4CVZA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
277
structure length
277
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I GLYCOPROTEIN HAPLOT
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 68
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cvzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4cvzA01
2QHLA 3P0VH 4AL8H 3C5JA 3AROA 3MLYH 4NC1E 4XBPA 3EYFB 3HC0B 4O00A 4F7EA 5AUMA 3U9PH 5A1AA 1N6QL 3A6CH 1RUMH 2R4RL 2DQTL 3B2VH 2OCFD 1CVRA 1JHKL 2NX5D 3RX7A 1N0XL 3OKEA 1E27B 1KBGH 2OTPA 1CG9A 4N5ED 2VLJB 2M2DA 5K9KA 5A3IC 3RVXC 4LVHB 5AG9A 1JYVA 4JAMA 2R2EB 5C6TL 3WLWD 1KXTB 3VU2A 2ICWA 3F7QA 3LEXB 4GBXD 4I8DA 3RHWF 4AK1A 5JPMB 2P5WD 2EC8A 2OQJA 3EUUA 3KPSB 5DD5L 3F7VA 3PXHA 3ZE1F 4S1SL 2HLFD 4GG6B 3CX5J 1R0AH 1KCRH 3KAAA 4O2CB 2QSQA 3G5VA 2GAZA 1Z9LA 2OK0L 5J1AA 3MUHL 4S1RL 2X7LA 1U91B 1QNZL 3P4MA 3E8UL 3OZ9L 1CVSC 1IZJA 4N0FA 4WEUD 1WWCA 1N6QH 1ND0A 2PN5A 1S5HA 2R4RH 1X7QB 2DQTH 3GI9H 4L8BB 4PJ9C 2IH1A 1T6WA 1JHKH 1N0XH 3SPVA 4XCYA 2CIIA 4NO0A 5AUMB 2FEEI 3FT3A 4RA0C 5I8EA 4N8VA 5C6TH 3QEHA 4XCNB 5DJ6A 3OKKA 3QH3B 2DQIH 5JA9A 2VZTA 1XGUA 5K9KB 4B53A 3T0WA 4NDMB 4N0UE 4JAMB 4WW2F 2O5YL 5DD5H 4OCYL 3VCLA 4S1SH 2H2SC 1K5NA 3MRMA 3HA0A 2YD8A 3RPKA 2OK0H 4JQVA 1S78D 3F7VB 1M71A 2M26A 3EOAA 4WWKB 2FL5B 3DOSA 4S1RH 3TCLB 4R4FL 3ZHLA 4XI5D 1H15A 3AS0A 4RQQA 2GAZB 5E7BA 3U4EB 5CMAA 1QNZH 1B0GB 1HHJA 3E8UH 2BVQB 2DQJL 4CDHA 2X7LB 5DQ9A 4PJGE 2XPGA 4PY7B 5FYKE 4NO2A 4HGKC 1ND0B 3JXAA 1SMAA 3QWOA 5FDYA 2IG2L 2IH1B 4M7JL 3K46A 3T8XB 3SPVB 3LAFA 4NO0B 3GNML 1S9XB 3B43A 4G80B 4ODUA 2O5YH 4ZSOA 4OCYH 3QEHB 5DJ6B 1UYWL 3AXLA 3DMMC 4NT6A 4F8TA 4U1SB 4ZO6A 3KLSA 1AO7D 3ES6B 5FGBC 4DJMA 2D9CA 3VCLB 4R4FH 1MSPA 4L3EA 1T7YA 3MROA 1NCBH 1K5NB 3E0GA 1DL7L 4MDJA 2X42A 2NXYD 3VG0L 2BVEA 4MNQD 2DQJH 1JPST 2LU3A 2XWJA 4V1DA 2ZUSA 3L5JA 1NFKA 3PQYA 1P84K 4LHUD 5FUZL 3QO1B 2EDDA 1UA6L 2PETA 4RQQB 5C07A 1VPOL 5EUOE 3OSKA 5LGJA 1D9KC 1J88A 4G8EA 1YUHA 1RK0A 3EYUL 3Q5YA 3L3DB 3W0WA 5B8CC 4L9LA 4LPUA 4OT1L 2IG2H 4PRPA 4M7JH 5FYJU 2GJ6A 4NO2B 3OKOA 3RBGA 3GNMH 3ARDD 2FD6L 3PHOA 3FQWB 1FVEA 2F74B 3CPLA 1V3LA 3WKNA 5FV1L 4DWHA 1UYWH 2A6JB 3HE6D 4OV5A 4KRNA 4P2RA 4G6ML 1BMGA 4ZSOB 1V5JA 4FQQA 4RMUA 4HHAA 1HH9A 1R3JA 1DL7H 5D7IE 2IQ9L 3N85L 5I8KL 3D1MC 5DR5L 3VG0H 3D18A 4OZHF 1JPFA 4R8WL 5FUZH 1Z5LA 4JGUA 5FAAA 4UDUB 4MDJB 1UA6H 2VISB 1QD0A 3CC5B 1VPOH 3L7FA 1ED3B 4X98A 5E0QA 5IEKA 4V1DB 3PQYB 2F53E 4WW2B 2DLTA 4XZUA 1XF2A 3EYUH 2Z35A 3ZYOA 4IMLB 3QXTA 4OT1H 4R97B 4PBWD 5HI3D 3ULSA 4MAYA 1NCNA 1VHPA 5LGJB 3NCYP 2VTFA 2FD6H 1B90A 3U48A 2MQ3A 3I2CL 1BOYA 5F6HI 4PRPB 4UBDD 4UQ2B 2X1PA 5E2VH 4P99A 3QUYD 1E6JL 4AT6A 2H9GA 2QSVA 4G6MH 3PHOB 1JPSL 3PWPD 5DD0L 3RU8L 4M7ZB 1WAAF 3N85H 1D3CA 4LOUC 5DJ8A 4R96A 5DR5H 5I8KH 5F1KC 4FQJL 4R8WH 4I9WE 3VJ6A 4FQQB 3FAWA 4HDIA 1UG9A 4HHAB 4LLYB 4MMZC 1JTTA 3I3BA 2OL3B 1OCWL 3MRIA 2AJ3A 5IQ9B 2LFGA 3D18B 3MYJB 5J6GA 1EZVY 2V9TA 1Z5LB 3GMPA 2VIRA 4EZMA 3ULVL 2VDLL 3QDGE 1JZ8A 5DWUL 5JLZB 3L7FB 1LEGB 3V5KB 3X14A 5IB4B 5IEKB 2ICWJ 1PYWA 5KOMC 4X7CC 1XF2B 2XA3A 5KVMC 3I2CH 4G43A 2GTZA 3RPIB 2I25N 4FFEX 3ULSB 3V0VA 4MAYB 4XVUC 1CXEA 4XCEA 5DMKA 1E6JH 2IALA 1JPSH 2RCSL 4YC2C 5DD0H 3QIWA 2YD2A 3TNMA 3IDMB 1F11A 3RU8H 4P4KD 1I1AA 4FQJH 4AT6B 5ID0B 2H9GB 4PB9L 2MTPA 3ARGC 2R56L 5I0DA 4IRZL 3TO2A 1OCWH 3RGVC 3DMMB 1II4E 5AEAA 1JP5A 3BDBA 1CIDA 3ARBD 3OAUL 4CW1A 3ULVH 3BIKA 2VDLH 3OAZK 3MRHA 3WE6A 4OKVB 1CLYL 4GS7C 5DWUH 2CO6B 2X4RA 3QUMA 3RIFK 1XCQA 5J6GB 5D7LD 3GMPB 2Z31D 5KSVB 1SQ2N 3UO1L 4KI5F 5DVKA 1A2YA 4U7MA 4X9IA 1HI6A 3GK8H 4WDIB 3X14B 1PYWB 3OKLB 4OZHB 5JXEA 5KSAD 4I18A 4LLMA 2AXHA 2RCSH 2E7LA 4BH8B 5KN5A 4LMQI 2DM4A 4JHWL 5T33L 5B8CB 5TE6L 4XNUL 2XTJE 5EU7E 1QBBA 5DMKB 4PB9H 2IALB 2N7BA 5D1ZB 5EZLB 2FATL 4XPGH 3QIWB 1CDIA 2XZAL 1F11B 2FBJH 2R56H 4F9PC 4IRZH 4JFOA 3KPMB 1OTUD 4DGVL 4U4BA 5DJCA 1MRDL 1AHWC 2P48B 3OAUH 4FQLL 1EH9A 4KK5C 4ODTL 3QQ4A 4OLYL 1CLYH 4M93B 1FL3B 2C1OB 2F8VA 3IDIB 3FB7B 2O5ZL 3HI6L 3L5HA 1MCHA 4CW1B 3EHBD 3MRHB 1MREL 3UO1H 2WBKA 3HG1B 3QI9A 4F33B 5B39A 2X4RB 3MV11 2NW3A 3QUMB 1XCQB 1JWUA 3UXFA 2P24B 2ZSWA 4D0DB 1VSCA 4NNYA 1YN6A 4P57A 1HI6B 4IBLT 4JHWH 5T33H 4BSVB 1NCTA 1OWWA 5TE6H 4XNUH 1FL6A 1IM3B 1WWWX 2BVOB 3MREA 4NCDA 1BZ7A 5D5MF 4I18B 4LLMB 2FATH 3VWJD 2XZAH 5KN5B 4O4YL 4JG0L 1EK3A 3ROOB 4DGVH 1MRDH 4JRXE 1WBZA 1BQUA 4I3SL 4FQLH 4ODTH 5F7UA 2APBA 4JFOB 4S1QL 4OLYH 3EFFA 3WLBA 3FO1B 1L6XA 4Y2OA 5DJCB 3PV7A 2O5ZH 3HI6H 1X44A 3TWCL 3BGAA 1EFXD 4UV7L 4Z7UF 3V6FA 5JR1L 1QOKA 2LQRA 4EI5D 1HK6A 3FQRA 3QQ4B 1MREH 4LPWA 2H8PB 2ITDA 2CUIA 2D7NA 1ZGLP 3GSWA 4HK3N 4Y19A 3IFPA 2EEDA 2CK2A 1CFNB 4ORGB 5CLWA 5E24E 3TCXA 1JWUB 1F97A 3OAYK 2A73B 4QT5B 4XPFL 2ZSWB 3I6KB 3W11C 2P5ED 1YN6B 3LRSA 4O4YH 5DGRA 4ZS6C 3RBSA 4JG0H 2L4OA 3OL2A 4PLKD 5GRWA 1UCBL 3BP4A 4KJQC 2F54E 3RWFA 2WANA 3GKZA 5C0AE 4W6YB 1WJ3A 3QQ9C 4I3SH 4J12A 4G42A 4WUUD 5JIPA 4P2YA 4S1QH 1ZGLA 5BJTA 5EC2A 4GRLA 3WJJA 5HYQA 4R7DA 4MCZA 1UZ6E 4TNVF 1FIEA 3TWCH 5D5MA 4UV7H 5DQDL 3WCYA 5JR1H 5D7JA 3O6LL 