4CVZA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
277
structure length
277
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I GLYCOPROTEIN HAPLOT
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 68
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cvzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4cvzA01
5CBEA 3V5DA 4F8TA 3EDDA 1NAKH 5FGCB 1UCTA 1KN4H 3VJ6B 3PWJB 1KNOB 4PJDB 5FEBA 2BSRB 1CDBA 1D9KA 3L7EA 5E2JA 1Q94A 3A6BL 4AMKH 1NC4A 2VISA 1L0XA 1A4JA 1AGBB 1BVZA 1AP2B 3MRBA 2AEPL 2X4TB 1R3JB 3D85B 1ROWA 3MR9A 1FZMB 3GHEH 4G43B 4CMHB 4MD5A 3HE6D 5TQ0L 1G7MA 1I1AB 5DR5L 3PDOB 5IT2H 4JQXC 4LQ1A 1EXUB 1N8ZB 2FGWL 4FOMA 4JO2H 3SDXF 5EOCJ 1ODAA 3I2CH 1NCAL 3K0WA 2Y36L 3LQZA 4R4BB 3RHWK 4I18B 2AW2A 3QQ9C 3FRUB 5IOPA 4KJYB 4HPYH 3ZKXC 4LGSB 4KK8C 5IEHB 3DGCR 3JTSB 2CDGA 3PG2A 4JO1H 2R4RL 5JA8B 4DTGL 5AWNH 3MRLB 1XIWC 1RV6X 4K8RC 3WBDA 5GRWA 4K9EC 5DK2A 2WANA 4D9QE 1N0LA 1QFWM 2EXWC 5CGYC 4WGVB 5K93A 3CLEL 3WUWA 1D7FA 1WCBB 3P4MB 1MCCA 1QRND 4FQJL 2R4SH 4E0RA 3BIAX 4ACPA 1MUJA 4RRPA 4Y4HC 5JIKA 4EDXB 5C2UB 4G80B 2PO6D 3O9WB 1INDL 4Y2OA 4JKKA 4R26L 4U1GC 2NY3C 4PRIA 4NQXB 1EMTH 5DYOA 4HS8L 3FRPG 3JZ7A 1DANU 1NKRA 1IMHC 1UEMA 2H1PL 2ICES 3DUSA 4LK4A 2OZ4L 1FNAA 1K5NB 4WTZA 4M7KH 5BMFL 4UDTB 3AUVA 3CNKA 5EC2B 2EIEA 2CLZB 4Z9KB 3L5JA 1B88A 1JE6A 1EO5A 3OKNA 3TO2B 3B83A 3EDFA 3MRQA 3P40A 3ULVD 3MNZA 5CMAB 2VE6A 5IBLC 3ULUD 1EVTC 5CAYB 1ZS8B 4MXWH 4FQ1L 3JWNC 1Q9OB 2DL9A 2UVFA 4P59L 2VL4A 3WXVH 1N2RB 2VLRE 3O2WL 4OLUL 1CICC 4OF3A 3X13A 2DQFB 5CZXC 3M07A 4FQHA 4E5XA 2PTTA 4E42B 3PWNA 4P2QE 1LO5B 4MJIE 3LIZL 3C8HA 3BP5A 5FV2A 2V17H 3Q3GA 4M7ZB 4N9GB 4NC1C 3HUJA 12E8L 3OXRB 3W82A 3WFZA 4MNGA 3UTZA 1OLLA 2E3VA 2Z91A 1OF2B 3SOBL 3V52L 1TIUA 5B21A 4PJCB 4QRUB 2ENYA 2YN3A 4GFTB 3LB6C 1ZLWH 2MQ3A 5FDYA 1LHZA 4PB0L 3EAKA 5BZWB 4ZUWA 5I1DB 2B0SL 5IG7B 1ZTXL 4FS0A 1CDYA 3VXMA 5FDWB 1N3NA 3IXTB 1XF2B 3C6LD 3MLZL 4EN3C 3HTLX 2JK5A 4UTBL 3DX9A 2KQNA 1Q72H 5D6CB 3ARDD 4S10A 4L9DA 3UDWA 3VI4E 5KS9A 2Y07L 1KPUB 1FIGL 4BJLA 2XWTB 1T66C 2NY5H 4ZNCD 5DMJB 3O8XB 2OM5A 2X4RA 4U1HB 4U6VH 4E41A 2WV3A 1UYWL 1EDQA 2BSTB 4X7FC 1ES0A 4ONHB 4FTVA 1G7PA 1URLA 3LN5A 2K7PA 3TH3T 3H8NA 4O5LH 1QLEH 4AQ1B 5J9PA 4LRNL 5KN5B 2X1XR 4LCYA 2ZG3A 3BPOB 1F4HA 2B1AL 2AJYH 1MJ7L 4J3OC 3RNQB 3VXUE 4OCWH 1YMMB 4MXQC 4LSRH 3MV7B 5F3HB 4F9PA 3C2SA 3EYUL 4ENED 3B9KB 1JVKA 2XKNB 2XPGA 3PHSA 5ERWA 2V5RA 1N4XL 4L4JA 1WISA 3HZVA 4JFDE 2JIXD 2P4AB 2A0LC 4N9OB 1BD2A 4NQUA 2X4NB 3I02A 1BZ7B 5KVGL 4OZFA 5E4EB 2QKIA 4GMSL 4XCCH 3ZSTA 3GUTA 1ULVA 5IMOB 5J1AA 1LO0L 3D1MC 1ADQA 4OSUL 4TULH 4Z77B 1AHWA 2VDLH 4H1LH 4CJ0A 1RIVL 2P47B 2Y5TB 2VXSH 1A6VL 3ORJA 4L4VE 4L8CA 4P4RA 4IOFD 5AUMA 1JGDA 1LP9E 2PYEA 3T0XA 3V0AC 4JHAH 1BPVA 3WS6C 3S35H 4ZFFA 4ZSOB 4ZFOB 4YXKH 5D7JD 5LQBL 4JZJC 5I30H 3QCTH 3BPLC 4KZDL 4WFED 1L7TH 3VD5A 1JGVH 3H3KA 5JPMB 4LASL 5MEQB 5T3XE 1EFXD 2P48B 1OGAE 3TNNA 1OARL 1WZ1H 1BBJA 1TQBC 3IJHA 1BFOB 4QHMB 2CUMA 5FKPB 2R29H 3KNBB 4DGVL 4GRMA 1M7IB 3MLYH 3QXAA 4F15B 4JN1H 3X11A 3TO4D 2HT4C 2CDEA 4Z76A 1IC5H 4FP8H 1KJMA 2B8OT 1UVQA 1R5IA 2WUCH 4LF3B 3MQIA 2CMRL 2EE6A 2H32B 1CIDA 1Z9MA 2DTMH 5F7EH 3PWPE 1MJUL 4KRPB 3TN0B 3RY6C 4KTDL 5LGJA 1DBBL 1F11A 3SCMA 1U8IA 2OBGA 5L7XH 4KRNA 2ZJSL 4D9RE 3HFMH 3MJGX 5K9QI 1UADC 3RWDA 3SO3B 3EDJA 1YC8A 1KT2B 4MAUH 1ZLVH 3C6SA 1DDHB 1T1ZB 4JFDD 2GUOA 1JWUB 4QOKB 2P8MB 5JXAL 4LLYB 1EO8L 4X9IA 4HH9B 4PJ8D 2DWDB 3CFEB 4JRXA 1G7IA 5D5MF 2KZ1B 1CGXA 3EDKA 1BZQK 4IRSB 3V2AR 1IE5A 4GW5A 1C12A 3I50L 5F1SA 5F7HA 5HYSA 1QRNB 2MCPH 1X5HA 3GK8H 3HRZB 5CP3A 3VXTB 1E4XL 2KUTA 4N5EC 1TCRB 2NX5E 3TJHA 4CMMA 4X8JB 5FECA 3EYSH 4NN6B 5DJDA 1HSAA 1U8JA 4NNPH 1HINL 5CEZE 5I1KL 5L2KB 3QA3A 4IBLT 2DM2A 3QPQD 1H5BB 3PHOB 4N0CD 5I8EA 4LKXB 4WWKD 5F9OH 1MLCB 4N8CH 4XWGH 2FGWH 5SV3A 3C8KA 2BCKA 1EO7A 2W9DL 2E6PA 2EYSB 5A2KH 1AKJA 3C5SB 3CSPA 5DD6B 1PY9A 4HIXL 3RPIA 1MCOL 4R0LB 5I1CL 2VKWA 4R96A 4HBCL 2OI9A 1QBBA 1OGAD 2LE9A 3EOTL 1J1OH 2DQEH 5I18H 3LN4B 1T0NB 4OI7A 2YZ8A 5ESAB 3WN5A 4HFUL 2X1PA 2D9QB 1KTLA 1JN6B 25C8H 1J8KA 3V6ZA 2IF7A 4GBXD 4Y5XB 5IMLB 1M7XA 1DLFL 5C6WH 5IFHL 5DVLA 4YNYA 4L8DA 4EKXA 2EEDA 1N7ML 3WLWD 2D4FA 5BOZG 1U9KA 5DRWB 1CFSA 4HD9A 2AP2A 1C5DB 1EAJA 5EBLA 4X98B 5D7LB 5HHMD 3AM8C 3PWPD 1TENA 1MH5B 4U1JB 1XF5A 4NRXA 2WWMD 1NAMA 1OT2A 1XR9A 3VG0L 4D9RD 5MENB 4J3SA 1I1AC 4PJGF 4TYUA 1RZKH 1WEJL 2ZOKB 2NTFA 3RAJH 3S4SA 1QZ1A 4I8DA 1TMCA 1A7PL 1BJ1H 1D6EA 4I18C 4FQIH 5JW4Q 3CXHK 3CX5K 4OLUH 1U3ZA 1IAIH 1FLTX 1T83C 4ZAKB 4KQ4H 5CJOL 1A3LL 1F6AB 3ZE2E 1I7ZA 3Q0HA 2Z9TA 2AXGA 2KDGA 4G6FD 4LSPH 4NSKB 4H8WL 4U1MA 5DO2D 2IH1A 1K4DA 1EEYB 2OXHA 4TSBH 2HMID 1EBAA 3RIFK 5FYLE 2EC8A 3GJFA 1FGVL 3EYOA 1VACB 1OAUL 5CEZD 1KIPA 2LU4A 4AJ0A 4QHLB 4GAYB 4M8QB 1PW3A 4A2MA 2WUBL 2APVA 1MRDL 4DVRH 3EBAA 5HVGB 1QD0A 1YEKH 5DQDH 1I7TB 3RGVC 4NO0D 2G9HA 5MERA 3O0RL 3VCLA 3VWJB 4OZIA 3KPMB 4UTBH 4M5YH 4PJBF 3RU8H 5ID1B 3LD8B 4F7CA 1QOKA 4LCWA 2NPLX 5C0JB 1C7TA 3NIDF 3EO0B 4H25A 2DIJA 5GS1C 2VLRB 1BFTA 2DQJH 3MRKA 3ZDXF 1ZT1A 4HF5L 