4CVNA

Structure of the fap7-rps14 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
GMLIAITGTPGVGKTTIAKLLAEKLGYEYVNLRDFALEKGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHLSHLMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENVIEVDTTNKTPEEIVEEIIGLIKSGVKRRVGIVDWSEVYDEIIPYLRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
total genus 68
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4cvnA00
5ELXA 1FUUA 1Z3IX 2SHKA 2WJJA 1MABA 5TB5A 1F5NA 4UQOA 2IXFA 4NYIQ 4N1AA 1XFAA 4A9AA 2JGNA 3OFND 3FKSA 4LYHA 3OIUA 4NZYA 3LFUA 4F92B 3L82B 4FMCF 4C30A 1XU4A 4I99A 3TE6A 3GFPA 2V6JA 1DBSA 1AA9A 2FSIA 2VHUA 3CRW1 1H65A 3EZ6A 3C15C 4Q7JB 3RS7A 3UKDA 1N6IA 5KDOA 2ZE8A 3AP3A 1LW7A 2GEDA 2QGNA 4JT2A 3FYHA 5FR1A 3U3JA 5AWFC 1NIJA 4ZI2A 5M04A 1ZBDA 4NH0A 1XEXA 3Q72A 3QKTA 5AJVB 3WBKA 1JECA 3MLEA 1UBCA 4LPSA 2JIZA 4PTLA 3X1WA 4WZBE 4D81A 1DPFA 4C7OA 3FMFA 1E32A 2XTZA 1X1SA 1PV4A 1YQTA 4G5SA 1Z8FA 2R6AA 3QKRA 1JR6A 1R0YA 1OH6A 5E4FA 1E1QA 4HB0A 4PO9A 4LYAA 1KAOA 4LX0A 1M34E 2OO7A 1I4TD 5KSOA 4OBEA 1YZUA 6Q21A 1M7HA 2W6JD 1HH4A 5L8VA 3ZZTA 4LPKA 4Q47A 3P27A 4P33A 4MA4A 3KX2A 3RWMB 2FWRA 1W0KD 3GEIA 4E09A 3THOA 2CLDX 4DZZA 2J9RA 3AF0A 3ASYA 2FFAA 5GJVC 1KOFA 5HCIA 3I5YA 1AIPA 1QHHA 4FCTA 1W36B 2AFIE 2WWGA 3G0HA 1ZNXA 4PC1A 1F2UA 3LW7A 2C9YA 4LGMA 4EQ6A 4D0NA 4UKDA 3TQFA 4BFYA 1XTRA 3WBJA 721PA 3PCRB 2YOGA 4AK9A 4C0HA 3MJHA 3WP1B 1KY3A 1CJTC 1Q1ZA 2JJ2D 2ZRDA 2WOJA 4IEEA 4AY2A 2GHIA 2ZRMA 1KI4A 2JJ1D 1FTSA 3IDQA 4QGGA 1E99A 3L8ZA 3LX8A 5AUQA 3MD0A 1IM2A 3QXJA 1WDTA 3VHLB 1EESA 1V43A 3TH5A 4CW7A 4WW0A 2JLSA 2ZRHA 4TSFD 4DIDA 4L4UA 5AJZA 5BQ5A 2V7QA 4PQYA 2VHJA 1H8HA 2IEZA 2JJ8A 1FNNA 5EE0A 5CK4A 3RRZA 5AJWA 2P2LA 1G16A 5LBIA 3UPUA 1DAHA 2Z4RA 3O8BA 1NVXQ 4MRRA 4B43A 4PPFA 3O8RA 2UKDA 3CRVA 4FN5A 4OHVA 4DLXA 3K9HA 3TW4A 2GDJA 3ICQB 1WXQA 3OFNA 4U5XA 2OLJA 3D7MA 4HAUA 5L3QA 1EWQA 5CK5A 3CO5A 4ABYA 3DO6A 2B92A 3R20A 2CJWA 5GJBA 1W0JD 2OEPA 5D3MB 1NMZA 2OCBA 3X1DA 2NOAA 1E2MA 4LJ5A 3D31A 1AS2A 1VPLA 1NG1A 2NZ8A 2F7SA 4KO8A 1QHNA 4LYFA 4DCNA 4Q66C 4M4SA 4TLBA 2P67A 5HCNA 1NLZA 2EFCB 1R2QA 2G1KA 4CEIB 4FI3C 1WA5A 2XNSA 1U0JA 3P26A 4KXFB 1D6JA 1MO4A 1R0XA 4Q02A 3HYTA 2QMHA 2G0TA 3SZRA 5EE1A 5KDLA 4RZXA 5KDDA 1DADA 4K8OA 2VL7A 1NJGA 2AK3A 4IOKA 3M4YA 2CDNA 2RHDA 1KI6A 3SOPA 4JZKA 3IEUA 3TVTA 3D8BA 1T8UA 4BZPA 3PFIA 2OLKA 5J4VA 2A5YB 3A1UA 1P2UA 4PHFA 3GMTA 4RCYA 4JLDA 4PSAA 1HURA 3PUWA 4M22A 3T12A 1D2EA 3FFBA 1GNPA 1EFRD 1Z6GA 3HYRA 3NBXX 1S8FA 4NHOA 2HLDD 2PBRA 5UKDA 4MUAA 3GLIA 2W6JA 3RS5A 2D06A 1GG2A 3GJXC 2CCGA 1W0KA 3U4QB 3QKSB 1G3IA 4I81A 1KY2A 1E0JA 3NKVA 2O8CA 5JJIA 2PZEA 3S1AB 1X8JA 4PR0A 5L3VA 1RPZA 3G82C 1YE8A 3W5IA 4Q4JA 3GLFA 4B75A 2BMJA 5FFMA 1CRPA 3DZDA 1Z06A 4I4LA 4JLVA 3GPLA 3T1QA 1XD2A 2BJWA 2PCJA 2GXAA 4JT4A 4OI2A 1WE2A 1A7JA 4HZUA 2QM8A 3ZZUA 4Q4HB 1DS6A 1R5OA 1EX6A 221PA 4I1OA 4F38A 1W46A 1JXOA 1SVSA 4RD0A 4LJAA 3R7WB 2Z83A 4XJXA 2R62A 2YWEA 3PQCA 3FHCB 1IXSB 1SXJB 2R6GA 4AWXA 4TSFA 4AIIA 2ZJZA 3TSOA 1IOZA 2BBWA 2OZEA 1K5GA 3CRRA 1FNMA 3GD7A 1E9SA 2LKDA 2W2XA 3DMDA 1XX6A 3RANA 4E5UA 1NP6A 4NYJQ 4DIEA 1P61B 3G5UA 4PC6A 4RVCA 2A5GA 1OV4A 4M1SA 2D7CA 2A5DA 3IGFA 3FWYA 3NEYA 4A0RA 1D9XA 5JEDA 4ESHA 1L7VC 2KI5A 4F7WA 1M7GA 2XJ4A 4L16A 2O0HA 2A7QA 2JEOA 1SVWA 1KI9A 2OG2A 4JLOA 3BERA 1XRJA 2YC2C 1ANKA 4MKFA 1TEXA 1ZP6A 2UZIR 3KJEA 1W0JA 1FTNA 4FWTA 4FIDA 3CW2A 2KSQA 4B3CA 1P9NA 2NTYC 4RD3A 2WSSD 2KBFA 2WWXA 3WRYC 2JAQA 1YKSA 3WP0A 1Q0UA 4DLUA 3ASZA 3I4LA 1MT0A 4DDVA 1Z83A 4PZLA 4II7A 3RHFA 3T1OA 1QG4A 5JZVA 5JHGB 3GLGA 4QJ4A 3WXMA 2ZQ5A 3CX6A 1XF9A 4ZCLA 2XXAA 1W5TA 1E2FA 1G64A 2BBTA 3I72A 3KQHA 4LHWA 3FOZA 1MKYA 4TTPA 2HF9A 2ZRLA 2WTUA 4M1WA 4TYQA 4YMTA 2N1BA 2N46A 2AD1A 4Q01A 5EE9A 4AD8A 621PA 2VLIA 2CK3D 1XWIA 2EW1A 3LBNA 4PAQA 2AXNA 2BV3A 1T3LA 1FFHA 1XD8A 3B8HA 3C5CA 1W1WA 4A8JC 421PA 2IYTA 4MGKR 1GVNB 2W0SA 3DDCA 4AKGA 4TMVA 1Z5ZA 1N6OA 1NIPA 4IW3B 1Z0KA 4A36A 2GXSA 2OFXA 2XITA 4JBXA 2XEXA 1XEWY 5CB8A 1BS1A 4RD4A 1W4AA 2L0XA 3BB4A 4JLAA 1WBBA 3DVLA 4WZAE 4UXJA 3AVVA 2ASEA 1US8B 2A2ZA 1K8RA 2HJGA 2RH5A 3THXA 1E2GA 1N2CE 3O8DA 1ZMXA 5BYKA 4YLGA 5BWMA 2CXXA 2OE2A 4QGFA 1KI8A 1E2QA 2VSOA 3SN6A 2CVHA 1O3YA 4A8JA 4OQXA 4PC2A 3TSWA 2WM9B 2H92A 4D4MA 2WKPA 1R5BA 5CDFE 2QEQA 3F5FA 2PMKA 1IY2A 2QAGB 5FL3A 4WZ6A 2QBYA 1E0SA 1G7SA 1DELA 3PITA 2OSBA 5SZHB 1KO7A 3E70C 3F3YA 1TQDA 5G3YA 1N5LA 1TL7C 3M0EA 4DC9A 2Q0HA 5CJ2A 3AKYA 3C4JA 4M9ZA 3LY5A 4GP6A 4FXPA 4AG5A 1M74A 1QVRA 3AH8A 4YMUA 3CPJB 4B76A 1IJEA 1XEFA 2IYXA 2YINC 3RAPR 2XZLA 4NL4H 2LWIA 3UG6A 4JBYA 1NSFA 1IN8A 4P0TA 4PAOA 2QT0A 4E07A 1OKKD 4H9GA 4DUGA 3DM9B 4TWZA 4WXPA 1V5WA 1XJQA 2NO1A 4BFWA 1NVVQ 4ZDJA 4YMWA 2IUTA 1VG9B 5ANRB 3HPRA 3WYGA 1NBME 2I1QA 3CF6R 2DFLA 3VMFA 4QHSA 4RKFA 2FX3A 5DNYB 3X1ZA 4QJ5A 4YONB 4Q7MB 4MITA 1G21E 4US0R 5FR2A 2BWJA 2O5VA 1EFTA 3U2QA 1J2JA 1W36D 4D25A 4DSTA 1JQLB 1S9HA 3KTAA 4ASUD 3CX7A 1XPRA 1OH8A 1VTKA 3RC8A 4QG7A 1JB1A 1KSGA 2QUZA 2BCGY 2AK2A 2Z4SA 2RKOA 1E96A 1G18A 1MH1A 2DWPA 3THYB 3D6TB 2BHRA 1HY3A 1ESNA 2H16A 4DLWA 1OXTA 