2FDBP 4MQXD 4IRSB 2BNUA 3EFFB 4JFPA 3TVMD 2DIJA 1IAII 1EPFA 3HR5B 5E5MB 4JZJB 3V6FB 3RZWA 1VGKA 3FQRB 1MRFL 4PRDA 3CX2A 2ERJB 1MUJB 1ZMYA 5F7HA 2H1PL 2AJUL 1ACZA 3ZT6A 2H2PC 3GSWB 4Y19B 1YNKL 4Z7UA 4XPFH 1MVFA 3IFPB 2AKRB 4I0PC 4XPBL 4FS0A 5HPMA 4NO3B 1H3TA 3V5HB 1MNUL 2HT3C 5I1DA 1UCBH 32C2A 4WI5A 5L0QB 3EGSA 1FC2D 3R8BB 1RIUL 4X9FA 3PJSA 5EU6E 4S0TD 3BP4B 1IARB 3GHBL 4LQ1A 2QADC 5ESAA 2IPUG 3JUZA 3RWFB 5F93C 3O6LH 4OZIE 5EC2B 4GRLB 4O9HL 1I8IB 2UY7A 4MCZB 5F3HA 5D5MB 1DQLL 5D7JB 2IMNA 5AD0A 3DURA 1MRFH 1IAIL 3DSNA 2BNUB 5EU3B 4JFPB 3RKPA 3VGEA 2H1PH 1JF5A 2AJUH 4Z7OF 1U3HB 2BNRB 3V6BR 1YNKH 4NRZA 3NVQA 1CDBA 3RTQA 4PRIE 4XPBH 3SDXE 1P7QA 1MNUH 4LCWB 5ELIA 2OL3L 3DWTA 4F9LC 1WK0A 4OB5H 3PWUA 4Z7UB 2QJDA 4QRRD 4R9HA 1AC6A 4NHUE 1RIUH 3C60A 1T66C 4QHUA 2ITCA 4Z95L 1X5GA 4O2FA 3GHBH 3F62A 3EGSB 1A6UL 5E1HB 3SE3C 1XR8A 3L3HA 2XN9D 1VEPA 1LQSR 4O9HH 4ZG1A 4OFDA 4PJBE 5FUCE 4ZO8A 1DQLH 3T3PF 1GCFA 1VFUA 5J11C 1YY9D 1IAIH 5JHDE 1WEJL 2XKSA 3MV8D 4QXWA 3NGBC 4ZXBC 2X4UA 3WYRA 2EKJA 4R2GD 3TFKA 1RD6A 4YDIL 4KZDL 4M5ZL 3BZEB 1RJLB 2OL3H 5EO1A 3MV7D 4P46D 1XF5B 2HMIC 5HBBA 1F2QA 3RTQB 4HC1A 1L6ZA 4Z95H 1P7QB 3B5HA 3SDCA 4KRPC 1A6UH 2NY7L 3C60B 5DTFB 1BJ1J 2X4SB 3RZCA 3S3PA 2BY1A 4JFXA 3NFNA 4FFWD 3T0EE 2R1WB 1E4KA 1W72A 1KACB 3C2AL 1FG2A 1XR8B 3L3HB 3QUZC 5INCB 3MRJA 4PPTA 4U6VL 1AKJD 1AE6L 1WEJH 3O2VL 3QO0A 4FG6C 3T08A 1GPOL 1NPUA 2GEEA 1OWRM 4YBQC 2JKXA 4XC3L 3ULVE 1ZVYA 2OI9C 3FCTA 4YDIH 3DYPA 2BX5A 4H20L 2NY4D 4M5ZH 4RZCB 4KZDH 1G9EA 1DDHB 4DOHB 3H9SA 1UB6A 3STLA 3NCJL 4JDVB 1IMHC 5EN2A 1EX0A 5HYEA 2VQTA 3NZ8A 3H42L 4NSKA 5BV7B 5D7KD 5EO1B 3TN0B 5GGRA 2NY7H 4YWGL 4KDTC 4TVPD 5IVOA 4C55A 3IDGB 3NIDE 4PJFE 5IGXL 3F7YA 4BKLB 1MJ8L 2E7BA 4JVUA 4EUPG 2HVJA 2VERN 5T3XL 3QUML 2R0KL 1P1ZA 3C2AH 3RZCB 3GKWL 4U6VH 1AE6H 5JORA 3CDGA 3O2VH 1QFWI 2I26N 5DMGD 1XF1A 4N0CD 1W72B 4TYUA 1GPOH 1C5DA 4QY8A 2VLJE 1GOGA 4ZPTA 4XC3H 4YHNA 4X5XA 3HUJA 1KYOK 2EDWA 4H20H 4MS8A 1F58L 4GRMB 3PGCB 4POZD 3NCJH 4ETYA 2WQRA 4MSWB 1J0YA 3KPSE 1FH5L 1A7OL 5CBAA 3FCTB 1RJYA 5DRWA 3JTTB 4BYHA 4L8CA 1TTGA 1V7NL 3H42H 4GG6E 4P2CG 3H9SB 1UB6B 5JW4R 4HF5L 1BGXL 3BP5B 3IKCB 4YEEA 5I76B 4P2QA 2FLRT 4YWGH 1AXTL 3IF1B 4G9FB 3F65A 1OARL 4LCCC 4P59L 4QHKJ 5IGXH 3AUVA 1WQVT 1MJ8H 5GGRB 4NQCA 3TH4T 4H0IA 4JFDA 5T3XH 3QUMH 4DKDC 2R0KH 3K80A 4JFZL 2C3XA 1CFBA 4PUBL 4S0SD 5F72S 2ZNXA 3GKWH 3X13A 2WIIA 3F7YB 3GZKA 4KV5F 3ILPB 1AR2A 2HVJB 3DI3B 1EBAA 4HKBA 3ARUA 3GUTA 3MA9L 1DE4A 4M9PA 2ADIA 2WUBL 2CUHA 3DYMA 1IEHA 1CGSL 1CXIA 1QFWL 5JORB 2ORBL 4NWTL 1K3ZA 1F58H 4U7KA 1JWSA 1H3UA 5D6CA 5EOTA 5CP7B 5T1LD 1C5DB 4QY8B 4HJJL 4NC2B 3A67L 4YHNB 1FH5H 5DUML 1A7OH 4HKJA 2NY6D 5HGHA 1V7NH 2AQ2A 5CKAA 4OBRA 1MOEA 1ZVSB 2ARJA 5INDA 4HF5H 4DCQB 1BGXH 1T1YA 1RJYB 5DRWB 1AXTH 1OARH 2J8OA 4P59H 4KKBD 2FEDD 3QNZA 3MRQA 4HLZH 1DEDA 3O45A 4LMQE 5L9DL 3FHAA 2B8OT 1FQ9C 5CD5D 4JFZH 2F5BL 1A7NL 4PUBH 4G6JL 1A1OA 4DTGL 4WHYH 2ZOKB 3CVIL 2N1KA 4S10A 4U1HA 4ODWA 1I1YB 2ZUTA 3P73A 3G5ZA 1KNOB 4JFDB 5E03A 3JWOL 5IB1A 4K3GA 2BVUA 3MA9H 3L95B 2DDQL 2WUBH 1CFSA 3PHQA 3GMQA 5EBMA 4NYLA 5C08D 1CGSH 1NGZB 3ARPA 2GUOA 1QFWH 5CZXD 1ES0B 1QSFD 2ORBH 4M4PA 4NWTH 2AQ3A 3BQUD 2X44D 4RFNB 3OTTA 5T1KD 3GUTB 1DE4B 4X6BB 4HJJH 3BE1L 3GMNA 3A67H 4N5EC 4K94L 4LLWB 1CN4A 1OGAA 4HSQA 4CAGA 5DUMH 4H1LA 4WHTA 4HIJB 4Z7NE 1CFTB 5D6CB 5MEND 2UY6A 3WLWC 3HAEB 4GBXC 1L4IA 3HHRB 4F7PA 3LKOA 2FNBA 4PP2B 2V5RA 4HKJB 1BVLA 3RWJA 1TPXB 2ARJB 3WHXB 2GSGB 4LVNC 2BC4A 1T1YB 1JMXA 3TIDA 1SJVA 5L9DH 4X80L 1WV7T 2F5BH 1A7NH 4G6JH 5FYLD 4DTGH 3V4VL 3L5WA 3CVIH 5IBUB 2DI9A 3QNZB 1AC0A 5BQ7A 1ITBB 3QXWA 4YHPA 4HS6A 3OB0K 3O45B 3GJFA 3JWOH 1CK0L 2DDQH 2NY2C 3ZE1E 4U1HB 2W65A 3U2SA 4ODWB 1CICC 3RAJL 2W38A 4HUVA 5IB1B 3UPCA 1CFSB 3UJTH 3GMQB 4K94H 2GUOB 4P5TC 2ZCKL 5DC4B 1N3NA 1GXEA 3EIFA 5DJAB 4JHAL 2ICEA 1GZQB 1OAKL 1VGEL 4KTDL 4ZSOE 1JMZA 3RX8A 5A43C 4Z6AT 5TQ2L 3BD3A 5I8CB 3V0WL 1LHZA 5FM4A 2ATPB 1NCWL 3JTSA 1VENA 3JV6B 2BXYA 1OAZL 4X80H 3C5ZA 1S78C 5JMRA 3V4VH 4XI5C 3L3IA 2BC4B 5F9WB 3TIDB 2J7LA 1RSFA 4FQ2L 1CK0H 1DQJB 4V1DE 5CEYA 3PQYE 4HBQA 1WIPA 3L5WB 5BQ7B 3VMNA 3CU7A 4HS6B 3RAJH 3QUKA 1UJ3C 3S4SG 3CLEL 3V6OC 2ZCKH 4ZUVA 1F6AB 4H26A 4KMQA 5SX5H 1OTTC 2C5DC 3BZ4A 5I1EH 4JHAH 1G7QA 4PRPE 4H25B 1J1OL 1CE6B 2BSRA 1OAKH 4MXVF 2APVA 4KTDH 4E0RB 4MD5B 4D3CL 5TQ2H 1T04A 4YFDB 4ENEC 3V0WH 2ICEB 1UACL 1NCWH 4L8DA 3IDXL 1OAZH 3VXRA 5FV2A 3JV5A 4RSVA 1HXMB 1DANT 2IBZX 2B7DT 3JTSB 1LILA 4FQ2H 4MCYA 3C5ZB 4XAKD 1MQ8A 4LKCB 1KEML 2ADGA 4KC3B 3L3IB 1RZ8A 1MFBL 4ZFZA 3SDAA 2AEPL 3CLEH 5GZOD 4QCIA 1QVOA 3QDHA 4RIRA 1BIIA 2EDXA 3UAJC 4P23D 4WCYL 3QSKB 1RHHA 1TQBC 2PXYD 1J1OH 3AS2A 4P4RA 5BV7L 4P5KB 1TCMA 1D5MA 3FHQA 3ARDC 5EO0A 1A02N 3W5NA 5E9DA 4D3CH 5IMKB 3BZ4B 4HC1L 3QDAA 1G7QB 1HSAA 2P49B 1JWMA 3HE6C 4KDVA 1UACH 4XP4L 2HA1A 2BSRB 3IDXH 4MNGB 4RA3A 2VWEC 4B41A 3MJ8B 1UH2A 2XZCL 1F2XK 1JGEA 3PGDA 4X7DC 4ELMA 3O9WA 1W72L 5EZIL 4M1GH 1NH6A 4LASL 4GAJL 1MFBH 3AM8A 4OZGF 4Z7QF 4YXHL 2E7MA 2ADJA 1IGTB 4QXTA 2F19L 2AEPH 5IW6B 3TBTA 