1GSMA 4X7CC 4P2QB 3IDJB 4MJIB 3VGAC 4U1LB 3U0TA 4JVWA 3IDXL 3GJEA 2W92A 5KSBE 1QFWI 4LARL 1JGUL 4P9ML 2Z31D 1FZJA 2E6QA 3B9EA 3DHJA 4IRJB 4JRYB 1A0QH 2FLBT 1GPOL 1RVFL 1A6AB 4P3CH 3O11A 2QADB 1T1XB 1PEZA 4KKCC 3ULUL 3RBSA 2FIKB 4KMTH 5IHUH 4ZXBD 4IJ3C 1R3HB 4Y16D 1FVDB 2W0FA 3DRTA 4Y2DC 5D4QA 5ACMA 1KCRL 1Z2KA 5DJ6A 1SQ2N 4WO4A 3KVQA 2V9TA 3SEPA 4ZS6D 4HT1H 1P7QB 5AAMA 2F53A 2DBLL 4RAUB 3BH9B 1NMBH 3BRGC 2V6HA 4PRNA 1S5HB 2VXVL 1HQRB 2UVEA 1T1YB 2E9IA 3RWCA 5JXEC 3IFPA 5AYUL 1U6AL 1KB5A 4RGOL 4TPRL 2E7CA 2XRAH 5LWYL 5AG9A 3QUXB 1F4AA 5C0AA 3QIBB 5F6IB 3BQUD 2UZYB 5HJ3A 3SKMB 1F2XK 5KSUA 1KIQA 3C08L 4TNWK 4YXLL 1KLFA 5FYLD 3CFKA 3VXUB 1D5BA 3FB5A 2YWYA 4HIHA 2YD4A 2NY1C 4PYGA 3TFKA 3BMWA 1ORSB 4FG6C 4XPBH 4HKZB 3MV8A 2MSPA 3PL6B 4JFDB 3STLB 2VXTH 2BNRA 5K33A 2C3HA 2CKBL 4RNRA 3SPVB 3VFMB 2ZG1A 5T3ZE 3S96A 3GBNL 4Z8FL 1S7VA 3QUYC 4CN4A 5JDJA 5B38A 5TDOB 2NY4B 3F8UB 3RWJA 5HHOD 1U2CA 2AK4E 4KV5E 1W0WB 3N9GL 4FQPA 3U1SH 5C0GA 4JZNB 1JPTH 4QYOA 4XNZB 3P73B 2XFXA 5TE4L 3THML 2OSLB 4L4VB 3L3DB 5H35A 4NZUL 1A6ZB 2J2ZA 4URTB 5C0IA 1AGEA 3VXRE 3PE9A 5ITBH 5F88B 5I2IA 4NQEE 5E6IC 2CRIA 3ZKMC 2D0FA 2YSSB 1T0MB 3O3AA 4GXUN 4YGAB 5IV2A 3GNMH 3CVIH 4RX4A 5KW9H 3O4OB 1C16B 2GITB 5DDHA 4MA3B 4JPKL 1HZHL 5A16B 4JFEE 3RTQA 4R4FH 4YDIH 4QKXB 5BV7C 4XC3L 3BUYA 1MREL 2IC2A 5EO0A 4H1LG 5BVJA 3NH7L 5E2UH 1AR2A 5IK3A 3MRNB 2GJ6A 1WFTA 5I1LB 2D3VA 4RA3A 4RZCB 5HHXH 3N0PB 4BQ8A 4WENB 5ADPH 3U79A 2F74A 4I9WE 5IKCA 3I50H 4AIZB 3JBG7 1N5AA 1F4YH 5DWUL 5F3BA 1VCAA 3OKLA 5F6HI 4OGXH 4EI5C 4M3KB 2DQUH 1VSCA 2EEBA 4YAQA 3HCVA 1XGYL 5IROA 5F93C 3D0LB 3TWCL 4M6ML 4LVEA 3F7YB 3MX0A 1RI8A 4OZGA 3P0VH 4OZHF 5TDNA 3D2UB 2L4OA 1KBGH 4X6DF 3KPRE 4KRPC 1H3TA 1MWAH 4HIIA 2Q86B 4WDIB 1XFPA 2VABA 4K3EL 5I1CH 4XC1H 4P46C 4P2OC 3BD5A 3VFUA 3WDJA 3D18B 1FQ9C 3A67L 1G7JA 4KUZH 5ETUA 3IU4H 3QRGH 2DBJA 4Y8DC 4ZFGH 3R0NA 1MNUL 5T3ZD 5J4MA 3E8UL 1MFCL 4MWFA 2JJVA 2VH5L 4JREC 2YEZA 1ZVSB 4H5SA 4OM1L 4KI5D 1NMCC 1QA9B 2NYYC 1LO2H 2VTFA 5IFHH 3V4VH 5JW3H 4MAYD 5C0BD 2YRLA 4S1RL 5C0CE 2NX5B 2ZUWA 5D9SB 4PG2C 4XBEL 2R2HB 3EYVA 4PV9A 4R4ND 5HYQA 5CD5D 4N5UA 3RL1B 2BMKB 4MSWB 4NQED 4DZBB 1YNKH 1ONQB 2ARWA 4XVSL 2PUQT 3PWUA 2CO6B 3RIAK 3ETBF 3BP4A 3PGCA 3KPNB 3CFDA 5C09A 3N85H 4NN6C 1RHHB 3MYZA 3VA2C 4PJXA 1H3XA 1Q9LA 2A6JB 3RDTD 3C9NA 1UB5B 4ZUVB 2PN5A 4LSUH 4IHOA 4DKEH 4JFED 1TJIL 5SX5K 4JHBA 1MJJA 1MF2L 2C3XA 2X4PB 5I15H 1JZ4A 5EDXA 4X4XB 1EX0A 4E9LA 4L9LC 3T04D 4Z7UA 5FYJE 4CGTA 1WBXB 1BVKA 4L8SC 1WZMA 3K8MA 1JWSA 3IKKA 4R0LC 2YBRA 1I8IA 1F97A 3MMEA 2HKFL 4TVPH 4WFFD 1L7IL 2GJZB 3DTXA 5KVMC 1JHKH 3EO9H 1T7VA 1EHXA 3S88H 4LOUC 3B9DA 2H6PA 1M7DA 1U93A 4LU5H 1AQDB 4Y5XC 1BBDL 5DVKA 3VDAA 2FJHB 3TBYA 4PJHE 1BJ8A 3DYMA 1NGXA 4P49A 5KSVA 2PXYC 2AKRB 5D7IE 3MOAL 1OAUH 5KTEH 3BN9C 3VFRB 4LKCA 4NOFA 2YPVH 4JQXA 1IC4L 4P2RA 1CD0A 4X6CB 4HG4J 3BE1H 3FKUS 4MJ5B 1NGZB 4KTYA 2D7TL 2V2TB 1I7UA 2MMXA 4ZD3H 4HEPG 5I17A 1FNSH 2XWBB 4LHJB 3KPRD 1U3YA 5A3IC 4W81A 2B4CC 2BY3A 3O0RH 5T1DH 2EC9U 1ND0B 2YA2A 2B20A 5EIVA 4NNYB 1KCLA 3LKNA 5LCVH 3K2UH 1W8NA 2VITB 4JO4L 4Y4FC 4H88L 3RI5F 2HJKA 3DUHA 5DF0A 4WFGD 1PZ5B 1DVFB 2X40A 5E2VL 3PGDA 5D2LE 3ZL4H 1RIUH 4G7VH 3BQUB 4OGYL 4QHNA 5CD3A 3ARED 1ETZB 4XHJD 5GJTL 2WMPA 3OKDB 1P2CA 2VXQH 3VXSD 5KJRL 1VESA 4GRWF 4ZAKC 5GS0D 3S7GA 4B41A 5SWZE 4FFVD 4NN7B 4XVJH 5TJWK 1CFVH 3ULVH 1PKOA 1J87A 4NZRH 1RK1A 5CIPH 3DV4A 3ULUH 3D39D 4WTXA 4LLQA 2KKQA 4XMPH 3QIUB 5EH1A 4L5FL 4JO3L 5DZOA 5F9AC 3MBEA 1F4XH 1KCRH 3T8XA 4GKOA 2O5YH 2AERT 4HK0A 4EQ2A 3MLWL 3UYPA 1S7TB 1DBAL 1GGUA 1FNLA 5ISZA 5GGUB 5IB4B 1RUQH 3Q6FA 3C5JA 5JQ6L 3VRJB 3NCJH 5FYKU 3GSVA 2GI7A 1U91A 3S5LG 2CGRL 2DD8H 3VWJC 4OQTH 1WZLA 5FYJD 3WJLA 2DMKA 1CICA 4OCRH 2HJFA 2EXYD 1F2QA 1N5YL 4NJ9H 1T5XB 3OKEB 2ZPKL 4JPVL 2X5PA 1BLNB 2XG4A 4RGOH 1IGCH 1ZWIA 2VMFA 5KSBB 1KC5H 4BZ2H 1PSKH 4QHUA 4XP9H 2AXFB 2DYPB 3O6KH 5EUOE 4QRRD 4NRYB 5HHPB 2EIZA 3HZKB 4F7PB 3TT1H 1I3UA 3GHBH 2CR3A 1CT8A 2Y7QA 4JG1H 5E6ZA 1JPSL 4NQTA 1TPXC 3V5KB 4HS6B 4C59B 2AJZB 3PHQB 3V8CA 3FJTA 3PV6A 2QADC 3SDDC 4ZNEE 4MCZB 3N50A 2YD6A 4FMKA 2NY2B 4GQ9L 4ZYKB 4Y19B 4X99B 5HD8D 1ZGLM 2FZ3B 5ID0A 4M5ZL 4WW2F 1NDMB 1PAMA 3L9RB 5J13C 4HUVB 3NABL 5C07E 3FQWB 3BWAA 4JM2A 4QCIB 4L3ED 3RWHB 3UTTE 1TETH 1RUML 3TBTB 1ZANH 1ORQA 1B4JL 4M7LH 3MRRB 1A14L 4MB3A 5GGTA 4YX2L 2AK1H 1UA6H 1X44A 2ZCHL 5FHAL 5DHVA 3NFNA 2BNUA 4P4KB 2VERN 1LE5A 2JB5L 1FAKT 4U6XA 2MTPA 2VAAB 3QG6B 3QUXC 3CFJB 4HAFA 4Z7OE 3OKKB 4YHLH 4PLJC 5EU7E 5I66A 1AIFB 4D3CH 1JF1B 4NHUA 4GKSA 3HE7A 3JWDL 4YHKH 3KYOB 1AY1H 5HPMA 1H9VA 2XY1A 3KJ6H 3KLDA 3WLBA 3FO9B 4X0KB 3VH8B 4HFWB 2W65B 2X9XA 3FT2B 3U9PH 1DTUA 1FYTE 3UAJD 5FKAB 2JLLA 2W9EL 4LSTL 4KUCD 1L6ZA 5HDBE 2AQ2A 1DUZA 1OP9A 3QNYA 1OT1A 3ME0A 2AK4B 3D9AL 4KKAC 2AJVL 3OSKA 3BH8A 5IVXF 3WFHB 2DDQL 4JVPA 1E6OH 3VXRB 3ARGC 3MJ9A 4EBQH 1OSZA 1H15B 5EC1B 4HMDA 1P6FA 4OM0L 4M6MH 5JR1H 4NM4L 1P4BH 5GIRB 4NNXA 2F54B 3DMMC 4JPIB 1J88A 4JZJA 3L3GB 2BXYA 3UPCA 3S36X 1MIMH 4PTUB 4GOSA 2EH7H 2R1WA 3SE9L 4JCLA 3B5HA 4L4TD 4UQ3B 