3BFXA 1TQ2A 2EFEB 1P3JA 3MJRA 2IXEA 2C9OA 3FDIA 4XVRA 2ZRAA 4TMTA 3HR8A 4IVQA 1XEWX 1GSIA 5KSPA 2CK3A 1RZ3A 2ZRPA 2WICA 4Q9KA 3DZ8A 2GZAA 3SU8A 2ECKA 5DN6A 5FTJA 2GCOB 3TUIC 1E2HA 4X8HA 5FBLB 3NBYC 2QY9A 4CDGA 1H8EA 2JA1A 4QFMA 4HAZA 1A2KC 3THWA 1ZU5A 3OEED 2A9KA 2CCKA 3SS8A 3A58B 3QUSA 4Q1AA 3W6PA 3P32A 3VKHA 3OIWA 3ADDA 1T4GA 5IHPA 1RE0A 2J7PD 4P4SB 1NLYA 1OJLA 2ZSEA 2O0KA 1KK1A 1NY5A 4ESVA 4IHQA 1G7TA 1E2EA 2ZYUX 4OI0A 1HA3A 1AKEA 2DHRA 1A5TA 1G9XA 4D6PA 2ZI3A 4DT1A 4EFLA 1R10A 2VQSA 1G4UR 4I1SA 2XOKA 2ZYVX 1GZSA 2ZJYA 3U7HB 4HLQB 1KO4A 4HAYA 2J41A 1VECA 2VPPA 1E79A 1WMSA 4Y0VA 1IN6A 3IPYA 5EE5B 2JLVA 3GJ3A 3SBDA 4M1YA 1KNXA 4O2LA 5FUWA 4D4JA 5FTLA 1OE0A 1CULC 1IQPA 3RLFA 4HLCA 3PVSA 1J8MF 1Z0IA 3EPJA 2QE7D 1JBKA 3PEUA 5J40A 5LD2C 4G3XA 3TUJC 2V1XA 3KKMA 3LVRE 1YZLA 2OUKA 4GZMA 2GXQA 1OFTA 2IEYA 2ZS9A 3I92A 3HU1A 2BIFA 4DSNA 5FI0B 3B5JA 1COWA 4OQMA 2VA8A 4D4LA 2ODBA 1KIMA 1UDXA 3AVYA 2MMGA 3KFVA 4LZZA 4QC2A 4Q00A 2XXAB 1E0AA 1U81A 4HDQB 4NP6A 4RFSB 2FFHA 4ZDKA 1PZNA 4HUQA 3QEOA 5KU1A 2XB4A 3DMNA 4LDJA 2VHQA 1GKYA 2ZJ8A 2FPLA 3QIAA 1Z22A 1ZD8A 3EC2A 2GVDC 4Q4AA 3SEAA 4IDQA 3IILA 2IYUA 4JLKA 5B64A 2Y8EA 5BYJA 2PJRA 1AZTA 4ASUA 4JJKA 4B33A 1ONBA 3EA0A 4TT3D 3WNDA 4US1R 1E9BA 3VAAA 3BJIC 3PIRA 3EZFA 2D2EA 3N2EA 4Q03A 2DFNA 2ZR7A 2ZS7A 1ODFA 3W8NA 1LFDB 1UKVY 1FQKA 3AKEA 3BC1A 4CGZA 3TVDA 4QGHA 4KFUA 1HQCA 4C0BA 4JLMA 1VHTA 1ZM4A 3L0PA 2P65A 3EAQA 5J4KA 3TW8B 1GRRA 2H1LA 2QSYA 1BIFA 1U8YA 1Z07A 3K0FB 1II8B 5FPHA 5FPKA 3AVPA 4JYCA 3LXXA 1SXJD 4EPWA 2ZYWX 3W90A 1S1MA 4TLCA 2ZETA 4O3MA 3P1JA 3RSLA 2GJ8A 4XD7A 2O0JA 2ZJBA 4V02A 2CE7A 5FL7D 4DLYA 5KHOC 3DEFA 4P4TA 2ZE6A 4EKDA 2QTVB 3UMSA 3I61A 2NO0A 2QM7A 4ITRC 3MWYW 4W9MC 4IFEA 4TQAA 3TBKA 4IDOA 4RD2A 4KAXA 1HE1C 1OIVA 3AEZA 3QVUA 3WRXC 2VTKA 4HYYA 2WOOA 4CRWB 2J7PA 3KQNA 3AGPA 2GJ9A 4G5OA 2GAAA 4B6FA 3CONA 3NBZC 3W3ZB 3QJYA 2VHTA 1E9EA 3FTQA 3ND9A 5D3MA 3B1YA 1LNZA 1CTQA 2LCFA 3QF4A 3CNOA 4W5JA 3SYLA 4GRAA 3U3RA 4BEBA 5FPTA 2EWWA 2FE4A 1XTQA 2FOLA 1D9ZA 4IDNA 4OHZA 3SE0A 1Q12A 4C3ZA 4LC0A 2DY1A 2IYWA 3Q8XB 4NCHA 2ZRCA 4CEIA 4JKYA 2OHFA 5E7MA 1CEEA 5C2JB 1RKBA 4RKEA 1G20E 1U8ZA 2EFHB 1E98A 1XJ0A 1GUAA 2KJQA 1XTSA 2HYDA 1LV7A 2IYZA 1RFLA 2C78A 3BIFA 1VDZA 2XAUA 2ZYTX 2BEJA 1GAJA 2TMKA 3QI2A 4LOAA 1GOTA 2HCJB 3OAAD 5KPJA 2J0UB 3PV0A 2CHQA 2WJIA 4R71A 3DM5A 3BE4A 2ZU0C 4EDHA 3CX8A 1CJUC 2FDCA 3KDSE 1B0UA 2ZRJA 1M7BA 2ZJ5A 4B35A 5FH9A 1TUEA 1XMIA 5B30A 4DCVA 2RGAA 1YZNA 4PFSA 3BGWA 3CF0A 3U4QA 3HDTA 3BK7A 3IUYA 3QKSA 4LI0A 5DI3B 2ZIAA 3K9GA 5JI3E 3S1AA 1XD9A 4Q4LA 2PX0A 4MYHA 4Q1CA 1F2TB 1FW6A 4PX9A 4TMKA 4RZUA 1UEJA 2C8VA 4TT3A 2OBNA 3TLXA 1Z0JA 5EZ6B 4XWAA 1KZ7B 2OT3B 1DVRA 2WV9A 4L9WA 1E4YA 3AF1A 4S35A 1FUKA 3B6EA 1Q57A 3B9PA 5E3HA 1R8QA 1KMHB 1NF3A 2BBOA 3U3KA 4A2QA 2WIBA 3Q3JB 1KK3A 1E9RA 5TV2A 1NMXA 2X1VA 2YWGA 2ZRFA 1F48A 1P9RA 1KYIA 4Q4HA 5KOYA 4JL5A 3IO5A 2ZSAA 2VP9A 3AV0B 4LHYA 4LJYA 4M21A 3ZVLA 2F3RA 3VTKA 1G6OA 1JR3A 1C4OA 5FBVB 1KK0A 4GOXA 4R7ZA 1GTVA 1SXJA 4Q7KA 3B1ZA 1NN5A 5JLJA 4TTRA 3I32A 3X1XA 4XSHA 2JCSA 1Z28A 5H70A 1CR0A 5FL7A 4BPBA 4PPNA 3GCGA 3BOSA 4FMBB 4MKHA 5CYOA 3GLHE 2WJVA 4IOMA 2RGNC 4EPTA 3CRQA 4LC1A 5F2EA 4GBMA 1NLFA 2JLYA 1G19A 2QPTA 4C0JA 2FSHA 1KAGA 2ODEA 2ZUBA 2ORVA 3TR0A 5FOSA 3IKJA 1SVMA 3OIYA 5G41A 2CMKA 2DWOA 1ESMA 3LD9A 3HR7A 3T5GA 1UAAA 4Z8XA 4BRWA 2V6IA 2O8DA 3LQRA 5FOVA 2RGNA 3CB4A 4FMDF 5IRCD 5F9HA 4H1VA 4PANA 4R9UC 2DWQA 2ZANA 1D5CA 4KSCA 1HE8B 4V0KA 1O87A 2G83A 3MMPA 3RNLA 5C1BA 2AFHE 2R6CA 4YXWD 3T1TA 1G5TA 3CR8A 5AK0A 4V0MA 2Z5FA 3VU9A 3BH6A 4FMCB 2K5UA 2C98A 5K8IA 3QXHA 1ELOA 1HEIA 2Q3FA 4QBFA 4F4CA 2B7BA 3A1WA 3BS4A 3OAAA 2EFGA 3QQ5A 3K70C 1IBRA 4ARZB 1JAIA 1G41A 2IS6A 1QVAA 3SJBA 5BXQC 4GOJA 4BFVA 1GRQA 4C0AC 4C0QC 5FPYA 5EXTA 5B57C 1SGWA 2IYRA 5JRZA 1QHYA 1IXRC 2JLXA 5GADl 3WNCA 2CL0X 3U5ZB 2ZPTX 1Y3AA 3C5HA 4GMDA 121PA 4D26A 5DYIA 5E7IA 2O8EB 2R9VA 2W58A 4TYNA 1BYIA 5JHHB 2D2FA 1Q3HA 2IWRA 3EARA 2QENA 4KBGA 1Z29A 4C0SA 1XTIA 1JR3E 4FMDB 5C4MA 3RWOA 4AURA 4GMXA 5FUYA 1QRAA 4O2RA 3OEHD 3QPVA 2HEIA 5JSZB 1ZNZA 3KKOA 1TF5A 3JZMA 2WWHA 2H7VA 4TN1A 1WCV1 3WNBA 4MRNA 1G6HA 2WKQA 5GVSA 5IT5A 1KDTA 4DLZA 3VKGA 1JPNA 1RRGA 1VKJA 2J46A 4C0LA 2WSMA 4G5RA 3U3OA 2Q9AA 3VQTA 3VHXA 4HAVA 4B3XA 4A0FA 4OJQA 1IN4A 1P2TA 4D80A 3A36A 1N6RA 1EXMA 3FHOA 4W5WA 1GL7A 4TQ9A 2OXCA 2X19A 1ZD1A 3O8CA 2ZRBA 1Z63A 1OB2A 2C03A 5C46F 3ND8A 2OFOA 3QPWA 3IPXA 4A2WA 2GKSA 5JWRA 4PSKA 4Q7LA 4DHEA 4Q5IA 2XNDD 1FMLA 1DG1G 1TQ6A 3RC3A 1AM4D 5CLQA 2H5EA 3T15A 1XPUA 3SJCA 1R4AA 4EUNA 1NL3A 2R6DA 1F60A 1M1YE 3LLMA 5LB2A 2VF7A 3OE7D 1YU9A 5EP3A 1NBMD 4OK6A 1KJYA 1DAFA 2NG1A 5DE3A 5CYPA 3FMIA 4QOSA 4AKIA 3SHWA 3THYA 1NVUQ 1KKMA 3SNHA 4YXWA 1GILA 2RGGA 3NVAA 4YQFA 4G5QA 1XXHA 1XBTA 1U9IA 4I1VA 1IN5A 4BFZA 3T34A 3JVVA 3P4YA 3LAWA 5KNBA 3B85A 2BDTA 1Q1BA 1P62B 4Z1MD 3DHWC 1ZJ6A 3Q5EA 3FHTA 1PUIA 1VIAA 1KTVA 2RMKA 3QXSA 1QHXA 1PLLA 3B60A 3LNCA 4ZO4A 2HJVA 2GCOA 4JVMA 4RCZA 4YMSA 4DLSA 1KMQA 4CEJB 1S0UA 4NPHA 1Z0DA 4FD2A 4RSGA 1P7CA 3P20A 2ZROA 1J90A 1OF1A 2VHCA 4UNSA 