4CW7A

Structure of the fap7-rps14 complex in complex with atp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
181
structure length
181
Chain Sequence
MGMLIAITGTPGVGKTTIAKLLAEKLGYEYVNLRDFALEKGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHLSHLMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENVIEVDTTNKTPEEIVEEIIGLIKSGVKRRVGIVDWSEVYDEIIPYLRLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
molecule keywords PUTATIVE ADENYLATE KINASE
total genus 66
structure length 181
sequence length 181
chains with identical sequence C, E, G
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4cw7A00
1R7RA 1OF1A 1T0HB 3TSZA 3BGWA 3U4QA 4RZXA 3THOA 4QM6A 3MWYW 2WICA 1U90A 4OHWA 3K9LA 4M1WA 2G9NA 2GDJA 3Q3JB 2BDTA 1PJRA 2I1QA 2QT0A 3HU3A 1VCOA 2BBTA 4MRSA 5LD2C 3GFPA 2ZVPX 4PO9A 2HT1A 1S9DA 5A0FA 3QY0A 3FPAA 4QHTA 1FUKA 1C1YA 3W3ZB 1G6HA 5CYOA 1P9NA 3QEOA 4X8LA 1TQ6A 1XD2A 4HAWA 5HCNA 3QG5A 4XWOA 3WBJA 4BUJA 2CEAA 1OYWA 4ZKEA 5TARA 2D62A 1AQUA 1U9IA 3RRYA 3RHFA 2CJWB 4NHOA 4RVCA 4D4JA 1CU1A 4ACAA 3GLIB 3ZLJA 2GZDA 4B2IA 1G7SA 1J8MF 1IN4A 2IWHA 4AY2A 3K0SA 2J7PD 3TQCA 3U7EB 3NBXX 4Q00A 4DSOA 1A2KC 1AA9A 1E2EA 4WXRA 2R6CA 4Q1FA 4HLUA 1CIPA 3ADKA 2ECKA 4ZIRB 1NMXA 3CO5A 3MWKA 5CLQA 1QHNA 2QY9A 2E87A 3DEFA 3WMFA 2W6JD 1ZNWA 2OSBA 3PEYA 3ADCA 3H1TA 3IIMA 5EXSA 4YMVA 2GESA 3KQNA 1NLYA 1D9ZA 4ITRC 4Q21A 1TQDA 3EZFA 1SKYE 3BAFA 2JLVA 4TZ6A 1W36D 4QNMA 1Z6XA 1IBRA 4TMKA 3CRVA 4NYMQ 4DCNA 2ZEJA 3TAHA 4X8MA 3FHCB 2A2ZA 4GL2A 5EXPA 3SJZA 1EG7A 1OHHA 1RE0A 2FGJA 4Z8XA 3GLFE 3FKQA 4M0LA 3EAQA 3GLIE 2ZR7A 4GZMA 1PLKA 5FL7A 3L8ZA 3THXA 1MH1A 2PZGA 3CX6A 2C9OA 1QHGA 2A5JA 3HPQA 2ZRAA 5B2ZA 3PUWA 1P2UA 2AWOA 2Z4RA 3TE6A 4C2UA 4IHQA 2YZ2A 4LJAA 2NTYC 4XJXA 4KLZA 4LX0A 3S1AA 1QG2A 3GFTA 4DEYA 4D0GA 1N0VC 1JJ7A 2D4HA 3A1VA 1NLZA 4GOKA 4R2HA 1WBDA 3PITA 3B85A 2XTNA 2ZPTX 3QPUA 4F4CA 3SFZA 4BRWA 3GP8A 1LS1A 2IYTA 5TV2A 2MMCA 4FMBB 4ZDWA 1OH6A 2REBA 4OHXA 2GVDC 2O0JA 1KZGB 4Q1AA 1YQTA 3CIOA 4BZQA 4D26A 3GD7A 4Q1DA 1RRFA 2OCYC 3RS3A 2BMJA 2A7QA 4IVPA 3NDPA 2LKCA 2JATA 4LDJA 2C96A 1HA3A 4LV8B 5G40A 2GWHA 4D2IA 1NY5A 3HYRA 4MITA 3EWSA 5EE3A 2ZRIA 3LFUA 4E03A 1CRPA 3BBPA 5J47A 1G5PA 1Z3IX 1X1RA 3SDZA 4NYMR 3QF7A 2DFKB 1CEEA 1EWRA 4OYHA 3OAAA 1T5IA 2XOKA 4G1UC 2WIAA 5TVKA 3A37A 4LHVA 4XSHA 2O8BB 2PT7A 1UKVY 2IHBA 1S0UA 4CYMA 3I92A 2HCJB 3MGCA 2DB3A 5SZIA 2GNOA 4IXMA 4Q4JA 1IHUA 1S3GA 3QOFA 2QRZA 3KTAB 2JLYA 1XNJA 2GXQA 2PZFA 3PEVA 2FSIA 4K81B 4DB4A 1GTVA 2ZITA 