA4A 3GLGB 2ZREA 1YR7A 2DFNA 3PXGA 2QBYB 2WIBA 4FMDB 1ZYUA 5CK5A 3ZZUA 2CDNA 5KDOA 2OZEA 4HLUA 2ZXUA 2W00A 4HB2A 2R6CA 1KAGA 1CRPA 3FDIA 5JCZA 3CZQA 3FHCB 3WHLA 2D2FA 1G9XA 4RCZA 2R62A 1E2KA 3CF6R 5CDFE 4W5JA 2C98A 3QXCA 1D2NA 4Q9HA 3QKSA 4JMPA 1VCNA 2N42A 1H8HD 2ZUBA 5P21A 1ZD1A 4B34A 4OHVA 2AKYA 3HU1A 1G5RA 3VR3A 1VHLA 1X1RA 3IQWA 1E0KA 3RC3A 5B57C 1ZU4A 4AK9A 3QPUA 3LNCA 3PEUA 2NPIA 1N0WA 1WA5A 1Z63A 2QEQA 1U98A 2F9LA 4JJZA 1ZNWA 3ZH9B 2ZJAA 2ZRKA 4ON9A 1BYIA 4QHTA 4DLYA 5JSZB 4B76A 2PH1A 1R10A 2QRNA 1OIXA 2ERXA 2JLQA 5CDFA 4E07A 3K09C 3BC1A 2WSSA 5KPDA 3PEYA 2DWOA 3MAAC 2PLRA 3AVQA 3QJYA 2WJVA 4V0OA 1J8YF 1UBGA 1XCPA 1P75A 4XVQA 3B1ZA 3DKVA 4BLOA 3Q85A 2ZEJA 2F6RA 3WNCA 1CJMA 5G3ZA 1GP2A 1I2MA 1YU9A 3EIQA 1IXSB 1OW3B 3QOFA 5E7JA 4E5UA 1PVOA 4NZYA 2QT0A 2WPDD 1G5TA 4K81B 2ZR7A 3M6AA 1U94A 1NKTA 1R6BX 2CE7A 2BJWA 4FMCB 4A2PA 3QF4A 4DLRA 1ZUHA 4GPTA 1TF2A 1Z47A 1EGAA 4IW3B 4EFLA 2ATXA 4Z54A 1Z0JA 3AF0A 3HDTA 1CJTC 4QXAA 1VG0B 1BKDR 1E79A 3CRW1 4G5OA 5FI0B 2JIZD 3CNOA 3CWQA 4GBMA 1KI4A 4IVRA 4JT2A 4D0LB 1IN6A 1WMSA 2QPAA 3SYKA 3TUIC 4Q66C 4B35A 2CNWA 3B1WA 4ZDWA 1KI2A 3FMFA 1XD2B 4HLCA 1KI8A 4Q1DA 3I61A 4TYYA 4GSYA 4R2HA 3W6PA 1O3YA 2C9OA 2J0SA 4GZLA 2AKAB 4MGKR 1UBFA 3IO5A 3OIYA 3KQNA 1NLYA 4D0GA 1M7HA 4Q47A 4D4JA 3OAAD 1ANKA 4JLOA 3RS5A 2VEDA 4C0JA 1VMAA 4LV6A 5CJ2A 1U8AA 4DKXA 2H5EA 4EFNA 3TBKA 5EUQB 1G7RA 1ZM4A 1LB1B 2ERYA 1Z3IX 3AGPA 1YR9A 1KK3A 1NJGA 1E2QA 1KIMA 2QQEA 4Q1BA 2HCBA 3LV8A 2A2ZA 4D2IA 3TUZC 4E09A 2QP9X 4RD1A 2BCGY 1WRBA 1ZU5A 4YLGA 4BZXA 1IY2A 4XVRA 4AYWA 1FL9A 4TSFA 2WJGA 3FMPB 221PA 4WOPA 1N6HA 1IY0A 1QHHB 5IF9A 2JLWA 2WJHA 3KJGA 3OEHD 3E5HA 2FFQA 5JWRA 2JJ1A 1LTQA 4PPQA 1SKYE 2QBYA 4EQ6B 1GNRA 3CRQA 4D80A 3T34A 1Z22A 3IEUA 2AXNA 1NMXA 1G4AE 1TQ6A 1JJ7A 3WHKA 3SBDA 1TU4A 3GQBA 1UDXA 2PZEA 3GJ0A 4DIDA 3ZVLA 1KDTA 1NIPA 2IYRA 1G1MA 3IDQA 4NCHA 4LV5B 5TB5A 2ZE5A 4AYXA 2ZS7A 2QM8A 2H1LA 2CCJA 3P32A 4QJ3A 1YZUA 4JL8A 2EFHB 4MDFA 2XSZA 4XOIA 2QE7A 3HWSA 3IBGA 3QI2A 4EPRA 1DADA 2ZJ8A 1OH6A 4BGDA 5L3QB 3AP3A 2PCJA 5EJEA 1R8QA 1XWIA 1P61B 5IK2D 1OH8A 1NVWQ 3L2OB 3QXSA 5EUMA 1OKKD 3GJXC 1KAOA 2CNWD 1Z8FA 2ZRPA 1E9BA 3WNBA 3I32A 1FMJA 2ZJZA 2IYTA 1HQYE 4LPKA 4RFVA 4P31A 3KQKA 4M9ZA 2HXYA 1P6XA 2X19A 3SYLA 4LJ9A 1XEWX 4LDJA 5F2EA 4MYTA 3B2EA 2JIZA 1J7KA 3F3YA 2VBCA 4JLPA 4CEJB 2UKDA 4MKFA 2WV9A 5L3VA 1GILA 2HYIC 1FUUA 1GRRA 4PQRA 4TTPA 2F1JA 1Z83A 4JVMA 4Q7JB 1LY1A 2B92A 1TU3A 3K0EA 4EKDA 5JCPA 5DI9A 2A9KA 1LS6A 3RS4A 2QU8A 3KJEA 3TLXA 4M1WA 2AK2A 4X8HA 3NHBA 3BFKA 1S1CA 5H68A 1EK0A 5E4FA 1VCOA 5C18A 3DMDA 4JT4A 5EE9A 3T35A 2G0TA 2O5VA 3KKQA 4Z8YA 1EXMA 4C0LA 4CT4B 4M2LA 1NKSA 4CW7A 2J87A 1AGRA 3PVSA 1FQKA 5J40A 4AURA 5IT5A 4EFMA 1SVLA 3LVQE 4NCJA 2AR7A 4LK2A 5CYPA 1KO7A 3B13B 2GCNA 4A9AA 2LCFA 5GVSA 2BC9A 2Z4RA 3KJIA 3SFVA 4ZCLA 2JGNA 1XDBA 1SQ5A 2K5UA 2C9CA 3BB4A 2CE2X 4QRHA 2IS2A 1D8TA 5DNYB 4A6PA 1C9KA 4B73A 3TVTA 3NC1C 3LX5A 3UANA 1E9AA 1F5NA 3UIEA 3O8CA 2YKGA 3NDBB 1BOFA 3CPJB 1H8HA 2EFGA 4C2TA 2PCLA 2ODBA 2YOGA 1A7JA 1FX0B 4EJSC 1G19A 3U3MA 1YZKA 3QE0A 3LVRE 2FEMA 2J9RA 5JECA 2IK8A 2NO0A 2OESA 5ANRB 3B8HA 2AFHE 4M4SA 3LFUA 1P3JA 2QNRA 4DUGD 2A30A 2Q3MA 5CYOA 3KUDA 4LJ7A 2P65A 1JR3D 1ZNZA 3PG5A 4DT1B 3O47A 3AVYA 2OFOA 2HYDA 2PT7A 4G0NA 2ZROA 1MOZA 1O87A 4ITRC 5FI1B 2G88A 2P5TB 5KTYA 3LLMA 1HQCA 3ADDA 3TAUA 4DSOA 1JBKA 4TMZA 4Q9JA 3RRZA 4E22A 2IYUA 2NO6A 1G18A 2XOKD 3NH9A 2WZQA 3IGFA 4YONB 5BQ5A 1DAMA 1IXRC 4IDHA 1KK0A 3E2IA 2C2HA 1E9FA 1XXHE 1E2DA 2XTZA 3ADKA 1II8A 3L43A 2CEAA 4TLBA 5DHFA 4AKEA 4D6PA 2BMEA 3LW8A 3IIKA 5CB6A 1G6OA 1HE1C 3KKNA 4B47A 3W6OA 2GAAA 5LD2C 4N0EA 3OHMA 4BUJA 4EPXA 1EFTA 4LPSA 2JA1A 2V1XA 3QSYA 2N46A 2BBSA 3T1TA 2ODWA 4A0FA 3DOEA 3I92A 4MGZR 1E2NA 1MO5A 1KO4A 1YZNA 2EYUA 2C5LA 4OHZA 2ZAMA 2XB2A 2YWFA 4IXMA 4LI0A 3BBPA 1DEKA 1E2HA 1Z2CA 3CZPA 1BMFD 4TQAA 1N6OA 4WIAA 4NCNA 2O52A 3FFBA 3HR7A 1KDOA 1DVRA 3P20A 4FMCF 4BFVA 4O2RA 4KFUA 1JR6A 2WAXA 2ZRFA 3QPWA 4B2IA 1EG7A 4U00A 5JLJA 1QDEA 1KY3A 2WWGA 4X8OA 2F43A 3K9HA 4Q1FA 3CX8A 3THYB 5HE8A 2QI9C 2WAYA 2H92A 4ZI2A 2GK6A 1GFIA 1NMYA 1ZD9A 1Z6YA 1NBMA 2IHBA 3CWZA 1Z07A 4MH0R 1GKUB 2O0KA 4KSCA 3UATA 1E2EA 1S9DA 4MGYR 4C0SA 1VCIA 4DZZA 1CS4C 4DT1A 4Q7LA 2ZM5A 1U99A 2OCYC 1KO1A 1SVKA 3WYGA 2NIPA 1N6RA 2J41A 4E03A 4CF7A 1AK2A 3PUYA 4DLVA 1NN0A 4A8JB 