4XCFL 2ADGB 4ZFZB 4XMPL 4WCYH 3ZKNC 2EEAA 1KTDA 3SDAB 4OFVA 5BV7H 1PLGL 4QCIB 5FCSH 3FFCD 4OZHE 1QVOB 4RIRB 5D1XA 1BIIB 4PV9A 5A16B 1ZT4B 5ISZA 2ESVA 4YBHA 4YDVB 5CEZD 5M7QA 2X41A 1B0RB 1RHHB 3C8HA 4HC1H 4R26L 5SWSD 3Q2CA 4UBDC 1K4DA 4KPHL 4MNHA 4XP4H 1M7IB 5MHSE 2RR3A 3STBA 1U8PA 4L29A 2XZCH 1KTLB 2GIYA 1JWMB 4GKZB 2VH5L 3T2OA 4MQ7A 1OP3H 4OD2A 1JNHA 4KHTL 1AY1L 1W72H 3MA7A 5EZIH 2SEBA 3EYQD 3OHXA 4DVRL 1TETL 4LASH 4FN0A 4GAJH 4YXHH 3PGDB 4Y88A 1CF8L 2F19H 2IAND 1C8PA 4LLDA 3A6BL 3O9WB 4XCFH 3SY0A 2YD3A 4U1LA 3FQXB 5K9OA 4XNZC 5E4IA 4XMPH 4MB5A 1WAAE 3O41B 2ADJB 4QXTB 3T0BA 5T3XE 2X1OA 1PLGH 3U6RA 5DRNB 4A2MA 1FE8L 2X1XR 3M17A 2ZP0T 3GGWA 1KTDB 4R26H 4K7FA 1T5XA 3DSFL 4KPHH 5D1XB 5E2WL 1UB5B 4G8GD 1MHEA 4MD0A 2ESVB 2R1XB 1J1PL 5HY9A 5CZVL 1AH1A 5GGVY 2EDHA 3WD5L 1E28A 3FONA 3OJDA 1MCRA 3P9LA 1K4DB 2VH5H 4Z9KB 4MNHB 4QOKA 4M03A 5F1OB 4KHTH 1AY1H 1IT9L 4CMMB 4L29B 4DVRH 2H26B 1TETH 4KRLB 2ZG2A 3VA2C 1CF8H 3A6BH 1UXWA 3ZL4L 5CGYC 4L9LC 3OHXB 3BPCA 1KJMA 3VXOA 2R39A 4XNXL 3TBWB 4LLDB 1KOAA 4E41D 2NXYB 3PNWA 1I3GL 1FE8H 2EXWC 3SY0B 4JRWA 4ZUSA 4LHUB 4HZLA 2DB8A 3QG6B 3QIUD 3VG9C 3DSFH 4OGXL 2VE6A 3U6RB 1A1MA 2VXVL 2IFFL 5E2WH 3U30C 3IAPA 3M17B 1RQ5A 1J1PH 5CZVH 5CEXA 4EQ3A 4XAWL 3WD5H 2H6PA 4M7LT 5BW7A 4OZGB 3VXSA 1R5IA 1VACA 4YHIA 1OW0C 1N8ZB 2NY5C 3QJFA 4J3XA 2GW5A 1IT9H 5AG8A 1Z2KA 3RWCB 1E28B 2NW2B 3FONB 3FQTA 3OJDB 2CLVA 4KI5E 1Q1JL 3KS0J 1OTUC 1DP0A 1KLGA 3ZL4H 2J5LB 4KVNL 1FCCA 3DVGA 4JO3L 3RUGF 3S96B 1EVUA 2ZUQB 4XNXH 5ISZD 4N8VG 5DK2A 3HAEH 1I3GH 3GSQA 2PR4L 1YYLL 2L7JA 3VXOB 2OJZL 3K8KA 4C4KT 3EHBC 3SO3C 3GMLB 4OGXH 3VFRB 4D9LL 2VXVH 2IFFH 3W9EA 3QIBD 4Y19E 4ZUSB 4GXVL 2HRLA 4HZLB 4OLXL 1MCNA 4XAWH 1NUDA 4MZ2A 3NCFB 4LSDA 3MLSL 3N9GL 2YZ8A 2Y1VA 5TGBA 4Y0GA 2DJ4A 3O81A 4AEEA 2H6PB 1R5IB 3VD4A 3UTTA 3H7BB 1Q1JH 1K8DA 5DSCA 4F3FA 2MQCA 2IPKB 3QUYB 2RGSA 4KVNH 5DK0B 2XQYK 3SQBA 5JPNB 3MCKB 3WJLA 4JO3H 1KLGB 4E42A 5D5ME 2W92A 2PR4H 4QTHA 1YYLH 2WLZA 2OJZH 5CD3A 3FAXA 4M7LL 5D1QA 1IZKA 4FTVD 4D9LH 5DK2B 4BELD 3ESUF 3GSQB 4QF1A 1BFSA 5EDXA 4GXVH 1HQ4B 1EAPA 4OLXH 1I1AC 1UH4A 5IWLA 1IKFL 2AS5M 1NANH 4LCWE 5TJWK 4QRQA 3MLSH 3W9EB 1F02I 3BPLC 3N9GH 4Z7UE 1TIUA 5ICXA 1EO5A 1C08B 1LMKA 4ZPVB 2AQ1A 3RY6C 3CSYA 5JNYA 4XHJD 5F89B 4U1JA 3GJFH 1QPXA 5TGBB 5HYIA 5ICYA 4CMHB 1P7KB 3LS4L 2OTUB 4OFIA 1CXFA 3TBYA 3U7YL 3WNKA 3UTTB 4OM1L 4UDTA 1L0YA 4O02L 3S37L 5DSCB 4F3FB 3PDOA 4GOSA 4P4KB 5FKPB 4F37K 1G0DA 4K8RD 5E56A 5J7CC 2VDNL 5JXEC 4M7LH 3MJ6A 3TVMC 3BRFA 5SWQA 4X6CA 2E7LC 5LAXA 3QXUA 4E42B 2V7NA 3OMZA 3VXSD 3ETBF 3ARBB 1K3IA 1SM3L 4Y2DA 2EICA 1IKFH 1I4FA 1ITCA 1N6UA 1QEWB 1AGDA 1VERA 4U1IB 2VQ1A 4QF1B 1IBGL 4L4TA 2Z31B 1LNUB 1EAPB 5I74B 3DHMA 5JZ7D 3MV9A 3RUGB 1UXSB 4HLJA 3MO1B 5AWNH 1ZTXL 5IMOB 4R0LA 4BFBD 1FAKT 1T3FA 5KSAB 3LS4H 3U7YH 2NY0D 3PG2A 4OM1H 1OAQL 3CSYB 5JNYB 3P4NA 3E3QC 4O02H 3S37H 5HTSA 1DCLA 3QI9C 3RVUD 2NYYD 2VDNH 3JVGA 3MRFA 1BAFL 3TJHD 5DVMA 5CSZB 1SM3H 2EH8L 4K2UL 1KJ2B 5SWQB 4DOHE 2VAJA 1FRGL 1VFMA 4C56A 1IBGH 5GRXG 2FSEA 3RIFF 2FHCA 4PJHF 1T89A 2K9UA 3UTSD 1JF6A 4Y2DB 4GW5B 4KKCD 1I4FB 3SO3B 5F9AC 1AGDB 3INUH 5CJQL 1ZTXH 1YMMD 4L4TB 4P3DA 1X9QA 1G0XA 3DTXA 2LU7A 3MV9B 1OAQH 3ECBA 5EG6C 4Z7OE 1FZJA 3T77A 3O6KL 1NC2A 3VWJB 2C7UB 1W8OA 2KUTA 3ZE2F 4A6YA 5C92A 3P4NB 2DWEA 2W91A 1GAFL 2NY3B 2XNAB 2E7CA 4WWID 1BAFH 2FBOJ 1A7PL 2O5XL 2EH8H 4K2UH 3L3OA 1FRGH 1IL1B 1HKFA 2Q20A 1JV5A 4JY6B 4PRBB 1G7MA 3VH8A 4EI5B 1F3DJ 4PP1D 2BNQD 3O8XD 2BVTA 3SKJL 5DURB 3FQUA 3CXHJ 2VDPL 3H9SE 2LU4A 5CJQH 5MEQB 1DQTA 4C56B 4P46C 3T3PE 2E9JA 4OFYD 5ECJE 2WINB 5DD6A 1T21A 5CIPA 3WJJC 1T22B 4DZBB 2K7PA 4N90D 4G9FE 4MWFA 8FABA 1JGDB 4EDWL 4JO1L 4XMKL 2R69L 4MX7B 3L1OL 3VGAB 2YUZA 4P3DB 3RWIA 4Y5VB 1ZLVK 3FOMA 4CBPA 3O6KH 4NQVA 4ESKA 1O0VA 5F1SA 2DMKA 1S7TA 4D94A 3ZTNL 4J3VA 4OIBA 1S9WA 1GAFH 2YUWA 4FFWC 4EXKA 3T77B 1WCBA 4UT9L 4NPYA 2O5XH 1A7PH 4WUUB 3KPOB 2PTTA 4AIXA 4A6YB 3JWNC 3RDTA 2DWEB 2MJWA 2NMSA 4IIQC 1XGTA 4AQOA 2VXTL 2X5PA 2P44B 4MQSB 3WMSA 1VFAA 2YSSB 4G6KL 5E6ZA 4WJ5A 5E8EA 1NDGA 1LP9F 3QJHB 2NY4C 1SVZA 3SKJH 3BN3B 4EOWL 2VDPH 1MY5A 4RDQF 2R9HC 4PV8A 4AG4L 2A74A 1X5LA 1OLZA 1JV5B 4UTAL 2Q76A 5HYJA 1T20A 5F7MC 3ALXA 1NAKL 4EDWH 4JO1H 4XMKH 2XG5A 2R69H 3FQUB 5IR1B 1SJHA 1MAJA 3L1OH 3D48R 4P2QE 3MRBA 4J6RL 1J8KA 4HLZG 2Z8SA 4WRLA 4UILL 3SKNB 4NRYA 5TFSL 3ZTNH 3F12B 1LEKB 4WHYG 3RWIB 4JFDE 3BGMA 4UT9H 1CXHA 4NQVB 3UJJL 5J3HD 1S7TB 1O7SA 5D2NB 3OF6A 1AD0A 5DF0A 4Y5XA 1Q9OA 4PLOB 1S9WB 2YZ1A 5DMGC 2VXTH 1WCBB 3WFBL 3E2HA 4KROD 3QFJA 4WI2A 4G6KH 2KH2B 1WBXA 4WO4A 5IJVA 4PJ8D 2PTTB 3S88L 2ZOLA 4LKXB 1HHHA 2FX8L 4EOWH 1XGTB 2I5YL 1BF8A 4AG4H 2BVPA 3BUYB 4J1UB 4POZC 1K6QH 1JUFB 2VDRL 1ACYH 4UTAH 3SGJA 1NDGB 4FQIL 1HZHL 1NAKH 4U6YB 3KYAA 3NOIA 3R0NA 2PCPA 4C4KO 2G2RA 3LMJL 1K8IB 1WZLA 4J6RH 4ZNEA 5IKCB 5HYJB 5FGRA 1T20B 4UILH 4H0HB 5ITBL 3WUWA 1CD1A 3E6HB 5IBLD 3B8SA 3LN9A 3MRBB 4JR9L 5HHMD 3PHSA 1X5ZA 3UJJH 5SWZD 3WIHA 1KB5B 4YBLB 4ZAKA 3TFKC 3UC0L 3BP7B 2JIXA 4OJFL 3WFBH 5DJXA 9CGTA 1T80A 2VR4A 4FXGB 5HHXL 