2PZFA 1SHZA 4YDHB 2QAJA 2QPOA 4AKEA 2JJ2A 4DB4A 1BOFA 1KKLA 4LSGA 5BN4A 4UNNA 4MDEA 1E2JA 4GFDA 2DR3A 2ODNA 3SBEA 1FX0B 2J5XA 2JJ1A 5EE3A 2I4IA 2WVJA 4M9QA 4XWKA 1OXUA 3DL0A 1AGPA 2QA5A 5AUOB 4HAXA 4TL9A 1G291 4YC7A 1N6NA 2WWIA 4C4PA 2C9CA 2GZDA 2AX4A 1EGAA 1R0ZA 4LWZA 2F3TA 2D7DA 4GOKA 3C8UA 3KQUA 1TMKA 3RVBA 2BCJQ 3OEHA 4Q9JA 1GRNA 3LLUA 2D74A 3PUXA 2WZQA 4GT1A 4M1OA 5E7JA 5KYKA 5KPDA 4DCUA 3J81k 3W8RA 1N0VC 2WWWA 3EZ7A 1A1VA 3NC0C 5L3SB 2P6UA 1P9WA 3HJNA 3MAAC 2GXUA 3K8YA 4TLDA 2NGRA 3KB1A 4QHTA 3L43A 2G88A 2PCLA 4RZ3A 4QM6A 1JEEA 3FFAA 5LB4A 1ZUHA 2VBCA 4W5HA 3OHMA 3T06B 1VMAA 5G40A 1ZU4A 2NPIA 4B3DA 3CBQA 1E4VA 5JCZA 1YZTA 2CLCX 3X2SA 2PH1A 4MH0R 4PAMA 5JJKA 1XMSA 4DSUA 1G8YA 2IYQA 3PEYA 2F43B 3LX5A 4PPGA 4Y0AA 4Z51A 5TMPA 3QE0A 2R2AA 5G53C 2XTNA 3AP1A 1WQ1R 1RRPA 2J1LA 4RFSA 4NTZA 3SJAA 4H1UA 1SKYE 1R5NA 5SZIA 2J59A 1DO2A 2QU8A 1CP2A 1B23P 3GJ4A 3QBVA 3BAFA 2FEMA 1TX4B 3QY0A 4D4KA 2NIPA 1NKSA 1G5PA 4TMZA 1A2BA 2AD5A 2X8AA 2R65A 2KBEA 3EIQA 4LK2A 3GLIE 4P32A 3U61B 3QSYA 4EPYA 5DISB 4F4IA 1VG1A 2VF8A 5BN5A 3W6NA 2OCPA 4P31A 2VH5R 1DAKA 3IBYA 3RS2A 2AHOA 3TK1A 1EFRA 1ZINA 4JLJA 4LHZA 4O25A 2HLDA 2XSZD 3GLFE 3BD9A 3K0CA 1TQ4A 1WB9A 1MRSA 1YZKA 3VX4A 4UJ3A 4IVRA 1M8PA 4E22A 1LF0A 4IDHA 4Q19A 1XP8A 1II8A 1L2TA 1X8KA 3K0FA 4HB2A 4B3GA 1Q20A 5KSZA 3UATA 2G77B 3SFVA 3DKVA 1MV5A 2I1VB 4CVNA 1QHHB 2D4HA 2PEYA 1UDWA 4EJSC 2ATXA 2HXYA 1F2UB 3QG5A 5FBWB 3RRNA 1E9AA 1UADA 1JPJA 2OM2A 3B7GA 1GKUB 1NI3A 2BMFA 2QL6A 2Z6VA 4GSYA 4KLNA 2XTMA 4WAUA 2MSEB 1N5KA 2FGJA 3KFXA 1AJEA 3W9YA 2NQ2C 3U60B 3EIEA 5JWOA 3EC1A 5FUXA 4RZ2A 1HT1E 4KV9A 4Q9LA 2ZSDA 2FSFA 3GJ0A 1S96A 3CM0A 1I2DA 1Z08A 3DPUA 3SYKA 4IFBA 2XGJA 1QHIA 4LJ4A 3LV8A 4EJSA 4ZIRA 2YV5A 1ZW6A 3C7KA 3TKLA 1NY6A 1XCPA 3L0IB 1OYYA 5B2ZA 4DEYA 3GQBA 3QXXA 4F93B 5CM8B 1CLUA 1F3OA 4XOIA 1X1RA 3ZIAD 2ZXUA 1AN0A 2QG6A 4BFXA 4M1TA 3CF2A 3GP8A 1ZUNB 1AS3A 2GETA 4M0LA 1RVDA 2OV2A 4KFSA 4RD1A 1EFHA 2FZ4A 1G3MA 4KVGA 1GDDA 4QBIA 4TTQA 1II9A 5DO9A 5EXSA 5AJXA 1HUQA 3A4NA 1UM8A 3GLGE 1CBUA 4UXHA 2CJWB 2ZU6A 1RJ9A 1E3MA 2CE2X 1XCMA 3EWAA 2GRJA 2WSSA 2QRNA 3RS4A 1Z6XA 1U8AA 3K0AA 1Z6AA 2ZUDA 3CLVA 1U94A 1ZIPA 5JBQA 2G1JA 1FOEB 3WHKA 3OIVA 4P4UA 2VSFA 3NIBA 2GEVA 4CIDA 2GWHA 4HSEA 4TL6A 4IKEA 3ECCA 5DI3A 4KBFA 1VG8A 2QQEA 4HAWA 1F2TA 1U2RA 5BW8A 3JZAA 3CZPA 3AGQA 1E2DA 1OFUX 1T8TA 1VG0B 4LV6A 1GM5A 4A92A 4JLBA 1E1RD 2GF9A 2IHBA 5HZKA 3HPQA 1G8FA 2RB4A 1E2IA 4KJZA 3ZH9B 1KMHA 4US2R 1DO0A 2XX3A 1ZNWA 3TMKA 3FPAA 4UXIA 4BFUA 2OILA 3BBPA 4NKRA 4M53A 2XSZA 2J45A 2ZJOA 3VR4A 5JMTA 4P3YA 1N6PA 4GL2A 2HF8A 2QGZA 3BFVA 2C77A 4DDWA 1KDOA 2R8RA 3V4FA 2WHXA 3V00A 1TAGA 3MWLA 1OHHD 1E6CA 3GJ6A 4PO1A 4DLRA 2VSXA 3EIHA 3QKUA 3NXSA 3TSZA 2WIAA 3EPHA 2CNWD 3T1VA 3L8YA 4Q4JB 4URUR 3AVWA 4IVPA 3CH4B 4C0KA 4BFSA 1OXVA 2ERYA 2ZUCA 1CR1A 1NMYA 1JQJC 1QG2A 3QENA 4AKHA 4XIGS 4PZYA 1XD2B 3NH9A 2FV8A 1ZCBA 2JLRA 4YDSA 3FE2A 2YC4C 5CLLA 3T5DA 2BKEA 1IAQA 4HEJA 3HU2A 4Z8YA 3W3AA 1HTWA 5HR5A 5H1YA 3EZ9A 4NYJR 4BZXA 4PHTA 2FPKA 2X2EA 3B82A 1IHUA 2QROA 4KFRA 2RGCA 1AK2A 1N6LA 1DG3A 2OCYC 3ZQJA 3MFYA 4R2IA 1SVKA 3SC3A 1W36C 2O8FB 3ICEA 1KSHA 2P5SA 3FMPB 1OKKA 2FEOA 1I2MA 3ZQ6A 4MYCA 2P5TB 3ZIAA 4NCJA 3K0EA 3U6BA 1GITA 4G0NA 1JEDA 4M2LA 2ZI6A 1KZGB 1U0LA 1X6VA 3UK6A 2OAQ1 1T3HA 5EZ5A 2HXSA 1XJCA 2FU5C 4IRUB 1YZQA 3FB4A 3LXRA 3I8SA 2NO7A 1K5DA 2VO1A 3VR1A 2Q3MA 3C14C 2ANCA 1TF2A 3SQXA 1GWNA 2OBLA 5IDVA 4MGZR 1YR9A 2E87A 3IHLA 3DOEA 1DTSA 3WYFA 4MKIA 2V1UA 3QPUA 3A1SA 4IOJA 5KUTA 3EG5A 2AR7A 3SFZA 1LTQA 1RW4A 4U00A 4ARZA 2PEZA 3IIMA 5F98A 1YRBA 2Q6TA 3ZD6A 4WXRA 5EJEA 1BMFD 3GEHA 5GJCA 3W6OA 4DLTA 1N3BA 5JFGA 1KI1A 2IS4A 1RIFA 2ZS8A 1R0WA 2YOHA 4WIAA 4E03A 2DCUA 3NC1C 2V4ZA 3AM1A 3K9LA 1DOAA 1J7KA 2ONKA 3GLGB 1GNRA 4L8GA 3RABA 3BB3A 4LJ8A 3ZD7A 1J99A 1KO1A 2GJSA 2AL7A 2ZTSA 5HKKD 5GJWC 2QTHA 2O8EA 1U98A 2CL6X 1IXZA 3L0OA 3VNVA 4CYMA 3IO3A 4MYUA 1XTJA 4B32A 1KSJA 4ACAA 3KUCA 3I73A 4JVLA 1C1YA 4AYXA 3AQ4A 4IOLA 3KQKA 1GIAA 1P60A 1Z2AA 4RY2A 3BORA 3K9NA 1DEKA 2WMOB 4KYIB 4V0LA 1F6BA 4ZI3A 5JSZA 1AZSC 4PSVA 4MGIR 3T61A 2GBLC 3OEEA 5FUVA 4KITB 2FFBA 1TU4A 5KTYA 4NBSA 2WMNB 1NKTA 4QNMA 3FMOB 1P2VA 1I4LD 1W4RA 1KI7A 1RRCA 3H2YA 2FJUA 3EZ2A 5L3RA 3PENA 4LJ9A 3FKSD 4ZKEA 1SVOA 4D0LB 4QNRA 3EA5A 1N6HA 1NRJB 2J0QA 1W2GA 3RSOA 4FW9A 2CLSA 2V54A 5CIQA 5HE8A 2F1JA 4A8JB 2HT6A 2ORWA 2UVQA 3MRSA 5AR1A 4XVUA 4KODA 2GBLA 2HDNB 2VP4A 3F0TA 3NBFA 3AF2A 2HT1A 1CKEA 2ATVA 4BLSA 1G8HA 3FGNA 1CJMA 1E94E 3B78A 2R6FA 3KXLA 4XTRA 2ODWA 3B1VA 2IBMA 4GNKA 4BWYA 2JLWA 1E2NA 2E9SA 2CCJA 2GF0A 3VR6A 2D62A 1UKZA 1ZRHA 1NVVR 1TF7A 3IIKA 1W4BA 1YVDA 2QRZA 4G1UC 2QE7A 4DRZA 2CBZA 3CNNA 3PR1A 2EFDB 3BRWD 1Z2CA 5SZJA 3PEVA 3EASA 4ERNA 1KJWA 1VYTA 1E2KA 1E1QD 3AF4A 4WOPA 3L2OB 3R9XA 2ZJAA 2I3BA 4DDTA 1X86B 1FQJA 4A0GA 4PC7A 3KJIA 3K53A 2QT1A 2BM0A 2FSGA 4R98A 1T0JB 1J8YF 2LKCA 3REFA 2OBMA 5AUNB 4HDOB 2H8KA 1KGDA 3QG1A 1OPXA 1X3SA 1P72A 2YOFA 3M6AA 1SXJC 1S4QA 3NTUA 3RRMA 4QBGB 821PA 4CEJA 5IF9A 3V4RA 3B13B 3GJ5A 2W00A 5JS8A 1KHTA 2G9NA 2N42A 1RC8A 1OW3B 2J0VA 