3NDPA 1N2CE 3PUVA 1OT3A 4TMXA 4V0NA 3NBFA 4P4TA 3X1ZA 5L3QA 4Q01A 1Z6TA 2OBNA 3LRPA 4Q4AB 3PENA 4C30A 4OI0A 2QSYA 4LJ6A 4U7DA 4C7OB 4DCVA 5F98A 3K0AA 2CXXA 2NTYC 2OXRA 2VP9A 1A82A 1UBCA 1SVMA 3VKHA 2V7QD 1AKEA 1OFHA 4L16A 5FFMA 2J7PA 3PV0A 4US0R 3KB2A 1KSFX 1UEJA 5D3MA 2A5GA 3V4RA 2QT1A 1T9HA 1QHIA 1W0KA 2I1QA 4FIDA 4TT3D 4LX0A 3WBKA 4A36A 4F4JA 4CEJA 1M6NA 4K8OA 2REBA 2Z43A 4AWXA 2NMVA 2LWIA 4TL6A 5UKDA 2W2TA 1GL9B 2IF0A 2BKEA 2JCSA 2ORWA 4M9SA 4QHSA 2RCNA 3GP8A 4TN1A 3VHLB 1CR4A 4D82A 2WIAA 4DLWA 3AP2A 4NCIA 1YQTA 4JSTA 1QVAA 4RCYA 1R0ZA 3W5IA 1FPMA 2Z0MA 3AB3A 2ANBA 1ZM2A 3CR7A 4F38A 2VP5A 2GZHA 3SJZA 3PCRB 1VIAA 1G16A 4WVFA 3NWJA 4A2QA 4EAQA 1N25A 3PEWA 3TW8B 3AF2A 3KQHA 2ZJYA 4V0LA 5DN6D 2MSEB 3D6TB 4GP6A 4QGFA 2P6RA 2IHYA 4BASA 3FKSD 4ZDJA 5KDDA 1CR2A 1IM2A 1TNDA 4HUQA 5HKKA 2Z6VA 4MUAA 3NVAA 3T06B 3GLHE 1OXXK 4QOSA 1NL3A 1XD9A 1GKIA 1GAJA 2J1LA 3RWOA 5BN5A 1E9EA 1ZJ6A 4KXFB 2JJ8A 3DPUA 3WP1B 2OBLA 4HB4A 3RC8A 1JPJA 1F60A 3CPHA 4AIIA 2W83A 4OBEA 5FTMA 3GMTA 3U6BA 2YINC 4H1UA 2PMDA 4V02A 1CULC 1LV7A 2IYZA 2YWHA 4LUCA 3MJHA 2HLDD 1GRQA 4BZQA 3AKDA 1ZINA 4N1AA 2RGEA 2MMCA 4OL0A 3C15C 1VYUA 3ZVMA 2B8WA 1XEXB 4O3MA 1GSIA 1XB2A 3I3SR 2OCAA 1UM8A 4GFDA 4OQNA 1DE0A 2V4ZA 1OXTA 1GVNB 5JWOA 4C7OA 4URYR 4S2EA 4KCGA 3UMFA 1WBBA 5KDLA 4O2LA 5CLLA 1COWA 5DI3A 5GJCA 4ZKEA 2ZJBA 2GZDA 5HTKA 1W4AA 4NP6A 3LXRA 3ZS8A 5ELXA 3IIMA 3GJ7A 4GMDA 1U2RA 1E0JA 1XMIA 4L4UA 3QKTA 4DCNA 5G40A 1QHSA 1E2JA 1IY1A 1M7GA 3GFOA 3TW4A 2FV8A 3LXXA 3RHFA 3D7MA 2GF0A 1W47A 4C0AC 4F4CA 2GNOA 1P9WA 3MWLA 1YZGA 2FFHA 2KI5A 4XTCS 1XTJA 4M9QA 3KZ1E 4LHYA 3T1OA 5L8VA 3R8CA 5KSYA 1E2PA 3F5FA 4W5HA 5CITA 2XB4A 1KDRA 3UK6A 2GKSA 2J0QA 4B43A 2ZI3A 5CLQA 5E3HA 4M8NE 4PQYA 4XWAA 2UZIR 2ORVA 1W4RA 5TDHA 1NG1A 4LHVA 3SEAA 2FGJA 5EP2A 3K70C 2IYSA 2OM2A 5TV2A 1U0JA 4HDOB 4A2WA 1MO6A 3R7WB 3ADBA 4UNSA 1IQPA 2R6DA 1Z6XA 2V8OA 4Q4JA 1OYWA 4RKEA 5FBQB 1KSJA 3OIUA 2NQ2C 5JJIA 1AGPA 1CU1A 1US8B 4IOJA 1OIVA 5KSPA 3VFDA 5BW8A 1H8ED 2F1HA 5B2ZA 4JVNA 4PZZA 1ZUIA 2DWQA 2EQBA 5EE5B 2FGKA 4LJYA 4H9GA 5JSZA 1G291 3MJRA 1E9CA 2CJWB 1E4VA 2DB3A 3SNHA 3PUXA 2WJIA 2GWHA 2DPXA 5KSOA 2X77A 1AS2A 1KNXA 3MFYA 1R0XA 3VU9A 1JNYA 1RRPA 3K70D 1I4TD 4DC9A 1XPOA 2HT1A 5FUWA 4C0KA 4P4SB 1VG1A 3LH5A 1XTKA 3CKLA 4JYCA 1LNZA 2F1IA 2OO7A 4BECA 2A7QA 3RANA 4XH9B 1Z0FA 4X8LA 2Q9AA 2ZS9A 4TLAA 1YRAA 2E1RA 3BFVA 2XNSA 2RGNC 3NH6A 4KHZA 4L9WA 5IDVA 3O8DA 1NLZA 3KXKA 4HAWA 2R6GA 4ZDIA 2X1VA 3C5HA 3B82A 4M1KA 4WAUA 1XEWY 2CHGA 2VP4A 4AG6A 2O8DA 5JI2E 3U3OA 1HEIA 5EXSA 1MABB 2XSZD 3CX6A 1E2IA 3D8BA 3MD0A 2ZI5A 1HYQA 2ZI4A 2GHIA 4MQBA 4PSKA 1Y3AA 1A1VA 3S1AB 2BCJQ 2WWIA 3GCGA 2AK3A 3PR1A 3IO3A 3BWDD 4DLXA 2XZPA 2ZVPX 3IILA 2F55A 2G6BA 3FYHA 3FHOA 4JL6A 5AUQA 4QC2A 1TQ4A 3F8TA 2REXB 1P9RA 3RRNA 4KFSA 4DLTA 3REFA 3ASYA 1YVDA 2D7CA 2R8RA 2ZE8A 1A4RA 1XX6A 1G5PA 2GF9A 1VDZA 3KJHA 2G1JA 2IYVA 4KV9A 4U5XA 4W9MC 1KI6A 1UKYA 2FSFA 5K8LA 1CRQA 5GJBA 2F7SA 3QKRA 5F9FA 4IDPA 5JJLA 5SZKB 2ZYWX 3QVVA 2VSXA 4Y0VA 5BYJA 4HEJA 4RZ2A 2IF2A 4G5RA 1T3SA 2FSHA 2H7VA 2Q9BA 2VL7A 4BEJA 2D7DA 2CBZA 2GZAA 3K0FA 1SXJA 4QM6A 2RGBA 2IUUA 1EWRA 2O8CA 2L0XA 4ZKDA 2JDID 1HURA 2OFXA 4Q21A 1Z29A 1DTSA 5C2JB 3TIFA 5KYKA 4I4LA 4NYMR 1P4SA 2XZOA 1NF3A 1NY5A 3ZZTA 4M1OA 1G3UA 3SI7A 3RRYA 3DM9B 3CNLA 4Q02A 1ZNYA 5A0FA 1RRFA 1M2OB 5DIFA 2OHFA 4PPFA 3BORA 4O25A 4XVUA 3QPVA 2ZI9A 3B1YA 3H84A 4B6EA 4I1UA 2V9PA 1E2FA 2QMOA 4HZUB 3MRSA 2GVDC 3BRWD 1OLOA 4FINA 4QL3A 1TEVA 2ZUDA 1NG9A 4KVGA 4UJ5A 3QXJA 4BLTA 1FP7A 2G1KA 2ASEA 3QUSA 4QNRA 5AJXA 4WW0A 3BB3A 5HR5A 2VP2A 5CK4A 3AVWA 1J70A 4JLDA 4UNPA 1UJ2A 1OKKA 3N2IA 1S3GA 4PAOA 5EP3A 1CLUA 1P62B 1SZPA 3ASZA 4Y0AA 3FMIA 5B58C 3NG1A 1G8HA 4HI0E 4NDZA 4B75A 1A5TA 3EWAA 2QGNA 3SOPA 1W36D 3EXAA 4BLSA 1US8A 2O8FB 1KMQA 4KO8A 3WRYC 2Q3HA 4UXJA 4QBIA 3A1TA 4Z8XA 3WY9A 4BQSA 3PUWA 5KOYA 1OH5A 1RJ9B 2PEZA 1ZM3A 1XCGB 1ZW6A 4EJSB 2ZUCA 3BERA 2P6NA 3DEFA 3JZAA 2IWRA 1IOZA 2PX0A 3TGPA 2X2EA 4JBWA 4M1TA 2OUKA 5DO9A 1TMKA 1V5WA 3VU9B 1N5LA 2RGAA 4V03A 3OE7D 4IFEA 4PC3A 1QHXA 4A82A 1VYTA 2ZSEA 3QKUA 1AN0A 3DM5A 1KMHA 3QXHA 5FOVA 4P0TA 3VHXA 1K6MA 3LAWA 1SXJB 4OQLA 2O8CB 1KO5A 1JXOA 5SZHB 2F3RA 4WA7A 2IYLD 1F2UB 2W58A 2PL3A 2WSMA 3WMFA 2CCGA 2QTFA 2ZYVX 2D2EA 4BFXA 1Q20A 4CRWB 1EFCA 3THOA 3CIOA 5DHAA 1Q1ZA 4A92A 5JJKA 3K9GA 