4CVZA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
277
structure length
277
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I GLYCOPROTEIN HAPLOT
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
total genus 68
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cvzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4cvzA01
1KEGH 2YD2A 3NIGE 1HIML 3WKML 3IDGA 5IMOB 4X4YB 5EOCH 2X4OA 2AJ3A 4YXHH 4OZGB 4TRPL 5IB3A 5DFVD 5EOCL 4UILL 3WD5H 4M6NH 1DDHA 1ZT1B 1AHWC 3MLVL 4G3YH 5BXFA 1PG7X 4N0FA 2NY5C 1I3VA 1M1SA 3M8OL 3FT3B 4MDJA 3WL9A 1MJ7H 2QSQA 4ZO7A 2X4NB 4V1DE 3RUGB 3RNKB 4JRYB 3SJVE 2JJTA 4QOKB 2FATH 1HYSD 3RP1A 3TYFA 3QIUC 4TN9A 1KC5L 1UA6H 4JLRB 4M8QB 4YO0B 4P5TB 4M62H 3MYJA 3NAAH 4XPAH 2BVOB 1BFOA 4M62L 1JPFA 3LQZA 4GUPA 1YYLL 1MHPH 3QRGH 1DQLH 4N1EA 2A77H 1G7QB 3TFKC 4NQSB 1Q72L 3PWVB 4HCRH 4R0LB 3M17B 3DARA 5FXCH 1EERB 4EQ3A 4HCRL 5ACZB 4U6VL 2ITCA 2DBLH 4LSUH 5J7CC 3ILPA 1MRFL 5CD5D 3O4OC 2HT2C 4PB9H 1RUAL 3ZTNH 4PB9L 4Y2DC 4LF3B 5ANMA 3NIDF 1I1YA 4U1HA 3ZDZE 4C59B 5I16A 4GG8B 3I6GA 3JWOH 3UPRB 3O9WC 4PYHA 4ISVA 3HPLA 5EC2B 1FZMB 3QO0A 3GMOB 3RWDB 2IBZY 3W9EB 5FYJE 4DW2H 4XNYH 1NPUA 2VWEC 3DX8B 2DWEA 3HG1A 1S7TA 4QCIA 2XKNB 1ZA3B 4LLDA 3MA9H 5LAXA 1MFCH 1AXSA 1TETH 3GSNL 2HFEB 1F58H 1IAIH 4HIJB 4X5WA 1P7KB 2V5TA 2VDKH 1F58L 1PD6A 1IAIL 1DSFH 3ULUC 3QWQB 3NZHH 3FQNB 3G6DL 5D7JC 3RZWA 4G8GE 4IIQC 4O4YH 3UTTA 4ZSOE 5DVOA 4F7MA 4O4YL 1JVKA 5CCKL 2ZOLB 1MVUB 2VDNH 3WEXA 2WW8A 4F7PB 1RVFH 1XCQA 4K55A 4NQCE 3S37H 4LVOB 3KPRB 4H1LH 5F1OB 5SWZD 4LHUG 4U1GC 1E4XL 3UAJD 4JO2H 4HULB 3RFZC 4YDKH 4OGYH 5ID0A 4P2QD 4XC1H 4J3OC 3RIAF 5L6YH 2FYYA 5IB4A 5IMMB 3OPZH 4RFOH 4G6MH 4HLJA 4LSRH 3CXDL 4BYHA 1U8PA 4RFOL 4G6ML 1E28A 1EH9A 2NXZC 4WEMB 3E2HC 2XZAH 3S34L 3T04D 1CBVH 4TQEH 5F3BA 1P4IH 1I9IH 5HVFB 1EAPB 1CBVL 1KBGL 4C56E 1P4IL 3KS0H 1OD9A 1YECL 4CW1B 3F62A 2PTVA 3IF1B 2NY3C 3FZUD 3LRHA 2XYCA 1OGTA 1DEEA 3BYYA 1A21A 1FFPB 1I4FB 4YGAB 4S1SH 1KXTB 2NW2B 5IW6A 4KTDH 3BEVA 1DQTA 1BFVH 1SQ2N 1BFVL 5MERA 3NCJH 3TVMC 4Y1AB 3TPUA 5F89B 1UWEL 1SYVA 2XY2A 1HQRA 1EHAA 3VRIA 4CU6A 4Z7VB 3P4LA 4EI6B 4GRLD 3G04B 4NM4L 2X1OA 5D8JL 2AEQL 3MV9A 3GMLB 1IGJB 3OKKB 3HCVB 2I9TA 3CNKA 2CLRA 5M94B 1MI5A 4JREB 1CICC 5INCB 3I3BA 4PRIE 1LVEA 3HG1D 3T1WA 5T1MB 3DSFH 3G9VA 3S97C 4ZFOA 4O00A 4M6OH 3VI4E 3MA7B 3VXSA 3D0VB 2BC4A 1FYTA 4WUUE 4NBZB 4WUKL 2CKBA 3MUZ1 2YSSA 3NFPA 1SJHB 2FHCA 2D4DA 1OAYL 5EOTA 5ADOH 4OB5H 2JB6B 4EJ1C 3C5ZC 3V4PL 4OB5L 1S9XA 4KJWD 1A3RL 1FLTX 4F33A 2J4WL 4JRXE 4KJPD 5CEXA 1PX4A 1CLCA 3CVIL 2H26A 2V2WB 4QY8A 4JFFA 5IFAH 3IYLW 2DLHA 2BSRA 4K3JL 4Y4FC 3SEPA 3T77A 3T4YA 5ISZE 1A0QH 2CK0H 3GJFB 2GCYA 2WY3A 2AVGA 5DYOA 4S2SA 3QPQD 1S9WA 5E5RB 2ID5A 5IBUB 2B1HH 1CWVA 4K94C 5EZIH 3ZKXB 3O8XB 4BH8B 2CUHA 3L6FB 1TLKA 4X7EC 1XF3A 4XWOC 3BMVA 1FL5B 3FB7A 1FNEA 3TN0B 1WK0A 4X4XA 4WHTB 1HKLH 4GAGL 1Y6KR 3EHBC 3VFOA 4F8TA 1DFBL 1CVRA 4AG4L 4N0UE 5DJDB 1K8IB 1HKLL 1DEDA 4MMZC 2VE6A 4B0MM 3QUXC 5DT1H 1C08A 1NL0L 3WSQH 2ZSVA 5D7SH 4R96A 5DT1L 2ADFH 3WSQL 5I1HH 4H0HB 4UT7L 5IB5B 5ICZA 3QUMH 5ELIA 3CFJB 1QQDB 3SE8L 5JW3L 4TSAH 5A1AA 1AQKL 3ZE2E 3Q5TA 1UXWB 1RK0B 4TSAL 1C7TA 4I0PC 5D72H 4P2RE 1JF1A 1SBBA 4L29A 1X5KA 4HS6A 5D72L 1CFQB 1T7ZA 1UWXK 2J8UA 3F7YA 2QQLL 2PW1A 3HRZB 3MV9D 2NY6D 5C2BL 2GJZA 5TFSL 2EDLA 1NFIB 5FO7A 3OKOB 4LCWB 5F7LB 1MI5D 5JOFA 1T7YA 1Z0NA 1EFQA 1RZGB 2DQFA 2ARWA 4UU9B 1IM3A 2VZ3A 4WI5A 1JUFA 3DURB 5IJVA 1EVUA 1Q38A 2W60A 2C7UB 3CC5A 3MRIB 3MV8B 4FXKA 4R26H 4O5LL 3MBEB 1EZVY 1FYTD 1QFHA 4P2OA 2EDYA 4YFLI 3PHOB 1Q8MA 3TNNA 4BH7A 1T7WA 2PW2B 5H37G 4I0CC 5B8CA 1ZT7A 2HG5B 2V7HA 3D18B 1SYSA 5KW9H 5F9OL 4FN0A 4HWZA 3CLEH 2UYLB 1LO2H 5J9PA 5L9DL 1UB6B 4PJAB 5F70A 5DQJA 1BVKA 4NN6B 3QG6A 2FO4B 4Y4HB 2DLEA 4JFFD 2VRAA 4QWWC 1WFTA 2A73A 4PRPA 1T1XA 4JPIB 4HBCH 3V8CA 2BNRE 4WW1B 1WIUA 5JPMB 5HHMA 2X4SB 4MD5B 4NO3B 3WIFA 4ALAL 1Q9LB 3MJ9A 1LEKA 5BZDB 5GGVL 3BWAA 1IAMA 3E8UH 5IEHA 1OW0C 1QVOB 2VLJB 4HKBA 1ZWIB 3E8UL 1PKQA 1AJ7H 1A9BB 4MAUH 1G1YA 4ZUWB 1HHKA 4MB5A 5B39B 3EJYC 3EYQD 3FB6A 5BRZB 3UTPE 4O2CA 1FV1B 1DTUA 3L7FA 3TO4A 3HS0A 2JLLA 3FQUB 5J56B 2HKHH 1EEYB 3WO4C 1A02N 4D9LH 4NWUH 1B3JA 1EGJA 5EOQH 3IAPA 2YXFA 3BXNB 3D0LA 4JFOB 2E5EA 2P45B 4ORZC 4WCYL 4XCFH 1SBSL 1F4YH 5JZ7D 2I07B 3LKPA 3QR2A 3VFNB 2DQHH 5IG7B 1F4YL 5F7YC 4RMSA 3WYRA 3DV6B 1ZLSH 3E6FA 5KSBE 1JHKL 3CIQA 2QTEA 3VGBA 4HIHB 2J5LB 2Y9RT 5MHSE 4YXLL 5EIQA 1TQBC 4AEFA 3PNWA 43C9A 1FPTH 1F97A 5D1ZB 2W65B 3BRGC 3X3GL 1PLGL 3PV7A 2LFGA 2EE6A 5J3HC 3Q2CA 3CXHK 4FQCL 4MA8H 3RWFA 4YHZH 5HYSB 4EI5C 2Z31B 5E8OB 4YHZL 4ZPTB 2L7JA 4Z7WE 3SDXE 3P77B 4OIBA 2DM7A 2GAZB 1N59B 5IHZB 3VFSA 5ADPH 2VERN 3OGCA 4N5EC 3EOAB 4FFWC 4QRTB 4WNQA 4NT6A 4YK4B 1H3VA 5DD0H 1A7OL 3GMMB 3AS2A 3S7GA 3HUJF 4P2OD 1OTUC 3QNYB 3VWJB 2VSDA 4M43H 1E27B 1KG0A 2HAZA 3BFOA 1SJXA 4FQHB 5I8CA 2D03L 3JWDH 3ECBA 2Y72A 1QRNB 1F11B 4U33A 1NAKH 3VFWA 2DLIA 1L6ZA 1XR8A 4PJDB 4EVNB 4O02H 2D0HA 5DI8B 1U95B 4C83A 3G9AB 4JAMA 4O02L 1KIUA 5BQ7B 1N4XH 4M02A 3K4ZA 4LFHD 4F7TB 4PRPD 4NYLB 