5EP4A 4B47A 3N5CA 2GCNA 2ZSBA 3Q85A 4BLOA 2OFWA 2D3WA 2NO6A 4D2IA 2EYUA 3NDBB 3QOFA 3A37A 5D3QA 3JVUA 2B8WA 2ZE5A 3H86A 3R7WA 2RGEA 2HUPA 1T3SA 4LRWA 2AWNA 2ZITA 3TJZA 1UKEA 5EXPA 3TAUA 4EPVA 2YWHA 1OXXK 4KHZA 4JSTA 1P73A 4KU4A 2V7QD 4KLZA 1H8HD 1GL9B 2A30A 1LY1A 4AG6A 2YKGA 2QMOA 3THWB 5JRJA 1J70A 1MRNA 3MWJA 4BASA 1NN0A 1UEIA 1ZM9A 5L3SA 5HE9A 2DFTA 3EPKA 2B21A 2NO9A 2ZI4A 2W2VA 3E5HA 1LF5A 5P21A 2IS2A 2P6RA 5J4YA 5FOXA 3RDPA 1NSTA 2DFKB 1YJ5A 4JVNA 1JAHA 5TVKA 4DLVA 1UBFA 2BMEA 1UJ2A 4OQNA 1E9FA 3N70A 2IXGA 3UWOA 4OHXA 2ERXA 4DT1B 4Q9IA 1KK2A 2GCPA 2PLRA 2ZI7A 3I5XA 4D82A 2QNRA 2BC9A 2F43A 4Q18A 3NH6A 3U44B 3C16C 4HDCA 4C2UA 2VRWA 2PZGA 1IONA 4B48A 3ETLA 2ZSFA 3TIFA 4CT5A 1T6NA 1Z6YA 4B2IA 4KI0A 3UWKA 2F1RA 4MRSA 1MR3F 2HYIC 1KNQA 4GZLA 1UFQA 2AWOA 4F91B 4PQFA 5DHAA 5J4LA 4X8LA 2BM1A 3RRYA 1T5LA 4ILEA 2EWVA 5FOTA 2G3YA 4OQLA 4BECA 4OI4A 3U3MA 3AUYA 5KNCA 3A1TA 1OT3A 4IXNA 3KKPA 1AS0A 3WYAA 4ZDWA 3F8TA 5F9FA 1X8LA 2C96A 4LYJA 1ZCAA 4IEIA 1TUIA 1JJVA 2GESA 1Y63A 4WVFA 1MO6A 2QAGC 1G1MA 2QMUA 5DI9A 3AB3A 1XNJA 3GEEA 4JYBA 3I3SR 4HUQB 1DARA 3RS0A 2FGKA 4M9SA 1US8A 2RGXA 4G01B 3WMGA 2B8TA 4Q4AB 4BZQA 4HLUC 1FP6A 3KB2A 2FNAA 4GI7A 4XH9B 3TUZC 5LD2B 4OQFA 3I1FA 2X2FA 3SI7A 2CHGA 3UG7A 4ZV4A 2H57A 3MCAA 3WMEA 4GP7A 3VX3A 2RGBA 1SXJE 5EQTA 1C9KA 1PUJA 5J47A 5JS7A 1QHSA 2ZRIA 3UIEA 2QAGA 3VNUA 1ZNYA 3ZYCA 4GPTA 3CNLA 2RCNA 3Q9LA 3WMFA 5KNDA 1W48A 2O52A 2H18A 3ZDQA 2J3EA 4B2PA 3SR0A 1RYFA 4HLUA 4URYR 2JLUA 1M6NA 2ZVQX 2JDID 1XZPA 2GVZC 5TXGA 3SQWA 2FMXA 4JS0A 1ZIOA 1G3RA 1FL9A 2B7CA 5K8UA 1HT2E 2YYZA 4NYMR 2PT7A 5BN3A 2MSDB 4LCBA 3CPHA 4HLDA 1DAGA 4URZR 3LW8A 4FCWA 4EPXA 1D2MA 4JIMA 3UXMA 1R8SA 3M1IA 1CJVC 4OHYA 4ZCMA 4LV8B 2ZAMA 3B9QA 2XJ9A 1DAIA 2O8BB 1Z47A 2C99A 5DSZA 1U9IC 5EP1A 1Z6TA 3BH7A 2ORIA 5JI2E 3GLHB 2YWFA 4PHGA 2EYQA 3GFTA 4XTCS 4MQBA 3X1YA 2DPXA 1SHKA 4TYYA 1CU1A 3TNFA 3O47A 3ZLJA 2QSZA 4V0ME 3QF4B 1ZAKA 3E2IA 5J5CA 3PUZA 1G7CA 1TPZA 4L15A 3KKNA 4EFMA 4Q1BA 3Q7PA 4B6EA 4CF7A 3RS3A 1QBKC 3CIOA 4LJ7A 2R44A 4IXMA 4RFVA 1QF9A 4L9SA 4CEHB 4DWJA 1EX7A 5A0FA 2VYFA 1T0HB 5CB6A 4BEJA 1BYUA 4QKQA 3R9WA 1LB1B 1KSFX 2ONJA 3IEVA 4FWIB 3TAHA 3V9PA 2NZJA 3ADKA 1W47A 2W0MA 3NDPA 1W49A 1BKDR 1NG9A 2FZLA 4OL0A 4DEXA 2PMDA 2IT1A 5FI1B 4XSGA 4OI1A 4BE7B 2XB2A 3UMFA 2ZJ2A 1CXZA 4ZPXA 1G8PA 1WP9A 1TU3A 4KFTA 2CL7X 4JKIA 5C18A 4RD6A 3ZVNA 5AUPB 1UBGA 1CR4A 1Q22A 1Q1QA 4LY6A 4MRVA 4URVR 5SZKB 1N6KA 1GP2A 4HI0E 4XWOA 4BUJA 4AYWA 2J0SA 2BBSA 1SQ5A 3IBGA 3OF5A 4P4SA 1DAEA 2GEUA 3BFKA 4WA7A 1Q21A 5KSYA 1K6MA 1G17A 4KVAA 1HV8A 2GZHA 4M9XA 4DCSA 1MO3A 2REOA 1NNEA 2CEAA 4NYIR 1QHGA 2J87A 4O0MA 2YNMA 2MSCB 1S3SA 3SDZA 4PQRA 3CWQA 4B3BA 1NN3A 5A4JA 1KJZA 3KJGA 3ONWA 2IW3A 2GJKA 1RYHA 4TLEA 4UNQA 2RGDA 1MABB 4BLPA 4HUTA 3KXKA 3B1XA 2AKAB 4QJ3A 2XZPA 5DIFA 4Q21A 2V55B 4UJ5A 1XMVA 1MOZA 2IHYA 2JDIA 2ZE7A 5CDFA 1ZYUA 5IK2D 3A8TA 3CH5A 3NEJA 2O8FA 4HZIA 3IHWA 3IQWA 4BRUA 3K1JA 3W34A 1A82A 3A6PC 4IDPA 4DUGD 3EPLA 3U7FB 3EW9A 3ZVRA 3EWSA 4OJKA 1D8TA 1S2MA 1VYVA 4OKSA 3RYTC 4OYHA 4JBWA 1AQYA 1XEXB 2OESA 1OH5A 3VR3A 4B3FX 2IS1A 1N25A 2XNDA 4DKXA 3K0CC 5LDDC 5JEEA 3VR2A 2KWIA 2Q9CA 3BWDD 3CRMA 4KSBA 1S9DA 3GFOA 5JECA 4C7OB 2EQBA 2PT5A 3FVQA 3ZGXA 5TY0A 3OE7A 1XXHE 1YR6A 1G3QA 2REXB 1YRAA 1NBMA 2BMDA 3A4MA 4MKGA 2O8DB 1TNDA 3QKRB 4NDZA 1GFIA 1ZC4A 3CR7A 5AJYA 3CWZA 3AP2A 4JJZA 1W44A 4I1UA 3GJ8A 5CITA 4TL8A 5JCPA 3LBIA 1SZPA 3DOFA 5HTKA 2FG5A 2DYKA 3NHBA 1ZD9A 1E2LA 1LVGA 2E1RA 2P0EA 2FA9A 4BLRA 4YMVA 1PVOA 4M8NE 1TEVA 2RAPA 3GJ7A 4JMPA 1U99A 4F4JA 5DLQC 3VU9B 2C04A 4B34A 1NJFA 4Q48A 1PLKA 4Z1MA 3KL4A 1CRQA 2C5LA 2A3RA 2GK7A 3Q7QA 4R2HA 5DGXA 2F9MA 2P6NA 2QTFA 2BEKA 1SULA 4S2EA 3R8FA 2ZR9A 4C9BA 1QDEA 3UMRA 3ADCA 5DN6D 4RJLA 1P75A 4EQ6B 4TZ6A 4B71A 5JWHA 1H8ED 5HZHA 2G6BA 4DXAA 3B2EA 1Z0FA 2QI9C 4MRPA 521PA 2IYLD 5JJLA 2BJVA 3ZZ0A 2ZVPX 4A2PA 2ZRKA 1JALA 1UKYA 2QP9X 4TLAA 1E9DA 4V03A 2F1HA 5DH9A 3LQQA 1ZUIA 2NPFA 1XDBA 2WJGA 3QBTA 4B74A 5GVRA 3ADBA 4LHXA 3A4LA 1L8QA 2PX3A 3NWJA 4EAQA 1G3UA 4JLPA 3K70B 2VP5A 3LVQE 1NVWQ 3EXAA 4BLTA 2VP2A 2BKUA 3I62A 2QMEA 3PJRA 3KUDA 2JLQA 1EG7A 2XOKD 2CHVA 4DB2A 3ZJYA 4EFNA 1KO5A 1PLJA 2GILA 5EXXA 1XZQA 2IYSA 1OIWA 1A4RA 2HCBA 5B58C 2PL3A 1XCGB 1VCMA 5DYGA 1E79D 1VCIA 2IA5A 3E1SA 4QHYA 2DBYA 4NCKA 4Q1EA 1XPOA 1R6BX 3R9IA 2V3CC 2C2HA 2PJZA 2YZ2A 2JASA 3CPEA 4QXAA 3NG1A 3PUYA 1UBEA 5IK2A 4NMMA 2WJYA 5HPYB 5L3QB 3BB1A 1VCOA 4DCTA 4PHHA 2BOVA 1XMJA 2ZR0A 1FP7A 1KI3A 2Q3HA 5CM9C 1VCNA 1W2HA 3L0SA 3Q5DA 2J0UA 1LS6A 3ZS9A 1W4CA 4HB3A 1PJRA 2KB0A 3LO5A 1G4AE 2Z43A 1JI0A 1COWD 3ZVMA 4DVGA 1ETUA 1E0KA 4HB4A 4N3NA 1Q3TA 1Q1EA 4FINA 2IWHA 3CKLA 4QL3A 1OXSC 3LRPA 1WRBA 1YZGA 5EP2A 1G7RA 4UNRA 3U6KA 4ON9A 4Z54A 1OLOA 2ZREA 1U0HC 1CS4C 4KCGA 5CJPA 3AF3A 3AVTA 1JXMA 2F9LA 4UNPA 4LUCA 3PEWA 1T5IA 1XTKA 2IYVA 1KI6B 3QF7A 5H8WA 2JATA 3K09C 2GK6A 1SKYB 2FPMA 3QNUA 5K8LA 2AKYA 2IUUA 1ZM7A 4A0HA 3OZXA 2GA8A 4B44A 5A5GA 2IX3A 1P4SA 2UZ3A 1EK0A 1Q44A 4QBHA 2ZI5A 2YJTD 2QP3A 2ZI9A 1HQYE 3GLIB 1CIPA 1JJ7A 4WBSA 2QPAA 1XXHB 3UANA 2WWFA 1OYWA 2IL1A 