3UWKA 2CVHA 3LY5A 1FFHA 2RHMA 2XJ9A 4HB0A 4KBGA 4I1SA 2QUZA 1RW4A 4OHWA 3E1SA 1XTSA 1YR8A 2PBRA 2ORIA 2FEOA 1EWQA 3JVUA 4IOKA 5FL3A 1ETUA 1ZCAA 1W5SA 4FI3C 3K0SA 2WOOA 3NEJA 2P67A 4M21A 3AF3A 2Q3FA 4RD0A 1EESA 4PC7A 2DY1A 4DVGA 2WWHA 3RABA 4B74A 2YWGA 5JHHB 5DSZA 1X6VA 3LD9A 4ZPXA 3GLFB 2GCPA 1KI6B 2JLVA 1DS6A 3NBXX 2HLDA 4PSAA 2O8BB 4HZIA 1JEDA 2FE4A 1NRJB 2FG5A 3AQ4A 3VR4A 4CIDA 4QKQA 3TKLA 1QBKC 1WCV1 1XPUA 4PHTA 4JSYA 1G3MA 4PHGA 3U7HB 4AYTA 1KSGA 2G83A 1S3SA 5AR1A 3UXMA 5JEEA 3K0FB 4LSGA 5F9HA 2ZRGA 4DDVA 2VP0A 4ZDKA 1XZQA 5DISB 1A2BA 3TUJC 5G41A 1MO4A 3FKSA 5FBVB 3AKYA 3RYTC 3FB4A 5C1BA 3WMEA 3M0EA 4Z1MA 4WXRA 3SZRA 4CVNA 4D4KA 5FH9A 1UDWA 1G8GA 3EPKA 5DN6A 2JLZA 1NBME 1H8EA 1G6HA 3GLIA 3TSZA 4URZR 1FNMA 4J0QA 2OLJA 3Q8XB 1N5IA 4PZYA 2ZAOA 4QM7A 5KNDA 1E2GA 2A5JA 5LBIA 4M1YA 3CRMA 2GCOB 3SQXA 1G8PA 2LKDA 2PLFA 3ZVNA 4AD8A 2W2XA 4NYJQ 2XGJA 3X2SA 1RKBA 1SVWA 3W3ZB 1IN5A 5J4HA 4GMXA 2BM1A 2R6FA 4A8JC 1SGWA 4MRNA 2QG6A 4RZXA 2FMXA 1SHKA 3U61B 2J0UB 2JJ2D 1ZNXA 4TT3A 3A58B 4I1VA 1ESMA 1XMSA 3EW9A 1DBSA 1FTSA 2Y8EA 4YC7A 1HTWA 1GWNA 4KJZA 3RWMB 4JJKA 2D4HA 2DYKA 3L0OA 5AJWA 1TEXA 1GUAA 2YVUA 4KFRA 2V6JA 1N5JA 4ACAA 1FMLA 1N3BA 2BIFA 4GP7A 2O8FA 1TL7C 4PANA 1DO0A 1II0A 2CK3D 4LJ4A 2ZJ5A 4QG7A 5D3MB 4C3ZA 1FTNA 1JAHA 1CJVC 1E69A 4IEEA 4N3NA 1F2TA 2RGNA 2BDTA 2Z5FA 4M9XA 3ZQJA 5CB8A 4RY2A 5TXGA 4DB4A 1P2UA 1G8YA 421PA 4HATA 2OCPA 2DR3A 1Q21A 4JLAA 2O8BA 2F43B 1XD8A 3TRFA 3BOSA 2IYXA 3KB1A 1TX4B 4OJQA 1S0UA 1SHZA 1XTQA 4DCUA 4EPTA 3K8YA 4MYHA 2XEXA 2GXAA 2GESA 4O0MA 1YZTA 5IRCD 2IWHA 2ZTSA 3TMKA 5C4MA 2CK3A 1Z0DA 1S9HA 2ZI6A 4JIMA 2J0VA 4GOXA 2RH5A 2GBLC 2ZITA 2ZRNA 4B3XA 5LPNA 4PXAA 5FPSA 1S1MA 5FPYA 3BIFA 4RD4A 4GZMA 5FUYA 1OHHA 4LYHA 2VHUA 1UPTA 3BXZA 4IDNA 4K46A 4L5BA 3OFNA 3RLFA 5FOWA 1Z5ZA 2C78A 3U7EB 1PLJA 2A3RA 1NY6A 2CCKA 4LBYA 4A8JA 4RVCA 2V6IA 1YKSA 4KBFA 3TVDA 3AF4A 3W6NA 3WNDA 4EQ6A 1LW7A 1TQ2A 4BRWA 3B5JA 1MV5A 3HPRA 2IYYA 2ZR0A 4Q4LA 2GA8A 2ZJ2A 1ZM7A 3CR8A 4PPNA 3V4FA 4IXNA 1ODFA 3IBYA 4TMVA 5SZIA 4PR0A 2G77B 3C7KA 2P6UA 1P5ZB 3MSXA 4KYIB 3GD7A 2QA5A 4PC2A 4GL2A 4QGHA 5FR2A 1S4QA 5LD2B 1XEXA 3LBNA 4Z1MD 4BFSA 3R9XA 1G41A 3QNUA 4LWZA 1F6BA 5JEDA 3VR1A 3U3KA 1M1YE 1AZTA 1D9XA 4LGMA 3EIEA 1KJZA 2CLCX 3N5CA 3TK1A 1W36B 1CF4A 3IKJA 2FZ4A 1DO2A 3ZLJA 1N6NA 3EARA 4FN5A 1AKYA 1F2UA 1FUKA 1JI0A 2QPTA 4XIGS 3NXSA 1W2HA 1GM5A 1AIPA 5GJVC 2GJAA 1XBTA 1QHHA 2BWJA 1W0KD 4BEBA 4TYPA 4BFTA 2W0MA 4B44A 4B48A 2WTUA 3CB4A 2VPPA 4V0ME 3DZ8A 2V7QA 2KBEA 1KNQA 3L82B 5HPYB 1NN5A 3CF0A 4US2R 3K70B 4G01B 1W44A 1IN4A 4GNKA 3AVVA 4DDTA 2AWOA 4LYFA 1KDPA 1PUIA 4DHEA 1T91A 3IHLA 2FOLA 1JR3A 3R20A 2RMKA 3U44B 1VHTA 4R71A 3THXB 4TQUS 4DUGA 3C8UA 1WB9A 1GG2A 3RDPA 5LDDC 2RAPA 3UG7A 2GILA 2HUPA 2QGZA 3A36A 2ZVQX 5EQTA 5BN4A 1XXHB 1U0LA 4B3GA 4M53A 1OFTA 4DDUA 1X3SA 1Z28A 5K8IA 4ZCMA 1JXMA 1UADA 3LBHA 1DAIA 3IPXA 4NCKA 2A5FA 2VQSA 4JVSB 1MKYA 4D81A 1UFQA 4QFMA 2DWPA 1R8SA 2RB4A 2ZSBA 4OHXA 2VHQA 2YHSA 2AX4A 5FL7A 3UG6A 4LHWA 2FF7A 3J81k 2KWIA 1EFRD 1W5TA 1KGDA 4NYIR 3EA5A 3QBVA 2J3EA 3VNVA 3CX7A 2R9VA 5FPHA 2A5DA 3GJ5A 1Q1EA 5EZ6B 3V9PA 4IRUB 4BLRA 5J4YA 3A4MA 1Q1QA 1I4LD 1G64A 3N70A 2ZRJA 4HB3A 2FSGA 3U6KA 2O0JA 4FMDF 4EIWA 2W6ID 3I62A 4B2PA 4Q1AA 4YMSA 4OJKA 5JRZA 3GLIB 3C5CA 2GRJA 3SHFA 3FHTA 4HAZA 2KBFA 1NVVR 1JQLB 1G21E 4JBYA 5JS7A 4BPBA 1OSNA 2OE2A 4URWR 4HLUC 2FFAA 3AVXA 1D6JA 1TF5A 3M4YA 4TYNA 2XNDD 4I81A 4NTZA 5TMPA 3ZZ0A 1CP2A 1OPXA 3U2QA 1CBUA 4Q48A 3IQXA 4MITA 4B3FX 2B7BA 2GXUA 1KI7A 1DELA 1KZGB 2YJTD 2XX3A 2XXAB 2GEVA 2C95A 2EYQA 4Q4HA 5J4VA 3GLGA 3KTAA 3GPLA 3GJ8A 4S35A 2J59A 3R7WA 5IHPA 3EX7C 1P73A 2E87A 4M0LA 1WDTA 4A1FA 2ZRIA 2BMJA 5FPTA 4QBGB 1KI3A 4TMTA 2WWYA 2XOKA 4HYYA 2Q9CA 5FTKA 4CEIA 3A4NA 4Q9KA 1RPZA 1UKVY 5FTLA 4HDCA 3X1XA 5GJWC 3PJRA 2W6JD 3ZJYA 1M7BA 1PUJA 4HAUA 4B3CA 1DOAA 5H70A 1NN1A 1JALA 4RJLA 4P33A 1XJ0A 3EPLA 2HF8A 2NO9A 3T5GA 4BFZA 3JVVA 1UAAA 4WZ6A 3QKSB 4D25A 2VHJA 1IAQA 3GLGE 3QIAA 3BB1A 2PZGA 3EZFA 3ZIAD 2QAGB 2WM9B 4ZI3A 1WE2A 2GEDA 1CR0A 1G17A 1E32A 2VLIA 4LC1A 4JBXA 1R5NA 4KODA 3WXMA 5AJVB 3FPAA 3A1UA 1LF0A 1UKEA 4B33A 1SXJD 2BHRA 3NEYA 1OFUX 4DEYA 3OESA 4MUBA 4IVQA 4G5GA 4NYMQ 4FWTA 4CEHB 2A78A 1U0HC 5EXPA 3BJIC 1NI3A 1VCMA 1L4UA 4JS0A 1SULA 1ZBDA 5LB4A 1M34E 3C41J 1XJQA 1J90A 1SVIA 4GT1A 3WYAA 4DDWA 