3U4AA 3U0WH 5HHMD 5TDOB 5T3XD 4CMMA 2ICWB 5DJ2A 5EUOA 1KTLA 3RY6C 1F3JB 3PP4H 1NFDA 3IDUA 3D9AL 1CLZL 3MROA 3WO3B 3STZB 3BZEA 4PB0L 5C0EB 2CRZA 1HH9A 3DXAA 1WISA 4XNUL 3LKRA 5TPWL 1KGCD 3NMEA 1MCPH 3KNBB 5D2NA 8FABA 5ILTH 2ESVA 1JPTH 2DLFL 2EH7L 5AEAA 5IV2A 1MCPL 5EC1B 3TO4D 3NCCB 2CDEB 3B5HA 1YPZF 3QFJB 4K71C 3O2WL 2XN9B 1R3JB 1RURH 4RZCB 4PUBH 4DAGH 2HT3C 4PUBL 1UZ8B 5EUKB 4JFDA 1IEAA 1N5AA 3C09B 5A3ID 2DKMA 1K2DA 3E1F1 5JXEA 3MCLL 4XHQA 3HC4H 1QFUL 2RGSA 3QI9A 4E42B 3HC4L 3NPSC 4KRPC 4UB0H 1KXQE 3GBML 3TH2T 1TTUA 3LB6D 5EPMA 2HFTA 4BZ2H 1XGYL 2OXHA 4HXBL 1JBJA 3OR7B 4R4NC 5MENB 3P4NB 3QQ4A 4OGAD 2PYEB 4JO4H 2AXHA 5T1KB 3X12A 4LPUA 5IIEB 4JO4L 1IM9A 1I8MB 4Z77B 4XB8A 4ELME 4APQA 2YN5A 4U1KA 4YNYA 3RL2A 1HWHB 1IZKA 1CTOA 3GBNL 4LPWA 2V17H 3UBXB 2LU4A 5ALBH 5I15H 3FFCB 3BD3A 5I15L 2VC2H 5DD3H 4RGND 3QA3A 1WBZA 5DJCB 4R4BA 4NRYA 1T6VN 4M48H 3CCHB 2XA3A 4N0YL 1AD9B 4G6JL 1J0JA 4C57C 4IRJB 2E7LE 1T0PB 2HFFA 5CZVH 5SWZE 3RVUC 3ARDC 1WC7B 1FIGH 4AIOA 4CNIB 5FYKE 2FX7L 2ILLA 4P2QE 4P9MH 2Z9TA 3ZHDA 5ABDE 4OD1L 5F1SA 2Y06H 4PJFE 4PV8B 4YHOH 3LMJH 3ET9F 2HYMA 5FECA 1MWAA 1G7IA 4I18B 4LAJH 4TVPH 1I8KA 4AQ1B 4XT1C 2E7HA 4OZIA 1FVCA 3QFDB 5FO8B 3R0NA 4FA8A 3A67H 3VXOA 1BQLH 3ULSB 2ICEB 3L3KB 2CDFA 4LLQA 5C0BE 3ZSSA 1A14H 1BQLL 1QG3A 3QP3A 5DZLA 1ZS8A 2X4UB 1AIFA 3DXAD 4NJAH 5E4IA 1A14L 3U9UB 3PWJA 1NLDL 4O51A 3EBAA 4QRRA 5D5MB 2ESVD 5GJSH 4LCIL 5J13B 2EYTA 2OTUA 3MRFB 4DCQA 5AWNL 5F9WC 4NCC2 3KDMA 4JFDD 1RIVH 4N8VA 5CJQH 2VXSL 1F4AA 3EW3B 1RIVL 3QQ3B 3CFEA 2BY1A 2OJEA 1P9MA 1S7VB 1ZTXL 1O0VA 3QI9D 5FUOL 1FZOB 3GNMH 3W9DB 3D25B 5I1AA 5ANME 5JW4M 4Q6IB 3WE6A 1CFVH 2VDML 4P59H 2BSTB 1JZ4A 2D7QA 5DJ6B 2MOVA 4PP1D 4HUKB 1UADC 4JZJA 1JZ8A 4L4TA 1X5JA 1IM9D 1KACB 3HG1E 3ERYA 1F90L 3TA3A 3PWUA 2R29L 4APQD 1F2QA 4WU7B 5DJYB 1J7VR 1MFEL 1MLBA 4M61B 1M7DB 5F1NB 3I6KA 5GGQL 2P8MB 1KYOK 4JZNA 1VESA 8CGTA 4U1LA 3I2CH 3LPFA 4JM2D 4LFHG 3GSRA 4UQ3B 3I2CL 3IDYB 4MSWB 3KR3H 4Q0XH 2ZUYA 4JY5L 1R3HB 3UTTE 3O3EB 3KR3L 5B22A 3L5WA 4HK0B 4ELKB 4K3EL 5JIHA 5IESH 1MVFA 2CH8A 5KAQF 2G9HA 5FM4A 2UWEE 4HWBL 1YMMB 4CVZA 4NZDA 2HP4A 1K9TA 3O6FA 3QAZB 1XZ0A 3OL2A 3BH8B 4KXZI 3P0GB 5SX5K 3RU8L 2CKBL 4ERSH 3SDAA 5JMRA 3QEUA 5C0DB 2HMIC 1U8NB 4ERSL 3V0VB 2ED9A 3R1GH 1RJYB 3N0PB 4MWFB 4JPWL 2AK4B 3GMQB 4X7TB 3KPNA 4WV1B 3C60C 5D6DA 1C5BH 5F88B 1HYSC 3BIKA 3OKLB 5JDSB 2Q86B 1GHFL 3VFVA 2PCPB 3EOTL 3PABA 2B1AL 2KQNA 4JHBA 3V5HA 5ID1A 4ZUVA 4QRRD 3P11H 3V5KB 3VGEA 1OP9A 3P11L 3QXDA 3O3DA 3U9PH 4NQEB 2J7LA 1BQHA 2VDOH 4OF8A 3TIDB 1JZ6A 1AP2B 3BPLC 1WFNA 4DZ8A 1S9VB 3D85A 3MRKB 4MNHA 4AL8L 3FL7A 1N6VA 5CD5C 2FIKA 3TPUE 4KQ3H 2HVJB 4JN1L 5AD0B 1IZJA 4KQ3L 2HLAA 4WO4B 2RFXA 5H35B 1DL7H 4NNXB 5DF0A 3MV9E 3IETA 1NDMB 3OXSA 4CAGA 3QH3A 1DE4B 3O6MH 1IKFH 4FABL 5B3NA 1G7JB 4MJ2A 2VIRA 1KJVB 3U30B 3O6ML 1MI5E 1VFAB 4Y5YC 1ACZA 3LS4H 1C1EL 4X6BB 1QSFA 4L4TD 3LS4L 3V5DB 2Z92A 4HJ0D 4R8WL 3MRPB 5MEPB 3EYFA 2PXYB 4L3AA 1WT5C 3MJ6A 4GMSH 3VXSE 2EKSA 1UJ3A 4O9HL 4YIQB 4GMSL 3EDJA 4MJIB 4QF1B 5EULV 5E99H 4YWGH 5TE4L 4GAJL 1YUHA 5J06A 4JANB 4RWHA 2H32H 3RVWD 4YWGL 2BY3A 3GB7B 5KVGL 4ACPA 4M7ZC 3WLWD 1QBBA 3RA7H 4MQXD 5E08H 3UYOD 4NSKB 4JFPA 3BKJH 3UTSA 4PV9B 3VI3E 3MFFB 2E7LC 5B3JE 4CVUA 4PJGB 4XVTL 1A1OB 1CI5A 1T20B 2WINA 2OZ4H 1KN2H 3K8LA 4JB9H 3UAJC 3LZFH 3IXAA 4HKZB 1I9RL 3O6FD 1NBZB 1SEQH 4LCUB 4JFYA 3EJZD 1ZHBA 5L8JB 1PKOA 3F8UB 4FQ2H 4K8RD 3BPOB 4JM4L 1S78D 1T2XA 2IMMA 4X80H 3QXVA 3MZGB 3DROB 2WM0A 5E94B 5L8KB 4X80L 3SGJA 2UZIL 4YDJA 5E8EA 1FGVH 2AQ3A 1WBXA 2FJFB 4OQTA 1UKSA 3TPKA 5DFTA 3I75A 3REWA 4FQIH 4L9LA 3MRHA 5IR1A 3FZUC 1EEUA 1JE6A 5CHNA 4HUVB 1X5FA 2PO6B 1NBQA 2CXGA 4J6RH 4XB7A 3GUTB 4PRDB 2HH0L 5IEKB 1CGSL 1C16A 4X4YA 3ZE1E 5F1KC 5HSFA 4LGSB 3VG9B 25C8L 5IT2L 1L7IL 4L8SB 3MLRH 3BP4B 4M4RA 4GRLC 3BZ4B 4RFNB 4R90H 4DGVL 3WBDA 2J8UE 4IBLT 4XVJL 3RUGA 2IH3B 1MIEH 1X6NA 3V6OC 2DQEL 1MIEL 4XBPA 2R1XA 1E6JH 4M8QA 2AGJL 1IQWH 1NDGB 5DMIH 2E27H 2BVOA 1QSFD 1IQWL 5DTFA 3OJMB 5CEZE 3RY4A 4H0GA 1S7WA 2GIYA 3IU3B 1G7QA 2X4PB 5EORL 2EYRA 2QADC 4U6XB 4YZFF 1BM3H 3WS6A 4R0LA 4RGOL 4YAQB 4TULH 5ACZA 1P4BL 5HGAA 5BCAA 4PIRF 3V6FB 3D2UB 5DJXA 1RQ5A 3HNVH 5GPRA 1B4JH 2O61B 3D3VB 4KJWC 4X6FB 1T2QH 2JK5B 3EFDL 2FR4B 3HNTL 3U36A 5EU4A 4LF3A 4BFIB 3UTSD 4GG8A 1TFHA 3PGCA 3UPRA 3CX5J 1AGDB 1KSRA 1QLEL 1FZMA 5HDLA 1W0VB 3GMOA 3RWDA 4PRPE 1VA9A 1T0NB 1U8KB 1BGXL 3L95B 4NKDA 3MRNB 5HHME 5T3XE 1Q9KB 3WCYA 3QPQC 5DVNA 1ZA3A 1I8LC 5IJKA 3WLBB 4GRMB 2MPAL 1EPFA 3H9ZA 1K85A 3DPBA 1WF5A 3SDDC 2GT9B 3UROR 1PKQE 1P7KA 4ZUSA 1KGCE 3JV6B 4N8VG 1UG9A 1ODAA 3I9GH 3FQNA 1QLRB 2WP3T 2VKXA 4IOFD 1F8TL 4ONOA 4PJBA 4AEEA 4JO1H 3WUWB 4FQJH 3LN5A 2WBKA 2EH8H 1EO5A 5GGTH 4XP5H 1N2RB 2R1WB 4FQJL 3KLAB 2DWDB 5KSUB 4PDCE 3KPRA 5C9JA 1VSCA 4Z0XB 1K4DA 3QUYA 4BK5A 5MEQA 4NO0D 1E6OH 3IFPB 3NABL 1MCOL 1E6OL 1LE5B 4PRHB 5IMMA 1CR9H 2BSSB 4PGBA 3H3KA 4TTGA 4JJ5B 5C0CD 3VH8B 3HC3H 2WBJB 3GI8L 3NTCL 1KTDA 3H42L 4XNXL 2XNAB 2QL1A 2MCG1 5IW3A 3S36H 1IL1A 4ODWA 2NY6C 3HZVA 4JFXB 4CW1A 1ZHKB 1OTTD 4I1NB 