2O8CB 2Z0MA 1HYQA 2A78A 3EX7C 4MYTA 1P5ZB 3I8XA 4OK3A 4LHVA 1DE0A 3AUXA 4PPQA 4TMWA 1T91A 1CF4A 4NE2A 2BVNA 4LBVA 3K09A 4XD7D 4U7DA 3TRFA 1BH2A 2H17A 3GLFB 2OXRA 2X77A 3K0SA 1ZM2A 3SHFA 4LBZA 2IYYA 2A5FA 2NMVA 3IIJA 4URWR 5EUMA 2W6ID 1P2SA 4ZCIA 1FMJA 3AVOA 2G0NA 2FF7A 4HZUB 2ZRNA 3KZ1E 4AI6A 1OSNA 5E95A 1G5RA 4G5GA 4TZ0A 4MUBA 1N5JA 2OCAA 5FTNA 2QZ4A 2QN6A 1YR7A 3LBHA 1N5IA 2J7KA 4CT4B 5FTMA 2Q9BA 3HWSA 3SYNA 4NONA 1UF9A 3VKWA 2DB3A 2W83A 4X8MA 1KDPA 3MSXA 1FZQA 1WBDA 3U44A 1SKQA 2F1IA 1CR2A 4PO8A 5DHFA 2GTPA 2AN9A 4LBYA 3IQXA 2OAP1 2ZEJA 4U02A 2VIIA 3BH0A 2GAOA 1U90A 1Z0AA 4OK5A 4A15A 3VFDA 3N2IA 3D3QA 3AKCA 2VP0A 4NU0A 1P6XA 1GNQA 1N0UA 4LJ6A 1OB5A 4V0OA 1FPMA 2GJAA 4JVSB 1GL6A 3KKQA 4XVQA 1LS1A 4ZDIA 5TARA 1TTTA 1I4DD 4QM7A 4POAA 2F6RA 2MMCA 4Q1FA 4D0GA 1OFHA 2ZM5A 3LH5A 1L4UA 3H0KA 2HV8A 2WBLC 3HU3A 5FOWA 4IJMA 1OIXA 1R7RA 2EVWX 4DJTA 3MGCA 4QRHA 4JL6A 4AYTA 4PC3A 3W5JA 2ZRGA 1E1RA 1EFCA 4J0QA 5F3WB 2XZOA 4TQUS 4EPRA 5TDHA 3T35A 1IJFA 2QP4A 3ZS8A 4A1FA 1CJKC 2WPDD 2ANBA 1EFUA 1E69A 5G3ZA 1SVIA 2B6HA 1DAMA 2WJHA 4TYWA 3KXIA 5FOUA 4BGDA 4A6PA 4AC9A 1ZM3A 2IUSA 2FH5B 3MWKA 2WAYA 1JR3D 4QGAA 4EIWA 3WY9A 1OHHA 1QZXA 5CIWA 3QXCA 3PXGA 4NCNA 4L5BA 4DSOA 3THXB 1W7AA 3NHAA 4V0NA 2CNWA 3DKPA 1VIYA 4BLQA 1BO6A 3LDAA 1GKIA 3B1WA 4JL8A 4LBWA 1D2NA 1G8GA 4M1KA 2W6IA 4TMXA 3PUVA 4PZZA 5EUQB 1E2PA 2F55A 1N0WA 5FPSA 5C4GB 2CVFA 1IN7A 1RRFA 4N0DA 3WHLA 1S1CA 2A5JA 3CUEF 3LA6A 3H1TA 2Q21A 3MG9A 3P4XA 2QBYB 2O8BA 2V8OA 3C41J 4X8OA 2REBA 1NN1A 4NYMQ 1L4YA 2JIZD 2W2TA 2IK8A 3GLHA 2QORA 1MO5A 3OESA 5LPNA 1KI2A 4M1MA 5H68A 3SJZA 1IY0A 3KJHA 1W5SA 4EJSB 4ACBA 1JNYA 1OFIA 4ZIRB 3U7EB 2EU8A 4PXAA 2FN4A 3U7GA 1KDRA 2WKRA 3VR5A 4FCVA 4JLNA 4A6XA 1T9HA 2IF2A 1AKYA 4TYPA 5FBQB 3AVQA 1II0A 4CEHA 4Q9HA 4GDFA 3KQLA 4A82A 1UPTA 5FBRB 2YVUA 3HP1A 1M2OB 2QQ0A 5K8TA 4CZ2A 3LWNA 1S3GA 1TADA 1XB2A 2C95A 8OHMA 2ZAOA 4JSYA 4BFTA 4OHWA 4LV5B 1KO8A 4ZKDA 2AXPA 4MGYR 1VYUA 1RJ9B 2WWYA 1E9CA 5KO2A 4K81B 4A4DA 1AGRA 1ZVQA 4URXR 3KTAB 1AQUA 2YHSA 5FTKA 2RHMA 1BMFA 2IF0A 3K0AB 2PLFA 3MUFA 1VHLA 1YR8A 3AKDA 4W7SA 3TGPA 2P3SA 3AVXA 5J4HA 1ZC3A 2VEDA 1FX0A 5HKKA 3H4MA 4NCIA 4DBLC 3BXZA 3QVVA 4K46A 1SVLA 3A1VA 3AVUA 3FKQA 2V9PA 4C2TA 2IC5A 2VP6A 4TL7A 2FFQA 4KYUA 3CZQA 3PG5A 4B73A 2WAXA 1IY1A 3QEJA 4BQSA 1WF3A 3K70D 4MDFA 4B2LA 1OH7A 4DDUA 2GNOA 1YHNA 1EWRA 3R8CA 4Q1DA 3H84A 2WPDA 3TQCA 3TR5A 2JLZA 4N0EA 4HATA 3REGA 2KE5A
chains in the Genus database with same CATH superfamily
1KYXA 3EIUA 1FUUA 5C0OE 4LXTA 2SHKA 2WJJA 4NS1A 5K7SA 1XCBA 3VPDA 5JXWA 1ABEA 3LQFA 5G4KB 2XV1A 3R0ZA 2IXFA 4UQOA 1BHQ1 2NTNA 2ZK7A 4N1AA 3R7FA 3WGMA 1W6UA 3QKWA 4UU7A 2R4UA 1XWWA 3M3DA 5CTAA 5EINA 3A27A 3OIUA 1GSOA 4F92B 5LQRA 4R1UA 1JIIA 4DY4A 4XX0B 3GFPA 1MJGM 3PDIB 2C2OA 2Q28A 1TLFA 3HLTA 1AA9A 3NTQA 1OAKA 3EZ6A 3C15C 3FVWA 3RS7A 4CBVA 3WKBA 4L72A 1LDNA 3ZHRA 2YL2A 5FR1A 3NPMA 1TA4A 3E18A 3U3JA 1R4ZA 1NIJA 3D5EA 4J8PA 4J0KA 4ES6A 3TIIA 4ZI2A 1CIJA 1Y1QA 1J0CA 1ZBDA 3GHYA 5B3JC 3RUAA 1K63A 2IYNA 1Y6GA 3PHHA 3DBRA 1KXZA 4DMGA 1IRXA 4MK4A 1JECA 1O6FA 4LPSA 1HGXA 4P2BA 1ATIA 4KDRA 6REQB 4HGZA 2YV2A 4PTLA 4UMFA 4BVHA 2ASVA 1FLDA 2Y4NA 1I0IA 4TVSA 1PJZA 2QHXA 4GYJA 1SD1A 2V0GA 1GLVA 3DA8A 1O5OA 1DMSA 4M37A 4HRAA 1J25A 4WUTA 5GOZA 5KOHA 5ECDA 4F3RA 1PV4A 1MTOA 1YQTA 1Z8FA 3OPYI 3CX3A 5DBHX 3V7WA 4HT3B 2R6AA 5LWHA 2Q3EA 1R0YA 3KLPX 5ALSA 4IXTA 3R5HA 5DW0A 5J5AA 1CEQA 4CQMA 4LYAA 1H66A 3TZKA 4PVDA 4U8HA 3C1OA 5JMWA 3ILVA 3TKYA 4XDZA 1Z5PA 4F60A 4RV4A 3IODA 4OBEA 4C5AA 1YZUA 3RBAA 1RKVA 4EG1A 2C4VA 4L50A 7GPBA 1HH4A 2R0QC 3DOOA 2IW1A 2VVTA 4LPKA 4Q47A 3P27A 1KOLA 1U5BA 3ETCA 3SYTA 2GYYA 2I4NA 3IB3A 3K2BA 1CZHA 1IDN1 1LC0A 5COQA 5KNBD 1Z2OX 3GEIA 3TINA 3EVFA 3UFXB 2YRXA 3AR3A 3ASYA 2XB6A 3OKCA 2FFAA 5HCIA 4DZZA 5BRAA 4DV2B 1AIPA 1YVPA 4Z7NB 1Z5WA 4F2DA 1XJWA 2WWGA 4LVNA 4NZPA 5E1MA 4XQEA 4J1SA 4LGMA 4D0NA 4RTQA 3V4VB 4TVBA 3IOMA 2PKYX 1Y1RA 4KOEC 4C05A 1QMGA 1B3BA 2AQIA 3AM3A 1L3BA 1WOYA 3MJHA 1QG6A 4XI9A 3QFHA 1Q1ZA 4YJFA 3H2ZA 4MEBA 3VC1A 1U7HA 2Z8ZA 3N2NA 1FDWA 1DU4A 2OXEA 2IELA 3LC0A 1YT5A 3JAKB 3IDQA 4K0RA 4KE7A 4R1MA 2P9GA 3EQ6A 3GLUA 5AUQA 3LT0A 3OZVA 3SQMA 3VR6H 3IP6A 4KQWA 1WDTA 1CNFA 2BW0A 4G07A 3TH5A 4DAEA 5CB4A 3MUOA 4WW0A 2ZYDA 3BQ9A 3LMKA 1AB6A 4OQ4A 4R9RA 1ISIA 1J2YA 1IH8A 2JRLA 4LTMA 2V7QA 4G24A 1RI1A 2VHJA 3LOPA 1KH3A 1FNNA 1ZITA 2OO5A 1I80A 3JASA 5CK4A 5EE0A 5AJWA 1X74A 2E85A 3ZLUA 1X1EA 1UDCA 1YQWA 4UZEA 4AKIA 2J09A 1G16A 4ZMRA 5CD1A 3D6UA 1TVEA 1HE3A 5BYAA 4LZOA 4LZLA 1Y5MA 5K4GA 2Q8PA 3DB1A 1TKBA 3O4FA 4B43A 2PH7A 3T99A 1A69A 1K4MA 3CRVA 4ZVNA 4DLXA 4OHVA 1EFVB 1VJGA 1XZKA 2R25B 3PNPA 4MPPA 5B1HA 5HP4A 3ICQB 3OFNA 3OMLA 3Q15C 2OLJA 4EF6A 4GKKB 2XMGA 3DOUA 3D7MA 1BWPA 1RBQA 2HCRA 4HAUA 5L3QA 2WQ7A 2GLTA 3FPHA 3DO6A 3OEYA 4QARA 5D7NA 1KHHA 4WLFA 1A8PA 3AUKA 1KEWA 1W0JD 2R5WA 1YJXA 2AI3A 3TX2A 3UCEA 3DTNA 5EWJB 1YASA 3X1DA 4AF6A 2I67A 3FLAA 3ORFA 5K0FA 5EYPB 1NG1A 2WILA 2OOSA 3T5TA 2F7SA 1AMNA 4LDAA 4KO8A 5F52A 1TYZA 4Y6OA 3ZDEA 4CETA 5IJWA 4FX5A 3WO1A 1T0IA 2Y3IA 5AOAA 