4KKLC 2I07B 3X3GH 3HZYB 5EBWB 4XCFL 5EZOL 4NJAH 4APQC 2G60L 5KVEL 2DRUA 2GKIA 4K07A 4PRHE 4RCAA 4JKMA 5IFAL 3H9SA 1S9YA 4YFLF 3IKCA 5F71A 1UZ8A 1MFCH 1N6VA 2BY2A 3KXFD 2F58H 3MA9H 1YPZF 2NZ9C 1O5DT 2D03H 3AU1B 4ZUSB 3BKJL 3CCHB 4OM1H 1LO4H 3AB0C 5KSAD 1MCKA 1TVHB 4XGZA 3HNVL 1A7RH 1YUHB 3CK0H 2ZOLB 3C09B 3U7YH 1UM5L 1JNHB 2EEAA 4PP1D 1MFEH 1JNLH 4MNQA 4XAWH 2APXA 5IP4A 4U7MA 2E7BA 3FQRA 3QI9B 4POYA 2ARJA 3HC0B 4HWUA 4Z0XB 2QQKH 4I0PA 3KPRB 1JYNA 4JFPB 1U8LB 4JFYA 3CFCH 4NRZB 1DUYA 1B9ZA 5C9JA 3DO7B 1L0YA 3U0PB 4XNYL 1TJIH 1Q9KB 2Y5EA 1YNTB 1AD9A 3RZCD 1KIUA 4NO2A 1FYTD 3I75B 1FL5A 1S9XA 2QTEA 2ZSWA 3P4LA 3BP6B 3BZEB 1YECL 1OP5K 3ZO0A 3EJZC 3MRPB 5IF0B 3HI5L 1YEIL 2GCYA 4P23C 3FT4A 2M26A 1KCSL 2WINB 4G8GD 3LEXA 4ZODA 1V5JA 4YDJB 5C0CB 4PJFB 4PP2B 1T4KB 4UTAH 2YRZA 3SDAB 4V2BA 4Y0GA 1BGXL 5T1LA 4Z7VB 4XNMB 3JWOC 5DD5L 1KJ3L 2IMMA 2W38A 2IAMA 1OM3H 1KCVL 1IC4H 5ICXB 2NY5C 4CW1B 4NHCL 1WC7A 4LLVB 1IAKA 5SX4H 2D7TH 1PQZB 2F19L 2AABL 3O6FA 2FX7H 1KYOJ 3QIWD 2MCG1 3TPUE 2UY7A 1GC1L 1OSPH 1RMFL 1XCTA 2EO1A 4XRCB 1IGFL 2R9HD 1HI6A 1RZIB 3B9VA 2ITDA 2LU3A 3WO4B 3SQOL 1LDSA 3GGWB 3ISWA 4PRHD 5AZ2L 2R2EB 4DAGH 3O4LA 2C7UB 3LEVH 5GSVB 3VJ6A 3PWJA 1KXTB 1KNOA 4PJDA 5HVHB 5E9DE 1V7ML 2XNAB 2BSRA 4KJWD 3C60B 3HAEB 3IS0X 2DLTA 3AMLA 4EUPH 2VDKL 3BXNB 2JJSC 4PJ9D 1AGBA 5JIHA 3S34H 2C1PB 3BKCL 3EJYC 1A5FH 3JV4B 1AP2A 1MEXH 3RVXC 2X4TA 1R3JA 1FYHB 3D85A 3PP3K 4X7EC 4WNQB 5JZ7D 1FFOB 4TSAL 2Z4QB 1FZMA 1PYWB 3EFDL 4G43A 2F8XC 1A6WH 3BYTA 1I1AA 3PDOA 5ALBH 3DX6B 3ZMRA 2A2QT 2WP3O 1EXUA 1N8ZA 2YUWA 2XKUA 3P9LB 5F21B 2OK0H 4PRIE 5E08L 4MCYB 4ODVH 5DRZB 1E6JH 2OLDA 3KYKH 2UWEF 3N1QC 4J3WA 5I8OH 1WIUA 4I18A 3FRUA 1DEEB 4KJYA 3CPLA 4QY8B 5EUKB 5CEZH 3RKDD 5IEHA 5HI4C 4A6YL 3JTSA 4K71C 4X4MA 3HMXH 4N0YH 5JW4N 4O02H 5F7YC 3FQNB 3MRLA 5F96L 4I4WB 1G7HA 1A7NH 1ZVHA 3GBLA 3QG7L 1QR4A 5SWZB 4CVXB 4RGNC 2AV1B 4D0DA 5CHNA 3QXVA 4OKVB 1D9KD 4LGPB 4C55A 3U46B 1WCBA 3P4MA 1IC7H 1NC4D 3GSWB 1MPAL 1U3HC 5HDQL 1RK0B 3HUJE 3VW3L 4EDXA 1CVSC 4G80A 3AS3A 3O45B 4ODXB 3WFBH 3O9WA 4ONGH 3REWB 1RZ7L 2W59A 4G9DB 2QR0B 3WMSA 4NQXA 3WFDL 4TUJB 4QRPE 3QIUC 1K5NA 4ZDHB 3CZFB 4M5ZH 4UDTA 2EDEA 4HZLA 4WHYH 3VXME 2CLZA 1JZ5A 3LH2L 1QBLL 3TO2A 3BJLA 3QHZL 5K9JH 5CMAA 3V6FB 5CJBA 4G6JH 4KHXH 1A7OH 1ZS8A 4F57H 4LHUB 1Q9OA 4S1QL 4KJQC 3ARYA 4PLKD 1SMOA 2DQFA 4RA0C 5EUOB 2ZCHH 3PNWB 1A47A 2P1YA 4E42A 4E41E 1JRHI 3MO1B 1LO5A 2H9GB 4NQDE 5HGAB 4N9GA 1U3JA 4FTVE 3ZKNC 3G04A 3L3KB 4ONFL 1HHHB 1SJEB 1NDGB 1A9EA 1OF2A 2FHCA 1KENL 4PJCA 4QRUA 4KAQH 2OTUB 1RAMA 3U48A 1H0DB 3RJQB 1QFWL 5BZWA 4P5TB 5I1DA 5IG7A 5DJZA 5FDWA 3MLSH 3S3PA 3UBXB 4RQQB 3IXTA 2OMBA 4PRID 1XF2A 2QHRH 3QCVH 4JPWH 5C07B 4Y1AA 4LLAA 4NQVB 2ADFL 5D6CA 4AL8H 1GZQB 4JDTH 4M43L 4PUBL 3JTTB 5FYLH 3UTTB 3WIHA 1QSVA 2ORBH 2XWTA 1MCRA 2D9CA 3FAWA 3O8XA 4X6DA 5ENWB 2CK0H 4N68A 2FR4B 1MAJA 4JY6B 4U1HA 1UENA 5DK0B 3JVGC 4KPHH 5B4MC 2BSTA 5CLTA 5JLZB 2DDQH 5LKNA 1RUPL 1D3CA 4ONHA 1ZGLP 3G6DL 1I9EA 1JK8B 5E8DL 4TQEH 1S3KH 3T0DA 1BQUA 1L4IA 3L5IA 4X7SH 4KDWA 2DQDH 5KN5A 5I76B 3EOBB 3FB8B 2GT9B 1EJOL 4ZUTB 4P4KC 1BIIB 3VG9B 5CZVL 1KJVB 3K8LA 3RNQA 1R3IL 3LMJH 1XF3A 3L1OL 4H0GA 4LL9A 3MV7A 5F3HA 3RZCB 3WSQL 1EPFA 1P84J 5FUCC 5J8OA 3B9KA 2XKNA 1S7QB 4XCFH 3C8DA 3H9YA 4OGZA 1NLDL 3U36B 3O3EB 3V0VB 4MA7L 3VXMD 3RWEA 1IBGH 1AFVL 4HWEL 4LNRB 1NCTA 2X4NA 1BZ7A 4PIRF 3ARFB 5IB2B 1BQLL 4Z7WF 1HH9A 32C2B 4R6UA 3TV3L 3OJDB 3BJ91 1PLGH 4U0QB 2VZUA 4WW1B 3IFNL 3LZFH 1RZKC 2AJXH 1I1FB 3U4BL 4E41D 3OB0K 2BVOB 3VWKC 2Y5TA 4UUJB 1IQWH 4K55A 3MUZ1 3S36H 4FTVD 4UINL 4W4OC 1JHTB 5B8CB 3SE8H 3ARSA 1HHJB 1KACB 3GRWL 1FC1A 4ZSOA 3FFDB 5C0RL 4AEEA 1DQML 5DI8B 1QBAA 4Q0XL 5IJKA 1ZT4B 3CSYB 1QPXA 4V1DA 3DARA 3LKSB 3B2UD 3QUMH 5MEQA 2WW8A 1FFNB 2P24B 1U8MB 1MVFA 1BFOA 4PJAF 4QHMA 5FKPA 4OLZL 1JCKA 2ATKB 3BI9X 3KNBA 1YEIH 4NKOB 5GZND 5LG1A 3OKYA 3OR7B 1BD2D 5F7UA 1M7IA 1S5IH 4MZ3A 4OCMC 2OR7A 5B39G 1XGPA 3O41B 5IMKB 1JV5A 4CJ1A 2V5SA 3Q1SH 1CL7H 4JRXE 3GIZL 4FFZL 1I1RA 4LF3A 5GS2D 4KU1A 2JJTA 2R39A 1KXQE 1QEWB 2F5BH 3P11H 2H32A 2HFEB 1D5ZB 3MLVL 5T3ZH 5FOJA 5ABDE 3TN0A 4PJIF 4PGBB 1D6VL 2F19H 3QEQE 3QI9C 4CRPA 3OR6B 1HIMH 2PYED 2V5MA 4AEIH 3BRFA 1KT2A 4W68A 4YFLI 4WEBH 3SQOH 1X5KA 3PIQB 5LVEA 4XPFH 5GRUL 1T1ZA 3EYQC 3VE0B 1FGNL 5TE7H 3P9MB 3NZHL 4Q2ZB 4ELKB 1JWUA 4QOKA 2P8MA 3Q6GH 5C6TL 2BP3A 3ZYZA 4LLYA 1NEUA 3QRFM 4DW2L 1KJ2L 3CFEA 5F1IB 3T2OA 4IRSA 1J5OH 5JHLL 4PG2A 5EOTB 2CKBB 4JKPL 1MAML 4ZTPL 4NQCE 1W72L 4D9LH 2VISB 3HRZA 4HJ0D 2X05A 5EN2B 2IPUG 3SDAC 4X8JA 1E0OB 5JHDE 3EFDH 3ZE0F 5L2KA 4GJTB 4J4PC 3UJIL 4GH7B 4MD5B 1H5BA 1NBYB 3TPUB 3PHOA 1G6VK 4N0UB 1WAAF 3ARPA 3M45A 4LKXA 4XP5L 5HI5D 2R15A 3BVNB 3QWOB 2H2PD 3Q5YA 5E08H 1CFNB 1ZHBB 3SCMD 3ZDZE 5D6DA 3MLXL 1RUKH 3C5SA 5DUML 5BCAA 1IAIM 3LQZB 3MCLH 1I7RB 4R0LA 3H7LA 1X5LA 3BRDA 2XG5A 1JUFB 3SKOB 5IOPB 1MIEH 1F3JA 1CXHA 5F89B 4HC1L 4M1DH 5E9DB 3PQYA 3LN4A 1T0NA 5ESAA 2HFTA 1JN6A 1GHFH 1MVUB 3OPZL 4G6KL 4Y5XA 5IMLA 4X5WB 5DK2B 1A7QL 2PXYA 4JRXD 3QO0A 2I60L 3N1PC 3O2DA 2VZTA 5HDQH 