2NNAA 1AD0B 1IEAA 4J3SA 2X4OA 3A6OA 3S88H 1Q9OB 2FX8H 4JM2D 4BFIA 2I5YH 3TLRA 5JW4N 5GGTA 1P6AB 5GISL 2VDRH 5C09A 1WBXB 3SDCC 1EXUA 5IJVB 2ZOLB 4FQIH 5D6DA 1HZHH 2VSDA 4KV5E 5FYKU 3N1FC 2AK4D 3LMJH 2R29L 3C6LA 5GS2H 3B5TA 3PL6D 4JKKA 5C9JB 4R2GB 3G5XA 2WBJD 3DROA 5ITBH 3QISA 3SCMB 5DS8A 4KKBC 3IRZA 2FEDC 2PCPB 2G2RB 2B4CC 3PWLA 4PG9A 4JR9H 3VRLF 5LWYL 1NFDF 3KPLA 2WBWB 2YBRA 5CD5C 3D2UA 3JWDC 1N5AA 5KANI 1LP9B 2FZ3B 1D5BB 1PQZA 4FXLA 3HRPA 1CD1B 3UC0H 1WT5C 1BD2D 5GIRA 4YR6A 4OJFH 2X4QA 5HHXH 2IAMA 1I8LA 4DFIA 3RQ3A 4JY5L 4GKSA 4ZAKB 1SYVB 3BQUC 2JIXB 5DJXB 4XVJL 5GISH 1RZJC 1QFUL 5IVXF 1IEAB 1DLHB 1WICA 1AKJB 2CGRL 3ALWA 5F7DB 5KSBA 2R29H 2FO4B 3TZVA 2WW8A 4OIAA 1EXUB 4N8CL 1QLEL 3C6LB 3WEXA 2NR6D 5LWYH 3HPLA 2X70A 3G5XB 3O6FB 3DROB 1ZA6B 3K74B 2X9WA 3D39D 5DS8B 4MJID 2Q3AA 3PWLB 4M7KL 4PG9B 5FHBL 4LFHD 3MNZA 4XH2A 4MS8C 4JRYA 3GEWB 4JY5H 1FGNL 3EO0A 1CDHA 1IFHL 1EO8L 4YR6B 4G3YL 1T4KA 4JFED 4XVJH 2R1YA 3IB4A 5SX4H 2IAMB 4NO5A 1FFPA 1I85A 5EC1A 2CGRH 2KPNA 3BVNB 1AIFB 1TXKA 4OCRL 4LSVL 1AXIB 5JO5A 1FN4A 4MA3B 5HD8D 4MNGE 4N8CH 1NKRA 2DLGA 1QLEH 2X6MA 4L8SB 5T1MB 1MCEA 3HRZA 2J8HA 1BFTA 5IVXA 2EDKA 4JANA 1FO0A 3KLAA 3BJLA 4JO4L 4PJXF 3Q6FA 4LP5A 3KNBA 3HMXL 3TT1L 4M7KH 1FPTL 4MJ5A 3VFNA 5FHBH 1ORQA 3HPLB 2E9BA 1T0PB 4K07A 4ZDHB 5ADPH 4MA7L 1FGNH 5CCKL 4M8VA 3WS6A 1IFHH 3G9VA 1EO8H 4G3YH 4XH2B 4XPAL 1ZS8B 4JRYB 2DQUL 4YIQB 3KYNA 1J5OL 3ZYJA 4TVSa 5F88A 4OCRH 4Y5YB 4LSVH 1IAIM 1NFDB 1O5DT 4IEFB 3VXUA 4LSRL 4HJ0D 3SKOB 4NO5B 1FFPB 2IFGA 3OKYA 4LCUB 4R3SB 4FQXA 4XVTL 3M1BA 5JO5B 1G1CA 2CD0A 4X4MA 1LDSA 5T1LB 5ID1A 4KK6D 3SKUD 5E6ID 4JO4H 3T04D 2NY6B 4YDLB 3NTCL 3HMXH 1X4XA 2HG5A 4ZFGL 3IXAB 4U33A 4A6YL 3TT1H 3HRZB 1FPTH 5BZDA 5IVXB 4JANB 1FO0B 3BIAX 1KGCD 4MXVE 2MCPL 3T1FA 3QULA 3Q6FB 4MA7H 4OF3A 3KNBB 5CCKH 3IAGC 3C9NA 2OR9L 4X4YB 3VFNB 5GZOC 5F7EL 4JFQB 3S35L 2DQUH 1I9RL 1CQKA 5HGBB 1J5OH 4P23C 4A2LA 2IADB 5DMIL 3DGCR 4LSRH 2HFFB 3QWRA 1FBIL 2ESVE 1NBZB 5C08B 2R0ZL 5F88B 4XVTH 5HDBF 1QSFB 1UT9A 5GSVA 5C0JA 3WFCL 4CVXB 3O6ML 4JEGB 4ONGL 5C6PB 4FQXB 4DFHA 5EBLA 3M1BB 3KLHD 3ARXA 4ZFGH 4A6YH 4GG8A 5DO2D 2DKUA 2FJHA 1IKNA 1WUNT 4HWEL 4LSTL 1PG7W 2MCPH 5JIKA 1MCWM 1I7ZA 1FYTD 2HG5B 3SN6N 3T65A 3L3GA 4L1DA 2OR9H 1T2XA 1FNHA 3NN8B 2JCCF 1JGVL 1RK1A 5F7EH 3S35H 1I9RH 3QULB 5DJ2B 4UOJA 2LAGB 4RWYL 3I6GB 4RRPA 3T1WA 4K3EL 4LPXA 5DMIH 5C0BD 5DD3L 1FBIH 1FDLL 3OX8A 1OB1A 2APTA 5CIPH 3HE7D 3T3MF 2R0ZH 4Z7QE 1Y18B 2XKNB 4LRNL 4OZGE 3CDFA 2ZKHL 1S8DB 3WFCH 1PKQA 3IYLW 3T2QA 1KCUL 3O6MH 3ISWA 5J06A 2XWBA 4ONGH 3R06A 2HFEA 5HPOA 4NQDA 1KB5L 2J8UF 5GSVB 5T5FL 5C0JB 5KJRL 4OLUL 4HWEH 4C59B 1S7XA 5JIHA 2KL6A 5IEHA 4ZOCA 5I6XB 3EYQC 4WV1C 3EW3B 3QAZC 5E95B 1TENA 3VFGL 4PJDA 1OQOA 4XGZA 2FJHB 4RX4A 4GAFB 1NLDL 4WHCA 3VWKA 4BSWA 2EYSB 1JGVH 1WCQA 1PY9A 2HTKD 1I7ZB 5F71A 3T65B 3L3GB 1BF2A 4RWYH 3I75A 4WI3A 2IH3A 1RK1B 5A2KH 3IS0X 5LGHL 1QSED 3CU1A 4KK9D 5EOCL 4B7LA 5DD3H 4ONHA 1FDLH 2RFXA 4K7PY 4JPWH 5KVDL 4LRNH 1FZKA 3S36L 4IRJA 3IXTB 5CUSH 2ZKHH 4BZYA 3L3JA 1SEBA 2JCCA 1KCUH 3IDUA 3MLXL 3DRQA 3OX8B 1OB1B 4TUOA 3RVVC 1FCGA 3SGKA 1B6DA 3VXMA 4WFFD 1JFQL 5T5FH 4BUGA 1PKQB 5KJRH 4OLUH 5C2UB 5A3ID 3LQAC 4W70A 3RVXD 3ZKQD 2XWBB 5FUOL 3WL9A 1TQCB 2HFEB 4BA8A 4CUCA 3TPUA 3VFGH 3DXAD 1J1XL 4YJZL 5C9KA 1NLDH 1GC1C 2V6HA 1S7XB 1I3RA 2E7HA 1Z9OA 3MC0A 2AV7A 2FYYB 3MCG1 5FO8A 2Q8BL 2BY2A 4XGZB 1NBQA 4H1LG 3WSQH 3VWKB 5F8QC 1HHIA 5GGTL 5LGHH 3QPXL 1NFIA 3GSOA 4XXCA 5EOCH 3ULUF 1KELL 3QDMA 1QYGL 4X99B 1X4ZA 5KVDH 5JW5A 3S36H 1X5YA 4L4VD 1MCLA 3I75B 1QFWM 43CAA 4FZEH 2YRZA 1XGQB 3MLXH 2F8XC 1PVHA 4IRJB 3EOBB 4JCMA 1DBJL 1JFQH 2PXYB 3FB6B 2JCCB 5HVWA 4QNPF 3I50L 3DRQB 3SE8L 4NN5C 4TUOB 2F8OA 3MJ9A 5FUOH 1CU4L 1EHNA 3UTTE 3QBTB 1J1XH 1O7VA 4HUXA 2WP3T 3BFOA 3BN9D 2KDGA 4PJ5A 5CWSA 3IVKA 2YS4A 3WL9B 4FQPA 2Q8BH 3OAYH 4MMXC 1TJGL 3TPUB 4XPTL 2H2SD 3UPRA 3SE4A 3QYCA 4XHQA 1I3RB 2VYRE 1NUGA 2AV7B 5GGTH 3QPXH 1P6FA 3KPRD 5FO8B 1KELH 4PJ7F 1KUMA 1QYGH 5I16A 1CD8A 5DQJB 1Q94B 2J8UB 3AU1A 3L6FA 1HHIB 1AD9A 3GHEL 1NFIB 3GSOB 4HIXL 3QIBC 2CR6A 1CL7I 3O4LD 3E6FA 3QDMB 3RUGE 5EUKA 2D31A 2VOTA 4G6FD 1DBJH 2Y5TA 43CAB 1CDGA 3HR6A 3LH2L 3L7EA 3I50H 3SE8H 4RGNB 1KB9J 4RX4D 1BP3B 1CU4H 1RZKL 1RU9L 4TPRL 1NC4A 1QSZA 3TYFB 4AYFA 3BWAB 1HE7A 4PD4K 1TVHA 2K3TA 3B9KD 3NCEB 1ZGLM 1TJGH 1WC7A 4XPTH 3BO8A 4PJ5B 3F5WB 3IVKB 4FNLL 3ROLB 1H3PL 3RY5A 3UMTA 1VDGA 2OP4L 2CRMA 3UPRB 2P47B 4FMFA 1D7FA 1HN1A 3G04B 4O51A 2IANB 4PGEA 3GHEH 4HIXH 5B21A 4YPGA 3D69B 3MLTA 4J4PD 2CRIA 5DYOB 1SYSB 3BW9A 2GK0A 4PJGA 3QZWB 1CL7L 4X7EC 4L4TE 3LH2H 2DJSA 4PJAF 4APQD 1FO0L 5D4QA 1RZKH 3IDYB 3MV9E 1RU9H 4TPRH 1OLLA 4N1EA 2Y5TB 5ALBL 3QEGL 1RZIA 2GY7B 5C2BL 1KG0A 4XHJC 2A6DB 4KGLA 12E8L 4M61A 4F15C 2R2HA 1NC4B 2AJVL 1QA9A 3PIQA 4DEPB 2FIKB 1CTOA 1ZT7A 1AXSA 1FFNB 2OLDA 5FYJL 2NTFB 4FNLH 1BQHA 3BPOB 3IU3A 3ZTJG 3AB0C 1H3PH 4K8RC 5HJ3A 1WC7B 4RGMB 4MXQD 2CLRA 5J56B 2DYPA 5TF1L 4ETQA 1ZHLB 4V3DB 5BW7C 3KPNA 2FJGA 1NAMA 2MNUA 4C54A 3QPQC 4HKZB 1ZXQA 4KMTL 4OD1L 1CL7H 4G5ZL 4PGEB 4C56E 