1CUUA 3GCWA 4WK6A 2NSLA 3NKLA 3IPRA 1XPJA 4HMOA 1U0JA 2IPAB 1KIFA 2XT6A 1TYAE 4JC8A 1D6JA 5FQNA 1MO4A 1T10A 1ZVMA 3O4IA 2V6MA 3WTBA 5KINB 2HA2A 5SICE 3RS8A 2G0TA 4FNOA 1K5PA 1DADA 2BFBB 3COVA 3DLAA 4KUEA 4YCAA 3FDZA 1H6DA 4QXMA 1SUFA 2AK3A 3M5CA 2C4NA 2P2SA 3M4YA 2NXJA 2CDNA 2IGBA 1VZ2A 2RHDA 3QUAA 3TOZA 5JH7B 2QZPA 3SOPA 4N3GA 5J4VA 1T8UA 3CNBA 3JARB 3PFIA 1UBMS 2EQAA 3G2NA 4KQKA 4UBOA 4IFTA 2ACVA 3DE2X 4PHFA 2W42A 1TIBA 4IWXA 2IDMA 4PSAA 3UMBA 5B7NA 3ODPA 1OZAA 3MJDA 3T12A 5LLTA 1MU0A 3NU1A 1EFRD 3NBXX 3R7DA 3BWMA 1KAHA 1JL3A 1SC3A 3L1IA 4N7BA 4FSDA 3RS5A 3OQVA 4MWSA 3GLIA 1X7GA 1PZHA 4LCEA 5EERA 1PT6A 3PHBE 4R41A 2QYSA 4JI6B 4EA8A 1IB0A 5CHYA 3U4QB 4IQ8A 4KDEA 2RH8A 3WK9A 3ICOA 3NKVA 2PZEA 3N58A 2O5EA 2H2FA 3LX4A 4M0UA 4PR0A 5L3VA 5KU7A 2ADFA 2WVGA 2ZZKA 4MPRA 1FFSA 3P45A 5E4TA 4ZYVA 3BYZA 5ALXA 4Q4JA 2VR1A 5M7EA 1KARA 4IUCS 2P2YA 4ODIA 1KF0A 3HA3A 1Z06A 4I4LA 3FYUA 4JLVA 3WDSA 4YQZA 5E6SA 4BNUA 3GPLA 2C0PA 1IIRA 1I4EB 3OCZA 1DEHA 1TLLA 5JNUA 1WMEA 1A7JA 1HBJA 2FEPA 3ONNA 4CTNA 1DX6A 1C1XA 5ADUS 3P2YA 4HQKA 1X94A 5HIJA 1ENPA 2FN8A 2WIFA 4UTRA 1JIQA 1U80A 1DS6A 4FEYA 4OGLA 1R5OA 221PA 2PXCA 3PVZA 4G4JA 1CUIA 1JBEA 4R8LA 1SVSA 2PWPA 4B82A 2BHSA 2VJLA 5KVSA 3G9ZA 5BSKA 4CKCB 4DDKA 4X44A 3T5CA 1DQYA 3PQCA 4AWXA 2Q6IA 1PJ8A 6PFKA 3AY3A 4P8RA 2ZJZA 4QDKA 3T3EA 2OZEA 3DEJA 5EGSA 3L06A 3USES 4UDYX 3GD7A 1TU0A 2QRPA 5FNZA 3NT2A 4E5UA 1ST3A 4S1WA 1V4VA 5DBFA 4NYJQ 2PAAA 1IUKA 3B12A 1SU6A 4PC6A 3OJFA 1JMKC 4RVCA 4DIEA 2NNLD 4TV9A 1OV4A 1BMTA 5DB4A 1RJFA 2A5DA 3KSUA 4JKOA 1EWYA 2GD0A 3ONVA 3WR5A 1JQ5A 1XZJA 1U2ZA 2AG5A 2HIAA 4P3NA 3BMQA 3GVCA 4L16A 3RYIB 2GCIA 3H9EO 2GS9A 2ID4A 4TS4A 2PD6A 4II2A 3K30A 3T7RA 1TMOA 4OAQA 4Y2TA 3ZW7A 1G1AA 3QA3E 1IQUA 1HRDA 3KJEA 2EGGA 5CDYA 2GHRA 1J5EB 1Y1KE 3O8QB 4ZOAA 3R0VA 3UMGA 4K2AA 1CUXA 3CW2A 1T1EA 1TOAA 4B3CA 1IPHA 3QEBZ 2WT8A 3HACA 4ZYWA 3ZOKA 3IR6A 5KHLB 3TL2A 4F38A 5D51S 1N2OA 3ML1A 5FO1A 2G8LA 5K0ZA 4C4TA 1MT0A 1NFRA 1Z83A 1FMFA 2Q2NA 3O9MA 1L7MA 2H4YA 5IAKA 2FUNB 5FD8A 3WK8A 3WXMA 1NF8A 1DXOA 3ETJA 3UYKA 4HPJB 1W5TA 3MCUA 4EW1A 2CDBA 2N75A 1XDWA 3GFQA 4L76A 4X1KA 3PD1A 5FYDA 1V37A 3MINB 4B17A 4ENQA 2BCEA 2HF9A 3T8YA 3OQMA 4M1WA 5TT1A 2YDXA 3IDZA 2AD1A 2IOHA 3TI7A 3N7UA 1BE6A 1CW2B 2DPHA 4N8DA 1RC1A 1GAXA 1MDFA 3L49A 4HDKB 1TVCA 2ID7A 2P9CA 1E4EA 2AXNA 2Z58A 4GR5A 5DDIP 1T3LA 4N5HX 3A6JA 4MP6A 1EP1B 2VHXA 1W1WA 3B8HA 3L5OA 4P36A 4Q3KA 5JSFA 4HDNA 2H1SA 4AP6A 4O4IF 2W0SA 1YB1A 3DDCA 3OZ7A 4HWGA 3W2HA 3DEHA 4A36A 4W5NA 1A9PA 1LBIA 5CP8A 2FVYA 3KL2A 4KXMA 2XITA 5AVQA 1QIMA 4CM9A 3E81A 5ED0A 2L0XA 3BB4A 3JTMA 3PCTA 3QX9A 4JLAA 5KVCA 3E4DA 1ZD4A 3H19A 4Q7EA 3WB0A 4ARUA 4WLOA 1BU5A 4CKXA 2P3OA 1RWQA 4UXJA 2FRXA 3S8YA 2WPNA 3RVSA 1US8B 1AQIA 2RH5A 4FE3A 4DR4B 1JA9A 1J49A 5HILA 5E8JA 1V45E 3THXA 1N2CE 3O8DA 1UKCA 3NASA 1KQ3A 5BWMA 1VLQA 1B0AA 1FLAA 4A8PA 1J1UA 1M2EA 3LY9A 1V8OA 4K03A 4TLLB 4A8JA 3N07A 4PC2A 5FO0A 1QTIA 2AJDA 3IJRA 3QPAA 1R5BA 4OJYA 3ZWMA 1GUBA 1QH8A 1AO3A 2QEQA 4L8VA 5GWXA 1Z18A 2XYRA 5IJAA 2QAGB 2IQ5A 3OCJA 3FPJA 1THTA 1T8RA 5FL3A 4KXWA 2WFAA 1E0SA 1JLLB 1G7SA 4MV4A 3LSTA 4F84A 1TQDA 1Z35A 1TL7C 4O4HB 5AI6A 3TTTA 5CJ2A 4FBGA 1J0BA 1WJGA 3N6RA 2A3NA 2FG6C 2WAAA 1P6UA 2V5VA 3NX4A 2AH5A 2HU5A 1UJ4A 4FXPA 5T6BA 2AOTA 1FVOA 3AH8A 4ZVTA 4YMUA 2FX5A 2C5HA 1ZIDA 5T8KA 1IJEA 2ZPUA 3RAPR 3FSGA 3N05A 4NL4H 4B6SA 2LWIA 3VU3A 1FJGB 4NZ9A 1ECPA 4NBRA 3UG6A 1K7YA 1NSFA 5BT8A 4MQEA 3V33A 3ICVA 1OXKB 1RJDA 4PAOA 5JJCA 4TWZA 4HNSA 3H3FA 4FHEA 1KP9A 1GN9A 4R05A 5DK6A 1XJQA 2NO1A 4D9NA 3QU7A 5LZ4A 2NP6A 3KVNA 3VKFA 1PWEA 3BEDA 1NVVQ 5LP6A 2QD2A 2B61A 1M2HA 1ADFA 1VG9B 2IUTA 2J8ZA 4Z86A 5C32A 5FLKA 3WYGA 2C61A 5FWDA 3F1KA 3FPSA 2XXBA 2DFLA 1ZOIA 1U3TA 3KQQA 2YMPA 2EBFX 2FX3A 5MFPA 4F5EA 5DNYB 4QJ5A 4M0MA 5FULA 4MITA 5LA6A 1G21E 5KVAA 2BWJA 2O5VA 1RJGA 3HDGA 5LCXA 3U2QA 3E03A 1J2JA 1JA0A 1V95A 4CV1A 3ZD8A 1S9HA 3KTAA 4MIEA 4BNZA 3RC8A 1TM3E 1KSGA 3GRPA 2WU4A 3LHIA 4GEKA 4YGXB 2WTNA 4BNDB 2YXBA 1M1NB 1USVA 1Z36A 2ZBUA 2QOEA 2BCGY 3HEAA 4ATNA 4FKBA 3IPCA 2AK2A 2Z4SA 1KRWA 2WLTA 2I33A 2PYDA 3VZSA 2CNNA 4EBFA 1LBHA 2QMQA 1SBCA 3THYB 1QKJA 1U8FO 2D13A 3VGJA 2X7HA 5M29A 3TF5A 4HQNA 4WERA 1RE1A 2SCUB 1CYDA 3KXDA 2EKZA 3LUBA 2A0YA 3OUUA 4CXMA 2CXNA 1DRUA 2O5CA 2XBLA 3CXRA 1AK1A 3ADOA 1YQDA 4ZCTA 3D6VA 1N2XA 2WICA 1YE5A 2X5KO 3DZ8A 4HNAA 3PWKA 3FTFA 4BRZA 3ZTWA 4YTEA 4LVOA 3GBVA 5FTJA 1E2HA 2Y92A 4YQYA 4R31A 3G88A 4LE1A 5A6SB 1LPAB 5BSTA 3THWA 2GH1A 1P0IA 4GI3A 1DNPA 4UAVA 4DCMA 3ROFA 1GGFA 1EGMB 3DMYA 4U2DA 4D8WA 3IP1A 1IUOA 4PWZA 4Q1AA 3SC2A 3W6PA 3C3DA 3P32A 3KT3A 3PGLA 2AIRA 3EQ9A 3QNMA 3ZH2A 3J80A 1SHJA 1PV1A 4ZTZB 1RE0A 5LJLA 4P4SB 3CE6A 3ORQA 4N7MA 2ZSEA 3ANSA 4PPYA 1G7TA 3JQDA 4WN9B 4HAOA 3S2ZA 4AX8A 1BQ4A 1HA3A 4AX4A 4HO1X 2AN5A 1E1NA 1SUPA 1QQ6A 4YV2A 2XUKA 5CA1A 2WJAA 3OJXA 2VQSA 1G4UR 3NI2A 3QUTA 3N8IA 3D81A 2MT9A 2ABWA 3C3JA 1HT0A 3TZCA 2BI8A 4UE3S 2HPZA 1KO4A 5FBHA 5E6UA 2XWPA 3ZC3A 1R4NA 1YDFA 1DG9A 1E79A 1WMSA 2WJ3A 3B3GA 3CUWA 3TOXA 1B8VA 1WCIB 4WE3A 4CTJA 3B3JA 3TLMA 1H2AS 3GJ3A 4M1YA 