5DRWA 3VW3H 5GHWL 1C5DA 1EGJL 4X98A 5D7LA 4L1DA 3CU7A 2UZXB 1MH5A 1JPFB 1ZA6B 3TJHD 5LJYH 3WD5L 2JE8A 5I8KL 1U8NB 4PRIB 4OB5L 4IDJL 3QHFH 5MENA 5IHZA 5GS0H 2ZOKA 4PTTB 3QEUB 3B6SB 3L3HB 1FBIL 3MNWB 4U7SA 2VUYA 4Y5VB 1AKJD 4OZIE 5IR1B 3MRQB 4EUPG 4EDWH 2EDFA 3QUZB 2VE6B 3V0WL 1CD8A 4LCWE 5CKGA 3ZDYF 4EXPX 1UKTA 1CXIA 2QQLL 4UI2A 5DTFB 2R0ZL 5E6YA 4HLZH 4ZAKA 1IRAY 5TFSL 1C5BH 5DGRA 2JCCB 1EEQA 3KR3H 1J1XL 1K3IA 2CO7B 3RA7L 1WWBX 1QFHA 2CSPA 2XV6B 4NSKA 4ONFH 1EEYA 4X4YA 1QNZL 5FYJH 5FFLA 3KYAA 1VACA 3TM6A 5JW4R 4FQLL 1RZJL 4GAYA 1OAZL 4M8QA 5T5FL 4QRPB 5D1QC 2GK2A 3ZHKA 2YC1B 1UCBL 5DMGC 4XX1G 1I7TA 4M48L 3O6ML 2QQNH 3VXMB 3W9DB 3UP1A 4UIKH 1N3NB 3VWJA 3HAEH 3KPMA 3MBXL 2Y6SC 5E94B 5ID1A 4YHIB 2G2RB 2PR4L 2IH3B 1JZ8A 5I1HL 2DLEA 3BX7C 2F53E 1A1MB 5C0JA 2VL5B 4HV8B 3WS3B 2QSTA 3EO0A 4HIEB 1JBJA 1IAOB 2VLRA 3NCBB 3GSNL 5FF6B 1G6RL 4P2QA 3ZT6A 4MJIA 1QACA 4NQDB 4U1LA 1MOEA 5GGVY 1ES0B 5EIIB 4DN4L 2C3GA 3VFGL 3NA4A 4IRJA 4JRYA 5F44A 1MCEA 2JB6B 1A6AA 4CU8A 3IDIB 5DA4A 2FL5B 4KI1A 1T1XA 4JFOB 4WHYG 2FIKA 5E2TL 1R3HA 5TDPB 4XP4H 5E8OB 1FVDA 1AQKL 5EZIL 4U1KB 1DFBH 1T2QH 3QQNA 3UJTL 4U7KA 2OJZH 3W81A 5KOVC 5BS0B 1KXVC 1NLDH 4YDLB 5EBMA 2WY3A 3FHAA 1ZLSL 3MV8E 4RAUA 2J8UE 3BH9A 2Q8AL 3FAXA 1DSFL 1S5HA 5E24E 4HWBH 1HQRA 1F3RB 2BNRE 5FCUH 4JY5H 4HKBA 4LCWD 2MQ0A 5TQ2L 1S7RB 4OLXH 4F7TB 4OZ4A 1SM3H 2DQGL 2A6KB 4ZG1A 5KVDL 3DBXB 1IILE 3HC3L 2XICA 5INCB 2FNBA 1UWGH 5CINL 4YXHL 3QUXA 4U2YA 3QIBA 1OD7A 2MKWA 3SKMA 3E3QE 5I75B 3SDYL 3IT8D 3LEYH 3HLAA 1J86A 4ELMB 4CNIB 4L8CB 4P4RB 4MA8H 3HE6C 1JGDB 1FORL 3VXUA 2V2XB 5CJ8A 2CH8A 3IJYB 2BK8A 3BZ4B 3OAUH 3NFPA 4XP6H 1ORSA 4WI4A 4HKZA 1HHKB 2VWEC 5FHBL 3WNKA 1R3LB 3R4DA 3PL6A 5GJSH 1BZ9B 4H8WC 3STLA 4JB9L 2QEJA 1GL4B 4WO4D 1NL0H 3IDMB 2XQBH 2F8VA 3ARBB 3VFMA 3SPVA 3SY0A 4C4KO 5HGHA 2F53D 2DF3A 4GSDH 1S78D 4GRMB 5TDOA 4I77L 4NZDA 2VIRB 3ARFC 2EYTB 2VZ1A 1W0WA 3IRPX 1RFDL 4YZFF 5DEZA 3SDXE 3P73A 1ZT7B 4L4VA 3GI8H 5L8KB 2J4WL 1A6ZA 4O00A 1G7QB 5JOEA 5DJ8B 4JFHE 3DETC 2PO6C 3QYCA 5C0AD 3QNXB 4WEMB 4Q74A 2P44B 1T0MA 4FNLH 4KWUA 2OQJB 1LEKB 1NQBA 2KQMA 3MRIB 1CGTA 3OMZA 4WFHE 4JQVA 1LD9B 2GITA 3VI3F 2E7HA 1FE8H 4JGMA 2UZIL 3KLAB 4QF1B 1AGFB 3RWDB 4N90D 2IPTH 3BT2H 3TFKD 4I3GA 2J8HA 2V9QA 2VDOL 2NY0B 3MV8D 3B8SA 3ULUC 4ZTOH 4EEEA 3WFEL 2FX8L 1FRGH 3MRNA 1U8KB 2BNRD 3TYGH 4QTHB 5I1LA 4RZCA 2GYSA 4CDHA 5B3NA 4JRXB 1UXWB 4KZEH 2DQCL 2X2YA 4XXDB 4FZ8H 4AIZA 4Y5YC 5J1TC 1FN4B 4OI8A 3QDJE 2H2SD 4YHYB 4JG0H 3SGKC 5CJXA 1IGJB 3D0LA 5CKAA 2ZCKL 5FECB 5D2NC 3ZKQD 4KTEL 3F7YA 4R97B 4HPOL 2HH0H 3QEQB 4LGRB 3BOVA 2VJXA 5DRXB 1T04A 2DJSA 1T3FB 3D2UA 4KY1L 5I8EB 4FFWC 1P7KB 4XP1L 1OCWL 3OKMB 4LSSH 4F7EB 5C09E 3Q2CA 4P9HH 2HKHL 3LY6A 5LBSH 3C6LC 3QSKB 1AKJB 4RX4D 4WDIA 1ADQL 3RVUD 3ARDC 3RPIB 2BDNL 4S1SL 3RTQD 1HKLL 3G6JF 5TH2B 4AM0B 3D18A 2YS4A 5AYQA 2E5EA 4NBZB 2HJLB 3FZUC 4Z7UE 1SJXA 3VFPB 1Q1JL 3P4NB 4RMSA 1U92B 3VH8G 1E4KC 4LCIH 2J8OA 1ZVSA 5DD0L 2GJ6D 2Q6WB 4NQCB 1QA9A 2BVEA 4WTWA 5IIEA 3G5ZB 4HJJL 2C9AA 4U49A 2Q8BL 2X44D 2NX5A 5D9SA 5JHDB 2R2HA 1ACZA 1P1ZB 4JFZH 1YEHH 5GHWH 2HVKB 3RL1A 4BFIB 2BMKA 1MCJA 1PDKA 1ZSDA 4MSWA 1J1PL 5JO5B 4DZBA 1ONQA 1MFAL 1L0QA 1U8QA 1QKZL 1XF5B 3KPNA 1J0IA 3UZQA 2LU7A 4P2RE 1KEMH 1UB5A 1AE6H 3KPSB 4ZUVA 5C2BH 2XN9E 1N6QL 1XGRB 1YZZA 2ZNXA 4WUUB 4YDKH 4O2EA 5IVOA 3DVFA 5T1MB 2X4PA 2NTFB 3RI5K 3HN3A 4X4XA 4XXCA 3S4SB 1WBXA 3TIDA 5FYKL 1HEZB 5H94B 4DGIL 2FATL 4RFNB 3CVHL 2GJZA 1DE4B 2BNQB 2JJSA 3EO1A 3WKMH 1F02I 3I6LE 1NMAL 3NPSC 5DMKB 1BWMA 3JV6B 3RA7H 3ULUF 1FH5H 4MDJB 4ZS7L 3HPJB 1AQDA 2O5ZL 3RUGB 2FJHA 5LGHL 1K4DB 1FZKB 2AKRA 4NP4L 2BJML 1VENA 2HLAA 3VFRA 4LRIA 5C7XL 5KZCD 3QHTC 4X6CA 4KGLA 3F58H 4IEFB 1NGZA 4H20H 1WBYB 3GB7B 1UCBH 5GISL 2V2TA 2X09A 5IBTL 1KPRB 5FOBA 1YNLH 5J6GB 3I84A 3SBWC 4M48H 2XWBA 2Z8RA 3GJFK 2YA0A 2DLFH 1NSNH 2NCMA 4NUJB 5C09D 3OGOE 1IAII 4PBVC 4EQ3A 4TOYH 4GMTL 1ND0A 5DFTA 1EV2E 4YEFA 4NNYA 2LQRA 4FQCL 4F7CB 5ISZE 2YXMA 4LCWB 2AQ3A 5MI0B 3T08A 3WFCL 2VITA 4HIJB 1KEGL 2GW5A 4Y5VC 1T7XA 3QFDB 5IGXL 1PZ5A 2AEQL 2X1QA 1DVFA 3QUZC 1MRCH 1QFOA 1ETZA 5I9QB 5I1JL 1OTUC 2ZKHL 1T03H 1NGWB 3OKDA 1WIOA 1TDQA 4GW1B 4KVCH 5GGSY 5E5MB 3BPNC 3MRGA 4U1IB 2APBA 2HVJB 4NC1E 4YK4C 3GFUA 3C2AH 2AQ1A 1NCNA 5DGQA 2DQIH 1I9RH 3O11B 3W2DL 2Y72A 3MXVH 1S7WB 5ILTH 4R90H 3QIUA 2DI9A 1S7XB 2GY7B 5DUPL 1CR9H 5E1HB 4IIQB 2JF1A 5KANG 4P2RD 1WWCA 1DANT 2N1KA 2DWEB 1FLRL 1HCVA 1S7TA 2B39A 1IGYB 4LAJH 4R2GB 4UV7L 4HLZG 5GGUA 5IB4A 1ZLSH 4GT7A 1J05A 4MS8C 4OD3H 5DJ2B 5E8PB 2OS7A 3QJFB 4KVNH 3GSRB 4X80H 5IQ7H 2KBGA 3LS4H 4KK8D 4DQOL 4PJ8C 2L7JA 1T5XA 2VXUL 3OKEA 3QDME 4HLJA 1BLNA 3IFPB 4MNHB 3OL2A 1Z3GH 2E7LC 3HC3H 1KELL 1AJ7H 5EFIB 4DKAA 2AXFA 2DYPA 4UAOC 4C83B 3I6LD 5ICZB 5HHPA 2AXHA 3TA3B 3HZKA 5DLML 5L2JB 4F7PA 1X5GA 1INEL 3MRCB 5EA0H 5KSUB 2DAVA 4HCRL 2AJSL 4PJAA 3HAEG 4XNXH 1PG7X 1Q9WB 3NGBC 4HS6A 3V5KA 4YHZL 3TC9A 2AJZA 3EW3B 4N0CC 3PHQA 4WWKC 1ZEAL 4AZ8A 1MHPL 3ARWA 4OFYD 2NY3D 1JRHL 4MCZA 2A74B 1CXFA 1EHAA 4GO6B 2AGJL 1MELA 3ILPA 5D5ME 4ZYKA 4Y19A 4X99A 