3IF1A 1OWRM 2Y25A 5DMKB 2Y36L 4WDIB 4Y16B 2K7PA 1M71B 2YUVA 4P3CL 2Q7YB 4QXGL 1Z5LA 4KZDL 3DVNA 2GYSA 1I4FA 1FFPA 3GSQB 1Y0LA 1YEIH 1ZOXA 4Z0BH 3O3BB 3MGTB 1YEIL 1M4KA 1LEGA 5FEBA 3ZKND 3L5IA 2GJJA 2E7BA 3U7AA 3FO1B 4XP9L 3C6SB 3WFCH 4M7LH 5F89A 2EDTA 1G7LB 2XG5A 4YHKL 4Z7VA 2VH5L 2DDQH 4EI6A 3G04A 2A9MH 2P7TB 1AHWB 3BPCB 3GMLA 5F7FA 3OKKA 5L88H 3HCVA 3QQ9D 2Q7NA 5FYJH 1H5BC 1X4XA 4YFEA 2KL6A 4ZD3L 1SEBB 2YMXH 4ZXBB 1V3KA 3GRWA 4Q2ZB 2X7LB 1NEZA 3QCVH 1H9VA 5EUOE 3QCVL 2YEZB 1JNNL 1NFDE 3MA7A 2IANA 4GW1B 3D0VA 4LEOA 1A1MB 3EYQC 1BQHG 3AY4A 5GHWH 1QFWM 4R6UA 1LK3L 4L4VB 3VXMB 1SJHA 3H0TA 3QIBA 2ESVE 1MREH 1AFVL 2FX9H 4LCCA 3G6JF 2JB6A 3HUJA 2FSEB 2Y07L 3MO1B 2ZJSL 4KTYA 4H5SA 4QEGA 2Y5TB 1LQSR 4JQXA 2EDXA 3O4OB 3VW3H 4JFDE 3CFBB 2WUBH 2FBOJ 5JZ7C 1PBYA 2YPVL 5GRZA 3QUYD 4M7KL 2WUBL 4XPTH 4Y2DB 4XPTL 1C12A 3O9WB 1CS6A 1HYRC 1U0QA 3FN0L 4HPOL 2W38A 3G08B 2ZUTA 2O5XL 4W4OC 5CD3B 3S96A 4FHBD 4A6YL 4ODTH 1QNZH 4BH8A 1UCBL 4NIKB 4PJ7F 1FBIL 3MRMA 5K9QI 4MMXC 4YHML 3TN0A 1EO8H 1KT2B 2AJSL 2E9WA 5D93B 3B2UD 5DJDA 4NFDA 5D7JB 2YWZA 1YPZA 4HC1H 4IIQB 4M6MH 1T80A 1U58B 3OQ3B 5IM7B 3THML 3DVIA 4HC1L 1MCIA 4P2OC 5J12C 3L3DB 5IB5A 3JV5A 2W92A 4U1GB 3ZKMD 3BP7B 3CFJA 1QQDA 5EFIB 2OK0L 1BVLB 1RK0A 5TE6L 1S8DB 4FMKA 4MQSB 1MCCA 2FD6H 2W9DL 5JXAH 2Q1EA 4ZFGH 3HRZA 5E1AB 2VR5A 1PEWA 3PQYB 2BJMH 2BFVL 3E2HB 1KN4L 3U1SH 2BJML 3OKOA 4HG4J 1IBGL 2EDWA 1Q9OB 2YD5A 4BK4A 1RZGA 1DBAH 4UU9A 4OZIE 2NY3B 5D2LF 3PJSB 4OD2B 3FT4A 4ZAKA 5GZOD 5T3ZE 5CWSB 2IAND 2C7UA 4NQVB 4BSJA 3HAEB 4W6WB 2F54A 2PW2A 3TO4C 3DTXB 3D18A 3QIBD 3H9SB 4LASL 4UV4H 1FE8H 2LVCA 3JTSA 4POZD 1FE8L 4K8RL 2UYLA 3NFSH 3WFEH 4ODHH 1UB6A 5EZOH 3TVMB 3U7YH 4PJIB 3NFSL 3MACL 1KJ3H 3IKCB 4G42B 4RAUA 4XNZC 4YPJA 5ESVB 2A6DB 5D7IB 1P5VA 2X9YA 5DD5H 1XGPB 3KPQB 4JPIA 4WW1A 5JPMA 2X4SA 1Q0XL 1PSKL 1LE9B 4MD5A 4NO3A 4TSBL 3K2MC 1Q9LA 5LG1A 1NCCL 4NO5A 4RRPA 2BOBB 3P4OB 5I18L 1AH1A 1MF2H 1CICB 5F7MC 2VLJA 3K1KC 3O6KL 4IS6B 3TWCH 5IVNA 4Z78B 3VXUB 4RBPK 5CIPH 3C08L 1A9BA 5CUSH 3SPVA 4ZUWA 3MGOB 4OGAC 5HHOE 2H8PB 5CUSL 5DRWB 2EE3A 4UNTA 1FV1A 5LQBH 2DD8H 5JW5B 3DI3B 4L4TE 3FQUA 4I2XB 2EDBA 2DD8L 3TN0D 1EEYA 1KLUA 3R8QA 1A4JB 1GC1H 2QSTA 3BXNA 5E2UH 1A6UL 3R06B 4JFQA 1JRHH 3C5ZB 1G6VK 3IRZA 4DUWA 1JRHL 4PJCB 1QO3A 1BBJB 3VFNA 1J0KA 1FFQA 5IG7A 4RGNC 1MELA 5L2KE 5D9SB 5DHVB 5LGHH 2EDNA 3DV6A 2A0LC 2K7QA 1DVFA 2L0DA 1KJ2B 1J05B 3A6CH 5DD6B 1RY7B 4HIHA 3BN9D 5GJTL 2HT4D 3OKNA 3ABZA 1EHNA 4JEGB 1TITA 5D1ZA 4GLRI 2W65A 3SBWC 1YYML 3AU1B 2B4CH 2HFGH 5BV7H 4LARL 4HDIB 4X9GA 5BV7L 4Z95L 5HYSA 1HHHB 2CIKB 2Z31A 5DS8B 4MXVF 1TMCB 4JVUA 2Z91B 3RGVD 5CZKA 5JTWA 4U1SB 4X83A 4GXUN 4S10A 3P77A 4WGWB 3SJVB 4Z7OF 2GAZA 1DUYA 3ZDYE 1QD0A 1LO4L 4JQVA 3EOAA 4ZAKD 3OSKA 2RBLA 3U0TB 2DS4A 5I6XC 4LDEB 3QUXB 3GMMA 2F54D 5D2NC 3R8BB 3QNYA 1HI6B 4I5BB 5K9OA 4X6CE 3WFDH 3DUUB 4FQQB 3WFDL 3P2TA 1F6AB 4FQHA 1ZSDB 5EZJB 3B8SA 2H3NB 4GSDH 3WNLA 5FHAH 3V4VH 3Q3GB 4EVNA 4GSDL 4KAQH 1CXIA 3VJ6B 2R0KH 2YD6A 1N6QH 5EOCJ 4F7TA 3QI9C 5AG9A 2H6PA 4NYLA 3G6AA 3OWEA 4OLXH 5TDOA 3MRDB 2HRPL 1MAJA 2G2RB 4HMCA 3FRUB 3MRCB 3S37X 3TYGH 3V52H 1SJVA 1NKOA 3STZA 2VLJD 4HFUH 3T0EE 3TYGL 3FO0L 3RX7A 1E4JA 3OZ9H 4PP1C 4WFED 4OF7A 1YEFL 4ZOBA 3KNBA 4QHUA 4DEPC 1P4LB 3IDJB 3QDHA 3ILQD 2CDEA 1RJZB 1TCRB 4NCDA 4OLEA 4XH2B 1D5MB 4HGWB 3L1OL 2DN7A 1UZ8A 2IGFH 4ZSOB 5EUKA 3BW9A 1TENA 3HC0B 4JM2C 3NZ8B 3VGHA 4FQ1L 4PG2C 1UWXH 1CDIA 3EFFB 3WHE0 4RNRA 5GRJH 1NEZG 1DVFD 1OAKH 4UTBH 4GJTB 4TSCL 3UTSE 1WFUA 1OAKL 4UTBL 5IF0B 3TNMA 1U6AL 3OR7A 1KB5H 4OLWL 5MENA 3P4NA 5D1ZD 2G75B 4JDTH 2PYEA 4KY1H 1F6FB 4E0RB 1TJHH 5IIEA 1FFOB 1BOYA 3UCRA 4K7PY 1I8MA 1INQB 4WI7A 4D9RE 1YNKL 4OGXH 1GGYA 1YDPA 4S1RH 4Z7UB 5EBLB 4N5UA 2L4OA 2ARJA 4LLWB 4S1RL 2Z31D 4C56B 3MZTA 4FZ8H 4D0DB 3DIFB 4RMQA 2FH8A 3BT2L 3K4AA 3JVGA 1YY8A 3WO4B 3EDEA 1I9JH 3FFCA 5HYJE 1XGQB 3TBYB 3T2NH 4RISH 4KV5E 1I9JL 2X4RB 2P49B 3ELAT 4PGZA 3T0BA 3S3SA 4FS0A 3T2NL 4RISL 3EYVA 2LTQC 3BDBA 1CFSB 1EJOH 4OCNC 3SKOB 1AY1H 4QXTA 5I1JH 5CP3A 1DJSA 1JF5A 1K4CB 1AD9A 5E4EC 1AY1L 4IRJA 2GSIB 4XPBH 1Q1JH 2EDQA 5IBUG 4XPBL 1F4WH 4S1QL 3GSNB 5I8EB 4ODVH 5KS9A 1TQBB 1XT5A 2X10A 2ATKB 1RIUH 1L0XA 2ZZUT 2FJGB 4A2LA 3TT1H 1FSKC 1KTRL 5FCUL 1S7UB 3JZ7A 1P9MC 1EUTA 4OZGE 2RCSH 4WY7L 1JHTB 2ED7A 4OJFL 4I18A 4Y8AA 1MAKA 4EI5B 3MV7B 3QFDA 5FO8A 4YX2H 4NQXA 3ES6A 3A6OA 3ULSA 4NP4L 3C5SB 4YX2L 5HI4C 2RJMA 3RUGE 2X4UA 1RJLB 5EG6C 1R5IA 2R56H 3U9UA 4QOKE 3VFMA 4KMQA 2VUOA 4NQDB 4JZJC 5D5MA 1YY9D 4X6EA 4JGUA 4HJ0C 1MCFA 4MD4B 4U1JB 2VLLA 3MRFA 4UIMB 1BWMA 3EDFA 5IFHH 4K23H 4NO2A 3LEYL 2FL5A 1LO0H 1T22B 2O5YH 3QYCA 3QQ3A 4X5LA 5LWYL 5J1SC 2O5YL 3RVWC 3UMTA 4OSUH 3WLWC 4CL7A 5DD1H 1IC7H 4MQXC 1ADQA 3W9DA 5ISZB 2ZCHL 2IWGA 1IC7L 2ZG3A 3GSWB 4MVBA 5EN2B 1T1YB 4KRNA 4Q6IA 3SHSA 2ZUXA 3OR6B 2BSTA 4JG1H 4M8VA 2JELH 2XQYG 1A22B 3TH4T 2BRRL 2FLBT 4JG1L 1NBYB 5MEND 1VPOH 1WGOA 3O6FC 1E0OB 3CZJA 3CVHH 2PYED 4CKVX 1VPOL 3JV0A 3EJZC 5ESQA 3CVHL 4AJ0A 2QHRL 4PP2A 5F8QC 2DBJA 2ARJQ 4K8RC 5JW4Q 1S78C 2B0SL 5GRXG 3VXPB 