1KNXA 4ETMA 4DR7B 2B78A 1JAXA 1OE0A 3M6VA 4UW9A 2FMTA 3G8CA 1CQJA 1W19A 2NXWA 2B8JA 3A9CA 3HYCA 4KLRA 3V8QA 3PEUA 4JK3A 1U2GA 3LSYA 5LD2C 2V1XA 3KKMA 5SV2A 5LQNA 2GXQA 4B40A 1PEYA 2IEYA 2D5AA 2ZS9A 2Y0DA 3HSSA 2P8JA 3HU1A 1G20A 3I92A 4HGOA 3TQIA 2ZFUA 4E08A 4RL6A 1Z25A 4LFAB 4P0PB 1FDUA 2VA8A 1KIMA 4JASB 3RYCA 2MMGA 1OBFO 1RLUA 3IKVA 3KFVA 2XXAB 1D6SA 2ZYAA 4QDZA 1E0AA 4NP6A 4W82A 4BMZA 4QUEA 2WM2A 3HSYA 3RIMA 4BMCA 5KYGA 4ZDKA 3DL4A 2D5BA 2VXYA 1RIIA 4CM4A 3GF4A 3GLVA 2QTAA 4OUKX 2HPAA 4B5LA 3R09A 4IDQA 1U8CB 4UM9B 4BO4A 5K0EA 2XQIA 2Y8EA 4RAQA 3VA7A 1AZTA 1RQXA 4JJKA 1JR2A 2LR0A 3M9XA 2G1AA 2FEWB 4ASUA 3EA0A 3GN1A 1M83A 2PV0A 4TT3D 2F8TA 2QRUA 4X3PA 1N78A 1QGOA 3BJIC 3PIRA 2DWUA 1D7AA 4KWHA 4C6SA 1WHSA 4WBXC 4O4LF 3P9XA 1YJAA 3H9QA 4ALKA 3BC1A 2QI9F 2M1ZA 3G2MA 3AHDA 3N8NA 4QGHA 3PXBA 3USZA 2V3VA 4B9EA 1ZM4A 3L0PA 1F8UA 2HFKA 2ATCA 3DQZA 4BMOB 2QKYA 4X66B 4FONA 1R18A 3TW8B 2GA9A 2LIVA 2OZVA 1JDUA 2XD9A 5JAZA 1Z07A 5FPHA 1II8B 2G9QA 2X41A 3MNFA 5DLEA 3LPLA 1MQSA 2EHJA 4FZVA 3S40A 4XIYA 3W90A 2CLFB 4TROA 2JCXA 1U1FA 5GP1A 4UHEA 1JE0A 4XD7A 4TUYB 1KFCB 2CE7A 4UTXA 3N2GA 1BS9A 3DEFA 3ZCRA 1KEKA 1Y5RA 5GY7A 5JCJA 3IEPA 3UMSA 1PL6A 2AE1A 3O8NA 4AQ7A 1BC5A 1T26A 1FDSA 3OOSA 1JDSA 3MWYW 2JARA 4CQLA 4IFEA 4DDMA 3TBKA 3M4NA 5HSGA 3D6NB 4W9MC 3DZBA 4KVZA 4TXNA 1HE1C 3LE8A 3QVUA 2IU4A 1LSOA 5JQWA 4HK4A 3KQNA 3NC4A 1NONA 2GJ9A 5FA8A 3I9OA 4ISCA 3BGVA 4B6FA 3CONA 3LXMA 3NBZC 3QJYA 3T94A 2OXTA 3W3ZB 4PN3A 3SXUB 1T5SA 3HCCA 1E9EA 1KORA 1H4TA 5BW6B 1RWPA 4F7DA 5G1PA 1IK6A 4BEBA 3GI1A 5FPTA 1LXCA 2EWWA 5BWNA 2WUGA 3BJEA 4IDNA 2FSUA 1USUA 1E1DA 1Q12A 2IKQA 3THRA 2HIHA 3Q8XB 1EZ1A 2VJMA 3DAOA 3STXA 2QIPA 4CCSA 5A9SB 2AE2A 1HFKA 4JKYA 2OHFA 4CEIA 2GFHA 2DTXA 4FPXA 2CHEA 1D4ZA 1RKBA 1XEAA 4RMIA 1XROA 1U8ZA 2EFHB 2QMZA 3HY3A 3PC6A 1XJ0A 1N3LA 5JZSA 2PNJA 4X6XA 3AG5A 5TMDA 2HYDA 2IYZA 1NBEA 1RFLA 2C78A 3IA2A 1L0BA 2BEJA 1AKQA 2ZYTX 4IF4A 1GLGA 1LQTA 4IIUA 1E60A 3CSDA 1JS1X 3PCXA 1V16B 3OAAD 2AZTA 4F04A 2ZB2A 4IDEA 3OX4A 2J0UB 5GGXA 3M3PA 1NI5A 2ONZA 4DR6B 2A94A 5FX2A 4UDXX 2ZU0C 4JP8A 1PTKA 1X7DA 4EDHA 3KDSE 1PVVA 2ZRJA 4FFMA 3S70A 5A9RA 6ABPA 1NDQA 2PKWA 1HG1A 5FH9A 1XMIA 1AG9A 3DKRA 2BRUA 1QP4A 3D7RA 3NAGA 4MUGA 4PFSA 3BGWA 3NXKA 3CF0A 3HDTA 3QKSA 4YRQA 1RABA 1YO6A 3SSNA 5AKGA 4FYMA 2XWSA 5KC9A 3D54D 1BH6A 3MB8A 5AVUA 2C8VA 3E5RA 5K3CA 5EZ6B 4GDMA 4XWAA 1KZ7B 2OT3B 1DVRA 1WETA 2MU1A 1Z16A 5EUCA 3AF1A 3P0RA 1FUKA 5C52B 2E2WA 3TZ6A 4FE4A 2CFOA 1KMHB 1NF3A 1AHIA 4BVAA 3TYXA 3SZGA 3HJRA 3IS3A 1E9RA 2PDAA 4G84A 2XCLA 2YWGA 1F48A 4BU0A 1JGTA 1KYIA 2VPXA 4RL4A 3STYA 2QYHA 2VP9A 3ZVLA 2RB5A 3DG9A 4NSNA 5EQJB 4JQYA 4EELA 2QRVB 5D3KA 3TG8A 5HIIA 5FBVB 5J58A 4RGYA 1LEHA 1CR6A 4GOXA 2PD3A 2G9RA 1GTVA 3GRFA 4Q7KA 3B1ZA 4PS0A 3VYTB 2NPOA 5AKLA 3N87A 4N7RA 4BX8A 2JFBA 3FF1A 3DAFA 4TTRA 5D5PA 3I32A 4A26A 1PX0A 1XHLA 5BUZA 5D2CA 1WSDA 3CN9A 4GOMD 5CNIA 5H70A 4F0JA 1LV8A 5FL7A 3QNWA 3TEFA 2LRHA 2O2HA 4FMBB 4MKHA 3VBCA 3GGCA 3MWDB 4GMGA 1PUXA 4GBMA 3WWDA 2JLYA 5E9JA 3IT1A 1BHJA 2QTBA 2GKGA 5HGJA 5DX1A 2PO5A 1JHMA 1RWBA 2QPTA 1JHOA 1A0OA 4XGIA 2ODEA 2YZKA 1N4AA 3PICA 5B5SA 1N33B 4V2IA 1CRWG 2W48A 1OBHA 3F4LA 2W8BA 3Q7RA 2QRQA 1SVMA 4Q9AA 1VXOA 4LRSB 4Y2UA 5G41A 5JAUA 5IS2A 1M8GA 3MPOA 1U7DA 4NCBA 4LECA 2CMKA 1GG9A 3F6RA 4Y8VA 3A4TA 4PIMA 4W9NA 3HR7A 3T5GA 2MDTA 2UUCB 1ATZA 3INRA 2FWJA 3M9WA 1NF9A 5GZ6A 2CL5A 3LQRA 1PK7A 1JHXA 5FOVA 2IE8A 3CB4A 4JQOA 4L95C 4NH4A 5IM5A 4PANA 5TQJA 4CUKA 3M1LA 4ZTUB 2X15A 4DRXA 1Q92A 4R9UC 2VAMA 4ZODA 4YJ2B 2FUKA 4V0KA 1Z5VA 1E3JA 2WI8A 4YXWD 5AK0A 3HZOA 3UJ8A 2XYHA 1YAJA 1WW2A 2OORC 2XMBA 3R6GA 4V0MA 2AG6A 3DS8A 3VU9A 4J1TC 4CTMA 1V3VA 4BWGA 3PNSA 1QO9A 4KSYA 3VZDA 2AG8A 1JPVA 4OFWA 3NTLA 2OK8A 5KYUA 3ZCTA 3NWBA 4XGNA 1QOZA 4UREA 4J0IA 3QQ5A 2AQHA 1E3SA 1ZVVA 4ARZB 3NEAA 1LPSA 4P7KA 4WJLA 3VOBA 5FRDA 2IS6A 2YQ5A 2HJWA 1MGPA 2Y68A 4IIXA 3SJBA 4D43A 4GOJA 1GRQA 2X42A 3V7FA 5TIIA 1FIUA 3UF0A 1ZJ4A 1SGWA 5B57C 1LU9A 1I36A 4U6SA 1J2RA 1A4XA 1IXRC 1TM2A 3H13A 3WNCA 2CL0X 4QWMA 5JARA 5DHRA 2ZPTX 3V6LA 3JQGB 4YYEA 3NHUA 1XQYA 2AI2A 4XXHA 3NRCA 2R9VA 2W58A 2M1XA 1BYIA 2XOEA 4IDBA 5IJZA 4TYNA 5KYVA 5KWIA 5CBPA 1DRJA 2UDPA 4IMJB 2W6CX 4HQLA 1Y7TA 4C0SA 3PNQA 1DWOA 4FMDB 5C34B 1KBQA 2F00A 3E9RA 1RWOA 2W4MA 2YNMD 1ZI9A 4DJFC 4AURA 4G0OA 1FUEA 1QRAA 2JIRA 3A3KA 3LA8A 4B6OA 3A4YA 2PBFA 3WLQA 2HA0A 4R9VA 3GEDA 4ZOCA 1QGZA 2WWHA 4C4XA 4FXOA 1WCV1 2YJGA 3A9RA 1KPIA 2YN0A 1G6HA 5AQEA 3BK1A 3QLVA 4DLZA 4C4YA 5IT5A 1H69A 1JPNA 2YWXA 2PN1A 2N9UA 3D3EA 1VKJA 2CN1A 3TMAA 3ABQB 3U3OA 1QZZA 4AJKA 4D3SA 1QDLB 4ZOLB 1XTPA 3VHXA 2CW5A 2WV7A 4B3XA 2VRCD 3IOEA 4YAJA 3FYSA 3INGA 1ZR4A 3G0CA 1XTUA 1Y1SA 3UWPA 3V7NA 1DOZA 3BUSA 3GPCA 1EXMA 3KWJA 4NNJA 4TQ9A 3FPCA 3W6ZA 1LBQA 2OXCA 2X19A 1ZD1A 3HA5A 3NIWA 5HGXA 2QN2A 5I9LA 2QM0A 3KYCA 1IEVA 3A32A 4CM6A 2C03A 1T15A 1Z63A 2XIJA 2OFOA 3ND8A 4PG8A 1E6EA 3UB3A 1AN9A 1DZ3A 2GKSA 4A2WA 4EY6A 4EYSA 1EFPB 4Q7LA 3FCYA 3WSVA 1XALA 4MO9A 4ICIA 4XLZA 1AM4D 2YIVX 4FYPA 3V1YA 3T15A 4EI7A 5KYYA 1XPUA 1CT9A 1VKZA 1KJ8A 