3SKJL 1YJDH 2J8UB 3MBED 1JFQL 2FZ3A 4X9BA 5DRNB 2VNCA 2GTZB 3IFOA 3NPZB 1N64L 1NDMA 3L9RA 3QCUL 2BNRB 3GSXB 3IYLW 5ISZD 5GGVL 3FQWA 5IBLD 1OWWA 1NLBH 3JVGA 4QCIA 5I19L 4M93C 3RWHA 2PETA 3WJJA 3TBTA 2VDMH 4UT9H 4GBXC 1CICD 3VMOA 3MRRA 2VLKE 5CZXD 1EHLH 3P4OB 2R0LL 3NCEB 3WXWL 2HAZA 3VI4F 3T4AB 5FM5O 5DJ0B 1RD6A 2NY6B 2J6EL 4P4KA 4YC2C 4I1NB 3PGFH 2VAAA 3QG6A 1YQVL 5KVFL 1AGDB 3CFJA 5GGRY 2QL1A 4DEPB 3OKKA 4G42B 2UUDH 4XPHH 2WWMC 2YPKA 4OLVL 2NLJB 1AIFA 4TNWF 4CU7A 3CXDL 1JF1A 2OR9H 5DDHB 2PW1B 3BAEH 3SE4C 3KYOA 4X5LA 1DBML 2QSVA 3BUYB 3FO9A 2B2XL 2IADB 3D69B 3RZWA 4JGJA 4X0KA 4HFWA 5HHVL 5BVPH 1BQHB 3RP1A 1OL0A 4B7LA 5I74B 3L5XH 3CD4A 2OZ4A 2AK4A 2I5YL 2RCSH 1MCHA 3OKOB 4RFOH 4AEHH 4JM2D 4NBXB 3O3DB 2AEIT 4P2CG 3SDXB 3VWKA 3WFHA 2AV7B 4W4OA 4RMTA 3VXRA 1FVEB 5DO2C 3OKLB 2B4CL 2HMIC 5EC1A 5LXGH 3T65B 1LO3L 1ZLUH 3TBVA 2BC4B 1VGEH 2F54A 4JPIA 4JLRB 4MNQE 3VD7A 4Z95H 3L3GA 2E8YA 5JW4M 5TGBA 3OQ3B 1EVUA 4OZFH 5C0ND 1PFCA 2HP4A 2XTLA 3RVTC 2I07A 3HKFA 3TVMB 1FL6B 2WP3T 3HZYA 1A6UL 4WY7H 4U4BA 5EBWA 3MSPA 4HXBL 5GS2H 2OP4L 1KB5L 3UCRA 1TJGL 1LP9F 3CDGB 4EOWL 3DX8B 3VFSA 3HE7D 2BFVH 1VFOA 5TF0A 3TGXA 2QHLA 1D5IL 3MOBL 2A0LD 4Z7QF 4LSQL 2P5EE 2VN7A 5JUEH 1MQKL 1FDLL 1FPTH 4NWUH 4JEGB 4JKWA 3KAAA 3AU1A 3CCHA 5ALCL 4JDVB 1RIHL 3Q48A 5I71C 2DMBA 4HJJH 1TVHA 5J7CC 3QDJB 1YUHA 2ZOLA 2RBLA 5I1AB 4OUOA 1L9MA 1JNHA 5TE6H 2A9NL 2CD0A 3SDCB 4PJBE 5HYQB 2R56H 2RQ8A 3QI9A 4ZXBC 3HC0A 3FFCD 1K2DB 2MKLC 4Z0XA 3NIDE 2ZUQB 3DSFL 3AS0A 4JFPA 3PGCB 3GMNA 1U8LA 1I8KB 2OL3B 4NRZA 2L7UA 4R97C 3WNPA 3C9NB 3DO7A 4ZS6C 5ACLA 3U0PA 43C9B 1HNGA 1U58B 4IHOB 4JRWA 1T89A 5DFVD 4PLOB 2Z8WC 1YDPB 4K94H 4QNPF 3LS5L 1X3DA 3I75A 4NM8H 4DFHA 4PS4H 3BP6A 2IANB 3INUH 1A22B 3VFWB 3MRPA 1R5WB 3S6CA 4OCXL 5IF0A 2DLGA 1DN0B 3H9SD 1MHEB 3O4LE 4MB5A 5C08B 5L88L 3QZWB 3MROB 4YDJA 5C0CA 4AG4L 4PJFA 4PJDE 4PP2A 1T4KA 3X17A 5CWSB 3SDAA 1HKFA 2DB8A 7FABL 1T20B 1ZHKA 4Z7VA 4XNMA 5LGHH 1F13A 3S37L 3CXHJ 1RHFA 1GIGL 5E2WH 4JR9H 3CX5J 5ITFB 2VDNH 5ICXA 2GTWB 4CW1A 1X5AA 3D3VE 4LLVA 5FUZL 3GSOA 4MNQD 1E4WL 3CFIC 1AR1D 1PQZA 2XN9B 3ARZA 3DUUB 4LFHD 2BSED 4YHPB 1I7UB 1CE6B 3LDBC 4FQXC 1X5ZA 5EU3A 3LKRB 5FA4B 4I0PD 4XRCA 4MJ6A 3CFBB 1QVOB 3F7RA 5CFHA 3ZKXB 1RZIA 3QWQB 5IB1B 4LCCC 2A6IB 5A2IH 5CP3H 1NCUA 1NFKA 1J12A 1KV3A 1WIPA 4QGYA 1KEGH 1FAIL 2COQA 5E03A 1XIWB 3LVEA 5GSVA 1NAKL 2J88H 1TNMA 2G5RA 1KN4L 2XNAA 3CLFH 4QHNB 5CD3B 3C60A 2N56A 5ANME 1ZLWK 2EDRA 3BKYH 4AMKL 5A2JH 2C1PA 4Y4HB 1JF6A 3JV4A 2DM4A 1CF8H 4WNQA 4U1GB 1QQDA 5T1LD 1FFOA 4YE4H 4JGUA 4PGEB 5EBGA 2Z4QA 1PYWA 3VFTB 3GHEL 3IDNB 1PKQE 2IAMD 2EO9A 3HG1A 4POZC 3DX6A 4JAMB 3S9DB 4NKIH 5IT2L 4HK0B 1I9IH 3P9LA 5CJQH 5EOCH 5I1EH 2YUZA 4JO2L 4UV7H 4MCYA 1N0XH 5DRZA 3O6FD 4HQQH 3T2PA 3I2CL 4RGMC 4F2MB 1FSKC 3D25B 3OX8B 1DEEA 4QY8A 1UWXH 5DHYA 5E5RB 4HPYL 5BQ7B 1OAQH 3AY4A 2GSGB 1H3PH 2ENSA 4JO1L 3FQNA 5AWNL 1KELH 2QSQA 4I4WA 1IGMH 3O4LD 3OTTA 3ZTJH 1NAMH 5SWZA 4CVXA 2AV1A 4I5BB 2ARJQ 3MRFB 1M1SA 4RMQA 5I1IH 3FOMA 4OKVA 2AI0H 1JTOA 1KJ2B 1SYVB 1SEQH 2EDJA 2XA3A 3GSWA 3RQ3A 4F3FB 1RK0A 3ZLQC 5FAAA 1VFAA 4YHZH 5FGSA 2R4SL 3E2HB 2BOBB 3J8F7 1RJZB 2VB5A 4ODXA 3JUYA 4LLUB 5ESQB 3D85D 4K23H 4G9DA 2QR0A 2VAJA 2H45A 4PJCE 4YWGH 4EIZC 2AGJH 3HI1B 2HRPL 4LVOC 4TUJA 4EN3B 1EMTL 3L3JB 4WJ5B 1HCFX 1I1AD 5CILL 4ZDHA 4AIOA 3GI9H 3H0TB 5IFJB 3CZFA 4IIQC 4M7KL 1MY7A 2ZWLT 3IXAB 2N4IA 1IGTB 5IB5B 4BUHA 4O2CB 5GZOD 3V6FA 2M8XA 4Y1AE 3QDMB 1WUNT 1BM3H 1BF2A 4LHUA 1DZBA 2YD3A 3GJFH 4MXWL 4P57A 2MPAH 1II4E 4KI5C 1GC1C 1ORQB 2YPLA 4NFDA 4OZHE 2FGZA 3WXVL 2R0LH 5EZJB 4X6DE 5EUOA 3VDCA 3PNWA 3MO1A 2H9GA 1PG7H 4CADB 5HGAA 4R4NC 1IJ9A 4ODSL 2DKSA 2V17L 3L3KA 4U6XB 3EFFB 1HHHA 5D1ZB 4ZOEA 2MFNA 1IT9H 1F90H 3TA3C 1NDGA 4ZPVB 5E99L 4ZNEA 2OTUA 4NO3B 3RDTC 1H0DA 5D5MB 3DI3B 5C0EB 3WUWG 1CFQB 4LEOB 4O9HH 3L3OB 4P5TA 4X7TB 3O9WD 4KK5C 5CP7B 4GKSB 2FWOB 4RRPG 3K8KA 3UBXA 3UPRB 1ZHNB 3FN3A 2B2XH 5D8JH 3NMEA 5C07A 5IWLC 3HI6H 4NQVA 5L6YL 1LK3L 1V3MA 5FV1L 1FG9C 1GZQA 1Q72L 1ZOXA 3UTTA 1G0DA 3JTTA 1VPOL 4WTZG 4DKDC 5CSBA 3TIEB 2I26N 2VLKB 1ACYH 5ENWA 2FR4A 5DK0A 2R8SL 3GMRA 1SY6H 4U6VL 5JLZA 1DL7H 1CFTB 3MLTB 1Y18B 5IW6B 4DK3A 1JK8A 4N8VA 1QR1B 1F5WA 3G6JA 3A6CH 4O5LL 2P5WE 3UPAA 1QLEL 2BXZA 1ZLVK 5I76A 3EOBA 3FB8A 4KKCD 4M6NL 2GT9A 1U42A 5CEYB 2NY6C 1BIIA 1KJVA 4JZJB 5FGBC 2AJYL 3OJVC 3S97C 4D0BB 2FEDD 2ICWI 2A73B 2ADJB 3BPLB 4OCWL 4LSRL 4MXVF 5C3LD 1S7QA 1FFRA 4Z6AT 1O7VA 3BD4A 4UNVA 4YHOH 1AI1H 3U36A 3O3EA 3V0VA 1R24B 1QFUH 3N1FC 3JV5A 4V1DE 2IQ9H 4NKDB 3LSOA 4LNRA 1C1EH 3KS0J 3ARFA 5IB2A 1NUDA 4I3RH 3UTPD 1UZ8B 2FO4B 32C2A 3RX8A 3VFVB 4WWID 3AVEA 3OJDA 4XCCL 4XHJC 1RU9H 4P2YA 4WW1A 3NACH 3O8XD 4TULL 3OV6A 1I1FA 4GS7C 3E6FB 2VDLL 3F62A 2P8PB 2BVOA 4UUJA 3GSNB 2VXSL 1YEEH 2FLRT 3SJVB 3BO8B 2YUVA 3QNZB 1JHTA 4QWWD 4QLRA 1J0YA 3FQRB 4KI5F 4KV5F 3DSFH 1HHJA 3MREB 1CI5A 4NDMB 2WBKA 4U6YB 4JHAL 3S35L 3FFDA 5IEKB 3TJEH 3T0AA 5C9JB 4FQ2H 1ZT4A 1I1YB 3CSYA 4HS3B 2CRZA 2P49B 5ESVB 5I30L 3K3QA 3LKSA 5GGTL 4U3HA 3MV7D 2P5EB 1AD9B 4GRWE 1IM9B 2DMCA 