1OAQL 2VDQL 5E9DA 3RKPA 1J86A 5DJYA 5C0AB 1UYWH 4P3DB 2B8OT 1IAII 4I48B 1UYWL 4K71B 5L0QC 2P8MA 4J3TA 3P0YL 3K80A 5E03A 5DQDH 5C0FA 4DKAA 3RQ3A 4NQUA 4MSWA 5CJ8A 3UJTH 1R3HA 4PJBE 2CRMA 4KHXL 2RQ8A 1K3IA 4DQOL 5C6TH 1IAIM 3IDIB 3FHAA 1BIHA 4RRPG 4HK0A 1GH7A 4ELKA 2MQCA 4DWHA 2WIMA 2R2EA 1JTPA 2YC1B 3NPSB 4KRPB 4IRJD 3T0VA 3WXVH 3KPRE 1E4XI 3M07A 4NWTH 3V79C 5FYKH 1KCRH 4F7EB 1XR9B 1KCRL 4M93C 5H37H 4HWEL 2IPTH 4Q74A 1MHEA 4EDXB 3O4LB 2IPTL 4OCWL 2A6IB 1X4YA 4POYA 5C0DA 3V0VA 1EIBA 2DQIH 3OAZK 2GSGA 2VABA 2AK4A 5TF0A 3TEUA 3ZTJG 1OTSD 1MCWW 3UTQB 5DRZB 3MLSL 3TBWA 1PJ9A 4WHYG 4N68A 2LAGB 4PJXB 3SOBH 3EOBA 4FOMA 2Z35B 2VAAB 3SOBL 1A7RL 3OKLA 3KHQA 2Q86A 1KIRB 3U6RB 3S35H 3V5KA 3SKNB 3BRFA 4MLSA 3FTGB 2HVKA 4FNLH 4MD0B 4OLUL 1PY4A 3V7MA 2P5EA 4DFHA 4HUMB 4DKFH 3UPCA 2XZCL 3TIDA 4DKFL 2FB4H 3KPPB 1AP2A 3ARDB 5CSBA 1S9VA 5HYSG 1QR1B 5A2LH 4L8DB 5FYJU 2MSPA 5AD0A 1D7FA 1MQ8A 1G6RL 2IJ0C 3KYKH 4GQ9H 4PJ8D 4CDGC 4PGCB 4WO4A 4Z7VE 3SY0B 3VFPB 5DJ0B 4BKLB 3KYNB 2W0FA 5H35A 4MVBD 4NNXA 3SE9H 4XMPL 5FO9B 2YPKA 1KOAA 2WIIB 1NDMA 4ZNEA 3KPLA 1X3DA 1KJVA 3H7LA 2C3VA 1LNUB 5F1IB 1CL7L 5C6PB 4X6BA 5EIIB 4LHUB 4KPHH 4M7JH 4FQLH 2PXYA 2WQ8A 4RAVB 5E9DD 1IE5A 4FQLL 5GGUB 4YUEL 3GSOB 4YIQA 4HIIB 5KAQG 3SGJC 1TVBB 2WK2A 4MJIA 5DR5H 4LCYA 1KFAH 4NRZA 1QSEB 4S1DD 4IOFC 4XRCA 5DR5L 4LSVH 35C8H 1G9NH 1XIWD 4LSVL 4HX1A 4L9LC 1OARL 1UM6H 3NIFF 2XQYK 1GGUA 2XXCB 4TNWF 2DI8A 4CADB 4M1DL 4PV9A 4R9HA 3MFFA 4RMWA 4QT5A 4PJGA 4D0CA 1A1OA 1N5YL 4POUB 2Z93B 2FCBA 1DLHB 4HKZA 3LIZL 4LCUA 3LPWA 5A16A 1L7TL 1JP5A 3DOSA 5HPMB 5A2JH 3VRLE 2X1WL 3ZYJA 3VFUB 3CSBA 2BHYA 5ACMA 4RAHA 4DVBA 3DROA 5E94A 2AK4D 2DQUL 3TH3T 1F4XL 2FJFA 4H26B 3UEZA 4H25A 1OTTC 5FGBA 3LQAL 1T6WA 3A6BH 3GIVA 3W11D 2V5MA 1WEJL 2ZPKH 4U3XA 3L3IA 4HUVA 2PO6A 5GRUL 2PTTA 1RZJL 4OIIH 5FGSA 3LV3B 3PIQB 3MNZB 1N3NB 4HK3J 4MQTB 2NPLX 2P5ED 4RWYL 3ZKNC 3WS6C 5IEKA 4M9PA 1CXLA 3CFDB 3OTTA 2FLRT 4TNVF 1XGUA 1YQVH 1FNSH 5D71L 4ZS7L 3BP4A 2C1PA 1CDCA 3BZ4A 5BO1H 3UBXG 4WO4D 4AEHL 1DLFH 1AR1D 1NGXB 3CLFH 4JE4B 3SGDH 4LPCA 2X4TB 3QQ9C 4V3DB 4YDLC 3CLFL 4U2ZA 2IH3A 1U8JB 2Y23A 4R2GD 1AC6A 3MYZA 4PJ7A 4XBGA 5AUMB 1CXFA 4CN6A 2PF6A 4LCWE 3C60B 2Q76B 2BVPB 1JWSB 3L3JB 5IWLA 3F12B 3ZHKA 3LDBC 4GO6B 3P9WB 2EDEA 3GKWH 2PXYD 3IU3A 2BOCB 1EFXA 3MV8E 5F72S 5HHQB 1LDSA 5KG9B 3R4DA 1WQVT 5GXBB 4MJID 4KUZH 4JY4B 2RR3A 3PDOA 2VDRL 5CJXC 5F6HJ 1OM3H 3BGMB 1ZHLB 4TUOB 3D3VA 4BUGA 4L8CB 3BPLB 2NMSA 5SX5H 1WZLA 4KROD 2JK5A 4PJAE 4JFEA 3FJTA 3RJQB 4BFIA 4AYFA 3T1FB 4QRUB 4FRWA 4QRPA 1AGDA 3QUYC 5I2IB 1AD0B 1W0VA 2BVQA 5DA4A 1T0NA 4Q9BA 2VO5A 3MRNA 5SWQA 4EDWL 1YEGL 5K59E 3WLBA 1ACYL 3CFCL 5T1LA 3DI2B 4Y5YB 3KJ4C 2VLJE 1AGEA 4L3CB 4LEXH 2GT9A 4ELMB 4NUGL 4WFEE 1FVEB 2X09A 3JV6A 4KJYB 4HWNA 2DTSA 5TQ2H 1QLRA 5E00B 4HUXA 2UY6A 4RQQA 3B2UC 1GIGL 4PRBA 1ETZA 4QTIH 3QDGA 4HBQA 1NEUA 2R1WA 2DWDA 4BELD 5KSUA 2PO6D 3O6LL 3AS1A 4G59A 4M7ZB 4L5FH 4WJ5B 1N26A 1EEZB 2JJSA 1K6QL 3IFOA 4K9EL 1P1ZB 5BW7C 3BDXA 4P9HL 2EZ0D 1S5IH 1JGEB 2FRGP 4IJ3C 2VXUL 5SWZB 5L7XL 2YA2A 3QIWB 3ZKMC 4MCYB 5I66B 4P2QB 1QHPA 2VL5A 4XCEB 2JE8A 4H8WL 3IDGB 4JJ5A 1EA9C 3VH8A 1A6WL 4XWGL 5HTSA 2OTWA 2XNAA 5IB3B 4MZ2A 5EU6A 5H2BB 3O81A 1CYGA 1FG9C 4N0FB 4JFXA 5ACLA 1B0GB 3NH7H 3WL9B 2NCMA 1J0HA 3BMWA 5IVXB 4I77H 1HZHH 3K0WA 2YUXA 4I77L 5CEZH 4G6KH 1U8OA 3TYFB 5GS2D 4ZUUA 3GSQA 5GZOC 1OSZB 1W0WB 3IFLH 3L9RB 4MCZB 3MYJB 3CSPA 3O3BA 1BFOB 1EFXD 4IHOB 3AY4C 4K7PH 4TUJA 2AJXL 3QIBC 1GAFH 3ARBA 4LCCC 1A7QH 5F6HI 1G7LA 1A7QL 1I8IB 3TLRA 4BZ1L 5AZEL 4JPKL 4JQXC 4KU1A 4JFED 2P7TA 3FONB 1A7PH 1AHWA 4PJDE 3BPCA 3TT3H 1CTNA 4QRPD 1QA9A 4GRLB 4PLJD 1W72H 3L3GA 4U1HB 5I16B 5T3XH 4ZXBA 4XNQA 3MJ9H 1CZ8H 3OJDB 4ISVB 4BUHA 2X7LA 1Y6NR 1YJDH 1HH6A 2Q8BL 5JOEA 1BEYL 5TGBB 4HPYL 5CKGA 5T1LD 4AENB 2R0WL 5IHLB 4GW1A 4QCIB 3HG1B 1S7TB 2EXYD 5IHUL 1TZGH 5IMKB 1AXSB 1TZGL 1I3GH 4L4VA 2I5YL 2XICA 4XAWL 1I3GL 2QADB 4OZHF 3TN0C 5FUCE 3QPXH 3KJ6L 3IS0X 5JHDD 1UVQB 3QFJE 3QDGD 2E9IA 3HA0A 2P4AB 4F7MB 4YDIL 2GKIA 3UTOA 3WEXB 2FHBA 3CFIC 1WWAX 1HXYA 1XCQB 2OMBA 1YEJH 2FEEI 1NAMH 4XP4L 2IQ9H 3F58L 3BN9C 1DANU 4JKWA 1NGQL 3DJ9A 2HT4C 2WLZA 5GISH 15C8L 3FQTA 5GISL 5MENE 5IB4B 3BJ91 3BKYH 3IDMA 2PYEE 4DN4L 5EU6D 1I1RA 4RMRA 3SDDB 3LKNB 2NXYD 4YDVA 3MREB 4JVWA 3HTLX 1BLNA 3RGVC 1CF8H 4YBLC 1G9MH 3N1QC 3DBXB 1CF8L 1G9ML 2NY7L 5IM7A 2VZ1A 4KDWA 3RVXD 2I60H 3FFCE 4ZAKC 1A6ZB 1EHLL 1DEEB 3KPSA 1A6VH 5I19L 2D7OA 3L3DA 2VQ1B 5AG8A 3BEVB 2R39A 5CJ5A 3ARBD 2F53D 2WWKT 3SGEH 1BVLA 2ADGB 3QRFM 4JFHE 1R6VA 4M5YL 4YE4H 1MRDH 3BIBX 2CD0A 1SYVB 5KS9E 4HZAA 3KYMA 1HQRB 2D9QB 4PBXA 3VRIB 2APFA 3MNVB 3PQYA 3E2HA 4OCSL 4WHCA 1Q9OA 4ZXBD 3BGAA 2CLRB 4C55A 1RZJC 1RFDL 4MNQD 2XRAL 3PJSA 4OD2A 2BVTA 1EZVX 4G5ZL 5CWSA 1EJ6A 4U2YA 4NQVA 1WAAA 4LKXB 3HAEA 2UY7A 1VDGA 3VGAC 2WUCH 2BC4B 4RGMC 4L4VD 5JIKA 4HEME 2N4IA 3GGWB 1FYTB 5D5ME 3H9SA 5IK3A 4L3EB 2CKBB 1I9EA 2X9WA 4NGHL 2YSSB 2ZWLT 2LQRA 3DUSA 3NFPB 3S8WA 4Y5XB 4X9HA 2YRPA 4P2YA 4J3UA 4G42A 3RL1B 1S9XB 4TTDD 3BRDA 3ARFA 4F33B 12E8H 3QUKB 3EYSH 2H26B 