2RBEA 3DR5A 3B36A 1FRZA 2H1CA 2NM0A 4EUNA 3DTVA 3KR2A 1F60A 4QA9A 1G0OA 1XDUA 2O6LA 3LLMA 3TRJA 4AJNA 4P53A 3IIEA 2FJ0A 1HYEA 4IIJB 3OE4A 4IMPA 5GPBA 2MIIA 1IBSA 1ZSVA 3FOEC 1QH0A 1FW8A 3FCEA 4PW0A 1QHEA 3AR5A 4GC9A 1DP4A 1GTMA 4X61A 4YRJA 3U3ZA 2H2HA 4BEVA 2ZOSA 1FYDA 2C1EA 1MTZA 4JQCA 3DQPA 3A26A 3LP8A 1TT5A 3FUWA 3G9QA 1KKMA 1K5HA 1ZGBA 5T4HA 4NNOA 3KS9A 4HEA6 4YQFA 1QAOA 3GRZA 3TLZA 1XXHA 2UV8A 2H9YA 4HAIA 5HJ2A 1YQUA 5LDGA 5JV5A 1A9XB 1YS6A 2QVLA 4E4YA 3JVVA 3P4YA 4G0PA 2BDTA 1QONA 3FHTA 4KHPB 3DHWC 4GLJA 3F9CA 1HX7A 1VIAA 4EF4A 5CAEA 1QHXA 3JRNA 3B60A 3LNCA 5B7GA 4QUKA 1Z74A 4PGMA 1C0PA 2XMRA 3UAOA 3FNGA 4G4IA 4JDPA 3VV2A 2QSJA 2XUHA 4YMSA 1YFKA 1S0UA 2O50A 2G04A 3G2HA 4RIGA 3IESA 3CE9A 1XKLA 1D4AA 3P20A 1JHDA 3PHGA 4IJUA 4UNSA 4ZEOA 1SHZA 4YDHB 2QAJA 4MI3A 1AUQA 4S04A 1L5HB 1DX9A 1KKLA 4DB4A 1GSAA 4IJ6A 2RHTA 4MDEA 4GFDA 4QBKA 1VGQA 2ODNA 2VK8A 2HPHA 2ZBRA 1H0KA 2PL9A 4OHOA 4M9QA 1DQRA 4ZVKA 1NURA 1T2VA 1AGPA 3PRJA 2QA5A 5JNVA 2X3FA 1P5JA 4FFBA 4HAXA 3ZD9A 1RLTA 2GT1A 5KYTA 1GNTA 4OMDA 1N6NA 1AZLA 2WWIA 5IAOA 2GZDA 2AX4A 1EGAA 1IEXA 3Q3GE 4LWZA 3W8EA 4CUJA 4MLPA 3C7CB 3C8UA 1DGQA 1CEYA 1TMKA 1LBTA 2WUDA 2CLHB 3CG4A 2PRJA 3OQJA 4NESA 4Y30A 4BMXA 2IFTA 4Q9JA 3K31A 3E3NA 2D74A 1Q7RA 2CBXA 1T2DA 2WZQA 5E7JA 1QLWA 2CYBA 2YN4A 2ACKA 4K9SA 4UE2A 3T3HA 1QCYA 3M33A 4JAVC 3W8RA 1N0VC 4E5DA 1NVMB 4FHFA 3PLAE 1H6CA 3I2YX 3QJ5A 5L3SB 1EVZA 2PUWA 4L08A 3MAAC 4CL2A 1KBOA 5LDHA 1T35A 2H4HA 1CDOA 3OJCA 3LF1A 2GPBA 5KYXB 3L43A 3CR3C 1CY0A 3EUEA 1AH2A 1JEEA 3ZWNA 4MB6A 2I62A 3OX1A 4DXHA 4RQBA 2VBCA 3RSZA 2D7JA 3CVYA 3T06B 5G40A 5K0GA 3ROPA 3OG9A 1QQ7A 4X6YA 1DB3A 3IXQA 5JJKA 1VI6A 2UYYA 1XMSA 5DFAA 5F64A 3OZSA 2EBWA 4DSUA 4YT4A 1POWA 3AB7A 2I99A 2JNWA 2HHJA 3PEYA 3HDYA 2F43B 2AJCA 5KJFA 3QE0A 3H9BA 2XTNA 3QMVA 1RRPA 2J1LA 3IQFA 3L6EA 4HGNA 4JOQA 4NTZA 3ERCA 5LP1A 3FLBA 5SZIA 1U04A 1WSAA 2QU8A 3STUA 1R0BA 5GV8A 3QY0A 2FEMA 3EGIA 1BWRA 3O91A 1NKSA 3SMVA 1EDOA 3GLIE 3EIQA 5KOHB 1KQGA 4F12A 3WZLA 3MIZA 1L7RA 4PCUA 4BFCA 6CHYA 5AW8A 3ZEAA 5CA0F 5DISB 1JJIA 3GJRA 4CIVA 4F4IA 3WGZA 3W6NA 4NAHA 1GZ7A 1DAKA 1CUGA 1RQNA 1XA0A 2EL9A 2VSNA 1NVAA 4WLEA 4YIHA 5KBYA 2AHOA 1ABBA 1ZHHA 4JLJA 3GLQA 4O25A 5ALTA 4DJ5X 2JGDA 1V8DA 1ZG3A 4AWAA 4NXMB 2C0QA 1ZWKA 5EJ9A 1CDEA 1WB9A 4JI7B 1IXKA 1YZKA 3VX4A 2NUTB 4UJ3A 4IVRA 1M8PA 1IPEA 2B9VA 2P11A 3IT0A 2GERA 4IDHA 3K0FA 1U5BB 4HB2A 4C7BA 3ZU6A 1HKUA 3H8JA 5KX5B 1PG2A 1Y8QB 2B25A 4EG3A 1K2WA 3UATA 1ONPA 2O2XA 2XUPA 3PFHA 2DU8A 2IZ7A 1Q1AA 4FYJA 4LKRA 4CVNA 3LT2A 3P9KA 2PEYA 2HXYA 1QH9A 5DEOA 4ZICA 1V0JA 3QOYA 1JPJA 2YWJA 1TAUA 1KVQA 1YXMA 4G37A 1NI3A 4GM1A 1DCFA 2VHYA 3C3WA 3WB2A 4ZK6A 5DNUA 1T29A 4WCVA 5KOJA 2WYHA 3O95A 3RSHA 5DGHA 2GK4A 2P2NA 1T9GR 2FGJA 2HF7A 1DAOA 4MX8A 1NQOA 2NQ2C 4CHTA 1NE7A 3EC1A 4RZ2A 3RUCA 3WLRA 3WQHA 3QZUA 1JSLA 2GFIA 2QLJA 2QUHA 1EK2A 1P39A 2QQFA 1B00A 2G71A 2OD2A 2O7VA 3CM0A 1DKUA 2HKIA 4UCWA 1L5GB 3SFTA 1WQ3A 4C4AA 1EA5A 1Q77A 4LJ4A 1S4MA 3TDNA 4ZMBA 4EJSA 3TX6A 4QWWA 1NP3A 3AFGA 2O7QA 1PWXA 1PGJA 1NY6A 1YGPA 2OCDA 4G0ZA 2JAPA 4A23A 1JAZA 4AJEA 1NVFA 3SBXA 4DEYA 1CLUA 4XOIA 3ZIAD 1YCDA 4A10A 2QB5A 3GPIA 3QGMA 3RIXA 2Y9PB 3R0XA 4M1TA 3GP8A 1EJBA 1AS3A 1H93A 3I0ZA 1L4FA 2GETA 3ZUGA 2DETA 3HP7A 3U4IA 2JZOA 2VF4X 1CHNA 4L5CA 4O1MA 4RD1A 5FLYA 2FZ4A 4KVGA 1WSWA 2J9YB 1EHCA 1Y81A 1XA3A 3JS5A 2CVPA 1Q0PA 3T38A 2WQ6A 4RZSA 3IC5A 3MMXA 1HUQA 3H2GA 4V3BA 1X7WA 4PFQA 2B1IA 3KJQA 1KMCA 1GZ4A 3EYWA 3QX7A 4GUAA 2CV0A 1Z4JA 4UXHA 2ZU6A 3DOJA 1U3GA 2GPYA 5A4DA 3F3MA 1VA4A 1S89A 3EWAA 3IQHX 2GRJA 1U4SA 4H6VA 3RS4A 5KQSA 5BR1A 5AVXA 1U8AA 2CMFA 1P29A 3ILXA 3I9FA 1FYXA 1Z6AA 1UM9A 2O20A 2G1JA 2OC4A 1FOEB 1ZQ1A 1UMCA 1WM1A 2ESRA 3FMGA 4RETA 4HMPA 9GPBA 5L95A 4IINA 5K3BA 5BMVB 4CIDA 3O0DA 2E89A 4TL6A 1NTRA 4HDMA 1HSZA 2HSJA 3ECCA 1YJ8A 2EJUA 4KBFA 5BV8A 3FAKA 1JHZA 5LMUB 4HAWA 4ALLA 1ZY2A 3CZPA 3INNA 3AGQA 4WN3A 4KMMA 4YRFA 3GLSA 1GJRA 1T8TA 2G4CA 4LV6A 4PN7A 1GM5A 5J2TA 2DERA 3R2JA 1LH0A 3O2QB 2GF9A 4EUSA 1ISJA 2IHBA 3DPIA 2C8JA 1E2IA 3GHHA 4KJZA 4QPPA 3ZH9B 3DYBA 7REQA 1SJ9A 1QX3A 1ZEMA 3E0QA 1ZNWA 3TMKA 1Q19A 2IZ0A 1G60A 4NKRA 5AJHA 3TL6A 4MV1A 2XSZA 3GAAA 1Z2NX 3DTYA 3MYYA 1V1RB 1EDEA 2EL7A 4GR9A 4DDWA 5B7PA 1KDOA 1QLHA 3CVXA 3PLNA 3V1UA 3LTEA 1MQAA 2QLLA 3LIPA 4BNNA 4DBZA 3IMEA 4R68A 4EABA 1E6CA 4XLLA 1TGYA 1XU9A 5AFSA 5F7ZA 3LCCA 5ESXA 5FT9A 3TSZA 3KZXA 2WIAA 4L73A 2RGYA 3M4JA 3OZUA 2CNWD 4MW5A 2OAEA 4Q4JB 4NBKA 4C0KA 5G4LA 3UHJA 1NRIA 1T4DA 5I7FA 3ABRB 3AU9A 1JQJC 1SG0A 3QENA 4UVGA 2VF2A 3AZOA 3WIBA 5E6SB 3FTCA 5FPPA 4YMLA 2I91A 2PT6A 3UVEA 4ZARA 2A9RA 3GUUA 4OYRA 2JLRA 3W1EA 2YXEA 3FE2A 3AJAA 1K86A 2HHAA 4QU5A 4HEJA 3HU2A 4DCCA 4IO1A 4OAPA 2ZUUA 1QO0A 3OE5A 3FI0A 3KKZA 5HR5A 3I23A 2Z2XA 4NYJR 1MFPA 1OA0A 1P1HA 3QLTA 4WD3A 1YSCA 2QROA 1B1AA 2NTVA 2QJOA 4GH5A 4Y2YA 4GE0A 5IARA 2P68A 2J0EA 2Y1DA 3F3SA 4EGCB 2PS1A 2PUDA 3SC3A 1SVKA 2OTCA 1CZOA 2BEWB 3ICEA 3ASVA 4XM1A 3FMPB 2FEOA 4KRYA 3SYRA 3T3OA 3GVHA 1QMPA 2XI4A 3K0EA 5IHXA 4KN5A 4Z99A 3HB0A 3NALA 3E2MA 1YC5A 1KZGB 1P31A 3ISVA 3A31A