4JVLA 1RVDA 3CBQA 2IA5A 4DSNA 1K5GA 3E70C 3SE0A 2NPFA 3OE7A 3H2YA 4D0NA 3U5ZB 4AY2A 2QQ0A 2Z4SA 1AJEA 3FWYA 1Z0AA 3L0PA 4KFTA 1YE8A 4MGIR 2GXQA 4YQFA 1U90A 2IC5A 3T12A 1D5CA 2BV3A 3LDAA 4JL5A 2DHRA 2ZYUX 1ZMXA 1GKYA 4A0HA 4URXR 1W46A 2GDJA 3KUCA 1EFHA 1Q12A 4JLBA 1JQJC 3HU2A 4NL4H 2FNAA 3B9PA 5GVRA 1CEEA 2WWXA 1Z6GA 3KX2A 4WXPA 4OQMA 1OB2A 2O0HA 3BS4A 4XTRA 3GEIA 4P4UA 1D9ZA 2PJZA 4LBZA 1KTVA 1GIAA 2DBYA 2GJKA 1C1YA 4XWOA 3GJ6A 3VKWA 3R9WA 5GADl 1P7CA 2JLSA 2ZU0C 2WVJA 4RSGA 2FPMA 5J5CA 2GAOA 1LS1A 2KB0A 1EX6A 4AG5A 1CTQA 3BH7A 3GLHA 4LJ8A 5HZHA 1U9IC 4KVAA 4Q1EA 2VHCA 2B6HA 2XZLA 4PO9A 4OI1A 2HJGA 3VQTA 1SKYB 3OEEA 1OIWA 4XWKA 1E99A 3THXA 2WBLC 4PPGA 4A4DA 2BBOA 5EXXA 3TQCA 3MWYW 4RZ3A 4CEHA 3REGA 2QY9A 4KAXA 3T15A 1NJFA 3GJ3A 3C16C 1GZSA 2WPDA 2XTMA 1M8PA 3H86A 3HYTA 3FOZA 2ODEA 5KUTA 3I72A 5BXQC 3A37A 5FTNA 2V1UA 3EZ2A 5DGXA 5FOXA 2KSQA 5HCIA 4PFSA 1X8LA 4LY6A 5H8WA 3AGQA 2EW1A 2IL1A 3MWKA 1P60A 3I5YA 2CL6X 3DL0A 1JEEA 3ICEA 2BEJA 4MDEA 1NNEA 2BMDA 4PZLA 3OIVA 4Q5IA 1CIPA 4BLPA 4NH0A 2C8VA 4XSHA 3AVOA 3QQ5A 4I99A 3FVQA 1YZLA 2AD1A 3TR0A 5L3SB 3IUYA 3KXIA 1VECA 2IS4A 3IEVA 1HH4A 2I3BA 3A1VA 5C4GB 2F9MA 4OK3A 1L4YA 2FH5B 1ESNA 5EP4A 4CDGA 1N6LA 3TAHA 2W0SA 4L9SA 4WZBE 3B85A 2FWRA 2JLXA 1BIFA 5FBLB 1J2JA 4LYJA 4DSTA 1S96A 1D2EA 1TUIA 5CIQA 2D74A 1SVOA 3DDCA 5TVKA 1OJLA 3PIRA 1LF5A 1X86B 1VPLA 1JECA 1UEIA 4BFYA 5E7IA 1WF3A 1GNPA 1RYHA 521PA 1KHTA 3X1DA 2AFIE 3AUXA 1QRAA 3MLEA 1COWD 2GJ8A 3DZDA 5JBQA 1ZUNB 1VTKA 3D31A 4NE2A 4TLEA 3K0CA 5KNBA 4PAQA 2ZI7A 4IDQA 3QG5A 1R5OA 1FZQA 3T61A 3ZVRA 4EPVA 4U02A 3ZDQA 2YYZA 4A0RA 3U7GA 1E94E 1QZXA 4NU0A 2HJVA 2QM7A 4EDHA 3GLIE 1HA3A 5EE1A 1V43A 2IYWA 2OEPA 3C4JA 3RRMA 4Q4AA 2EFDB 1JR3E 2PT5A 821PA 2VYFA 1SVSA 3PUZA 4PO8A 4UKDA 2DFTA 3K53A 3L8YA 3GFPA 1GOTA 4BE7B 4TLDA 3IIJA 2P3SA 1W4CA 2GXSA 3ND9A 4LHZA 2ATVA 3BK7A 4G1UC 1PLKA 4QHYA 5FTJA 1N0UA 3T1QA 1QF9A 1W0JA 4CZ2A 3UKDA 3VR5A 1K5DA 2QORA 1G7SA 1OYYA 2GK7A 4R98A 4C4PA 5BWMA 1NN3A 2ZRDA 3WRXC 4ESHA 1H65A 3KKMA 2OAP1 1MRSA 2ZE6A 4URVR 5L3SA 1DG3A 3V00A 1E96A 3CH4B 3H0KA 5DE3A 1EX7A 2VA8A 3C14C 4HAYA 3SHWA 2JLYA 4ESVA 3FFAA 4QGAA 1QVRA 1WP9A 5FBWB 1E1QD 4MKHA 4HLQB 2PZFA 3IPYA 4G5QA 2WSSD 2VF7A 2ONJA 1N6KA 3BD9A 3Q72A 3LX8A 4NMMA 2JATA 1N0VC 2C99A 4II7A 4OI2A 1ZP6A 3N2EA 3CPEA 4DJTA 4B2LA 2YOFA 4MRRA 1R4AA 5EP1A 4ZIRB 4KITB 3SQWA 3ZYCA 1IONA 1G20E 3P1JA 3VR6A 2QZ4A 5JRJA 5DH9A 5E7MA 2QP4A 3GFTA 2ZANA 1OFIA 1MT0A 3T5DA 2F3TA 4QGGA 4KU4A 1NSFA 1SXJE 2P5SA 4IDOA 3VMFA 4A0GA 1QHGA 4BZPA 4JLKA 1W1WA 2AHOA 4RZUA 1E1RA 3TNFA 2LKCA 2FPKA 4LRWA 1Z08A 2J7KA 1NMZA 5G53C 5FUVA 3CM0A 3QY0A 3TR5A 3WMGA 2ZRLA 4P32A 5E95A 4ACBA 1VYVA 4BWYA 5F3WB 1KI1A 2XJ4A 3IHWA 1XP8A 3OF5A 4MKGA 3SJBA 3MGCA 4C0QC 1RIFA 5FOTA 2WKQA 6Q21A 4B3BA 2B8TA 1GNQA 3JZMA 2B7CA 2QRZA 5FOSA 4TMWA 3TQFA 4Z51A 3LWNA 1BO6A 2ZS8A 4DEXA 3QF7A 3L8ZA 1ZCBA 1HT2E 2ZU6A 1OXVA 1KO8A 3CRRA 1B0UA 1DAEA 1XMVA 4IFBA 3KQLA 1BMFA 1LFDB 3G82C 3ZGXA 5CJPA 1BYUA 4FW9A 3A1WA 4LOAA 3NTUA 1PJRA 2ZRHA 4TZ6A 1CJKC 2C9YA 3K9NA 3W90A 1Z0IA 1HY3A 4ABYA 2O8DB 1AQUA 1S2MA 4LV8B 3LBIA 1GL6A 2QPOA 2WKPA 3QEOA 3THYA 1R0YA 2CMKA 4YMVA 2V54A 4V0MA 4Q1CA 2BKUA 3BFXA 3EWSA 3KKPA 5BYKA 5AJZA 2BBTA 2E9SA 2EVWX 1Q22A 2IUSA 1MH1A 2VF8A 3CUEF 3K9LA 4OQFA 4X8MA 3B60A 3LLUA 4Q4JB 1GDDA 2NZJA 5AWFC 3CH5A 5EZ5A 3F0TA 2PX3A 5JFGA 1G4UR 2OXCA 4LC0A 1NP6A 4MYCA 5BN3A 4DB2A 1DARA 3UPUA 2NO7A 3RAPR 2KJQA 4Q9IA 3W8RA 3AVPA 1NIJA 1Q3TA 4R9UC 4RD6A 1SXJC 2NOAA 1BS1A 4KLNA 3ETLA 3EIHA 3UMRA 3SU8A 4C9BA 4DBLC 3ZD7A 4DWJA 4D26A 2R65A 4PC1A 4GDFA 5HZKA 4YXWA 4GI7A 1OH7A 1AZSC 2IEYA 2JLRA 2NG1A 5EE0A 4EPWA 3HU3A 2C96A 2P2LA 1P2TA 1Q0UA 1FOEB 3B9QA 3SN6A 2VTKA 4AKIA 3P4YA 2FPLA 2QAJA 3K0AB 4M22A 3CONA 1T0HB 4XD7D 3ONWA 4PHHA 3TE6A 4DLSA 1CKEA 1E9DA 4Q03A 4RFSB
chains in the Genus database with same CATH superfamily