4QY8B 2CDGA 4JFFB 5EU5B 4YXKL 3EYSL 1CE6B 5J4MA 1GOFA 1DVFC 4NBXB 4XPFH 3PF2A 2BOBA 1H5BB 2GCYB 1KCSH 3OHXA 4GRWE 4IS6A 1HDMA 4KJQD 1UWGH 3VXUA 3W0WB 4S2SB 3FO2B 1KV3A 5D1ZC 5FUZH 1UWGL 1VGEH 2YS4A 5FUZL 1VGEL 3BKCH 3PUCA 3V6ZA 2GFBA 5MP6L 2AI0L 1Q9WA 5ECJE 4NN5B 3OAYK 5JORA 1A4JA 5E9DE 3FB7B 1FNEB 4K3DH 4CU7A 3R06A 3C5ZA 4G8EA 2EDDA 4PJCA 4JQVC 3WUZA 3O2DA 5LBSH 5FYKU 3KPSD 5D9SA 1C08B 2JCCB 5DHVA 5J11C 2ZSVB 4XHJD 3EZ8A 4LSSL 1JFMA 3MOBL 4OLZH 2FDBP 1J05A 5FDWB 4S11A 1WICA 1PZ5B 2ORBL 4YJZL 4TUKL 5ICZB 4JHAL 2NY1D 3K8KA 4NNPH 4QRSB 5I30L 1YMME 5DK2A 5EH1A 1Y6MR 4HDIA 4HGKC 1JF1B 4C4KT 2CIKA 4HS6B 2J8UB 3F7YB 4X0KB 1MWAH 4OGZA 5CJOH 4EIZC 1TMCA 2GHWB 3O3AB 3LS5H 3DO7B 3O11A 2GJZB 3UJIL 2HKFL 2AK4E 3DWTA 1DBJH 1FO0L 4Y2OA 3DECA 3LS5L 4U6YB 4IRZL 1NCBH 5FO7B 2FECI 1V7ML 1VADB 5T3ZH 1KCUL 4K9EC 5I0ZA 4P9HC 2AQ1A 2DQFB 3U0TA 3SN6N 3QUXA 1JUFB 3BKML 3EAKA 3JTTB 3NGBC 3QJHB 3CDFA 4G6FD 4I5BA 5C0JA 1YY9C 32C2A 4FXKB 4H8WC 5IGXH 4FQQA 2RIKA 3OGOE 3H2WA 3H9SD 3VH8G 5J12B 2CMRH 1FVDA 3V4UL 4BH7B 4EQ2A 1ZT7B 2V7HB 2DI7A 1NLBH 1SYSB 4NQEE 2H3NA 4G7YH 1NLBL 3DYPA 3RAJH 3SKUD 3WHXA 2V6HA 4G7YL 3DX6B 1MCEA 5J9PB 1MPAH 2X4QB 4QHKJ 4UDTB 2DQCH 3ARFD 1BVKB 3X13A 1KEMH 3QG6B 2HJLA 3MRDA 4LPXA 2E8YA 4PJEF 2V5RA 4ODXA 3UYPA 2G2RA 5C07A 1BIIB 1T04B 6FABH 3WIFB 2EC9U 3MLYH 1LEKB 2E9JA 4LQFH 3RX5A 5IEHB 4UOW0 5I73C 2FX8L 5CBAB 2QSCL 1P4LA 3RIFK 1BWWA 4N9OB 5DZNA 3MLTA 1RJZA 1TCRA 2OM5A 2VTFA 3FB6B 1HEZB 4XH2A 5K9QG 4O2CB 4LSTL 1E4KC 3LKQA 1UM5H 2BNQA 4CU8A 1D5MA 3L7FB 4HGWA 3HS0B 1RZKL 3TO4B 5I1IH 1S7QA 3QXTA 3UDWC 3VD7A 1S5HB 3C2AH 4LNVA 5I17B 2XXMB 3OJ2C 3S36X 5GS0D 3C5ZD 3HC0A 4MJIE 3NZ8A 3D0LB 3O0RH 1AC0A 3L5XL 3O0RL 3O2VH 3T2OA 1A1NB 4OCRH 3O2VL 3LKPB 1NMAH 1CFTB 4GKZA 1NCDL 4OCRL 4ZTPL 1AGBB 1NMAL 2HN7B 3E3QA 4PJGE 2V7NB 4OBRA 1JWUB 2G75A 1ZGLB 2FZ3A 3PNWB 1FFOA 5A40E 43C9B 1INQA 1YNLL 4Z7UA 5BS0A 4HCRA 4X6DF 5J6GA 3KXFD 5KVDL 1GGCL 1FQ9C 4XWOD 1OTSC 1JN6A 4KTEH 3RWFB 1RHHB 1NKRA 1OP5H 4CRPA 5E8DH 5IVZB 4WENB 5JPNB 1XGQA 3TBYA 1QSVA 5E8DL 4NKMB 1MAMH 2LVEA 1CFSA 3OGCB 5ICXB 3SKOA 1HILB 4LKCB 1ORQA 4WNQB 4YHLH 1K4CA 5DJ8A 4ESKA 4RGNB 5JNYA 5FYLD 1JPSH 2GSIA 4ZO6A 1Q0YH 3ZYZA 5LCVL 3ULVF 3GSNA 1Q0YL 5I8EA 2XA8L 3CX5K 2ATKA 4GAFB 4I3GA 5I8CB 1YN6B 4RBPH 3ECBB 4QHKI 4CN4A 1M6OA 2F58L 5F7WC 4X7SL 3O41B 3LRSA 3X14B 2CGRL 3RNQA 1CU4H 3MOQA 4PJ8C 4Z5RB 4C83B 1CU4L 1OSPH 3F6IA 4EI5A 5F7KC 3MV7A 1DN0A 4G8FA 2AAVA 5C07D 5E6IA 3P30H 2XWTA 1CT8A 1KPRA 3C5SA 3LN9A 3FB5A 5DJ2B 1KTLB 1QFWL 4NJ9L 4H1LA 3OKEA 4U3HA 4ZYKB 5BJTB 5SWSA 4N5EA 5SX4H 3MROB 4NQDA 4QKXB 1HH9B 2R2BB 3DXAB 4D2NA 5I6XB 1MNUH 4U1JA 1MNUL 5D2NB 4S0SD 2BNQD 1A3LL 2J3SA 5JIPA 5EBMA 3WXWH 1GOHA 3WFBH 5C92A 4S1DC 1T22A 2XI9A 3IJHA 5TF1L 1OB1B 1OPGH 1XIWC 4OM1H 4J8RB 4FQPA 4LLAA 3K81A 4OM1L 1N5AB 2R2CA 3D3VE 1D9KD 1K2DB 2J6EL 5KANI 1T21A 4O58L 3GI9L 3GSWA 4NHUB 3QI9B 5EN2A 1T1YA 4JFEE 4Y0GA 3VD9A 3OR6A 3CH8A 1NC2A 3QBTB 1IC5L 1BJ1J 1RPQA 3HAEG 4EBQH 1MIMH 1ND0A 4EBQL 2F74B 3OKYA 3MV11 1IAKA 2DIJA 3QQ4B 5IW1B 1AE6H 2OI9A 4CBPA 5BS0D 4LSPH 3X12B 3QXUA 3VXPA 4PJHF 4LSPL 5C0AA 4DEPB 4P3DA 1JF6A 4X9FA 2FO1A 4I48A 4OLVL 4OLYH 1GGIH 3T3PF 4E5XB 4I3RL 1INEH 3TJEH 4YNYB 1YMHB 4GG6B 3DLQR 4OQTH 1KENH 3GDBA 5IMLA 1HHGB 3QNXA 3W11C 1IGCH 1T4KA 3IDIA 4JM2B 4AMKL 4YQXL 1IGCL 2AV1B 2DB8A 3TZVC 3TIEB 4R4BB 5JW4R 4NC2B 1BBDH 1KPVB 4ZPVA 3C8DA 4D9QD 1L4IA 1WCBA 4F7EA 3GIZL 2HFFB 4RA3A 2BXZA 4OKDA 4U6HB 5JOPD 3LEVL 5DRXA 2YZ8A 1A9EB 4EDXA 1XF1A 2P42B 3DX7A 1A4KB 4M03A 3UJJH 2VZUA 4XMKL 3T2PA 1NC4B 1FG2A 4Q9RL 4JO3H 4WO4C 1AR1C 5JIIA 4EI5D 4JO3L 3MV7D 2DL9A 2UVEA 4LIQE 5EU6E 1F02I 5E6ID 4R2GC 1G7IB 1L9NA 1CCZA 1V8HA 1I8KB 1FVCB 3VXOB 1JGUH 5SWSD 2YPLB 5KVFH 4LLQB 4LLUA 3MJGX 4I9WE 5KVFL 3SKNA 3RJDA 4WW2F 2NX5B 5C0IA 3UO1H 1WZKA 2LTQB 3PWJB 3BE1H 4MNGB 3FTGA 4QHMB 2PXYC 4QRRB 2ZUQC 1GPOH 3GZKA 4A6YB 2F19L 3JV4A 4ODBD 2M8XA 3STLB 4EIGB 4AEIL 3DRQB 4XCNA 1G9EA 4F80A 4YR6B 4YEEA 2E3VA 1N7MH 3ARDA 4GH7B 3HZMA 1QR1A 3BAEH 2DQJL 4L8DA 2OTPA 4KROC 4JPVL 3CFEB 5T5NF 1FSKB 3B9KA 3VFPA 2OJEB 1UEYA 1JYNA 2WIIA 3S6CA 5AAWA 4XXDA 5I1AB 4OTXH 1NC2D 2NTSP 3H8NA 2VISA 4OTXL 3WE6B 1INDH 1R3LA 3QJFA 1LNUA 5F1IA 1INDL 1DBML 1SY6H 3MMEA 2OL3L 3QUMA 1N64H 1IFHH 1NCAH 3TCXA 5GRVK 4RMVA 3CU1A 3PWUB 3HMXL 4KQ4L 5JHLL 1QSEA 5T5FH 1MLBB 4L4VE 4WWKA 3VXME 1M05A 4GFTB 1QYGH 1NQBA 1X5XA 2A1WL 2HT3D 5FGBC 5T5FL 3NFNB 1NCUA 2P5WB 5GRVL 3D39A 4U1LB 4MA7L 3GSRB 5HY9B 4CADA 4ZFZB 1KTKE 2R0ZH 3L5WB 1E4WH 2RAMA 4YHNA 2Z93A 2EZ0C 4BQCA 1NUGA 2GUOA 4YPGB 3GBLA 1LP9A 3B9DA 5INDA 4CVZB 4R7NB 4R4ND 4HS8H 2HWZH 4XZUB 4HG4K 1XZ0B 1RZKC 3VFUA 4R4FH 4JR9L 5JR1H 3VXTA 2VWEE 4R4FL 3HE6A 3QEUB 4KMLB 5KN5A 3KLHC 4M5ZH 1ZE3C 4M5ZL 3NIGF 5E8NA 5L0QB 3MNWA 4MYWB 3ULUE 2C3WA 4DGYH 3I50L 3BSZL 3IDNB 4F57L 1QEWB 3TV3L 3VFVB 4HIXL 3ARYA 3V5HB 3PIQA 1Z3GL 3SKMA 5ICYA 2V2TA 1UQSB 5DLMH 4KRMB 3KPSE 5EA0L 5DLML 3IJSB 3O3DB 2XTJD 3PGDA 3ARDD 1TTGA 1U8QB 2BSED 3CX2A 4M93B 3RHWF 1WTLA 2FJHA 5FIEA 4MNHB 1I3RA 3B9KD 1A7NH 1NGXA 2JJUA 1IGMH 5GS0L 