1L7TL 3IRZA 3B9KD 1JGVL 1FFNA 4PBWD 2P24A 1U8MA 4FXGB 2EXYC 1WZ1L 3T0BA 2ATKA 4NKOA 3LN9A 2R29L 2FIRT 4YGVB 3TH4T 1TLKA 1X4ZA 4PGJA 5JA9A 2ED8A 3O41A 4PJ7F 4Y5YA 5IMKA 3T3MF 4JN1L 4XZUB 1XGQB 1RULH 4BH8B 2GFBB 4OZFG 3LRHA 5C0FB 5FM8A 5D2NA 1IC5L 4FP8L 4PJBB 4O4YH 2WUCL 2HFEA 1UM6H 5A1AA 2LABA 4JFXB 2DTML 5F7EL 4PGBA 3VGFA 1DN2A 3OAYH 3OR6A 2HG5B 2MJWA 5HD8C 5L7XL 3T09A 3HFML 1M4KA 4YPJA 5F7MC 5JOPE 5SWSA 4FMFA 4M62H 3PIQA 4G9FE 1LEGB 3O6LH 4MAUL 5J89A 3W5MA 3P9MA 1CXEA 3DYPA 4Q2ZA 2E9BA 4V1DD 4ELKA 4AQOA 5ICYB 1EUTA 2A9MH 3AS2A 2XWJB 3VD4A 3UTQB 1HHIB 3QFJE 3O4LB 1WBZB 5F1IA 3PQYE 5EOTA 1X6LA 5SX4I 2CKBA 1X5XA 1IEBB 5C8JA 3FONA 4LVHC 3GSQB 2MCPL 3ECBA 1W0VB 3GK8L 4PB9H 5EN2A 3D3VB 5FGRA 4F37K 3EKCA 1B3JA 3E6HB 3EYSL 2Y1VA 4NNPL 2C1OB 1UKQA 1JGEB 2QV2A 1NBYA 2NXYB 3PJSB 3TPUA 4N0UA 5D7LE 3BVNA 4P0DA 4TVPD 2Y25A 4KRPD 2JJUA 5F9OL 3QWOA 3ROLB 4X6FB 1V05A 4N8CL 4X6EB 4XWGL 3TN0D 5HVWA 1CFNA 1ZHBA 4PJEF 1O7SA 2VDPH 1UKSA 5MENE 3UAJC 4MB4A 1I7RA 3HPLB 1JUFA 4OCSH 2R0WH 3SKOA 2GSIB 2Z35B 3CPLB 1V3KA 1TXKA 5GRJL 5F89A 5E9DA 1J1OL 5EWIL 2DQEL 1NEZB 3L5WB 3OF6A 5I18L 2EDNA 1KCKA 5ANMB 2FH8A 4QOKD 1MVUA 4Z0BH 1R0AL 2NYYD 1G7HB 2OL3H 4X5WA 25C8L 1NCCH 3SKNB 2EDHA 4D0DB 1FFQA 4IRSD 5CHNB 2HTLD 1TFHA 3OHXB 1U8PB 3MYJA 1UACH 1JYWA 1KULA 4OD1H 2Y4SA 5DD3H 1PKQB 5HYSG 1S9KC 3SBWA 2VRAA 4PV8B 1JPFA 1ZA6A 3RGVB 2VLME 4KXZH 1U8NA 4XI5D 2HRPH 5L2KD 2IFFL 5CILH 4XVUC 4PJHF 4Q6YA 2EC9T 5D7IF 1JMZA 3K74B 4PTTA 3QEUA 3CMGA 3B6SA 4X83A 4CL7A 1RZKL 4HZLB 3L3HA 3MNWA 5GS1B 2BRRL 3RAJL 4Y5VA 4PFEA 1OP3H 5IR1A 4ISVB 3QUZA 3VGAB 5HGBA 4C4KT 4DKFH 4AT6B 2XZCH 2O5XH 3H7BB 4FQIL 1BIHA 5DTFA 2WZPD 5KSAC 2MQCA 1IAIL 4G7YH 4KQ4L 2C5DC 2JCCA 3PQYD 1JTPA 2PNDA 2HN7B 4PP1C 4R7NB 1GGBH 3RFZC 4ODSH 4LSPL 3G04B 4IJ3B 2PXYD 4NOBA 1XGTB 4TSBL 1GH7A 1NANH 4JRYE 3V5HB 2HFGH 5E99H 4Y2DB 4MVBD 4RWHA 5D2LF 1GZPB 1A9EB 3M8OH 3WDHA 4G6AC 3L6FB 2W60B 1S8DB 3W0WE 4QRPA 5KOMC 2YC1A 5JDSB 4M6OH 2Z8SA 3T3PE 1A1OA 3E2HC 4WRLA 5D7LD 1YPZE 4MS8A 4DVRL 5A3ID 1YEKL 5D72H 5DJZB 5DQDL 1YYMH 3W9DA 1T21B 3EHBC 1G9NH 3V9FA 1L9NA 2D31B 5E94A 5L6YH 1LK3H 4YHIA 2G2RA 3ZTJG 5MEND 4Y1AB 2IH3A 4M5YL 3RU8L 2LVCA 4GG6F 2W07A 1A1MA 1VPOH 2VL5A 4MYWB 4HV8A 3WS3A 2A83A 4ODBD 4HIEA 5DSCA 1IAOA 1L8JA 3IDYC 1MFDH 2E7LA 4OZHB 5FO9A 1HWHB 5FF6A 4X6DB 2R8SH 1T5WA 2DQJL 3S4SG 4NQDA 1DEDA 3V8OA 3I6KB 5EIIA 5IUSA 1A7BA 2QLVB 3VD3A 2O61B 4KUCF 2P8LA 4ZAKD 5GRZA 3TNMB 4D9QD 3CVHB 4N0CA 1I8MB 2JB6A 1A0QL 3IDIA 4N1HB 4M6NH 2FL5A 4P3CL 4JFOA 2VDQH 2NY1B 2YMXH 4PDCE 2CJUH 3SGDH 3BZFB 4KMTL 3FO0L 1XMWA 5TDPA 5IHUL 5D1ZC 5E8OA 5CBAB 1XF3B 3LPGA 1CXKA 3U30B 4U1KA 1JZ3A 5M7QA 4HW6A 1R5VB 4JDZB 2R9HC 5DK3A 5H8DA 4Q97A 2C4FT 5BS0A 4HT1L 2O93L 3KGRA 3QULB 4YO0A 5ACZB 5HYJE 1Y6MR 5I1GL 5EZLB 2DKMA 3RWEB 1NMBL 3VWJD 3QUYB 4WU5B 1JI1A 4OT1H 4GBXA 4J7RA 1AC0A 5E8NA 3V4UH 3MLUH 4NGHH 3BW9B 4XVTH 1HH9B 1S7RA 4K3JH 1DP0A 4F7TA 4YHMH 2A6KA 1IZJA 2VLRD 3DBXA 4UV4H 1O0VA 4PJ9C 2XRAL 5INCA 4FHBD 5E6IB 4P2QD 2P5WB 4JFFE 4MJID 1VFUA 5FYJU 5D93C 5CGMA 5JZ7C 2FX9H 1S9WB 6FABH 1INQB 4ELMA 4CNIA 3IF1B 3NFSH 2VKXA 5EORH 4MMXC 4IRJD 4JRYD 1P4LB 4U0RB 2R69H 2V2XA 3IJYA 2QADD 5BV7B 1FNGB 3BZ4A 3AMKA 4H26A 1HHKA 1MCSA 2XZQH 4XPBL 1R3LA 1QPPA 5GGTH 2XTJB 1BZ9A 4YPGB 3DXAB 1OTSC 4V1DB 5F1NB 3QBTB 4Z7OF 4AK1A 5MP6H 1J0HA 2VXTL 4NFCA 1F4WH 3IDMA 1A8JH 3ARBA 5DHVH 1P7QD 1RZJC 1CD9B 4X9HA 4DJMA 4Q6IB 2VIRA 1IL1B 2EYTA 1XGPB 3KPLB 4EI5B 4YIQB 1JV5B 1ITCA 3DHMA 2OTWB 3BP7B 1ZT7A 1D9KC 3U1SL 4CU6A 1JPTL 3UZEA 1G7QA 2UWEE 5JIPA 2PW2B 5DJ8A 4MD0B 3QUXD 3QIBD 5ITBL 3QNXA 3QXDB 5E0QA 4C54A 1GVIA 1KIRB 2OQJA 1LEKA 3MRIA 1LD9A 3VXUD 3GNML 3CVIL 5KW9L 1NC2B 3GBMH 3LCYA 4P46B 4P2OB 4BQCA 3KLAA 4QF1A 4GRWB 4OFVA 1AGFA 4R4FL 3KPPB 4YDIL 3KLSA 4XMLL 3FQTB 4M4RA 1CL7I 4NKMB 1A4KB 3MJ9H 1HWGB 4RBPH 5JMOC 3PL6D 2X4OB 4JREB 4BQ9A 5FUOH 2IBZX 4QHKI 2VDRH 5E2UL 1U8KA 5AZEH 4QTHA 3F65A 1NMCB 3VDBA 4KKAD 2WBJC 5TPWH 1UXWA 5HHXL 4XXDA 3HRPA 5ADPL 2NY4D 1F4YL 3K7UA 4YQXH 2BSSA 1FN4A 4JZOB 5B38G 4OGXL 1Q0YH 1VGKB 2DQUL 3U83A 1IGJA 4HMCA 3ZZ1A 4NZTH 3HMWH 4L4VD 2DM3A 3QEQA 1I8LC 5DRXA 1EHNA 1T3FA 3RVVC 3P0VL 1P7KA 1KBGL 3QAZB 3OKMA 4F7EA 4W6WB 1LILA 1EEUA 4L9LB 4G9FB 3BSZH 4GRLB 2QQQA 3SQBA 1MWAL 1CE1H 1EERB 2E27H 4L8SB 3RWIB 3A6OA 5TH2A 4AM0A 4QEGA 4XC1L 3VGHA 1LDPH 5T3XD 4NN5C 5GRJH 2FBJH 3QFJB 1F3JB 4KUZL 2HJLA 3IU4L 3QRGL 5EWIH 3VFPA 4ZFGL 5T33H 3P4NA 1NH6A 3PQYB 1U92A 5DUBB 1CD1B 2NZ9D 5JMRA 3B5TA 4Q9RH 1R0AH 2V2WA 4W6XB 2SEBB 1RJCA 2Q6WA 3O81A 4NQCA 3RY5A 2JELH 3G5ZA 1LO2L 4ZFOL 3GMPB 1F8TH 2PXYB 3V4VL 3QO0B 5JW3L 4WW2B 2WIIA 5JHDA 3K1KC 2F5AH 1P1ZA 1ZGLB 1WF5A 2HVKA 4L3AA 3T0EB 1NUGA 4BFIA 1YEFH 2HWZH 5JO5A 4FQXA 1YNKL 1FC2D 2DS4A 1B0RB 4LIQE 3ILQD 1QP1A 2IFFH 4U1SB 4X6CE 1I3GH 3N85L 2KL6A 3KPSA 4EXKA 2DQTL 4EVNB 2NR6C 2LAAA 1XGRA 2NXYC 4WUUA 3D2UD 5IHZB 5I0DA 4LSUL 1UT9A 3O3UN 4DKEL 5T1MA 4NKQB 1KTDB 2HT3D 3FHQA 2BRRH 1IFHH 5I15L 1E27B 4Y4FB 4S2SB 4UILH 2EDYA 4YUEH 3UDWC 1JNNH 1E28B 1HEZA 4RMWA 5H94A 3NBNA 1DE4A 4TVPL 4U31A 2BNQA 2IEPA 