3U9LA 3AUSA 2VRWA 4IXWA 3V7NA 4PBRA 1O94A 2Q3JA 3HGMA 1HDCA 4HRVA 5BT8A 1C30A 3VTFA 4MAMA 1H0HA 2FY8A 3EPHA 1GY8A 4V0RA 4Z86A 1Y8QB 2MOKA 1BXGA 3LC0A 3R5KA 3GV0A 1HV8A 1ZG3A 3CE9A 3RV4A 4BO4A 3NI2A 3FVVA 3LPMA 4GZ6A 2RGCA 5L7WA 3HKDA 3K9QO 3HADA 4PLYA 3CXUA 4KQGA 1FIUA 2P9EA 4MS3B 4TYMA 3DMNA 1JQ5A 3IP8A 4PX3A 3OHSX 4Z4QA 3KXPA 3WIBA 3PWTA 3IUMA 1EP3B 5ECYA 5BPHA 3OTWA 3S2IA 3I73A 2BELA 1H2BA 1EVYA 3HABA 3LBYA 5L40A 3KL4A 4L28A 2H0QA 3NDIA 3H1FA 5KOIA 2DCUA 2FW1A 1NDUA 2X2FA 5EIOA 4JI0B 1ELOA 3KSRA 4JUCA 1R50A 1XJCA 3B7GA 4HH4A 3R9IA 3KCQA 4C4AA 5DLPA 5K0JA 3DMTA 3QENA 5YASA 1TIBA 2YXPX 3N2LA 4FDVA 4NMWA 1RJDA 3AF1A 3WR5A 3OIWA 4Q4HB 1I30A 1CUCA 2BOVA 1YXMA 4KQ9A 5AW9A 5T3YA 3Q8KA 1WXIA 3S2UA 3OZEA 3RVOA 4RVDA 2P2SA 4EB6B 4AJ1A 3RTCA 3S2SA 1TF7A 4K88A 2N75A 5I47A 4RVSA 1TTPB 2OCLA 3EEBA 3G23A 3LPDA 5A0VA 3A9SA 3MA0A 2QG9A 4B6FA 2XMZA 4HXEB 4FZJA 3OQOA 4WJZA 4EHLA 1E8MA 3MN1A 1I80A 4PTLA 4QARA 3WLTA 1RBQA 1UKBA 3EASA 3ISTA 2AMYA 2AEEA 4ATNA 5A6SA 1C3OA 1U8XX 4OHMA 5J47A 1MB2A 3E3NA 3HDJA 4B85A 1PR3A 3SC2A 4FT2A 3BE4A 2IYPA 4ZICA 2BVNA 3FUUA 2Q5FA 3GEMA 3L04A 3LZDA 2NYRA 2FW6A 1OZGA 4ASUA 1KI9A 1X1SA 4HEA6 1NLUA 2OZPA 2C2XA 5AUOB 2NLOA 4AS2A 1TUEA 4G6ZA 2HCJB 3B2NA 4ERNA 5U9CA 5I4CA 4RF4A 4TL8A 4IL5A 4QE3A 4WXEA 5JDIC 3Q3JB 1MOQA 3A04A 1VKHA 4JP1A 1O0BA 4QDJA 3AHIA 1E4EB 5JS8A 4PC6A 1F48A 3NYRA 5KYYB 4AKGA 2WICA 1RXCA 1P2VA 3D43A 3TTVA 2B9VA 1REQA 3A2MA 3OZWA 3R7BA 3HBMA 2QY6A 1TPZA 3JQ9C 4D8VA 1OXSC 3KAJA 3RRBA 1J99A 2HPZA 3BA1A 1VL6A 3GPIA 3U39A 2ZAGA 4WBSA 1KOGA 1IHUA 3ACDA 3A27A 1BC5A 1PJSA 1PL7A 4QULA 4IJMA 4DCSA 5FWXB 3OO0A 4IIGA 2XY4A 2ZJ0A 4RHTA 4JI6B 3IEPA 4RM3A 2V5AA 4L57A 2MMGA 3PLNA 1ODKA 2RGXA 5D5HA 4BP3A 2GAJA 3ZDZB 3JAWB 4E46A 4W4TA 3MTEA 3N6RA 3SJCA 1F3OA 1X80B 2BUBA 2CMDA 2WM8A 3B6EA 1G2PA 4FYHA 4LRXA 4CMJA 2J3KA 4N82A 1UWCA 3OOHA 1GEGA 3ME5A 3U7QA 4DVJA 2XZTA 3LY8A 4TVOA 5EJFA 4XYLA 3H4MA 5FHRA 1XRQA 1J0XO 1Y1SA 4C78A 4NF2A 5CH5A 4Y6GB 1DAKA 1W4BA 2BEWB 3R3HA 4B5KA 1FYXA 4FR0A 3AINA 4MVJE 4LGYA 2PQ2A 2VYCA 5JNLA 2E4UA 2RKWA 1CXZA 5COQA 5FWYB 4ZRNA 3TLEA 5DCLA 3E9RA 4JK3A 4QPCA 2RHHA 2Y2VA 4PWZA 4R54A 4BMCA 3STTA 1R8YA 3ECCA 1SCJA 2W71A 4IF4A 1VGQA 3E0QA 4FNAA 5KOJB 3C48A 3CEMA 3UAZA 4EHNA 4X91A 4E5KA 1U1CA 3NNSA 1CWUA 2JFUA 4YJHA 4D9HA 3VNSA 3TMAA 5A5DA 4ZV7A 2VO1A 3X2EA 2C7PA 4FOSA 3C3YA 4YRLA 4Z6KA 2A9OA 1IPHA 2JEOA 2XAUA 5K7SA 4UXIA 5CNIA 2F90A 3GGDA 3ZS9A 1QRTA 4LZZA 3I5XA 3MHPA 2FPSA 2DX7A 4KTTE 5CRIA 4MS1B 1F2TB 2Q5JA 1AF7A 1X1BA 3V48A 3IEXA 3AESA 2AZXA 3C3MA 4KZKA 1DJMA 1SCAA 1Z8NA 3ADPA 3IVAA 4KQMA 1PWXA 2LVBA 1YULA 3FSRA 4Q3DA 4ARAA 4IOMA 1J5PA 3E5MA 1E1CB 3B89A 3V2IA 3RUPA 4YMTA 5JPCA 4LJ5A 2JI8A 2L2QA 2EDAA 1RMYA 4JXJA 4WNCA 2YWJA 2P0EA 4P92A 4YMHA 2GVZC 5KJCA 3G0IA 3HMQA 3QV2A 1T36B 4XLZA 3NM5A 2WK1A 4HQNA 2FP4A 5AI8A 3UT5B 1XWWA 2EEPA 1BQEA 1MEJA 2C2GA 4F4HA 4KLZA 4YDSA 1AURA 3P2KA 1BOOA 4JUDX 4JI4B 1C1HA 1JU3A 3PQ4A 4RPLA 1B1CA 3GK3A 1MAUA 4Q24A 3I8XA 5G4KB 4ZYVA 4REQB 1OLSB 3R3UA 4TMKA 3M6VA 1E9SA 2I6UA 3PITA 4P34A 1RAAA 5IWCA 1NSYA 1E62A 1SKUA 3WQRA 1A2KC 3GLFA 2O8EA 2E5LB 3ZK8A 3O0DA 2XE6A 1KYIA 2FDXA 5JBNA 1RQGA 2O6HA 4KQ6A 3G5AA 1EDZA 2Q1WA 5EEGA 4AAYA 4G1MB 4D02A 4KYVA 3GXOA 3HFSA 2HRBA 4I1OA 2YCBA 1Y7HA 3PT5A 4MR7A 4ZAXA 3CO0S 3KAKA 4P38A 3S2EA 5ECGC 2G7MC 2E4YA 1WUJS 2FX3A 2ZSFA 4IGAA 1EYZA 4OATA 2QTWB 2D5AA 3SC2B 4DQDA 3SHTA 3RTAA 1V1RB 1YI8A 1E1LA 1XTRA 1UT6A 4IEIA 3DOFA 5KMGB 4XPZA 5CP8A 1N0IA 1EWYA 3KB6A 3OU7A 3RGGA 1AQYA 5TY0A 2YYAA 3UKOA 4J4HA 4L1KA 4C43A 4HEQA 1PJZA 3QX9A 3C6QA 2OAQ1 1XVTA 5AJYA 2NZWA 1ICEA 2Y1FA 4YRQA 3VH3A 4TZ0A 4BLQA 4X66B 4N48A 3EZXA 5BOVA 1IHOA 4EUNA 3EZ9A 3E9YA 3H97A 3PHCA 1K4MA 1U8ZA 1FTWA 2RJ3A 3RASA 4HVCA 1BH2A 4GPIB 2R5FA 1BMTA 3L0IB 4YAKA 4DXAA 1UKZA 3O8RA 2BM9A 1CDEA 3ED5A 2DLCX 1KZ7B 4FFBA 5DW0A 2ZYIA 3DNFA 3V1TC 3QG1A 4AI6A 3ORQA 4L0DA 1VPVA 2AF4C 2RFLA 4S1PA 4TSFD 3C5WP 1NVXQ 2WMNB 1L4FA 2ZIAA 3K6RA 1UJ4A 4IGIA 4HDRB 1TK2A 1MIOB 1XTIA 4H4CA 4OXNA 5JNSA 3C6MA 1RI3A 2Q6TA 5C46F 4JC4A 1T6NA 5C81A 3SZGA 5JDCA 3U7IA 3O0TA 1FQJA 1U2GA 2QX4A 1PT6A 4O1HA 2WSLA 3CBGA 2ZB7A 1T2AA 4QT0A 4HJXA 4JZKA 3EODA 5HMMA 3IP3A 1EGVB 2ZSAA 4DSUA 4EB3A 3WB1A 4B32A 2ODTX 3FNFA 4KYUA 4EJ2A 3R3SA 1WTAA 4G5SA 4OSEA 3GO4A 4TV8A 5IYZA 1ZVVA 2EJVA 1II8B 1SUPA 2HXSA 4F4IA 4E70A 1NVAA 1LI7A 3LKVA 3ZIAA 5GIPE 4I5DA 2WM3A 4JNKA 5EIEA 5CM8B 3MWEA 4Q6WA 3CF2A 1KY2A 3O95A 4I3GA 3NOQA 1T8SA 5CYFA 1XCMA 3DHWC 4G2NA 4NK4A 1UZLA 2Z2JA 2PGLA 2X58A 3TQSA 4H31A 2AE1A 1N9GA 3KDPA 3W8DA 3ESBA 1K08A 1EMDA 3WKEA 4NI5A 4K0KB 4R2IA 4TM7A 4UJ3A 4H7JA 2W6JA 5B4UA 4M86A 2VXBA 3BXXA 3ZPXA 3PWSA 4X1YB 1ULBA 3FSJX 2IODA 1NM5C 4CG0A 1UODA 4ETWA 4F93B 1WAMA 3RBXA 4A6DA 2ZPTX 2I6FA 3IT2A 1A50B 4MRPA 2JFPA 2WB4A 3OFKA 4RVGA 1NOJA 5DYGA 