4PLJC 4FXGB 3PQYE 2GTZA 5AUMA 4JY6B 3GRWH 3C60A 1VFUA 3IETB 4JHWH 3OXSB 2Q76A 1RIHL 2AEPL 1FC1A 3QH3B 1CDUA 1A8JH 4M1CD 3F12A 2VIRB 1A5FH 1Z9SA 4LSDA 2H2PD 2EXYC 2BOCA 1QSFB 3ZDZF 1J5OH 1H15B 1ONQA 5HHQA 1WAAE 2X89A 1MY7A 1RHFA 1DQJA 2EKSB 1QSED 4FP8H 3RWIB 4WWKD 3RWCA 3HRPA 2L7UA 3H9SE 1FDLH 2Y6SD 1B6DA 1ZHLA 4L8CA 3QWRA 4IOIB 1FDLL 3D39D 4N1HB 1HINH 2PNDA 4PJIE 2ZOKA 3T1FA 2FGWL 4XBEH 3OAZH 4ONFL 2VXTL 1U3ZA 2JJSC 4N90D 3PHSA 4EEEA 5I2IA 3GJFH 5D7IE 1AD0A 1MFDL 4H1LG 4XP1H 4LGRB 3ROLA 1JHLH 1BAFH 4OCYL 2IBGA 1RU9L 4OCXL 3BEWB 2W1NA 5J1AB 5BMFL 4Y5YA 4L3CA 4JFYB 3IFNH 3P0VL 3VXUE 1T5XB 5F7EL 3N85H 1OWWA 4QO1A 1FVEA 3HE6D 2B7DT 2H1PH 1WT5A 3GO1L 2NXYC 3RRQA 5E00A 5I8KH 4LSQH 4I2XE 2BMKB 5I8KL 4XPHL 3WJJA 1WBXB 5E5MA 1H8SA 4UINL 1JRHI 3REWB 4L9LB 5HBBA 4H88L 2EO1A 4WJ5A 3RVXC 5CHNB 2DQTH 4PJCE 2ZP0T 3TBVB 3MJ7B 1P1ZA 3CMOH 4RDQF 4XX1G 2GJ6B 1SMOA 4JKLA 1LO3H 3QIWA 4NO0B 3SDCA 5FHBH 3UZQA 5I0DA 2WWMC 5I66A 3ARBC 2IQAA 4KMTH 4P4KC 4I8DA 4XCEA 2XT1B 4KMTL 1KEGL 1C16B 3BQUC 1RZFH 4FTVA 5C0CB 5I1KH 2HMID 3IT8D 3U2SA 4YXHL 3LD8C 5H2BA 2CKNA 3WD5L 4HQQH 4M6NL 3MLPA 4G3YL 2CIIA 1B0GA 3ORJA 4HQQL 5DGRA 3U48A 3MRJB 1A64A 4ZXBC 5IVXA 1MJ7L 3B43A 3C60D 2C3GA 4XBPB 2CJUH 2R1XB 2AJZB 1EHXA 2FATL 1KIQB 1OSZA 1VACA 1W0WA 3L9RA 2CJUL 4MCZA 1JIBA 4UIKH 1UA6L 3QEGH 4WFGD 1T2JA 4IHOA 4UIKL 3NAAL 5DTFB 4XPAL 5JO5B 4BFEA 4KKAD 2X89D 4WI4A 3RBGA 1S7WB 2EYRB 1MHPL 3AVEA 3QRGL 1DQLL 3NCMA 4OD3H 5FYLE 2A77L 1CD0A 4OD3L 5CINH 3QWRD 1I8IA 5HGAB 4XC3H 2IALA 3P73A 1PG7W 1FRGH 2KPNA 4XC3L 3MBXH 5DJXB 3VI4F 2DBLL 1FRGL 4LSUL 3FONA 4TTDC 4WU5B 2XQBH 3ZL4H 4GRLA 1MHHA 2BVYA 5DJAA 3U36B 5EU4B 3Q5OA 1CGUA 3ZTNL 3PGCB 3EGSB 4JGMA 1FL6A 3OJDA 3JWOL 4YDLB 3HZYB 4P5MA 4UOJA 5HHNB 3V6OA 1PY9A 4KI5D 4Y19A 5TGBA 4FXLA 2AP2A 4KJQC 4NKDB 4AENA 5D4QA 2J8OA 5F7DA 3D1MC 4DW2L 4XNYL 4YLQT 2ZKHH 5IMKA 1LEIB 3LDBB 3MA9L 3MQIA 1AGFA 1MFCL 1H3PH 1L8JA 1TETL 3I85A 3HI5H 4ZUSB 1W8NA 3BISA 3SQOH 3HI5L 2VDKL 5D93C 1UVQA 5F96H 3DVFA 5DFWH 2NTFB 1DSFL 5F96L 4K7FB 3ZTJH 3NZHL 1Q94B 2D31A 4PJBB 5FK9B 4WHYH 4GS7B 1GXEA 3LN5B 3MPCA 4WI3A 4WTXA 1PW3A 2APTA 4CJ0A 1OAXH 2XKSA 3BP5B 2XWBA 2VDNL 5C9JB 2A6KB 2K3TA 4XHJC 1RVFL 3PGFH 3S37L 1JZ2A 1K4DB 3QUYB 5MEQB 3S35X 3QIWD 3SDCD 1TVDA 3B2VH 4XAKE 5A2IH 2F8XC 2VLKA 3MLWH 4JO2L 2NY1C 4YDKL 4OGYL 4ONGH 4PJEA 2NR6D 4XC1L 3T3ME 1I8LA 4M4PA 5L6YL 1B90A 1NBVH 4PGBB 4FTVD 5FA3B 1IQDB 1QUNA 3KJ4B 3OPZL 5GGRY 5D1QB 3SDDA 3LKNA 4LSRL 5HVWA 1NH6A 3MREA 1KTDB 2VNCA 4Z7UE 5BS0E 2A9NH 1IL1B 4ODWB 2XZAL 3HZVB 4TQEL 4UUJA 5IHBA 3DBXA 1I9IL 3ARQA 1JI2A 3ZE2F 1S7SB 3ARGA 3WS3A 1K5NB 3CSYA 1A6ZA 2QKIA 3INUH 1Z5LB 3VFTA 3DVNB 3X3FH 1WWWX 1Y0LB 2VQ1A 4OBSA 4S1SL 1LEGB 4IJ3B 3HLAA 4KTDL 2ADGA 4D9QE 1WZMA 4P23A 5LXGH 2DICA 3NCJL 5E2VH 4UT6H 5JUEH 5LXGL 4GMTH 4HT1H 5E2VL 5JOPE 3IJYA 3L5JA 3ARFC 3MNVA 2EO9A 5TJWK 2Y7QB 3AMLA 3E6HB 3K7UA 2Q8AH 2VYRE 3A0OA 3ZT5A 3H9HB 4I3SH 3VFGH 4Y19D 5CAYB 3MV7E 3MXWH 1X5LA 2QR0A 3W81A 1NEZB 4MJ4A 4LKXA 3HB3C 4HWBA 3NCEB 2MCPH 3DSFL 2IANB 2FBJH 3L3HA 4M6OL 4LEOB 4KHTH 4NQDE 4RFEB 4F9LC 5ITFA 1FGNH 3GGWA 3F6LA 2QADD 4L3EA 4N8PA 5IQ7H 3B5GA 1KCLA 1J8HA 3H0TB 3QIBB 4Y5XA 2PUQT 3NCYP 4LCCB 3HUJB 5ADOL 5GS0C 1CLYH 3RL1A 3B9VA 3V7AG 3CUPB 5JMOC 2CLVA 4H5SB 1CLOH 4NZTH 2M2DA 4TVPD 1IC1A 3QUKA 4MQ7A 5T33H 3BGFC 5EU5A 3G5XA 4M1GH 1CE6A 2PYFB 1BX2A 5IFAL 3B4NA 1H5BA 4KK8C 1XGTB 1J10A 1C12B 1A0QL 2CK0L 3U4BH 2VLKD 3W0WA 4JKPH 4PLKD 2RB8A 3ZT6A 3FO2A 3QULB 1QTYT 4TPRH 3S96B 4FFVD 2BDNH 4XX1E 1SHMA 4OFYA 4KC3B 4OZ4A 3SDDD 2MQ3A 2B1HL 1PX3A 5EZIL 2MFNA 3MRMB 5KSBF 5C0AE 4PJ5B 4MLIA 2YD1A 2XG4A 1G6RB 3ARGD 3SKJH 3QDMD 1GGBH 1AR2A 1YPZB 5J6HA 5C1MB 2JCCA 3QG7H 1I7ZB 5CP3H 1B9ZA 1Z9MA 3FQRB 5D7SL 5FDWA 2ADFL 2QHLA 1PZ5A 1JYVA 4KKBD 2BCKA 4Z7WF 5GS1A 1CIDA 5I1HL 1DBKH 1FCGA 3SDXF 1RZIA 4QRSA 4LLVA 1DQQB 4W4OA 3QUML 1HCFX 4P23D 2AXGA 1D5IH 1FNAA 1NGYA 2UZXB 1T03H 2A2QT 3O4LE 4X0KA 2VZOA 3O3AA 3DO7A 1T1WB 4DTGH 4U6YA 2B2XH 2VQUA 3RGVB 3SCMA 1N0XH 4EZMA 4YBLB 1VADA 4PJXE 4HFWA 2J2ZA 4Y8DC 2F5AH 3QUZA 3JTTA 3QJHA 3FT4B 3BX7C 4ZAKB 3S4SA 3IS1X 3IAGC 4K2UH 4W68A 3VD4A 4R26L 2F54B 1AO7B 1G0XA 5A43C 2PETA 4L3ED 1U9KA 2AK1H 3VRJA 3GKZA 5E1HB 2P48B 3I3DA 1J8HD 2GY5A 3HI6H 1HXMA 4X8XA 3JTSB 2BNUB 2Z8WC 5KW9L 4NZUH 2F9BT 3DX6A 2X4QA 2VSCA 5I1EH 4UDTA 3CLEL 1LO2L 3Q1SH 4RAUB 5B38A 1D9KC 5F9DC 4QRQA 3QCUH 2AJUH 5IBLD 3JXAA 1BIIA 1T04A 2OXGA 4LHQB 3E3QC 4HBCL 1MJUH 2NY2D 3S5LB 3UTZA 4NO5B 3QHTC 4HD9A 3TC9A 3W0WD 4Z9KB 1TCMA 1ZLUH 4Y88A 1CL7I 2W91A 5CBAA 4OFYD 3SPVB 1AJ7L 4MAUL 5GZNC 1DR9A 1HEZA 3VGAB 3LKSB 1G7MA 4RGMB 2VXQH 3QT2A 4WW2A 3AREB 1S5HA 4N9GB 1OCWH 5I17A 1VB9A 2XZQH 1KLUB 2D7TH 2HKHL 5C0RH 4D94A 1QSEE 4W6YB 4NWUL 4D9LL 3DMMD 5EOQL 4JFQB 2ZUSA 3JWOC 4HXAH 1A1NA 1QO3B 4ELMF 4XCFL 4HXAL 1CFTA 1AGBA 4KRLB 2DQHL 2HN7A 2IADB 3ZE0E 1AKJA 2OR7A 1DVFB 1GZPA 3ZO0A 1ZLSL 2V7NA 1OT1A 1JWUA 4PBWD 3MX0A 2YHGA 4K7PX 4F37F 1ZGLA 3OKNB 3ME0A 3VFRA 1LP9E 1UKTA 4UNUA 4AM0B 3H6JA 4X7FC 1G84A 5AAMA 1IGYA 1FPTL 4X98B 4DOHB 3MUGA 1EV2E 4PYGA 2DAVA 