5FB8B 4YPGB 3O3EA 2P7TA 5DVOA 1CZ8L 2X40A 5E8NB 1FO0H 4M6OL 1R3IL 2AW2A 5ALBH 3QEGH 3QIUB 5C2BH 1DVFA 5IJKA 4YHYC 4PJ7B 3WN5C 4EVNA 12E8H 5BMFL 2NXZC 1YPZF 1GRWA 4PJEF 4M9OA 1R5VA 2AJVH 1KG0B 1T03L 5IHUL 5FYJH 2V9QA 1OQXA 2MFNA 1LWRA 3RL2B 4M61B 2DQDL 3QEQD 1U42A 2DQGL 2R2HB 4WUUE 3RVUC 3IDJA 5ETUA 5TF1H 3D0LB 1IILE 3LD8B 1EVTC 4LOUD 1A7BA 1H5BA 4Q7DA 4ZYKA 1ZT7B 1AXSB 4ODSL 2EDJA 4RFEA 3BXNA 5HJ3B 1KV3A 3TJHC 1U95A 2CDEA 5IESL 3HZMA 4XT1C 4KMTH 2VB5A 4N1CA 4OD1H 5EORL 4AEHL 4G5ZH 1CZ8H 2F53A 2FJGB 4M6OH 3D25A 4DN4L 2R8SL 1NAMB 1R3IH 4KKCC 2R23A 5GS3A 2E9WA 4Y4KA 1IAMA 3O3EB 3RFZC 2XXCB 2P7TB 3WJLC 3LSOB 3KXFA 4NN7C 3PV6B 1MIMH 5BMFH 5DJYA 3NMEA 5L7XL 3VGFA 2UWEF 1T03H 2VLRA 1N0LA 5ESVA 3L5IA 5IHUH 4EVNB 4ZUUA 5D1QC 3BEVA 4NGHL 5D2NE 2DQDH 2UV3A 2DQGH 5I18L 4I5BA 5EPMA 4FP8L 4XBGA 4UV4L 2Q87A 4ODSH 5IWLC 4PJAB 1E4JA 1UH3A 3ARGD 5IESH 3IDJB 5FYKD 1KXVC 5ETUB 2EDTA 1H5BB 2D03L 5EORH 4MHHI 4AEHH 4X7SL 5GGRY 3GJEA 3IFOA 1U95B 5LGKA 5I71B 1SMOA 4DN4H 1AI1H 3HZMB 2R8SH 4AEIL 4QHMB 1EFQA 3ZE2E 1AGEA 4M62L 5I1HH 3UX9B 4FTVB 3NPSC 4ISVA 2DBLL 4U1NA 2EIZB 1AGFA 3TA3A 4Y4HA 5HYJE 1UM5L 2Q8AH 2R23B 4BQCA 5E5UB 4OF0A 1N2RA 3MFFA 4JPIA 4N8PA 3KXFB 3IDNA 4R4BA 2HJFA 2PYEA 4NGHH 3O2DA 5I18H 3FB5B 4UOW1 4FP8H 1XIWA 4UV4H 4PJIF 3SGEI 4N9GA 2VLRB 5ESVB 2VXQL 4FFZL 5BZWA 5EB9A 4ZUUB 2ED8A 4X6EB 1JHTA 4UT6L 5EPMB 5E2UL 1LO2L 2WLYA 2UWEA 2P1YA 2D03H 3MOBL 5IOPA 1DBBL 4X7SH 5F8RC 1BQSA 1A9EA 1QBAA 1YEEL 4DK6A 1A14L 3S7GA 4LEOA 4AEIH 1DVFD 1YPZB 4PJEB 43C9A 4R0LC 4YFEA 4M62H 2YD9A 1R3KB 1ZHNB 3MRKA 2W9DL 2DBLH 3GJEB 5FOBB 5IG7B 4CADB 4BK5A 3IFOB 1JGLL 1UM5H 1I3VA 1Y0LA 1AGEB 2PO6A 4JREC 1M7XA 1IM9A 3OR6A 4BFGA 4M4RA 1QFOA 3TA3B 2EC9U 4ZNEE 1RURL 5DRZB 5F3BA 1IGJA 1YDPA 4FA8A 2FH8A 2EIDA 1LP9E 2XRAL 5I19L 3D3VD 4JPIB 1TCRA 2VXQH 4FFZH 3IDNB 1CGUA 2PYEB 2CKBA 5J3HC 4UT6H 2NY0B 5E2UH 3U36A 1LO2H 3HZKA 4N9GB 3MOBH 5BZWB 1DBBH 4F58L 1BJ8A 1YEEH 2WP3O 1A14H 1DUZA 1JHTB 2DLFL 2YD1A 4H88L 4F37F 5JW4M 5BRZA 4PJ8C 5I1CL 3HPJA 3NA4A 2UWEB 5CEZL 2W9DH 5EWIL 3B2UD 1JZ7A 3THML 1JGLH 3G6JF 3MJ9L 3VD5A 4JKMA 43C9B 1UQSA 3PE9A 1EEZA 3HZVA 2N4IA 4H8WL 3LKRA 3SQOL 2WK2A 3K2UL 4JB9L 1RURH 3MZGB 2RBLA 2V5YA 3ARFA 4JKLA 4U0RB 2PO6B 2DBJA 3P3YA 3UTSB 2XRAH 1IM9B 3OR6B 2JK5A 3EO1B 5D7KE 5I19H 5IBLC 1YMMB 3U83A 3JV4A 4YK4B 1RUPL 1IGJB 1YDPB 2XACC 4P2OA 3ZSTA 4Q74A 2HP4A 1X5XA 4ZS6D 2EYTA 3S5LA 3SGEH 4PYHA 4U6HA 4KXZI 4M5YL 1TCRB 3QQ3B 4KJQD 3PP4L 4F58H 4JFFA 4Y16A 1HHKB 2CKBB 3QDGD 4JRXA 4NFBA 2DLFH 4H88H 5I1CH 4JM2C 3V5DB 5CEZH 5L2KA 5EWIH 5FK9B 2D7PA 1A0QL 1WIUA 3OB0H 3THMH 4PGJA 5BRZB 3ULUL 3MJ9H 5KW9L 4H8WH 2EKSB 3BPNC 4PJIB 5TDOA 2IJ0C 1FP5A 3K2UH 4FQHB 3PL6C 4JB9H 4ZODA 4I3GA 3OGCA 1TZGL 2XA8L 1EEZB 3B6SA 3BIBX 3HZVB 1FVDA 4XWGL 2BNQB 3LKRB 3AY4A 3O8XB 3A0OA 1YNTA 2H2PD 1QRNA 2Q86A 3QNYA 4FRWA 4OD3L 3CIQA 3RDTC 1RUPH 3ARFB 1RJZB 2VDKL 4EN3A 3TIEA 1F42A 1NL0L 4M5YH 1J0ZA 5I73C 3PP4H 1NGYA 4NP4L 3MOAL 1Y6KR 1XGRA 4NKMA 4JRYE 4MVBA 5C0AA 1MHPL 4P2OB 4TUJB 3V8OA 1FZMA 2EYTB 3MGOA 1KN4L 3REVA 3SDDA 5KS9F 2QADD 4JFFB 1ZT1B 3VRLE 4Y16B 1NFDE 1A0QH 1OGTA 1E4WH 1KTRL 2Q6WB 4OLWL 3ULUH 35C8L 4KVCL 4U6XA 5FO7B 5JQ6L 5KW9H 4GKNA 3W39A 2GT9A 3LY6A 5L2KB 4ZUWA 4HV8B 3U1SL 3CX5K 3M45A 5ILTL 5KAQF 4PRAA 1L8JA 3U9UA 2XTJD 4NCC1 4CJ0A 1TZGH 2XA8H 4XWGH 1UEYA 2C9AA 2MHAB 5IW1A 2CRZA 1FV1B 2NR6C 2WUCL 4OD3H 5IVXE 2AP2A 4G8IA 4Y5XC 3MNWB 3N50A 4N68A 2YPLA 3E2HC 3WO4B 1NL0H 1QRNB 2Q86B 3QNYB 3OR7A 4NP4H 4MJ6B 3MOAH 1M1SA 4BZ2L 3G6JB 1MHPH 4EN3B 2X4TA 3KPQA 3ZT5A 2ILLA 2Q1EA 1T66D 2DQHL 3KGRA 3MLVL 1NAML 1IEBA 3RWDA 3SGJC 1KENL 1KN4H 1HILA 5FYJE 5HVFB 1NGYB 1MVUA 4P9ML 1XGRB 4NKMB 5F1NA 4KQ4H 4M43L 1RMFL 4OLWH 1CFVH 35C8H 4KVCH 5C08E 5JQ6H 2GY5A 3HFMH 2HAZA 3AFLA 4OZIA 1QSFE 3REVB 5ERWA 3U1SH 5ILTH 4QRPA 4KROB 5HD8C 1BVKA 4U6XB 1T7ZA 1EJ6A 2JTDA 4ZXBD 4X4ME 5KS9A 2OM5A 1IC1A 2YD5A 3IKKA 2WUCH 2F9BT 4PRAB 2V2WA 4YO0A 1KPRB 4OAWA 2I07B 3U9UB 4CNIB 2D7MA 2G60L 4IOFC 4LVOB 4PRIA 1ERNA 4LDLB 2W60A 4DUVA 1P9MA 3WIFB 2DQFA 1MELA 4YQXH 5I9QB 4BZ2H 5DI8A 5I1JL 2D2OA 2YPLB 3TNNB 2DQHH 5FYLE 3MLVH 1NAMH 2BRQA 3VH8G 1KENH 3OR7B 3QUXA 3U46A 5J12C 3CFBA 4J7RA 5D6DC 4P9MH 2QSTA 3GSNB 4M43H 4WFGD 1RMFH 4HMCA 5SWZB 5HYSB 4UZGA 3BH8A 4MLSA 1S7QA 3KJ4C 3MR9B 4QHLA 3RWDB 5IP4A 5HVHC 2Z9TA 3T2PA 3QXAB 4PJBA 5F1NB 4OCWL 4X0KB 1HH6A 1ZEAL 4Y4FB 4Z0XA 3FB8A 2VLLB 3QDJA 1OPGL 5ERWB 3W9DA 1MH5B 4M1CC 4OI9A 2O93L 1AGBA 3VE0B 4QRPB 3WNNA 4KK6C 1F6FB 3BEWA 5E6IC 2M1KA 2G60H 1R3HA 2AGJL 2F54D 1MCOH 4OZ4B 5DHYA 5KS9B 1PGRB 1G7LA 3TO4D 2V2WB 4YO0B 4I0KA 1F5WA 4OAWB 5C0CD 3BD4A 2I60L 5I1JH 2WBJB 3P9MA 5CHNA 1FYHB 4Q6YA 4XTRC 3ILQD 2DWDA 1QACA 4KU1A 4OF7A 2X09A 3K3QA 1HINL 3TZVC 1EEQA 4J3OC 3U46B 3CFBB 2N7AA 3W2DL 4OCWH 1P4BL 3T0EA 2QQNL 1KIPA 5EULV 4HK3J 1ZEAH 4MA1C 3BH8B 3EDDA 5FDWA 1S7QB 3B4NA 3VXNB 1OPGH 1Q0XL 1NGPH 3KPPA 5JMOC 4LLQA 4JPVL 1PKQE 3I84A 2KKQA 2XT1B 4XNMB 1MWAA 2ZUVA 5FO9A 5IM7A 2EYRB 2AGJH 3O2DL 3QDJB 5ICZA 4J3UA 4G6AD 3O3AB 1HEZA 3O3DA 4KUZL 1MFCL 5DO2C 4PLNC 3S3JA 1H3VA 