4HVAA 3LCVB 3NAMA 4PO1A 4YUVA 1V3TA 2ZIXB 1U8EA 1A5BB 1E5LA 3NHZA 4R4JA 1TADA 3ZQ6A 4EATA 1YRBA 2CMHA 1FVFA 3M6FA 3G68A 5H0IA 1OX6A 2MR5A 3V4LA 3E2PA 2O1SA 3LXUX 1JHVA 1XYYA 3WWDA 1WUIS 2HLHA 2VATA 3VDNB 2EL9A 5HKAA 5M04A 3STWA 2F3QA 5TPZD 1IVSA 3NXKA 4EELA 1NTOA 2H07A 4FDTA 3TLZA 1N5KA 1Z2NX 3HYNA 3MT0A 4URUR 2IW1A 1PDOA 3IAS6 2ZETA 1LVGA 2Y4OA 3AOEA 1P44A 2H7YA 3BH0A 3CUYA 2GS9A 3K4QA 4GC5A 4GQBA 5EAIA 4ZVVA 3EVCA 3RS8A 2AL7A 3DONA 3T9AA 1PGJA 1A96A 1Q74A 3A1SA 1E66A 4G4GA 2FQ1A 2VNAA 4WBNB 5JASA 4BN0A 1DEXA 1KOLA 4IPTA 4MUKA 3RROA 3A6PC 5TARA 4MTLA 3FCOA 4GRIA 1T36A 1EDBA 1PFQA 4HD8A 4YLYA 1RI5A 1KBOA 2ODNA 3DFIA 3FHJA 4R9RA 3HWRA 3OWOA 2G9QA 5K6RA 2B30A 4RTNA 1EI9A 4HDRA 4DJAA 2I4NA 2HA6A 3NHAA 3RYHB 1A8QA 1XNRB 2ARKA 2OGWA 2YNMD 4JP3A 2XGMA 2NXCA 5IJAA 3LECA 5LKRA 3H8VA 1CUFA 3BREA 3KTAB 1QTRA 5TIIA 2XYHA 1LUAA 4CWAA 3PYMA 5F51A 2IFTA 4PE5B 4Z3KA 5JXIA 4GGOA 2FFRA 1UZAA 1ZH0A 1ZK2A 1L5WA 4TS1A 5IH3A 1ZLYA 1A69A 2FPPA 3IP9A 4L4XA 1RHJA 1W93A 2ECOA 3TNLA 2IJGX 3I4LA 4U6SA 1A77A 1I33A 3KCNA 4BVJA 4YVFA 3U60B 1A2OA 1J8MF 1FP4B 3Q10A 2FX2A 4M1MA 3UW1A 4YRNA 1XDZA 4YDHB 4ZEXA 3B5IA 4IMJB 1DT5A 3DDHA 3HDQA 4YWHA 5A3VA 2YZ2A 4XGIA 1AX9A 1XYVA 3T1VA 2SICE 4XJXA 4HH1A 3GW8A 1D09A 4NMLA 4NS4A 1H5UA 1Q44A 1Z06A 3NU1A 3UBMA 4DR6B 2R44A 1CQPA 2NPOA 1TCCA 2X3UA 4RKFA 4EJFA 4ZK6A 1B23P 3MJDA 3CUVA 2BKLA 2YOHA 5SV2A 4R1TA 4QBHA 3VNUA 4CIVA 3DJFA 3NLLA 4QPZA 2RCYA 1TMGE 3MK31 2ZRQA 4MSUA 4C21A 3LRXA 4OMDA 4ALMA 2V7BA 2P4UA 4D4MA 1GPUA 3LP5A 3MG9A 1K6XA 1UMBA 3O9ZA 3DPSA 5K3FA 1RZRA 3LUFA 1JLLA 3BJRA 2WU1A 4GWKA 4PS0A 5E6UA 5BMOA 2OCDA 4JB8A 1YU6A 3QYFA 2B37A 1JPNA 4Z4GA 1Q3HA 1T0UA 1Y7LA 1Z2AA 3I8SA 3K6JA 4GR5A 1CY6A 4KE6A 3D81A 4P53A 1XMJA 3VTKA 1VPEA 1HLDA 4ZANA 2RIRA 3K9FC 1HT1E 1E0SA 1LRKA 2VCEA 5AVKA 4Z9AA 2QGFA 4LOKA 4R1SA 4QBKA 4WJKB 5ICEA 5JC8A 1XFAA 3NIGB 5BQXA 1QZUA 3MMXA 2YNMA 3AR4A 4K40A 3EXHA 1TJNA 2C57A 2HJWA 3OOWA 1R3UA 3ENNA 3L9WA 4Q3CA 4H7DA 1WZIA 3N76A 4PZ9A 4FGSA 4ZQGA 3V7WA 5L3RA 5CNKA 1XHFA 4FD2A 1F51E 2JD0A 3HP7A 5IDYA 5T6BA 1JXQA 2CV0A 1KBQA 1F12A 2QYTA 2CVFA 4TMYA 2DGDA 3DLAA 1U0NA 2AQKA 2CHFA 1N1GA 3G88A 1VG9B 3L6CA 1Q0LA 4J8PA 4OI4A 3TDMA 4XRGA 1WBDA 1Y6GA 4GZ3A 3WDLA 4TTQA 5AUQA 4EG7A 5EZYF 4KH1A 2GKOA 4W5WA 1B3RA 1EGMB 1W96A 3LBFA 3HKBA 3FKQA 1RXUA 3IE2A 4OFZA 1JYSA 1W0JD 3MWGA 4YRSA 1RXWA 3OZXA 3KQMA 3U80A 5JT1A 2BZSA 2IXGA 2WNHA 5LR6A 3AL3A 2P1RA 5KPJA 3TD2A 2YZGA 1F2DA 3SBEA 1U9IA 4ZD6A 5L6LB 3MUNA 5HJ7A 5E2IA 4JR0A 1XNJA 5JCXA 3KYDB 3TPFA 3C8DA 1TK3A 3FWNA 1QO7A 3P4XA 3SSMA 5HOEA 1XALA 1ZIOA 2G28A 3DMTC 5KWSA 3M3PA 1WUHS 3KD2A 3OSZA 4TX1A 3V34A 3WX0A 4XAQA 1RLJA 3LK6A 1GFWA 1O77A 3NIBA 3P0HA 5H7XA 4MW5A 5LQKA 3AERB 1QCDA 5KU1A 1QK4A 3QBTA 4KQFA 2HIAA 1SHJA 1ZK3A 4BY9E 1AMNA 3I9V6 3HMKA 3BULA 3KKOA 3M1YA 3MBIA 1GUBA 2YY5A 3QMWA 2XXAA 3DHNA 2FG6C 4MA4A 3W2EA 1FDOA 2PS0A 1AHIA 1YR7A 4YCNA 1EFAA 1J42A 3T5BA 3UV7A 1YA6A 3D0OA 2GPSA 3AKZA 1ZL0A 4OFXA 1JILA 3OQJA 5A3SA 1F2VA 2CDNA 1DQPA 2IVFA 2DQSA 2LIPA 4HLUA 4IH4A 4HB2A 3HXKA 1E3SA 2LRHA 2R6CA 4U8GA 3OQNA 2EGGA 3GT0A 3IVMA 3CZQA 3FHCB 4WLFA 1KAMA 3VHQA 4Y3UA 4RBNA 3KYJB 2VG8A 1UMDA 1XZIA 1TLFA 3CF6R 3GHYA 3REQB 5JS6A 3TLJA 2BFCB 2OYRA 1TYAE 3F67A 5LP6A 1JFTA 4KRGA 1IQRA 4F2DA 1QIKA 4JMPA 4YWJA 2IZ1A 1H8HD 2D5IA 2R8BA 2ZUBA 3JQAD 4U7FA 4B34A 1HYEA 2PUTA 2IH2A 1NQOA 4H60A 1DRVA 1HMYA 4LHEA 3VR3A 1VHLA 4BMDA 4YRGA 5IJ0B 1QSGA 1RPNA 4XDYA 4U2DA 1ZU4A 1D1TA 3QPUA 4AK9A 2O05A 1GGVA 2UYYA 1WMAA 2NPIA 2C54A 3HFGA 4IHJB 1Z63A 1UPFA 3QMPA 5CVEA 5BN1A 1C41A 4DLYA 5JSZB 1RM5A 3H2ZA 1S02A 3NM4A 4CM4A 2W2PA 4UVDA 3TKYA 2BFEB 1B6TA 1ZGZA 2BW0A 4PYOA 4LWOA 2WSSA 3OZCA 4G41A 4NZ9A 4PXYA 4JI2B 3L6RA 2F67A 3MAAC 3WIUA 4F3YA 5T4HA 4RTRA 1E1YA 3C1UA 1N8NA 2PLRA 1SWVA 1WDMA 2G9ZA 3AVQA 4PGFA 1YDHA 2OYSA 4V0OA 1IOVA 1J8YF 2Z58A 5H3CA 4BJ1A 3G0DA 4DADA 1XCPA 1EK2A 4II3A 3PLAE 1WPQA 3QVJA 3DKVA 3FMVA 2P2NA 4G0PA 2Z98A 4HRAA 2ZEJA 4MYDA 4XPIA 3WRXA 2OCKA 4Y30A 1CQZA 4OFBA 1CJMA 1QH0A 1GA1A 2X6RA 3QOFA 3EIQA 2DWCA 2CWWA 3LWZA 4UBJA 2LDBA 3STHA 4DLLA 3NVMB 4Y2HA 1NURA 4BO6A 1GG9A 3KPUA 1NKTA 1R6BX 1USKA 1KP9A 2CE7A 2XE4A 3TOZA 3GJTA 3N8NA 4M89A 4DLRA 4K9NA 1ZUHA 2QNIA 2XMDA 2H5JA 3JR7A 4TQGA 3DZCA 3QU9A 1NV9A 1NXOA 2B2CA 1VG0B 1M72A 1M6YA 1P3DA 3IERA 2VN8A 1S3IA 3CRW1 4TSKA 1FYFA 3N0WA 