5DUMH 5E8PB 3VXRA 1RHHA 4KVNH 4MA8L 2HLFD 5IVZA 3SCMD 5E6IC 5JPNA 5GSRA 1MQKH 4XTRD 4DJMA 4NKMA 5KTEH 1NSNH 3MXVH 4R7DB 1DUYB 3QUZD 4PJFF 2P24A 5ICXA 1HILA 3HE7A 4LKCA 5ADPL 1RK1A 4UT9H 5J11B 4PGDB 5DD0L 5K9OB 3VA2C 3BIAX 3KPOB 4M43L 1VFMA 3AMKA 4HJJH 1YN6A 4GBXA 3LVEA 5IP4A 5MEOA 3SBWA 3JWDL 2ZUVA 3O41A 3X14A 1NAKL 5E6YA 3QHFH 4MX7A 4Z5RA 3ZMRA 2ENSA 3WFZA 1FLRH 3WN5A 1YEHH 2H6PB 4JDZB 1N4XL 3G6AB 1OAZH 1FLRL 3SGDI 1YEHL 2NLJB 3U0WL 1WCQA 3V7AE 4X4MA 1WIPA 1PGRB 1M7XA 2BHZA 5F71A 4ZYKA 5BJTA 2GI7A 3PP4L 5TQ0H 1Y18B 1HHJB 2R2BA 5E2JA 2OI9C 3NGBB 3S3JA 3DHMA 3GMPA 4QHUB 1ES0B 4NN7C 2OR9H 1CXKA 5ILTL 1JPTL 4WFGE 4NUJB 4QGYA 4FZEH 5DUPH 4WEBH 3QCTH 1JI1A 4FZEL 1OB1A 1RURL 2F5BH 1T0MB 3QISA 4DAGL 5I1DB 4J8RA 4LQ1A 2F5BL 5HGDA 3BW9B 3HPJA 4JVPA 3NA9H 1LILA 4NHUA 3NA9L 1NUNB 1MJJA 4OT1H 4XMLH 4XCYB 2PR4H 2K9UA 4MJ5B 1QBLH 4OT1L 4XMLL 4RNRB 2C1OA 1AKJD 4UB0L 2FEEL 4MDIB 3MRRB 4BZ2L 1KB9J 3TNMB 2R4SH 2F74A 4HUWA 3F65A 4LBEB 5IW1A 4KI5E 1FZKA 2VAJA 3OAUH 3PHQA 4JGJA 5I73B 3RY5A 4U7KA 4NKOA 4U3CA 1L6XA 1YDPB 3VXRD 4ZODA 4E5XA 2ARJB 4GQPH 3RKDD 1BZ7A 1YMHA 4GG6A 1JGVH 2UWEF 4KI1A 2JF1A 4X8JB 1HHGA 2V17L 1YY8B 5DQ9A 5T1DH 1FH5H 2DMCA 4JM2A 5T1DL 3BDYH 1G0DA 5ALBL 4PG2A 2AV1A 2EIZB 3HE7D 3ROOA 1B2WH 2VC2L 5DD3L 3EYVB 1WFOA 3TIEA 5DHYA 1KXVC 4QXTB 2A0LD 1KPVA 1MH5A 1UACH 4M48L 1F00I 5I74B 3O3UN 3MJ8B 1FP5A 1UXSA 3WMSA 2E6PA 1ERNA 2XTJC 4U6HA 2X40A 2YD9A 1JTOA 5CZVL 4GBXD 1R0AH 1A9EA 4E41A 2LU7A 3PP3K 2BP3A 2DJ4A 5KS9B 1FIGL 1A4KA 5L2JA 4ZFFB 1KELH 4HUUB 1OAUH 2ZNWA 5JQ6H 1NC4A 4P9ML 4KKNA 5K93A 1KELL 2H9GB 2Y06L 1YEDB 3B9KC 3CDCA 4F58H 4YHOL 2P44B 3IDXH 4FTVE 3LMJL 1F3DJ 5F8RC 4UI2A 4F58L 1FFRA 4NQCA 5KJRH 1WIOA 4G9DB 4TVPL 3W5MA 4NQXB 3ES6B 2YPLA 3UZVB 3UC0H 5IVXE 3A67L 4M1CC 3PL6C 2OJZH 5TH2B 2NX5A 3IU4H 2H2PC 4NM8H 1R5IB 4MNGA 3VFMB 2OJZL 4NJAL 2W59A 4QHMA 4X6EB 5ITBH 4A6YA 4K07A 5GJSL 3STLA 4FFYH 5ITBL 2VLLB 3DRQA 4QXUH 4TOYH 4YR6A 4FFYL 4L8BB 3VMOA 5BOPA 5FKAB 3IVKB 4WWKC 4G80B 4MAYA 4NO2B 3QWOB 2FL5B 2Y6SC 5FV2A 3EO9H 2R2HB 5CJQL 1YC7A 5HJ3A 4BJLA 1X7QA 4PJ8B 1FAIH 2N7AA 4HC1A 3GNML 4GT7A 4GRWB 4D8PB 1JNLH 3VMNA 4UZGA 3D48R 1CGWA 2KZ1B 1CFVL 4P59L 5JQHC 1H3TA 3V6OE 1UB5A 5ESQB 4ZNCD 4PP2B 3VI3F 4EUPB 1C5CH 4YBQC 4AH2B 5EBWA 5B3JF 4Z7NE 3HE6C 3S9DB 4WHDA 1UEMA 1TJIH 5E9DB 5ESAA 1VKXA 1UJTA 2R0LH 5GIRA 2APVA 3NFNA 3OB0H 5B38G 5FM8A 3GHBH 2P5WA 2IG2H 4F9PC 5C0FB 5D96C 1RUKH 4GAYA 4Z8FH 3GHBL 1U8MB 5HY9A 1XIWB 4N8CH 4ZFZA 5FYJD 4N8CL 4PRIA 4Q0XL 2NYYD 4HLZH 3WFHB 2R2EB 2IBBA 4YPGA 2E7MA 5IESL 3UX9B 2EDOA 3F7RA 4BFBD 3LSOA 4R7NA 5M95B 4JQIH 4XZUA 4E41D 1O7SA 2NY0D 3EYOB 1MHEB 1NC4D 3K1DA 3FN3A 4LIQH 3B8YA 1VEMA 2GSGB 4JRXA 2VABB 5CP7B 1HSAA 1U92B 1JZ3A 3ULVH 3R1GL 4NQCD 2EDHA 4U1NA 3TBWB 3ULVL 2FECL 4YEFA 5CZXD 2YPLD 3EOBB 5EU3A 3ZE1F 3IDNA 1Z9LA 1QEWA 4LDLB 1C5BL 2NX5D 2P46B 4UV7H 3I6LD 2AJVH 3TBTA 5IB2B 1UQSA 3TZVB 2NY4B 2J8UF 3UYRH 2OR8A 4KKAC 1RZ7H 2HVKB 4JDVB 5CIPA 3IJSA 3V0AC 3RWHB 1RUMH 5ERWB 2P5EB 3ALPA 4P46A 3TO2A 3U9PL 1C8PA 1RUML 1U8QA 4MAYD 4NPYA 1LK2B 1F3RB 3SGEI 43CAB 2VDOL 4BQ8A 4A2MA 4Z7QE 1MHCB 4N0UA 4KWUA 1R3IH 5KANG 2Q3ZA 1BF8A 4ONHA 1R3IL 2NY5H 1H3XA 4FXGA 2NY5L 2W0FB 2I27N 4JY6A 1F45A 1DBBH 2YPKB 1DL7L 4R2GB 1DBBL 3KPLB 4KI5C 5HI4D 1IKFL 2C3VB 6CGTA 3MOAH 4GXUM 5I1GH 1H15A 1NANH 3HMWH 1XF4B 4U1IA 3HMWL 4P2RA 1IEBB 1S3KH 2ZUQB 3JWDC 3SE4A 4S0UC 5CJBA 3RWIA 3FT2B 1FYTE 3WIHH 5HPOA 4LCYB 3WJJC 4L3EE 4NRZB 4IOIA 4XRCB 2P5WD 5DVLA 5C70A 1J1PH 5E99L 4HX1B 5HGHA 1FO0B 4KROB 4WI9A 1JFQH 4PRID 5DMGD 4WVRA 3AM8A 1JFQL 4G8IA 3RA7L 5E08L 1KNOA 3BKJL 2VITA 4QT5B 3UXFA 4JFFE 5C86A 4D0CB 1FIEA 3BEWA 3QIWC 3REVA 3FQXB 3SDCC 2R1YB 5J1AA 2OZ4L 1KN2L 4JB9L 2DL2A 5A16B 3C9NA 4NNYB 3LZFL 1WJ3A 1ZVSB 1BHGA 2AEWA 2NR6C 2X1QA 1SEQL 5SV4A 3SGKA 3W0WE 2FIRT 5I1CH 1KIPB 1T5XA 1OP3H 3GMNB 3NN8B 5IKCA 4HEPG 3FFDA 4FQ2L 4JRXD 4DVBB 2ERJC 3G5ZA 4CDHA 2BMKA 3ULUH 3CFKA 4PG9A 1FGVL 4H25B 5J0BA 5HHVH 3DYOA 3GIVB 2OQJA 3DVGB 3CDGB 4FQIL 3L3IB 1NUFA 3TBVA 3MJ7A 4YH6A 4HAFA 5IBTH 2WSKA 2PTTB 4Q9QH 4LRIC 2GJ6A 3RI5K 3ZKQD 2I9LB 2JCCE 3LHPH 4J6RL 4NO0A 2JTDA 3KGRA 4P46D 4PJ9C 1WZ1H 1U36A 4P3WA 3NVQA 3ZYIA 1XGUB 5HYQA 3LEXA 5C7XH 5C0CA 2EYSA 3LQMA 5GGSY 3GFUA 2C1PB 1FNHA 2E8ZA 3MLRL 1IGFH 3RX8A 4H20H 4QNPE 2IC2A 3MRJA 4HWUA 2BY0A 3QZWA 4D0BA 1IGFL 2X42A 1GGTA 1Z6JT 4OM0H 4R90L 1OF2B 2AABH 5DJZA 1RAMA 4OM0L 1I7RB 2AABL 4PJ7B 4XBGB 5CEYB 4QHLA 4RMUA 2AJZA 3OBAA 1ZLVK 1FC2D 1KIQA 4KZEH 3VG0H 4LU5H 1E6JL 2Q6WB 1BOGA 1WV7T 1VENA 3HAEH 1J11A 1A6TB 3MLUH 2E27L 5DMIL 1ZT4A 5JO5A 5CBEA 3KLSA 4P2RD 4GLRH 1KB5A 1EFXB 1VHPA 2APWA 4RX4A 2VZSA 5HGBA 1BM3L 3L7EA 5I1LA 3NOIA 5CFHA 4TULL 1IAOB 5EUOF 3PDOB 1UZ6E 1NFDF 4GKNA 2N7BA 5I9QB 5HHPB 4OI9A 1HKFA 4WU5A 3HNVL 4D3CH 1B4JL 2ICCA 1U2CA 4CUCA 3DNKA 3N9GH 1T2QL 1ZANH 4JFEB 1FORH 2X5PA 3N9GL 1NMBH 1ZANL 4QRPB 4IMLB 1D6EB 3EGSA 1FORL 4W6XB 1IGIH 1J9CT 2GITA 3MLXH 1UT9A 3HZYA 5HHNA 2BVQB 3HR5B 1WSST 5CILH 4PLKC 2QQNH 4PTUA 5GGVY 5SWQB 2D2OA 3O45B 4JZOB 4FFVC 2X6MA 2EIBA 5T1LB 1LEIA 3RWGA 1AGEB 3RTQD 