4NQEA 4KFZC 3DX6A 5EU6D 1A6PA 4AENA 5HHOD 2I60H 4ONOA 5F70A 1HWGB 4J3TA 5HDBE 2AK1L 2ZSVB 5EU5A 2HVKB 1G7LB 1OD7A 1OP9A 5E00A 1YEFL 3NIFF 5CHNB 3RJQB 1HINH 4HG4J 2V5TA 2DWDB 2Z8RA 5J1TC 3W2DH 1P4BH 2OZ4A 2QQNH 5C0GA 4WGWB 3EYFA 3HC0A 2EECA 1K85A 1MJ7L 1Q0XH 3PWVB 2JCCE 4JPVH 3WUWG 4JFEB 1E27A 4ZFFB 2VLJA 3TF7A 2GJZA 1MHCA 3O2DH 2GSIB 3OXRB 4PGCA 4FFVD 2BVYA 1ZLSL 4LLQB 4KUZH 1MFCH 1C16A 4LF3A 4UAOC 5JPMA 4RMTA 1MWAB 4CN1A 5E4EC 3KPSA 3MBED 1ORSB 5IM7B 3BHBB 3T3ME 1ZE3C 2CKBL 4GAGH 3TPKA 3TPUE 5ICZB 4ERSL 3DGGB 2AK1H 4GG6A 3HI5L 4O2CA 4NQEB 5HGGS 5C3TA 1CBVL 1YEFH 2HTKC 3S34L 3D87B 5EU5B 2J8UE 3D85A 2LTQC 5HSFA 3RP1A 3P30L 5JHDD 4D0CA 4LGRB 5E00B 5E8OB 1RVFL 3QDME 1W0VB 2VO5A 3WKML 1ROWA 3AS1A 5T3ZD 1U8KA 4W6WB 5FIEA 1MJ7H 2VABB 2A6KB 4L8BA 5C0GB 3DV4A 3FOLB 1M05A 4RGNE 3WXWL 1OD9A 3CSBA 4PY8I 5CEZE 1D5XA 1ZLSH 3H9HA 4XCNA 1F4XL 2Z0BA 3QH3A 4WU7B 4IMKA 1H9VA 1F90L 1Z6JT 2GJZB 4NDMA 1MHCB 2CKBH 2YRLA 4PGCB 4H5SB 4KGJA 4WY7L 2RAMA 4UUJB 2D4FA 2JJTC 3WFEL 4ERSH 2AJSL 1C16B 3HI5H 1N59B 2Q3ZA 4PJ5E 2HTLC 4LF3B 1YQ2A 3QNXB 2G9HB 1CBVH 1LGVA 3H3BC 1KCGC 3S34H 4G59A 2DJUA 4WWKA 2FL5A 3ARED 3TCLA 3HMWL 4LPVA 1MCIA 2D0FA 1IGIL 1GGUA 3U4EA 2IANE 1B0GA 4WTXA 2BVQA 2LABA 4GMTL 5I75B 1RVFH 5MI0C 3LCYA 3WKMH 2VZVA 4HFWB 1PZUB 1NBYA 1UZ8B 3D85B 3MZTA 3ZKXC 3ULVD 5GS0C 4PY7A 5F97E 2JB6A 4D0CB 1WTGT 2AXGB 3WIIL 1Q72L 2NY2D 3WXWH 2PTUA 1WITA 1U8KB 1IKNC 4YXKL 4Q6IB 1CICD 1F4XH 1ZHKB 3DV4B 3T8XA 1M05B 2J3SA 3ULUE 1F90H 4P5TD 1F00I 3ZDYF 1S9XA 4G80A 4TQEL 5D93B 4WY7H 1D5XB 4JDZA 4KUCF 1U41A 3CFJB 3H9HB 3WFEH 2AJSH 4CRPA 1YMHB 3BN9C 1FZOA 4U1SA 3MRDB 3ES6A 1PEZA 3DO3A 5GS1C 3HMWH 1U8QB 3NIGF 4CVWA 1IGIH 4QNPE 4ZTPL 4ACPA 3BYYA 4GMTH 1KIQA 3EO9L 4Y1AA 5EIQA 4UNUA 3QO1A 1P2CA 2X4PB 3HZYB 3QCVL 2JJVA 3OZ9H 3WIIH 1Q72H 4ZOBA 1Z3GL 1NMCB 4K71B 1NBYB 3KYMA 1TNMA 2XFXA 3L3DA 5DA0B 4MAUL 5F44A 2JB6B 3OKDA 1CS6A 3CD4A 4PJ7E 4D0BA 5C0BB 4CJ1A 4TQEH 4IM8A 3FQWA 3HE7B 2F74A 4UIMB 1OTTD 3MLPA 5IMMA 1ONQB 2A6JA 4B50A 4B0MM 3GBLA 2Z91B 2FEEL 2EXYD 3B9KC 3GSNL 3RVWD 4JDZB 3ZE0F 4YXLL 4ENED 3SOBL 1I8KA 2VKXA 2VR5A 1B6UA 2F5AL 1FZOB 4ZTPH 1JHLL 3EAKA 2DI8A 3EO9H 3RNKA 1JI1A 3GRWL 1C1EL 1KSRA 4UDUA 3BGFC 2VISA 5H35B 2W0FA 3QCVH 3CC5A 3BSZL 3OJMB 1ED3A 1KIQB 4BQ9A 3BKYL 4JN1L 4WW2A 4J4PC 4Y1AB 1Z3GH 3SJVA 4ZQKB 3CAFA 2NLJA 1P2CB 4J3WA 4K9EC 3ZMRA 4MAUH 2P8PB 3DI2B 4IMLA 1FFOB 4F80A 3BH9B 3C5SA 3BESR 4APQC 2A9ML 3DBXB 3UAJD 1LVEA 3KYMB 2XFXB 3OKDB 1XF3A 3P40A 5JOPE 4UQ2A 2QQQA 1S9KC 4PJ9A 5GGSB 4D0BB 5KTEL 3PF2A 4QXUL 3GSNH 3LS5L 1RUKL 5F6HJ 4CN4A 4YXLH 5IMMB 3SOBH 2F5AH 4LVEA 5E8PB 1JHLH 4PJAE 5DVLA 1RPQA 3GRWH 1C1EH 4MXQC 1I8KB 4LLYA 3DXAB 4NC1C 5L8LB 2OL3A 1BEYL 5IQ9A 1BHGA 3MYJA 3RNKB 3BKYH 4JN1H 5FA3B 1MLCA 3ALPA 5J1SC 3LN4A 2LAAA 2W0FB 4NO0D 3V7AE 4FTVE 5JLZA 2HT2C 4CDGC 1LEGA 5IB4A 3V5KA 2CMRL 3K0WA 4XCCL 2A9MH 5E5RB 3SJVB 2NLJB 3ZKND 3ZKXB 2R0LL 3RPIA 2X2YA 3RX5A 2PUQT 3KXFE 2G75B 4Y7MA 3SE4C 3C5SB 5KTEH 4QXUH 3LS5H 1RUKH 1FIGL 2Y36L 3IDMA 4QXGL 1U6AL 1XF3B 2VLRE 4PJ9B 2EE6A 4RRPG 3ZO0A 5ID0A 2WY3A 3FL7A 5AYUL 3QWQB 3K4AA 1F3RB 3MNVB 3CFKB 4OSUL 2IQ9H 1BEYH 3DMMA 5F9DC 2Q7YA 1RUAL 5FGBA 1ZLVH 1YPZE 4PJEE 4OKVA 5IB2A 3KYKL 4Z7VF 2CMRH 3KPRB 1MLCB 4XCCH 1MWAL 2A38A 4RCAA 4JLRB 3BMVA 4IOSD 3LN4B 5KSVA 2R0LH 1LO4L 1FSKC 4WDIA 3LDBC 3OKLA 4OZHA 3DPBA 3TGXA 1DJSA 1D9KA 1G9MC 1L9NA 4LHJB 4CKVX 5FEBA 2OTWA 1V3JA 1FIGH 2Y36H 4BH8A 2VZSA 1PY4A 4QXGH 1U6AH 5B8CA 4G6FB 4GO6B 3MRGB 3DJ9A 4L3ED 5B22A 1QR4A 2PYEE 1ETZA 1DQDL 5D1ZA 5EZLA 2A9NL 5AYUH 5SV3A 4RAVA 4U05A 3ARTA 2ID5A 4V1DD 4OSUH 5TDPB 3KPMA 1S7SB 1OL0A 3PQYD 3VI3F 4XP5L 1DN2A 1ZANL 5C07D 2OZ4L 4Z7WF 1RUAH 3I3EA 1F45A 4HWBA 2AJYL 1D6VL 2UWEE 4MHHG 1FL3A 2C1OA 3IDIA 3KYKH 3FB7A 3D9AL 3W0WD 3KHQA 3OV6A 5MEPA 5CGYD 3C8KB 2Q7YB 4PRPD 2GJ6D 1MWAH 2RJMA 2YXMA 3BAEL 3UBXA 1J0JA 1BOGA 1WAAA 4Z18A 3VGDA 5IB2B 1LO4H 3HG1A 4OFPA 4F33A 1X5KA 3VI4F 4LNRA 2JB5L 2EXWD 4JPKL 5CS7A 4HQQL 3NFPB 3VD9A 2P24A 1NDMA 4P2RD 4D0DA 1ZSDB 3UTSE 3VFWA 3MJ7A 3QQNA 4BSVA 1H3WM 1GIGL 1IM3A 1YMME 2BVOA 2DM3A 4P9HL 2W9EL 1NUNB 1N5YL 1XH3B 4RAUB 1D9KB 1DQDH 2OTWB 4U0QB 2A9NH 1T1XB 3FO0L 4DVBA 1JK8B 3C08L 5T5NG 1D6EB 4RNRB 3OBAA 5AZ2L 2BERA 2XIDA 1J8HA 2FR4B 4XP5H 3ROOA 2ICES 2XV6B 1ZANH 1J12A 1ETZB 2OZ4H 4PRHA 4JY4B 4X7FC 3OJ2C 1Y6MR 4RAVB 5DDHB 1CLCA 2AJYH 1D6VH 1U3ZA 3FO1A 4MJ4A 1FC1A 3D9AH 2AI0L 5DEZA 5BRZE 4ZUTB 4MAYD 1CWVA 1DVFC 1JCKA 3BAEH 3MRRB 5IJKC 4PJIE 2YMXL 2H8PA 4WGVB 3UTZB 3RWEA 2JB5H 5MEPB 4JPKH 1B3JA 2VUOA 4HQQH 5KSUB 1ZV5A 2P8LA 3UBXB 1BOGB 2YA1A 3VFPB 2BNQE 1CFNA 4ORGA 1B4RA 1DSFL 2VDQL 1GIGH 4LNRB 5IQ7L 1SBBA 2W9EH 4P9HH 1N5YH 4XBEL 2A73A 4QT5A 1J05A 3G08B 1PX3A 1NDMB 3I6KA 3FO0H 3VFWB 3C08H 1HYRC 3MJ7B 3GDBA 5EUOF 5AZ2H 4OCNC 3VRJA 4Z5RB 4Z7VB 4HPOL 1QLRB 1R3LB 5DGQA 2GI7A 2W0KA 1MFDL 4DVBB 2OSLA 4NKIL 4F8QA 3DVFA 1J8HB 4HUNB 4JFFE 1G7PA 2DLEA 3QG7L 2YKLL 5TE7L 4PRHB 4L4JA 2AI0H 2O61B 1AR1C 4Y4KC 3P77B 3QEQB 1Q9KA 4AMKL 4IRSA 5L2KE 2YMXH 3CMGA 1U8OB 3RGVA 3HR5A 3B2UC 5E5MA 1IE5A 4JZJA 1A9BA 2P45B 