3IR5A 3H9EO 3IVCA 3LLCA 4LE0A 3RV3A 4IXDA 2JIZD 4B81A 3ZHYA 1XA3A 1TAQA 2IUEA 1RM4A 3I12A 1SHLA 3B36A 4IVRA 1C3VA 2QPAA 1V8ZA 1P7ZA 1HTBA 1JFLA 1ZJZA 3KU1A 3PKIA 1A9SA 4FZ5A 2FP3A 4ZDWA 1XVAA 3LC1O 1IY9A 1KI2A 4HLCA 4K6FA 4X7PA 1GSHA 2P5YA 8ATCA 1KH1A 4KUEA 3W6PA 1SIWA 2J0SA 2QL5A 4B6RA 1QNFA 1C9MA 1KEPA 1Y6ZA 1YFZA 2AKAB 3IO5A 3PC8A 1B41A 4FEGA 4IV5A 3FTPA 4KQXA 1NLYA 3JCZA 5FT9A 4C6RA 3ODGA 4D0GA 1M7HA 4D4JA 1GU7A 4MUYA 1Y9EA 3I6ZA 4ZYUA 1EFVB 3T9DA 1GJRA 2O6LA 4GI2A 4XQCA 4AJ4A 2VEDA 3SX4A 1VMAA 1ESEA 4LV6A 4Q05A 4J7AA 4W1PA 2Q7OE 1IWOA 2Z56A 4CQLB 1ATZA 4IF6A 4P9NA 5ADUS 2RJOA 3PXUA 1E3TA 1IBSA 1LB1B 1SWWA 1SU4A 1Z3IX 3PGMA 3TRDA 1N5OX 1YR9A 1KK3A 1NJGA 1E2QA 3E5NA 4EW3A 4PG4A 5IVIA 3GL9A 3ER6A 3LV8A 2BFEA 3TUZC 3A9VA 5DF1A 3IXQA 2BEVA 1PWEA 4Z7JA 3E3OA 3R09A 4G65A 4U63A 5AIAA 2VJOA 4XVCA 2XYRA 5KQSA 2PPLA 3IAM6 4QELA 4TSFA 5LQMA 4O4HA 2EKBA 1N6HA 1IY0A 4NE9A 3SMQA 2E18A 2I55A 3NT2A 3ON5A 2CXRA 2P9GA 3LPAA 4CHGA 3PUHA 4LWQA 1NR7A 1ZA1A 1Q7TA 2FWIA 3FTCA 3QTBA 1CEQA 2FRDC 4FZ3A 1DC7A 3LYHA 4KPEC 2AN4A 3HBNA 1Z22A 2PKRA 4C06A 1NXXA 1UL1X 1SD5A 4ZMBA 5AXBA 2I3GA 2Y67A 5BOSB 2F3SA 1HNZB 4BTVA 1NV8A 3I0MA 3CZCA 1UJ5A 1G0OA 1FTYA 1J6UA 3UW3A 2FK7A 3MUOA 2NZ2A 5FNVA 4DWOA 3T38A 1NW4A 3N1UA 3IDQA 3IUPA 2M6SA 2BFCA 2ZE5A 4KWIA 1N5DA 2AR0A 4NBUA 4REQA 5FWYA 1SZDA 1TCVA 2CCJA 1UFVA 4X3PA 1YZUA 3CLKA 4JL8A 3QPDA 2C83A 2XSZA 3L01A 1XKLA 1UZNA 4Q9NA 4OHKA 4RQBA 3IIEA 4W9NC 2V58A 3I6YA 1FY2A 3COWA 3UJHA 3QI2A 1P8AA 3G49A 2R8PA 1T1RA 3OP1A 3P8ZA 2C61A 2J32A 4RUKA 5IDWA 1OH8A 2WFZA 1SUEA 1DWOA 1O96A 2Z3ZA 5EUMA 1QRUA 4J0DA 1OKKD 2R6JA 2ZGVA 3TD9A 3OPYI 4BKQA 3MB5A 2O3TA 3I32A 1FMJA 2ZJZA 2MWMA 2EP8A 3K0BA 3OEYA 3Q0EA 5AW8A 3KQKA 1P6XA 2WF6A 3JYLA 4TWRA 4P82A 3DAGA 2B2XA 3WJ7A 4LJ9A 4LDJA 2JCGA 2PRIA 2Y93A 5HW0A 2A58A 1GZ7A 1X1TA 2GN2A 3WK6A 3O7MA 3LKZA 4JLPA 3C5EA 4CEJB 3AL0C 4JJ4A 1GNSA 1YVRA 1VRWA 2B4QA 2HSDA 1IBLB 1YB4A 5DRYA 3TF5A 4FR5A 3GPDG 3V3TA 5DX0A 3IHTA 5WRFA 5HBGA 4Z99A 3EH2A 2B92A 2ZIFA 1PYGA 3DC2A 5CW2A 5AQEA 5I9MA 5JCPA 1L3BA 3KHTA 3JY6A 3RS4A 3D8SA 5JATA 4Q3AA 5CB4B 1S1CA 4N9QA 5H68A 3ZY6A 2HMSA 3CLRC 4CLXA 2RJNA 1VCOA 2VF5X 5C18A 3DMDA 4JT4A 3T3PB 2B4RO 5EE9A 2CNDA 4IG9A 3ZWMA 1F20A 1IPFA 1PI3A 1MGPA 2IE8A 3NTLA 1BN6A 5BNZA 3RT1A 5TGZA 4JU8A 4M2LA 5FYDA 1AGRA 3UWDA 4ND5A 4EFMA 1SVLA 4DC0A 1U9ZA 3W5HA 5ICGA 1XQ1A 1R3DA 5A4KA 4EARA 2JF0A 3R0VA 2DFDA 3OIFA 3R41A 1A5AB 2VAXA 4KUHA 5FXMA 2AH5A 2P9TA 3LX6A 2BC9A 3JYPA 5EKUA 5BRAA 3KJIA 1I2CA 3SNKA 1PZGA 4G07A 1Y5LA 3IOEA 4H35A 4MTCA 1PUXA 2AE2A 4J0CA 1I3LA 1UKAA 3ANNA 1M1NA 5DNVA 1DKQA 6REQA 1PBNA 4B3JA 3QPBA 4Z7OB 1JSXA 1V7QA 3OPQA 1KEEA 1SKBA 2JGKA 3D8UA 5D1HA 1JDSA 5LA6B 3NDBB 1KMMA 5G0TA 5H5JA 3CPJB 2VWHA 2EFYA 3TZHA 3ZGLA 2DPHA 3KSDO 3QLVA 3OCJA 1OLUA 2HIGA 1EUDB 4NDAA 4TOIA 4EJSC 5FX2A 4IO0A 4N3AA 4TROA 5EIHA 1FP2A 5DB4A 3E53A 5KVSA 4Z2YA 3KWFA 3LT4A 1V35A 5A2GA 2QMYA 2J9RA 1IU9A 1H05A 3QELB 2NO0A 4ZQFA 3NQ41 4EO7A 2MT9A 4U9IS 3STXA 2OHOA 2E7ZA 4X20B 5ESRA 2A30A 2Q3MA 4DXDA 3KUDA 4LXUA 2P65A 3GUUA 3VH1A 2O7NA 1N32B 4EUSA 4MPDA 2JIQA 3KE9A 1C7QA 2O1EA 1PR0A 1JUDA 1FXWA 5GONA 2AMVA 2UDPA 2PVPA 4G0NA 2WU3A 3L4SO 1M5TA 4X60A 1MOZA 1NF8A 2PZLA 4ZOLA 4HNTA 1QYWA 1IZYA 1X7GA 2P9FA 5DJ5A 5FI1B 5IC4A 3LLMA 1TJ5A 4DQ0A 3DG9A 2NADA 3K30A 4ZQIA 4PAGA 3ADDA 3QW4B 1AH2A 1FQOA 1JBKA 4RXTA 3ZH2A 2YZKA 4Q9JA 3RRZA 3T7SA 1H22A 3NH9A 5HS4A 2YJNA 5K8VA 3IGFA 4ZC8A 1UQRA 5HK8A 3DT6A 1QYRA 3ZV3A 4QJIA 3I76A 1SHUX 3VZQA 1Q1AA 1KK0A 1QQ7A 1ZXXA 2R3SA 3E2IA 3LPNA 1XXHE 4YJFB 4JHLA 3VNBA 2PU5A 5GWXA 3W2HA 4EVSA 2WRZA 3IIKA 3ZV5A 2Q5HA 3RIXA 1G6OA 4HYTA 2YY7A 4LDZA 5J1TB 3RG8A 3RUCA 5HQ3B 1SH7A 3CQ9A 2WIDA 1QH1B 4ZP1A 4B47A 2GAAA 4FC7A 5LD2C 4N0EA 1TCBA 1B74A 4B80A 1F0NA 2DY0A 2CF6A 3QLJA 3RJZA 3HVUA 3M89A 3VC3A 3W77A 4R1MA 3GVIA 3QSYA 2P2GA 3CLUD 5GOZA 4GLLA 5HXAA 4B0OA 3TM4A 1XQVA 3L1JA 4A0FA 2BI4A 1FMCA 4L2IA 3NTXA 4UBOA 1SG9A 2O3QA 4DR5B 1MO5A 4MCHA 2NV0A 1F17A 1GG8A 5ESDA 1DFHA 3BBPA 4RETA 4XUDA 5CH8A 4M8IA 3OJ0A 2JJYA 1FFDA 4MR9B 5HS6A 4AKTA 1ABBA 1RHKA 3EXG1 3PXAA 1TVMA 1KDOA 2FE1A 2Q4EA 3ESQA 3P20A 2V0CA 1JR6A 1EFLA 4NK5A 1MC5A 3QPWA 5F7ZA 3CNBA 3L8HA 1K68A 5B1HA 5JLJA 5EUCA 2JIBA 2F43A 5IAKA 2D8AA 4MS4A 4BMSA 4R8LA 4UUQA 5HE8A 3THYB 1HOXA 2HN9A 4MUJA 4KZPA 4PS1A 2N3ZA 4UPDA 5ED0A 5HIJA 