3JUZA 5D2LB 2ZCLH 3EO1A 5K9JH 4M6AA 1BJ8A 1RMFH 1QKZH 2NTFA 5C71A 4K7FA 3I9GL 1Q94A 4HUXB 5FK9A 5JHDB 4RQQB 5CJXA 3ARGC 3N1FC 1ORSA 2CXKA 4JG0H 5CSGA 4PRBB 1ETZB 2WLYA 3QDGB 4LK4A 4JO1L 1OL0A 2P8LA 3O2DH 2EH8L 3BP5A 5GGTL 4XP5L 4NZRH 2GTWB 3EYUH 4NOBA 3K2UH 1I1FA 2IPKA 5DHVH 4BFGA 1XF2A 2A6KA 4OZFB 3EYUL 2GJ6D 1KJ2H 4Y5VA 5KVEH 3IFOB 3KWWB 2G5BB 4P0DA 4MXWH 4KKBC 2I26N 1JL8A 4ODSH 4P23C 2AJYH 1JJUA 2VL5B 4HKJB 4OCLC 5FA3A 1IQDA 1CR9L 4ZTOH 2OP4H 4K94H 5D1QA 1QRKA 2OP4L 3EO0A 2OTWB 3W2DH 5C09A 3HC3L 4XPGH 5EU6B 3W2DL 2IH1B 2NXYB 1OLZA 3S36L 2LE9A 4R97C 5F3HB 1S7SA 3GHEH 3OX8B 2CQVA 1K5NA 4LVEA 3GHEL 5MHSD 4X99B 4NFCA 1U8OB 1WBYB 4ZUUB 5F7UA 2YD4A 4OUUA 4YHYC 1T7XA 5BW7A 4Z0BL 3DO3A 4RGNE 1SVZA 3CVHA 5ALCH 4NBYB 4TUJB 4RX4D 1H0DB 1TPXC 4Y5XC 4OZIF 3ARBB 2F53B 4P4KB 5EO1B 5DHXB 3W82A 3WFCL 4M7LL 1JYXA 3QHZH 4BSWB 4XVSH 3BQUB 3VD5A 3QHZL 1YC8A 4XVSL 2Y7QA 2DDQL 3E6HA 3PDGA 3GSVA 4G9FB 5HDBE 3LD8B 2I24N 5IBLC 2A9ML 1QA9B 3B9AA 4LDOB 3H9HA 5L88L 1XF5B 3L3GB 3EIFA 5FYJL 3PWNB 2NY2C 3FB8B 4XNQB 1QFWI 2ZG1A 2YMXL 1CGXA 1HH6B 4X4ME 4MNQB 4QTHB 2AERT 3H3PH 2DTMH 5SX4I 3QEQB 1HIMH 2DTML 3WKMH 4RFEA 3TM6A 2Q3AA 3DXAE 4PJFA 4K3HA 4NN5C 4G6AD 4L4JA 4TRPH 1QHOA 5GHWL 4X4ZA 5D2NE 4UILH 1FL3B 4LHJB 5H94B 3MLVH 1DQDH 1MREL 1PYWB 2FX9L 4I13B 3M8OH 1DQDL 3CUPA 3IKKA 3DGCR 1G0YR 3DMMC 4MHHI 5FA4A 3MODH 5C0BA 4FQXD 3MCKA 2PYFA 3VW3L 5HD8D 5DXWA 3MODL 1KC5H 1HXYB 1XGTA 4EN3C 3VXQA 4NHUE 1NCNA 1WLHA 5GS1C 4IMKA 2YRLA 4DKEH 1YYLH 3HI1B 3U46B 5A2FA 3QULA 4YHIB 4DKEL 1YZZA 1Q72H 3GSUA 5D1QD 3FQTB 4U6VH 5IUSA 4ODTL 3IDMB 1QNZL 5C09D 3CGTA 1MRFH 1WITA 4YDVB 4PJ5A 4Z6AT 1RUAH 3FQWB 4GW5B 1G6RA 2HLFC 2NW3B 1EO8L 1BLNB 3SCMC 3AC0A 4M00A 4GG6E 5CMAB 4XTRC 3QUZC 5HI5D 4M6ML 3J7HA 1EBPA 1JGLH 1I7ZA 4HSQA 2QQKH 1FYHB 3FQRA 4JN2A 1JGLL 3R0MA 2QQKL 2XPGA 3KPSB 4HZLA 1K8DA 2EECA 3MCG1 1GOGA 4UDUA 3GSNH 3AAZA 1DQQA 2OL3B 3AXLB 4HUNB 3ZDYF 3LAFA 3RVVD 2NY1B 4LPTA 2OYPA 3JTCA 4P48A 4BSVA 4KKLC 3RZCA 3G6DH 5DMJB 4E41E 4U6TA 2FD6L 3P40A 1R24A 3KYMB 5FOBA 5JXAL 4X6CF 4ZFGL 1T1WA 5CCKH 5KSVA 3QNZB 1HNGA 3RGVA 3U1SL 5BZWB 2WANA 2UWEA 1DBAL 1E4XH 1ZEAH 2KQMA 3BZFB 5D7LB 1ZEAL 2N56A 5IQ9A 2YPLE 5FYKD 4U7SA 4G6FB 1AO7A 3OG6B 2NX5E 1DQMH 4MNGE 4NRXB 3I6LE 2ITDA 4AY0A 1DQML 4QRRE 3CXDH 3VDAA 4WW2C 5IK3B 1PEZA 2BNUA 3TP4A 3BO8B 1CXHA 4UV4L 3DUSB 3K3QA 3S34H 2PN5A 3WFEL 1KBGH 4ODHL 5EZOL 3U7YL 1D5BA 1YECH 4LLYA 3QZWG 1KJ3L 5C0BD 3EOYG 3WHE1 3ARFB 3OKMA 1BREA 1KPUA 3DSNA 2CDGB 2VN7A 5DD5L 1HOCB 3F5WB 3CK0H 4LLMA 4PR5A 3S5LA 2KBGA 2Z8VC 3QSKB 1W2KT 3CK0L 2H2SD 3KYOB 3OHXB 1MF2L 1HDMB 2YUWA 4OV5A 2CO7B 1MRCH 4P99A 3TWCL 1J0YA 1BFSA 3CH1A 1MRCL 3RIAK 4MS8A 3LKSA 2DM2A 1UWEH 3V6ZB 2GFBB 2X41A 5LQBL 3AREA 4PS4H 4N9GA 1Q9WB 4PJ5D 3RKDC 3T0XA 2PTUA 2XKUA 4PS4L 5JORB 2OBGA 4NM4H 5D8JH 2AEQH 1UENA 1GC1L 2QEJA 3F7VB 5E2UL 4G8EB 5FF6A 2ICES 2P5WE 3OXRB 5TE7H 3HE7C 4NHCH 5TE7L 1EBAA 4NHCL 3BGFB 1MFBH 2IADA 5ENWB 1VEOA 1MFBL 5LGHL 1ZHNA 3WKNA 3A6CL 3BD5A 4WUKH 2DOCA 4KV5F 1WWBX 1T7VA 4AM0A 4GBXC 4H0IA 3NIDE 5DK2B 1OAYH 4X98A 4ETQB 3RZCD 3V4PH 2B4CL 1KCKA 1KLFA 2HFGL 4PPTA 5E8PA 5E70A 3UTTD 1A3RH 2OCFD 2J4WH 3WN5C 3KXFB 1UFUA 3CVIH 3O11B 2CK2A 4K3JH 4R7DA 3MUY1 4ORGA 3MSPA 3RPIA 4OZGF 4V2BA 5HDQH 3IRPX 4PGDA 1AO7D 5HDQL 4FG6D 5C0JB 5HVHC 32C2B 1EDQA 4KDVA 2YA1A 2VN4A 1IMHC 3KPOA 1FVDB 1JCKA 5FGCB 3RUGF 1IRAY 1LWRA 4P57B 4XP6H 3WHXB 1QBMH 1CGVA 4GAGH 5FHAL 3V4VL 4XP6L 3AGVA 1DFBH 1QBML 1TQCC 4HMEA 3FOLA 4KAQL 2E9BA 4AG4H 3HN3A 2R0KL 1N6QL 3X13B 1WWCA 4JDZA 2K1MA 3FO9B 2HJLB 1XH3A 2NLJA 1NL0H 4J1UB 4OLXL 4LL9A 1TIUA 3VGFA 3FOMA 4ODXB 3SQBA 5C07B 3N1GC 5DEFB 1Y18A 4UT7H 3V52L 1HHJA 4HFUL 3ISWA 3DX9A 3OZ9L 3KG5A 3SE8H 4MS8D 5JW3H 1AQKH 1ES0A 1QSFE 4NUJA 3MLTB 3ARED 3BP6A 3LKQB 2BNQB 1S7QB 2QQLH 5IB1B 4MA1C 5DEGA 1T0MA 2WP3O 5C2BH 5I1DA 5TFSH 2EICA 2IGFL 1HCVA 3SO5A 1G7HA 4XCYA 1D9KB 2NYYC 4MJ5A 4DN3H 4GKZB 1C5DB 5GRJL 4DN3L 4MDIA 5C0GB 3MRRA 3TF7A 2IFFH 4O5LH 3VXSD 3DRTB 2IFFL 2D4FA 3Q6FB 4F15C 4LBEA 4PJBF 2NY0C 1KB5L 2CUMA 2FZ3B 4JDTL 5F9OH 1KLGA 1HQ4B 1OY3B 4KY1L 1DCLA 1U3YA 1TJHL 4WTZA 5BS0B 3FAWA 1H3UA 1U3HB 5L9DH 5J6GB 4OGXL 1E4KA 4X8JA 1JK8B 3BHBA 3UDWA 1JN6B 4FZ8L 2OSLB 4OFVA 3PV6A 4O2EB 4C54A 1ITBB 5CZXC 4XGZA 4L9DA 5EO9A 3N1PC 4LRNH 2EIZA 4ALAH 1W72A 1VFOA 4LRNL 5GGVH 1ORQB 4OI7A 1EJOL 5DJ8B 3C5JB 5JNYB 3MJ8A 5I1JL 3EDKA 2GJ6E 1Q1JL 5B4MD 1F4WL 4MAYC 4ODVL 1OD7A 4ZFFA 1OQOA 4HUUA 1OLLA 1M6OB 1RIUL 2H9GA 4HH8A 1YEDA 5BVJB 2A6JB 3V95A 3LRSB 3TT1L 4G43A 5C0CE 3FCTB 3RNQB 4EXPX 2Y4SA 4WCYH 2RCSL 1SBSH 4G9DA 1DN0B 1EMTH 4G8FB 5E6IB 3ETBF 3BH9A 1EMTL 1X5GA 2XWTB 1CT8B 1KPRB 1WUNT 3KS0J 1D5XB 2XOTA 4IOSD 5DK0B 3FB5B 1JHKH 3LOWA 4H1LB 1VGKA 3OKEB 4UQ2B 5TH2A 4AT6B 5SWSB 1NAMA 3DETD 4YXLH 2R56L 2HTLD 3C8KA 4Z7VF 5E56A 3BWUC 4V2CB 1QPXA 2CSPA 4DKDC 3X3GH 1PLGH 4L8BA 5HDOA 3IVKA 5FKAA 5DC4B 5E95B 3JBG7 5C08A 4G80A 2HA1A 5IFHL 5EBMB 3WNOA 3QWOA 4K23L 4FQCH 1TVHA 1Z2KA 1YEEH 2R2HA 3RVTD 1LO0L 3IJHB 5KOMC 1YEEL 1HK6A 1YNTB 4X7DC 2W9LA 4ZOEA 5DMGC 4PJ8A 4OSUL 1T21B 1RUQH