1DBAL 1CCZA 2WZPD 1VCAA 5MHSD 1MUJA 2UYLA 1H3GA 3O4OC 1DSFH 2VDQH 4X5LA 3FRPA 3QIWD 3RWEB 5I66B 4LPYA 5IVNA 5IQ7H 4Z7WB 4XBEH 5C0EA 1TITA 2P8LB 1MCPL 1DQML 1I1AD 2AKRA 4FOMA 5H94B 3G9AB 1ZWIA 1NQBA 4NO3A 1QRNE 3V5HA 4LAJH 5DHVB 4DK3A 3LDBB 5CJXC 4WEBL 4HPOH 2Y7QA 3G6JE 1J05B 1MI5A 1MFDH 2OS7A 3VRJB 4NKIH 2JJSA 3PGFL 5SX5K 4LPCA 4MXWL 2YKLH 5TE7H 3CVHA 4YC2B 2OSLB 2ZG1A 5T3XD 2H3NA 1G9NL 4TUKL 4AMKH 5JW4Q 3HI1B 4F9PA 5I1KL 2VJXA 4Y4HC 4X8JB 1G7PB 1I8IA 5DEGB 1DBAH 3UPAA 3ARGB 1AHWA 1F4HA 1Q9KB 1W8NA 3CJJA 5JXED 5EU3A 1U36A 3RGVB 5BS0A 1IGYA 2Y07L 1U3HA 1A9BB 3K7UA 2BNRA 3HTLX 1XIWC 1LK2A 1MCPH 1DQMH 2BJML 1BQHG 5J6HB 1TMCB 4O58L 2WM0A 2UYLB 4GS7B 3CNKA 2CXGA 2DMBA 4LCWA 1AGCA 2YUVA 5TE4L 4WEBH 3ZYZA 2L0DA 5C0EB 5IV2B 1J0KA 1I9EA 4U3XA 2A6IA 2C3HA 2YPLE 1ZWIB 1KJVA 3QFDA 3PGFH 4LP4A 4UU9B 3WFHA 4MXWH 5F6IC 2Y7QB 1ADQL 1MI5B 1FVCB 3QB7C 2DAVA 5SWZE 3OKMB 2PF6A 2CDGB 3H7LA 1G9NH 3KG5A 4TUKH 5ACZA 5I1KH 4QYOA 4JZNB 4YHOL 1INQB 4BK4A 3VXQB 5DQDH 3CVHB 1UWXK 3DRTB 3F7RA 3QI9D 2H3NB 4JJHA 4PJCF 3R1GL 1DTUA 2Y07H 1CGVA 4UNTA 1S9VA 1ZOXA 4QRPE 3RY4A 2E6QA 1AHWB 1PEWA 2XTJC 3KR3L 2BJMH 5EU7C 2C3VA 4O58H 5I8OL 5CJOL 5BS0B 5KS9E 1IGYB 1RJLA 5A40E 3BZEA 4WFHD 1XF5A 5TE4H 4KI5D 4TN9A 1LK2B 4G7VL 1WGOA 4U6TA 5F1IA 5CGTA 5CFHA 3KJ6L 4ZD3L 5I1AB 4X6DF 1AGCB 5HI4D 1GSMA 4IRSD 1ADQH 1VKXB 2A6IB 2DTML 4NM4L 3RVTD 2GTWB 5DTFA 4X83A 1MCBA 2X4SA 3OQ3B 1UWGL 5D96C 1KJVB 3R4DA 3QFDB 3WFHB 4OM0L 1U8HB 4YHOH 3D3VB 2R1WA 2H32B 4HIEA 3H3KA 5CZKA 3LRHA 5INCA 5ACZB 2BMKA 3LKNB 4ZMAT 4Y19D 4QYOB 3R1GH 1AQDA 1YN7A 2BHUA 4QKXB 3TP4A 4CU8A 3KR3H 3QDJE 3PXJA 5I8OH 4RZCA 1JGUL 5CJOH 1DDHA 1S9VB 5FM8A 1NCUA 2BHYA 4JDVA 2GHWB 3DETD 4G7VH 5CILL 1ZA3B 2C3VB 3JSSA 3KJ6H 5DFVC 5ABDE 4ZD3H 1I9JL 4LLUA 3S8WA 3TN0A 1A64A 3CGTA 5I15L 1KT2B 1DEEB 2CR3A 4GRLD 4G7YL 5F1IB 2DTMH 4NM4H 1R5WB 2QTEA 5LVEA 3W5MA 3IDGA 4I0PA 5IHZA 1UWGH 1S7WA 5D7JD 4OM0H 4BKLA 5E70A 4U1GC 3UBXI 1JN6A 4ODXA 2AXJA 5CGMA 4JKPL 5C6WH 5GQBA 2ZJSL 4FXKB 1LDPL 2A83A 5DVNA 3T2NL 3MX0A 4ELKA 3S37X 4JFEE 4HIEB 3DIFB 1C12B 5ANMB 2G5BB 2BMKB 4U49A 5EBGA 1QZ1A 1HSBB 4C58B 3UZQA 1JGUH 5HI5D 4GRMA 1EERB 1AQDB 2QHRL 3OGOE 3IETA 3PGCA 1CXKA 1YN7B 1MCQA 2Y72A 1XEDA 4MSWA 5CILH 1V05A 4HGMA 1PKOA 3JTTA 2APFA 4MVBC 1I9JH 2R9HD 4YHLL 3BP5A 3IKCA 4NQEE 3TO4C 1YY8A 5I15H 4EBQL 5I76A 4G7YH 1VB9A 1T83A 1ZHBA 3SDDC 4G9FA 3IF1A 4PJCB 4HWBL 1N64L 2EIEA 4LLUB 3ZDXF 3ILQC 4F9LA 4JKPH 4I0PB 5IHZB 1MCFA 2ZJSH 4KJYB 1S7WB 3H9YA 1LDPH 3UDWC 4KI1A 3ILPA 2WAHA 3CFDA 3T2NH 5IBTL 1JN6B 1J86A 4ODXB 4HWUA 5A2JH 2YPKA 3SE3A 1H0DB 4XB7A 4QRUB 1OF2B 2A83B 4X6DB 4YAQB 3RTQD 4ELKB 2QHRH 2B2XL 3VFSB 5CP7A 2QADB 5LG1A 1P7QD 4WUKL 3MSPA 4G6AC 1ZVSA 3LKQB 5IIEB 4I4WA 3IETB 3C60D 3UTQB 1OAXL 3MOQA 4DCQA 1U93A 4EBQH 3FN3A 4OGAD 4K7PL 4I2XB 4J2XA 4RMSA 4HWBH 1N64H 4P3WA 3ARZA 2JJUA 1YY8B 2GKIA 2V2TB 5JUEL 1LO5B 1FNEB 3TT3L 4CVUA 1ZHBB 1REIA 5DHXB 3VXPB 4IHOA 1K2DB 2PYFA 3SBWA 2ZOKA 1UVQA 3TBVB 4HBCL 4HMEA 1I1YA 1KNOA 5IBTH 2XQYG 1XCTA 3L95A 2X89A 1NGZA 2C4FT 4RBPK 1ZAGA 2VLKB 4TOYL 1FG9C 1ES0A 3DX8B 3TFKD 1CR9L 3CFDB 3QT2A 2B2XH 2V17L 3DHJA 4X6BA 3NIFE 4X7TB 1A6VL 4YX2L 4LLWA 2YPKB 4WUKH 1P9MC 3QUZA 4GW4A 3BI9X 4HIJA 1DQQA 4FFVC 2FLBT 1CFTA 2X9YA 3S5LG 3HAEA 1OAXH 3BP6B 5TQ0L 4JVWA 5F21B 4WI7A 3SDCD 4PP2A 1SJXA 2B5IC 3MBEC 5J11B 3QUXC 2OI9A 3NZHL 4K7PH 3WHXA 2GSGA 4I4WB 3NGBB 4ZXBB 1U93B 3RZCD 3LPGA 4EIGB 5JUEH 3TT3H 2HWZL 5FUCC 1T0NA 3D0VA 4HBCH 3V6ZA 3NA9L 1JFMA 4WTWA 4IHOB 4Q58C 3KYOA 3SKMA 2PYFB 1UVQB 4TOYH 1CR9H 3SHSA 1C5CL 4AIZA 2YR3A 1XR9A 1JF1B 1XCTB 2V17H 5DHVH 4KRPB 1JYWA 1A6VH 4RMVA 5C0BE 3H9SD 4YX2H 3GJFK 1IAKA 3B9DA 4J8RA 1PD6A 5DJAA 5GSRA 1HCVA 2APWA 3FO9A 5TQ0H 1GZQA 3QUZB 4GW4B 1EHXA 4XNQA 1DQQB 3NZHH 1YC8A 5I8CA 5DMJB 3B9EA 2Z8WC 3MRCA 2ATPA 3FT2A 3JV6A 3CVHL 2OI9B 4WIQA 2HWZH 3AREC 3T0EC 2ZUYA 4PRNA 1V7ML 4JFHE 1HWHB 4L9DA 5EO9A 3TEUA 1MRCL 3NA9H 3ZHDA 1DQJA 5C0CB 5HGDA 3GMMA 4Y1AE 2Z8VC 2OBGA 1T0NB 3O0RL 5J8OA 3D0VB 3VFUA 3CDCA 1C5CH 2DOCA 3ULVC 3V6ZB 4MS8D 3MXVL 3SKMB 3KYOB 1F6AA 3FQNB 4R4ND 4AIZB 1XR9B 4H25A 1CE6A 3G6AA 2V2XB 3BE1H 1IAKB 1WVZA 4NRXA 4J8RB 4P2QD 2QKIB 4E0RA 3GMOA 4MD5A 3V9FA 5BVJB 5KOVC 1QO3B 2BSTB 2DKSA 5GSRB 5T1DL 1B9ZA 3DUHA 3FO9B 4H0GA 4ZOEA 2R2BB 4NQCD 3CVHH 2DQEL 4XNQB 4NOBA 4JFDD 3DXAE 1V7MH 1HXMA 4NZRL 3MRCB 1IGFL 3ULVF 1X6LA 1ZKAA 2P4AB 3FT2B 1MRCH 3BOVA 3ZDYE 1CQYA 5HHOB 4LKCA 4PRNB 1MHHB 1C7TA 1HDMB 2NZIA 3TF7C 5EO9B 4LCIL 4LVHC 1QBLL 1P4IL 4RGOL 4WI4A 2DLIA 5HGDB 3GMMB 4EEEA 4NKDA 1Q9LA 3SJVE 1X6NA 4LCCB 3NIGE 3VFUB 2ZUUA 1A8JH 1L9MA 2ADFL 4P5KA 3EBAA 1PG7L 1URLA 1JNNL 1J18A 2RIKA 5IMKA 2GJJA 2OX5A 1QRKA 3G6AB 5T1DH 3J7HA 3S4SB 3NCCB 2EXYC 1LK3L 4MNGA 5AYQA 4N5EA 1VGEH 4NRXB 2H32H 2DQEH 2QR0B 3GMOB 3MJ8A 3RVWC 4OTXL 3EDFA 1CD9B 2YA0A 4NZRH 4LLVB 1IGFH 2LV4A 5JOEA 2HLAB 4GBXA 2P5WA 4POUB 3X17A 4PR5A 2MQ0A 3MLUL 1CI5A 1NGXA 1IGTA 2COQA 5DZOA 4LCIH 1QBLH 5IW6A 1P4IH 3LHPL 4NBZB 4RGOH 4D9RD 4S0UC 4OQ1A 1U2CA 3KPRE 4Z77B 3ZE0E 3Q5OA 5JDJA 3VD7A 3UYPA 1JTOA 1OGAD 4GAYA 1X5HA 