1P4IH 1JHKL 4ODHH 4RGNE 3EYFB 1HOCB 3EO9L 1PY4A 5DMKA 4M1GL 3JV6A 4K3DH 5J06A 3U2SB 4LAQH 3S88L 4MDJA 3HPJA 3RUGA 3T2NH 4LU5L 3H9HB 4X4YB 4C56E 1FZKA 2BY0A 3PUCA 2X9YA 2NX5D 4S11A 1UQSB 5KTEL 3CC5B 2YPVL 4OTXH 3BE1L 1WBYA 3GB7A 4B53A 1KPRA 5J6GA 5KANI 4ZD3L 5IVXB 1FNSL 4NUJA 3Q5TA 1WWAX 1BFVH 3B2UC 3EOYG 3IS1X 5T1DL 2CIKA 4PR5B 2Z93A 3LRSA 1A3QA 2ADGB 4HXAH 4I0CC 5GZNC 2HRLA 1G9ML 4DGYH 5I73C 4HIJA 2FEEI 5DEGB 2ADIB 5LCVL 3K2UL 3QFDA 4GAGH 4GAJH 4RDQG 4L8BA 4WVRA 3LKOB 4U05A 4ODTH 3ZL4L 1RIUL 4G7VL 4GG8B 1NGWA 4GW1A 5D1XC 1AHWC 5E5MA 5E70A 3RWGB 4U1IA 2HVJA 2ESVB 2VXQL 5JNYA 1TPXB 3EJYD 4TSCH 1CCZA 4PGCA 4XVJL 4N0FB 2G5BB 1CFVL 4CBPA 3ULVL 4NZRL 3SDDB 3NCCB 1B90A 3KLHC 1S7WA 3W0WB 3FO0H 4PJAE 1FNHA 1SY6A 4XMPL 1S7XA 1YPZB 5F6HJ 2DLIA 2YR3A 4IIQA 4G59A 5F7DB 4F33B 1F4XL 1HHGB 2GAZB 2O5YL 4EI6B 2DWEA 1IGYA 4BZYA 5J13B 4BELD 2OCFD 1PX4A 4DVBB 4FFEX 5IBUB 1T1WB 4BH7B 3HUJF 3DVNB 4HWZA 5DURB 5EBMB 4Y19E 1RUQL 4WHTB 5DJ2A 5E8PA 5I1GH 1T22B 2YK1H 3QJFA 1G1YA 1ZKAA 2DQHH 3NCJL 3GSRA 1CZ8H 3R8QA 1I3VA 2DD8L 5FB8B 4OQTL 4OCRL 1TNNA 4OIIH 3ERYA 4HKBB 4MNHA 4NJ9L 1YY8B 4OZ4B 2HTKC 2Y9RT 1IGCL 3WE6B 5EFIA 1KC5L 1NGPH 1OAXH 4RWYH 1PSKL 2FJFB 5CSZA 4BZ2L 4HJ0C 1DVFD 2BOCB 4XP9L 2WLZA 4C83A 5ICZA 1XR8B 3O6KL 3TA3A 1T6WA 5L2JA 4C58B 5J11C 3MRCA 4R8WH 5KS9F 3TT1L 4OFPA 3GHBL 3HLAB 1J8HE 3RVWC 4M1CD 4AENB 4JG1L 1Q9WA 3BGFC 4GW4B 5HI5C 4KQ3H 2NTSP 1BQSA 4K7PX 2H2PC 1MRFH 2A74A 1AO7B 3NFPB 3QIUD 2XQYG 3J7HA 3PV7A 4HHAB 5HYJB 2J8UA 4WHDA 5DRNA 3U30C 2GTZA 1NKOA 4WCYH 5K59E 1FG2B 3K4DA 4D8PB 3GSXA 1MCIA 3SY0B 4BSVB 4OJFH 5HGHB 2V7NB 1MSPA 2XXMB 2XI9A 3ZE0E 3WHXB 1TETL 1V8HA 1ZANL 3ARGB 5IVZB 1IZKA 5D7SH 4M7LL 3OAZH 3P4OA 1ZA3B 4JFFB 5GS3A 3E3QA 2AK1L 1UA6L 4PG9B 3T4AA 3DMMB 5DJ0A 2IPUK 4NCC2 2DYPD 5FGBA 2EDBA 1QSFE 1NFDF 1AGDA 2B7DT 3WV0A 3TJHC 5BO1H 4G42A 1UJ3B 2F54E 1OAKL 4YHLL 2NLJA 3WIHH 1MY5A 1MI5B 4F58H 4U0RC 5GRYA 4KC3B 4APQB 4D3CL 5MEOA 2Z8VC 2PW1A 2VR5A 2R2CA 3T1FB 4I0KA 4XMLH 1VADB 4N1EA 4YHKL 4HWNA 1EA9C 1AY1L 3KJ6L 2IADA 3D69A 3ARTA 4G3YH 1BQHA 2NY2D 4Y19D 3U9PL 2XTJC 2OI9C 2XACC 4MMZC 2H3NB 3BPCB 2OXGA 2QBWA 3AB0B 3OKOA 3BD3A 5IQ9B 1F58H 3O3DA 1TVBB 2IALB 3SDXA 3WN5C 2A1WH 2C3WA 2EE9A 3UX9B 4PJEA 5HXMA 5HSFA 1NCWL 2AV7A 2EDXA 2UWEB 1E6OL 1M05B 4Q6IC 1FVEA 5GGSB 2AJUH 3X3FH 4UBDC 1JGLH 4EBQL 3T65A 3DROA 1ED3B 5L9DH 4NWTH 2BC4A 5DMIH 4L1HA 5D70H 5JR1L 1P4BL 5EU6E 4JLRA 2XZAH 4P4KD 5DT1H 1FNFA 1T04B 3V4PH 1IGIH 3HS0B 3ZDYE 1MIML 2XOTA 3O2VH 2EH7L 5DVMA 4BFEA 3TVMA 4TTDC 4HSQA 4ZO8A 1FL6A 4ETYA 3NIGE 4TRPH 4PJ5A 3X3GL 1MCDA 1NBVH 3FL7A 3CDGA 3DX8A 4NJAL 2DM7A 1IQDB 3AAZB 2A6DB 1JHLH 4P23B 1IKFH 4XWOD 1PEWA 1DBKH 1YMHA 3DV6B 3L95A 4ZOCA 1K8DA 3ZYIA 3VGDA 3KHOA 2F58L 5HBBA 2D7NA 3MA9L 5DEFB 2D03L 1BEYH 4JDVA 1LO4L 2AK4D 5BV7H 5B3JF 2XIDA 3BDBA 4M61B 5IIEB 3QDJA 5I1AA 1A7RL 1HH6A 3CK0L 3U7YL 3VWKD 4PJFE 2VO5A 4RAVB 1MFEL 1JNLL 3SDCA 1OB1B 4Z7VE 3VXRD 4JQIH 4XAWL 1K2DA 1ZSDB 3UJJH 1U8QB 5CJ5A 3MLRH 5LAXB 4AEFA 2X4QB 2F54D 2QQKL 3MV01 1I8KA 2OL3A 2DQTH 1HXYA 1DQDH 3CFCL 4XMKH 1MJ8H 4PRBB 1U58A 43C9A 3R06B 2VUOA 3QAZC 1XF4B 4O2EB 2BZDA 1YDPA 2FBOJ 3T77B 4NZJA 4GRLC 1UH2A 2RIKA 1KTRL 4HKJB 4XBPB 3PF2A 1U41A 4XBGB 3WNLA 2IANA 3CX2A 3MZGB 3VFWA 3TIDB 5CCKL 2H32H 1R5WA 5DJCB 4PD4K 1TZGH 1DN0A 3MRDA 1J18A 1MHEA 1MHCB 1WQVT 3EO1B 5D96B 5C08A 3QZWA 3MROA 4M1GH 4I9WD 2Q87A 5CWSA 4Y7MA 4UTAL 3OXSA 1T20A 2BERA 1BREA 3NAAL 2YWZA 1REIA 2H8PB 1GGCH 5ITFA 3HR6A 1UM4H 3SE3C 4WW2C 2HLAB 1OM3L 2GTWA 2VLJE 1FVCB 1YEJL 3OGCB 4ALAH 2J5LC 4H1LB 3T0EC 2XN9A 3DUUA 3QI9D 4AIXA 4FFYH 5BRZB 4YHPA 1QBMH 2EE2A 1CE6A 5A2FA 5FOBB 2FX7L 3LKRA 5FA4A 2CLRB 3HG1E 3MUJA 4LFHG 1OSPL 4BYHA 3CFBA 1QVOA 4WO4C 1KG0B 3TZVB 5IB1A 3GRWA 1BAFH 2A6IA 2VZVA 4K71B 3QDGB 3P77B 3BDXA 1G9MH 4G6MH 3IDUA 1GGIH 4QRTB 1OQOA 1LQVA 1XIWA 3FMGH 1VFBB 2I24N 4Q9QH 4LPWA 4CAGA 3U9UB 4DAGL 3ZDZF 4RGNB 3LEVL 3F7PC 1YN6B 4RAHA 1U3HB 1FO0B 3MRGB 3JSSA 4C56B 4Y4HA 1QHPA 4M7JH 5C0CD 4MJ4A 3S34L 3SDAD 1A5FL 4XNUL 1MEXL 2P7TB 4PGEA 4Z7WB 3GKZA 1GOGA 1YEDB 3VFTA 3IDNA 1QG3A 4FZEH 1KLUB 1KCUH 4NUGH 1A6WL 4JAMA 2YD8A 4GXVH 5ALBL 3BDYH 1MLBB 2OK0L 3HC4H 3H2WA 4ODVL 5L0QB 1E6JL 1K9TA 4YZFE 1AXSA 3KYKL 3UXFA 4F2MA 3SKUD 1J05B 3D25A 2EDKA 1GGYA 3OX8A 4HZAA 5I8OL 3VGEA 4WI9A 3O2DH 5GPRA 2VN4A 1JPGB 5KSAA 5CEZL 5BQ7A 1NCDH 2IPKB 4LLWB 2F9BT 4ZPTB 1Y0LA 3HMXL 3MGAA 2GSGA 1WT5C 4LLDB 4N0YL 5EOQL 2NW3B 4O02L 1VERA 1DBJH 2KZWA 4DUXA 3BZDA 4DCQB 2YPLE 1A7NL 2NY7H 3VI3E 4OZIF 1CU4H 2H2SC 4I5BA 1EEZB 1TZIB 3GO1H 3MRFA 3M17B 2VQTA 3C60D 4LSVH 1HSBB 2IMNA 1KJ2A 1SYVA 4HUWB 4F3FA 3TCXA 4PJAB 1IC7L 4QXGH 1WICA 1VKXB 3E2HA 2BOBA 1RJZA 5FCSH 2QSCH 4LLUA 5ESQA 3WFBL 4ONGL 4RIRB 2Q76B 3HI1A 4OLYH 4PGDA 4EN3A 3L3JA 3ILPB 4WJ5A 4LPCA 3HG1D 1CGUA 3H0TA 4XTRC 5IFJA 3RTQC 2C4FU 3MV9E 4GKZB 3IFOB 3P0YH 2RGSA 4S0SD 3IXAA 4UT7L 3U7WH 4XPTH 1IGTA 3OB8A 5DJXB 5IB5A 4O2CA 4HUUB 3L3IB 1HDMB 1K8IB 5K9JL 3QDMA 3UC0H 4G6JL 3QWRA 4PJIB 4KHXL 1A7OL 1MCPH 3MFFB 3UO1H 5JTWA 1T7ZA 1QYGH 1BVLB 4F57L 4AY0A 1CXLA 1WVZA 3CJJA 