5IDXA 1ZD9A 1Z6YA 2IHBA 2YJ5A 3A26A 3CWZA 4MH0R 1FJ2A 1BHJA 4WD3A 2DBRA 4WCDA 7MHTA 4YJKA 4P0PB 1CVLA 4PAWA 1R6DA 1S9DA 3DP7A 4MGYR 3P9CA 4L4ZA 3I0ZA 3JQPA 1UT5A 1YSCA 3D1VA 1D7OA 1XT6A 3KEMA 3KXDA 4KRFA 3OA2A 1AKTA 3FDJA 1CS4C 4RZSA 5LA6F 1Z5OA 3ZV7A 4DT1A 3N5KA 5E8JA 5ILOA 2D3TA 3CU5A 4LF4B 1P5JA 1BE6A 3JQEA 3RVRA 4CF7A 4YAJA 2X7XA 3PUYA 1PL6A 2BFNA 5B3JC 1P0CA 4Y2XA 4A8JB 1K66A 1N2CE 1GLNA 1O94D 4UMVA 2M6KA 1DEHA 1EXNA 3C8HA 1MJHA 3FRJA 4DUZB 2BFOA 2C7RA 2W7TA 1VLLA 5CVTA 1L7MA 2C5SA 2I76A 2VP3A 5EHIA 5L3QA 1ISMA 1Z6TA 1NX6A 5GGXA 3WQSB 5THXA 2QSYA 2WZBA 5GM1A 4DNOA 4DCVA 5D00A 5ALMA 5F98A 4RL6A 1F3LA 2NTYC 3CHYA 1A82A 1UBCA 5DXJA 1SVMA 1Y37A 4DMKA 4WHMA 5KVVA 4XYBA 2YN0A 5L7TA 2XB8A 4BP9A 1KSFX 1ODSA 4EP1A 3PE6A 1UEJA 2L82A 3JQ6A 4ZAYA 5KWIA 2QT1A 1I51A 4TT3D 4FIDA 1G4HA 3DE4X 1U4NA 1NVKA 4Z4HA 5CA0B 3PDCA 4F4JA 4A36A 4FMPA 4A3SA 4F71A 4WNYA 3UC5A 3DLPX 1BEZA 5CH3A 5CCBA 2BGJA 3T4UA 3U9SA 4DPLA 1J5EB 1GN8A 1IAVA 3CE6A 2ORWA 2BKEA 4M9SA 4QHSA 2XQFA 1U0EA 2O2SA 4I8IA 3RU9A 3LTEA 4HMOA 3AP2A 4NCIA 2HQOA 1ISJA 1MC1A 1T43A 3A6JA 4UCFA 3V3KA 2QTLA 1DQZA 3ETNA 3R6LA 1FPMA 1Y42X 2Z0MA 3N3AC 5G1OA 2JIOA 2I9PA 5KYXA 3OPYA 4M1ZA 2WAMA 1YQDA 2GZHA 4B3SB 4UD6A 3PCRB 3SMVA 2B94A 4OTZA 3KDAA 3V4ZA 5I8WA 5AI4A 3J81A 3KQHA 3AF2A 4LTDA 4V0LA 1EAMA 2GVNA 4HWSA 4GECA 3PZBA 3D6TB 4NBKA 3DE1X 2Z2KA 2P1ZA 1XEAA 4RK4A 5JYEA 2PRYA 3B7WA 4XFKA 4AUMA 4YPVA 5KDDA 5TPZA 1T10A 1UMCB 4ND7A 3H16A 3LZ6A 2CXHA 3TRHA 4ND3A 2XQJA 2DBVO 2Y1LA 3EZYA 4HUQA 5FJIA 4N12A 2POQX 2I6GA 1JYFA 3T06B 3WMRA 1KVUA 1NL3A 1K5HA 4QXRA 4BKRA 1JQDA 1G2OA 3AY0A 3O4VA 3PI7A 4RXMA 3RWOA 4L6CA 3UB2A 5BN5A 1JGTA 1JIXA 1OGIA 1CNEA 1M6WA 2K87A 5H59A 5LP6F 1OGJA 3REQA 4DIOA 2DXIA 1F60A 1Y98A 4CV3A 1TT7A 3KQYA 5FTMA 1QR2A 3FBWA 2DJ5A 3ANMA 3IQZA 4CCSA 1PQ4A 2I2AA 4G85A 1CULC 1LV7A 2YWHA 4JB3A 5DIZA 3HUEA 1JRLA 2DT5A 2QQFA 2C29D 4LXIA 1FFYA 4PGGA 2MYNA 5C53B 4MLZA 5C51B 1VYUA 4RH0A 7ADHA 2IEIA 2AF3C 4KXLA 3K7EA 2PX4A 3FCAA 4C7VA 2D59A 5KYNA 4AS1A 5KYWA 3GDWA 1OXTA 5D51S 3DOIA 4D46A 5KNBD 1AGNA 4IHJA 3N9IA 1K86A 3UMFA 3H9CA 1Z16A 3GH1A 4KG7A 1BS9A 3AUKA 5KDLA 3PX2A 5DI3A 3ZDYB 4Z53A 4O02B 1Y9AA 4MYSA 4ZRDA 2QG4A 2G9RA 5ELXA 1J1ZA 3I5UA 4XZ3A 5F2KA 1IXYA 3MAGA 4L4UA 4DCNA 4MS1A 4DQLA 2GR9A 2OKCA 4KIUA 1M7GA 3DL7A 3VR0A 1YB7A 2I3ZA 3PHHA 3OPXA 2FV8A 3NTQA 4OUDB 4R1PA 1T4DA 4TXLA 3TW4A 4B6PA 4F4CA 5JS1A 3OM8A 1IUNA 2KI5A 4KXYA 2I2BA 1IY8A 2VHZA 3KZ1E 2XUJA 2ATEA 3BL8A 1JHXA 1T9KA 4W5HA 5CITA 1Y7PA 3ND6A 3UK6A 4JLUA 5IULC 1HKHA 4B43A 2I99A 5ALEA 3OF2A 3TB6A 1TM2A 4INJA 2IDZA 2Q3LA 3LC7O 4WLVA 5NULA 4PQYA 2ORVA 4HWPA 5I5GA 1C14A 1NG1A 5F77A 3NM6B 5I7FA 3VJKA 3HA2A 3B1JA 2FGJA 4JFAA 2BEWA 4EI2A 1P1RA 2PV0A 1E7MA 2XDAA 4P54A 5DGCA 5TV2A 1GL3A 4TWBA 2O1XA 2XDWA 4IIJA 3WKAA 3BXEA 3DEJA 4IZHA 2EEZA 4MO2A 1GT6A 1U5BB 4WLEA 1NUSA 2IELA 1RWPA 4QPPA 1PF7E 2R6DA 5CX1B 2Y0PA 1KJJA 3BGVA 3FZNA 2IY9A 4FS8A 2IHVA 1M33A 2V8OA 1OYWA 3FRHA 5EXEA 3TB4A 5ITZA 1QQAA 3Q8LA 1NVDA 4MQ5A 3AR2A 1E7YA 2K6GA 4RNCA 1AGPA 1DWUA 1US8B 4IOJA 4YJDA 3H4TA 3LYLA 4FJ0A 4P2GA 2QVGA 1ZOIA 3OJCA 4EF4A 5B2ZA 2RD2A 3SVLA 1N1EA 5G1PA 1C3EA 1BX3A 3L5OA 2DWQA 3BWVA 1PJCA 1V6CA 2OGSA 4NNJA 5FD8A 3WMXA 4GWLA 1TYDE 1E9CA 2R1VB 3O4JA 4H7FA 1OI4A 2QUKA 3ITKA 2A9FA 3PUXA 5IC5A 5IKOA 3D54D 4I2NA 3TQRA 2DFVA 3LSTA 2FEPA 4EHKA 5EOVA 2DU8A 4UEKA 3U40A 1JF8A 5AVJA 5DYTA 4EKEA 1T5SA 4DQVA 3RF7A 4DLBA 1I4TD 4MVYA 4PTZA 1XPOA 5FUWA 1UBRS 2H4WA 4XCXA 4NIMA 2QJRA 2XB9A 5AK4A 3BA6A 1J0BA 1PFGA 2MSNA 3RANA 1LI5A 4FYYA 1Z0FA 4CL0A 3BSYA 2Q9AA 4YX9A 1AF4A 2E1RA 1EQUA 2I7CA 3BFVA 1QVZA 1XDGA 5E3JA 1FZTA 4LDNA 3KZKA 4RKWA 3WB2A 4RELA 5ALZA 5FWNA 4ZHQF 3G8CA 3B82A 4RA9A 3WJAA 4AG6A 1PDVA 3TEFA 4X1KA 4ALJA 1C8LA 1BGVA 3HO8A 4D44A 1Z2PX 3CX6A 3GD5A 4B4DA 2ZI5A 4KKXB 3U4MA 1QYCA 3JALA 5AH0A 3S1AB 2R4TA 2PS1A 4LNUB 2AK3A 4R84A 3RBVA 3WLRA 3OZ7A 2I54A 3QTLA 3E8SA 3IILA 5BSUA 5LOVF 1TQ4A 4KQCA 5CT8A 1FPQA 4J0KA 3T7TA 3L0BA 4QQKA 4AO7A 3ASYA 1TJPB 3MS7A 2R8RA 2WVHA 4G1CA 5LZ9A 4UHCA 4DR4B 4FYMA 4JUIA 1L5YA 1P2BA 5LZ4A 3X1KA 1G5PA 3GRFA 3KT3A 3VNAA 2WIJA 1EVJA 1JLRA 4ZT7A 4OQYA 1LPOA 3GEGA 3FDXA 3QWBA 1K7FB 1KI6A 2WW8A 2FSFA 3PX3A 4IICA 4LQ4A 1IUKA 3HI6A 1X7HA 3H6HA 5F9FA 4IDPA 4B4VA 3OA0A 1NRWA 2A0KA 5HZMA 1Z74A 1R12A 2I03A 5AO9A 1JDJA 5BYJA 3GWGA 3WGKA 3SYTA 3F98A