3QHZL 2P8MB 2ADFH 1RUQL 4NKDB 1PG7H 5A16A 1Q9LB 1ZT4A 4PREB 1JNNH 4NFDA 1NEZA 4YDVA 2XQBL 3BZFB 1B0RA 3LPFA 1G7JB 5DA4A 1RZFL 4BUHA 4WWKC 1J10A 1M7IA 1LK3H 3ARRA 2J4WL 4OTXH 5AAWA 1KTLA 4GKZA 2GITA 2YPVL 2NX5B 4IOIB 2YXFA 1RIHL 3IAQA 2EDQA 1KN2L 3MLUH 2BZDA 4YHZL 1T7VA 3Q6GL 4OGYL 4GBXB 2P5WB 3LHPH 4PR5B 1KEMH 3FQXA 3EDEA 1G7IA 1NGXB 3O41A 4HIHB 2ZUWA 4LVNB 3QHZH 1YEJL 1KC5L 3OJVC 5DRNA 1RUQH 1WFOA 1FNGB 2XQBH 1I8MA 2VLME 5F7KC 5ITFB 2EDNA 4GAYB 1RZ7L 3BUTA 3MRPB 1RZFH 1UJ3A 3V6OA 1UB5A 2NY2B 1NEZB 2R1XA 2J4WH 3NH7L 4PFEA 4JQVC 1CICB 3C5ZD 4X9HA 3BX7C 4RFOL 2YPVH 3IJSA 5B3NA 2VXUL 1RIHH 4P5TB 1KN2H 4CMMA 2ZNWA 2H26A 1AJ7L 4YHZH 4DKFL 1FNAA 2EDYA 2GITB 4NZUL 5FF6B 3Q6GH 1N4XL 4OGYH 2FHBA 4OLEA 1AO7A 1UKTA 2VN7A 5EIVA 5I17A 2W59A 4NWUL 3TBWA 5IVZB 1YEJH 1KC5H 3I02A 3WNOA 1RZGB 4MNQA 1G7IB 3GI9L 4LHUA 3HG1E 1RZ7H 3QG6A 4GSDL 5EIIA 2X10A 3B3IB 4GRWF 2DQIL 1I8MB 1MFNA 3NH7H 3CFEA 3LOWA 4OZGA 3VXRD 4LGSB 4RFOH 1UJ3B 4NNPL 1MCSA 2YD7A 4Z7VE 1H3XA 2VXUH 1N8ZA 4NCC2 3ARDA 1JL8A 3RVVD 2NY1D 4QHNA 2NW2A 4JKWA 3RWCA 4S11A 1AJ7H 2Z93B 1GOHA 4DKFH 4NZUH 1J8HE 4WW2C 4LU5L 3IJSB 1N4XH 5E1AB 3HE6A 4PRHE 3IGAB 4YUEL 3SDAD 3I6LE 5DUBA 4R97C 3QEQE 2BY3A 3GB7B 3S96A 4NWUH 3CXHK 4X8XA 2IBZY 3GSXA 1AO7B 3GSUA 4OV6F 1YZZA 1QHOA 5I17B 3C5JB 4XBPB 4NOFA 2D0GA 3GMLA 4XNYL 2VDML 3VI3E 4GSDH 4F7EB 1GH7A 3I02B 3VFRA 5E9DD 2Y6SC 1MQKL 3WBDA 1GL4B 4Z7WE 4MNQB 3U0PA 4M7ZC 3S35X 2OXHA 3OKEB 1CG9B 5EIIB 1TDQA 3GIZL 4NNPH 4U2YA 3U4AA 1J87A 4XX1E 3PUCA 1BLNA 5MP6L 2ICWB 3CFEB 3O9WD 2ZPKL 2OQJB 1TQBB 3H7BA 1OOAA 4LU5H 3VI4E 5LXGL 1I9IL 1FJ1A 1TLKA 1X4YA 3ARDB 4G9DA 2IPKA 1NCBL 3QUYA 4YUEH 3G5VB 4QHNB 5DK0A 3PWPA 2H45A 5JPNA 5J1AB 2MPAL 1EZVX 3MCKA 1T1ZA 4BFEA 1P69B 3N0PB 1VESA 3HE6B 4YEFA 4CL7A 1CYGA 5L88L 5DUBB 3DUSA 2XYCA 4MAYC 3P4MB 5D1XD 1U8IA 4XNYH 2VDMH 4N0FB 2B0SL 3JUYA 2ESVD 1MQKH 4Z76A 3GSXB 3I85A 1S5HB 3GSUB 1A7QL 1GGYA 1HQ4A 5IMLA 3HC3L 4XCYB 2CIIB 3GIZH 1IQDA 2IQAA 5LBSL 1ZLWK 3FT3B 5I8EB 4N8VB 3U0PB 2P42B 2EO9A 3OKKB 5MP6H 2ZPKH 1C08A 1XGUB 4ZPVA 5LXGH 3RRQA 5F89A 5HDQL 3GBNL 1UWEL 1BLNB 1I9IH 1MI5E 1JYXA 3MRMB 1P7KA 2OTUA 2MPAH 1K9TA 1M71B 4MYWB 3EOAB 3WHE0 1FJ1B 4P4KA 1H15B 4G9DB 4GRWB 5FKPA 4AJ0A 5L88H 2DRUA 2ARWA 3PWPB 5CMAB 3UTPD 4UI2A 1HHJB 3F8UB 3UEZA 1T1ZB 1KJ3L 1R24A 2B0SH 5GGUA 4EIZC 5DQ9B 3DUSB 2XPGB 4HS3A 1A7QH 3ARBA 1U8IB 3HC3H 3IS1X 3ZSSA 5BS0E 2OXGA 1QEWA 2JELL 5D1ZC 5GHWL 5LBSH 3CSPA 4U1IA 3QIWC 5GJSL 4Z76B 2BNRE 4KHXL 4X4ZA 3QWOB 5D7LA 2J2ZA 2Z31A 1LNUA 4GH7B 4QOKD 5IMLB 4XNZB 5BCAA 4JN2A 3RUGA 5E2VL 1IQDB 1UXSA 2IQAB 5IROA 3S36X 3MO1A 4ODUB 1CDYA 1ODAA 4M1DL 5HDQH 5IMOA 3GBNH 1UWEH 2BP3A 5KSAA 3AXLB 4M93C 4NT6B 1U92A 1I3UA 3D3VE 4XC1L 1OW0A 4L3EB 3MROB 1J0IA 5TDNA 5T3ZL 1KJ3H 2XWJB 3ZKMC 3JTCA 5DK3A 5C07B 3ZHKA 2GK2A 3GFUA 1X5IA 5B3JF 3REWA 4D2NA 1FFRA 5CSZA 3QRGL 1R24B 1KJ2A 4I18C 2CLZA 2JELH 5GHWH 4G8EB 1YUHB 5GGUB 5GJSH 1RK0B 4KHXH 3W0WB 4HS3B 4L9LB 1Z0MA 2VZ1A 2FH6A 2GJ6B 1YEDA 4GW5A 3ET9F 3OKOB 3QPQD 5GRYA 1PJ9A 5DXWA 4LRIA 3VDAA 4PIRF 1FVEB 4M1DH 1KCSL 3CPLB 1EEUA 1Q0YL 4AQ1B 5D7LB 1D5ZA 4N0YL 1T6VN 5K59F 5GS2D 4OF8A 3RIAK 4OV5B 4JN2B 4P2RB 1LD9A 3ZYIA 3VG9B 4UNVA 4M3KB 4XC1H 1S7VA 2DQCL 1HH9B 1R3JB 3FN0L 3U30B 4OLZL 2IEPA 1B88A 2NXZD 4KKLD 3U82B 3U7WL 3VWJA 2C7UA 1U92B 1JPFB 2E5EA 5T3ZH 1P5UA 2EDRA 1LEIA 4HXBL 3DVIA 4KQ3L 3RGHA 4JQXA 2XNAA 5IB3A 1GHFL 5ANME 5TDNB 3HMXA 3T4AA 4X98B 3QRGH 4XZUB 1IL1A 2Z35B 4TTDD 3FMGL 3REWB 1EFXA 4JY6A 4PRBA 3GK8L 5E8DL 4EI5A 4KKNA 2CLZB 3CCHA 4MGXA 5EZOL 5MEQA 2R15A 1KCSH 4M6NL 4KI5C 1Q0YH 3UTTD 2WINA 4N0YH 1T22A 2BDNL 4DZBA 2DD8L 4EXPX 1FFQA 1YEDB 2HT4D 1JGDA 4PJCE 1BECA 5FA4A 4MX7A 1J9CT 3TH2T 1CT8A 4XPGL 5HI4C 5I1GL 2DQCH 1D5ZB 4Y5VA 2FBJL 4IRSC 3FN0H 4HW6A 4OLZH 3RVTC 3LEYL 5DJ8B 4R96B 1U9KA 3U7WH 1K4CA 1LD9B 4JZJC 2P5EA 4AEFA 5L8JB 1TZHA 3VJ6B 2E6PA 3RY6A 5E6YA 4HDIB 1S7VB 4HXBH 4KQ3H 2ERJC 5D1QD 1GHFH 3MRIB 2AJ3B 1G6VK 2K1MA 3JWOC 4FABL 3MYZA 4YZFF 4WUUA 3KPOA 5H37H 2PW1A 4OGZA 4X6DE 5F9JA 1LEIB 5JDSA 2VIRB 2ICWI 1L7TL 3W81A 5IB3B 3FMGH 2YSSA 4AM0A 3T4AB 5E8DH 4K94C 3QJHA 5L0QC 5EZOH 1AFVL 2LVEA 3TVMA 2WMPA 2D0HA 2EC9T 4M6NH 1EFXB 3DETC 4G43B 2GTZB 1A22B 2BDNH 2JJSC 2DD8H 3QHFL 3V0VB 1DBKL 4XCEB 4I2XE 3CCHB 5IR1A 1WFUA 4Z78A 5GRVK 5I1GH 3TNMB 5EOQL 4GRLC 3LEYH 3SKNA 1I1AB 4PGBA 3F12A 5FA4B 1LEKA 1CT8B 5D7JC 1T5WA 3UBXG 1HCFX 5B38A 3BPLB 1A1NA 3TO2B 4PJHA 2ED7A 4FABH 5D2NA 1G7HA 1K4CB 1U3HC 2P5EB 3DECA 4M00A 1TZHB 2VLKE 4HD9A 2B20A 2J1KA 3L9RA 1P5VA 4O2EA 2OR8A 3E3QA 5EFIA 1L7TH 4Y2DD 2EDFA 3BIKB 4OFKA 3WE6B 4N1HB 4L4TD 2Z92A 2PW1B 5F9JB 4LKXA 4X6FA 3LIZL 5JDSB 1AFVH 3AMLA 3T0VA 5HI5C 3MV9D 3BUYA 1XZ0A 4J1UA 3RWGA 1JUFA 1QUNA 1A2YB 4AM0B 3QHFH 1DBKH 1HQRA 1LQVA 4U6YA 2W1NA 1RFDL 3TVMB 15C8L 4HCRA 3UJIL 5E08L 1XGPA 1K8IA 1QLFA 5EOQH 3ELAT 5IKCA 1WWAX 2NY3D 2BCKA 4Z78B 3E6HA 2UUDK 5DZNA 2XG4A 3BMWA 4WHDA 3UZVB 4PGBB 2A1WL 4QRRA 5SV4A 1KB5A 3KHOA 4HUKB 1T5WB 3BRGC 5B38B 3BP7A 1ZLUH 3ZDZF 2VL5A 1A1NB 4PJHB 5CAYB 5DURD 4WFGE 4FXGA 1G7HB 4KKAC 4WU5A 4RISL 4XX1G <