4HK3J 5EZJA 3IAPA 1AXTH 4CADA 3G5YB 4HC1A 1BOYA 2ERJC 5HTSA 1J8HB 1NEZG 4ZUUB 3V7AE 4OV6F 5SWZD 3EFFA 4K7PH 5D1ZA 4WU7B 3G6JE 5IROC 4ZQKB 2WLYA 4ZPVA 4MXQA 4PRPB 3W11D 1OAKH 4NO3A 4IRZH 2YKLH 4KAQL 2YPKB 1VEOA 2FO1A 5D5MA 5C0EA 4WHCA 1CFQA 5AAWA 1QLRB 4KHTL 4LEOA 1DQLH 2VWEE 3L3OA 4X7TA 5CP7A 4KJPD 2FWOA 1EGJA 3UPRA 1ZHNA 4J6RH 3MLSL 4PRAB 2Y6SD 1HYSD 3B2VH 2QHRL 3QCVL 4JPWL 5T1KB 3LQMA 3JUZA 3RKPA 5JW5B 1V3JA 5BOPA 4ORGB 4AL8L 4MQXD 3OZ9H 1F3DJ 4JDTL 5FYLL 5DQJB 4UT6L 3PP4H 5CLWA 3M1BB 2ORBL 3TIEA 3WHE1 2VLKA 4BQBA 1RURL 2CK0L 5ADOH 3MPCA 1G9EA 5FM5M 3VWKB 3L5HA 4LHUD 1NCWH 1CFTA 4KPHL 4OUUB 3MLTA 5ECJE 1Y18A 2YHGA 3I6GB 5IW6A 1X5FA 4OCYL 2C4XA 4HJGB 1QSFB 3QXUA 4TQEL 5IHLB 1QR1A 4U33A 1S3KL 4A2LA 1CGSH 2I9TB 4X7SL 3TBVB 3WS6A 2DQDL 2Z92B 4U6TA 5K9KB 4NPYB 4OF8A 5CEYA 4U3XA 5J3HC 4D0BA 3S5LB 1Y6NR 5TGBB 2IGFH 2A73A 3LMJL 4GLRH 2ADJA 4P5KB 4BUGA 2CRYA 5C0DA 1UJ3C 2Q20A 4ZOAA 4JKLA 4P5TD 3C5ZC 4JANB 1R24A 3VFSB 3ULUE 2DIBA 1CG9B 1GRWA 1PD6A 4NKDA 4TUKH 1IBGL 4XB8A 3MXWH 4NCC1 3BHBB 5C07D 3HNTH 3CUPB 1ZVYA 2FO4A 4H0HB 3VFVA 5DJAB 3UTTD 4DZ8B 1RSFA 4MZ2A 2EKJA 4J12A 3ULSB 1PLGL 4PJGA 3U0WH 3E6FA 3KPTA 3LZFL 2AJXL 2P8PA 4LP5A 3GSNA 5EU6B 1IQWL 1G6RA 3QO1B 2EKSB 3RY6A 3BO8A 3I3BA 5D2NE 4LVNC 3S36L 3SJVA 3QNZA 2M1KA 4Q9CA 5HHQB 1IC1A 1EH9A 5B22A 4C57C 1U0QA 1TZHB 3MREA 2YRPA 1KOAA 5BZDB 4NDMA 3SE8L 4U6YA 3SN6N 1MCLA 3W39B 1CVRA 3GMNB 3MACH 3P30L 5IEKA 2IWGA 3ALPA 2O26U 5F9JB 1I1YA 1WV7T 4HS3A 5ESVA 3HB3D 2VC2L 4M4PA 2P5EA 5I16B 1A3RH 1IM9A 5SWSE 3QUML 4L3CB 3FN0H 2WBJA 4FXGA 4KKNA 4OZGF 5CCKH 2HLFC 4YGVA 1H3WM 4NC2B 3DJ9A 3ARFD 2EH8H 1S5IL 2HYMA 5I8CB 4XZUA 1XGQA 2FH6A 4N5EA 4BH8A 3Q1SL 1CL7L 2GFBA 1G9NC 3NAAH 5C0FA 4ODUB 3UTSA 1ZHKB 4PJBA 1F42A 3DURB 3QH3B 4KRLB 1I8LA 3DETD 3P11L 2F5BL 5T3XH 2JTDA 3MNVA 1Z9OA 4YBHA 1YEJH 5HI3D 4JFXA 1TTFA 5T3ZL 1SBSH 3DSNA 5CEXB 3GSOB 3KPQA 2ID5A 2A77H 4D94A 5EU3B 3DVIA 2HG5A 2QJDA 1CLYH 1HIML 2XA8H 3MBEC 4N0UE 4AEIL 4F80A 4MJ6B 3AROA 5TF1H 1B2WH 3DPBA 1LEGA 4FQQB 4WV1B 4WEBL 4LPYA 4HGWB 2FD6H 4XPFL 1UWEH 4KKBC 3NA9H 5ICYA 5TE7L 4KROC 2XWJA 3QR2A 3WJLC 3Q6GL 3UTQA 1HHIA 3Q5OA 4PJXF 1WBZA 2PTUA 4O58H 4OD2B 3QEHB 5I6XC 1IARB 3GMOA 1RZFH 1J5OL 1IEBA 4J3UA 3DX7B 4OI9A 1JL8A 2RR3A 2FYYB 2NXZC 4RDQF 5IM7B 5IJVB 3GSQA 4D9LL 4Z7UF 3UYOD 5D96C 1W0VA 3NTCH 4XNUH 3AM8A 2VLJB 3D3VA 1EBPA 4FABH 1QQDB 5GGQH 3V6OC 3E6HA 5HGDA 1V7NH 4MQSB 2C1OA 1JGEA 3PJSA 2YD1A 4POUB 2BVUA 5EPMB 3HG1B 2VR9A 4HX1B 4FFWD 3ZT7A 5FK9B 1DJSA 2LAGB 5D7KE 3ROLA 4WFEE 4X6EA 4X6FA 4G5ZH 3FT3B 1RZ8B 2FB4H 2VSDA 4UB0H 3JWOH 1MFBH 1RUKL 3HPLA 4UOJA 1GAFH 2VSCA 4MQ7B 3MCLL 4IMLB 4R7DB 5SWSD 1KLGB 2GSIA 2LVEA 2Z35A 1F00I 3TZVC 4I2XE 1MIEL 3FZUD 1T83A 5DHYB 1T7WA 5C86A 4JM2C 3WIIH 4M1DL 4OF7A 3MGOB 4JM4L 1NEZA 3L5WA 3ZE1E 5EOQH 5ANMA 3RRQA 4MJ2A 3QISA 1GHFL 4Y4KB 3SKNA 3VRIB 2JCCE 3OHXA 3FOMB 2BVPB 1U8PA 3NZ8B 4WUKH 3QEGH 4UOW0 1FZOA 5D1QB 1PKQA 1VFAB 1MCWM 4Y88A 1A1NB 5IMMB 1NBZB 2I25N 4PV8A 4U3CA 5C0NC 3RGVA 3K1DA 2GK0B 1P9MC 1YYLH 1KB9K 2IG2H 3EOAA 4XT1C 1CBVH 1MQ8A 3H42H 15C8H 1AD0B 5FXCH 5J12C 3QHFL 3DRQB 3HE7C 4EJ1C 5GS0L 1WZKA 4UT7H 5GS1A 1NFDA 1QSEB 4JHWL 4HAGA 3HR5B 4ISVA 4MDIB 1S7UB 1A64A 5L0QC 2W0LA 4PPTA 4EDWL 3VGBA 3NCYP 4AT6A 1MWAB 2L0DA 3H7BA 4UMGA 4P57B 4LIQH 5D1XA 3IVKA 3QJHB 1U95B 2B5IC 2OYPA 2E7LE 2YPLB 3N1GC 5E9DD 1CLOH 3I9GH 3V95A 2ZZUT 5DC0A 1C5BL 3OF6D 2HN7A 2VR4A 1KPVB 3GIVB 3KR3L 4R7NA 3QDHA 1CDGA 3BIKB 1VDGA 4TUOB 4KK9D 2WK2A 2FEEL 1XGTA 1CLZL 3V5HA 5FYJL 4Y2DA 4Z7QE 1GZPA 1XGUB 3W9EB 1JI2A 3L6FA 2W60A 1S8DA 4KHTH 5JDSA 3QPXH 3QQ3B 3L7FB 4D0CA 5D7KD 5DFVC 3MV9B 3KG5A 2QQNL 1T21A 2PKDA 2B1HH 3STZB 4UIKL 2D31A 1RUAH 3LOWA 1TJHL 1EFQA 1FO0H 5BS0E 5JXEA 4UT6H 1U36A 4J3TA 1T6VN 4JE4B 4OZHA 4DN3H 35C8L 1Z0NA 1RURH 3QUZD 1X4XA 2GJJA 4I3SH 1QLFB 4JJ5B 3GMRB 1J0KA 4Q7DA 3I6KA 1OTUD 4OCYH 2O61A 4N8VB 1K6QH 3TNMA 2EE3A 3HE6B 4DOHE 3G6JB 3CVHA 1I8MA 3PWLB 5HHME 4JM2F 4RMRA 3CMOL 2K3TA 4QNPE 5DD1H 1AR1C 4QRSB 3BZFA 4U1NB 4ELME 4MLSA 3QXWA 3TT3H 1A9BB 5CBAA 1JFMA 4XP4L 4I0PC 4PY7B 2HA1A 1R5VA 1DFBL 4JDZA 1YEGH 4B50A 1T2QL 1V3LA 3NCYS 4QRPD 1BP3B 4OLWH 1HNFA 2OJZL 2ILLA 3QULA 3TPKA 4ZMAT 4MS8D 5ACZA 3SO5A 3B43A 5EZLA 2F8OA 3MGTB 1EUUA 4J3XA 4PGZA 3QUYA 4WU5A 3MFGB 1OOAA 3LSOB 4BM7A 4HWBL 3DIFB 4XH2B 3BW9A 3WIFA 3MCG1 1FFPB 2VZOA 5FCUL 4JY5L 3A6BH 4U6HB 4XCEB 4OLXL 1SM3L 2BHZA 4KGJA 4QXUL 3KYNB 1H8OA 2AEPH 2PO6B 5E6IA 2P5WA 4NQDD 1OD9A 1UWGL 43CAB 3FRPA 1S9WA 5DS8B 3VXQB 1INQA 3LEYL 5TQ0H 3IF1A 4XX1E 5DR5H 1EZVX 4YBLC 1P4LA 2IAMC 3VXOA 4MA8L 2CRMA 5DC9B 3DYOA 3CDFA 3P30H 4WI7A 5AD0A 2W9LA 1NCAH 1FNGA 3ES6B 3O6FC 1WGOA 2Y36H 4RSVA 3OAUL 4XP6L 4ETQB 2VC2H 5CIPB 3REVB 1UXSB 4YPGA 3DXAA 5F1NA 2H41A 2CUIA 5GJSL 3ALXA 1WSST 1E4JA 3TCLB 2RFXB 1NL0L 3IU3B 5BS0D 1J0ZA 2XQBL 4BFBD 2R4RH 4DTGH 2FSEA 5IBUG 1SEBB 3BN3B 1SYSB 4GSDL 1QO3B 4Q6IA 1QHOA 1IL1A 3KPLA 4Y5YB 4EI5A 3FB7B 4YIQA 5IB3B 2OTWA 3CLEH 3BP7A 5JOFB 1D5XB 4FQJH 5D2NB 3GI8L 2PW2A 4MD0A 1INDH 5C92A 1X5IA 4R26H 3QXDA 2ITCA 3GMMB 3F5WB 4HS8H 1KIRA 1WTGT <