3BB4A 3Q9LA 1BS1A 2GILA 2O8FA 1MV5A 2QQ0A 3CNNA 5DLQC 4BFSA 4URZR 4DJTA 1FTNA 1SXJB 1JXOA 3C4JA 2QI9C 4NL4H 2B8TA 2J1LA 1UBFA 3DKPA 4D4LA 3H4MA 5EZ5A 3AB3A 4NCJA 5KDOA 1Z0FA 4NCNA 2QBYB 3K9GA 3ECCA 4C0QC 1F60A 4A1FA 3OFND 4NYIQ 5KU1A 3PV0A 621PA 3H0KA 2IXGA 3WNBA 1ESMA 5EP3A 3TR0A 2C9YA 4HLUC 4QM7A 1P3JA 1D2MA 4LJ7A 2P65A 2KBFA 2JJ2A 3SZRA 2ATVA 1R0YA 4DXAA 5CB8A 1BO6A 2Q9CA 4RFVA 1GVNB 1TL7C 3AVQA 4E22A 2IHYA 3IBYA 3UWKA 3TMKA 4L5BA 5JRJA 2YJTD 3ADBA 3UMRA 2VP2A 1OT3A 3IPXA 4BFWA 3CNOA 4XIGS 5J40A 2P6RA 121PA 3EZ9A 1U9IC 2FH5B 3LVQE 2GHIA 1N6KA 3A4LA 3VAAA 1WQ1R 4MRNA 2ZAOA 3CH5A 2GEVA 3E5HA 3MJHA 3T5DA 1UKYA 1ZYUA 1ZU5A 1DAGA 4M22A 4US2R 1Q20A 1NSTA 2CVHA 2GAAA 3U44B 2B92A 2VTKA 2ZTSA 3B2EA 2CNWD 3K70D 2O52A 4CRWB 4NE2A 4R9UC 4Y0VA 4DLTA 3R8CA 1ZM4A 1JBKA 2J0UB 3IDQA 3NH6A 4Q9HA 4JSTA 3LQRA 1J70A 3QKSB 4J0QA 5BYJA 5LBIA 1ZVQA 3CPHA 2FA9A 4CF7A 2YOFA 4OI1A 4A82A 2W2VA 4DDUA 3OIYA 2WWFA 1MABA 1T8TA 3W8NA 3A36A 2BBOA 2Z4SA 2AFHE 3QEJA 3REFA 2H8KA 2BCGY 1T8UA 2GZHA 1XTRA 2AHOA 2C8VA 4M2LA 4KITB 1QDEA 1UBGA 1WP9A 1AJEA 2H1LA 1E2LA 5F9HA 2ZJOA 1OJLA 2SHKA 5AJZA 1A1VA 4UQOA 4OL0A 2JAQA 5FL7D 2WTUA 3QKUA 1AIPA 4R7ZA 1OH5A 1UADA 4IFEA 4DLXA 1UBCA 3DOFA 3MAAC 4PPGA 1Q1QA 2BV3A 1F2UB 4TWZA 1FQJA 2JCSA 5K8TA 4PFSA 2QUZA 2OAQ1 1G9XA 4B34A 4EQ6A 1Y3AA 4KVGA 4M1SA 3C15C 4RCZA 1AS0A 1UBEA 1EFHA 1JI0A 2Q21A 2FWRA 4TYNA 1E1QD 1XTIA 2G77B 3FVQA 2HYIC 1KI6A 5FBLB 2HLDA 2VP6A 2IYQA 3GJ4A 2ZVQX 1TMKA 1ZM2A 4LBZA 4LRWA 1B0UA 4URVR 3M0EA 4FMCB 2RGNC 4KO8A 1U81A 3K09C 2J45A 4NMMA 4Q66C 4TMTA 2D2FA 3OHMA 3W9YA 4LHXA 4AIIA 2CXXA 4LYHA 4DSTA 3NEJA 4QHSA 2WJVA 3I5YA 4Q03A 3KJEA 1CJMA 2IYVA 4UXIA 4QC2A 1PLJA 1X8JA 3NEYA 4BE7B 1FNMA 2CLSA 4MYHA 3QSYA 3IHLA 1OLOA 4QGFA 3PCRB 1G3RA 3CF6R 3DDCA 3PVSA 1NLFA 2OFOA 1W36B 2ZRJA 2ZIAA 3ZIAD 3AVOA 1R5BA 5FPSA 4KLNA 4M8NE 1NVUQ 3AVPA 2O8DA 2PEYA 3Q7QA 2QZ4A 1WRBA 4PHFA 5JSZB 1N5KA 3ZDQA 3NC0C 1N6HA 1COWD 3ICEA 3ZD6A 1T3SA 4N1AA 1RYFA 4PC1A 4LSGA 3C14C 2HF8A 1NVVR 2Q3FA 4W5HA 3B1YA 4C3ZA 1V5WA 5IT5A 3P26A 4TN1A 3U3MA 1CJKC 1XD9A 3PFIA 1U0HC 1ZM9A 2XTMA 3QI2A 4ARZA 3QJYA 4ON9A 3WYFA 3T15A 3ZVLA 2QBYA 2NO7A 1FUUA 2ORVA 2NO6A 1BOFA 2H5EA 3O8BA 3U3JA 1HT2E 3SQWA 4OJKA 4TTRA 1C9KA 1W47A 2WSSD 5JI2E 4MGYR 3MJRA 3GJ0A 4C0LA 1IXRC 2H57A 3AP2A 2ZRDA 1W2GA 3TR5A 2ZUDA 5HPYB 4FCVA 5GVSA 1OE0A 1KDOA 5JMTA 4DCTA 2JLWA 4G5GA 2GK6A 2O8FB 3K0AB 3O8DA 4ZO4A 2YOGA 5H70A 4GNKA 2EFHB 1OW3B 2JEOA 4PC3A 1IONA 3OE7A 4B48A 3DZ8A 3WBKA 1P6XA 2NQ2C 4U7DA 3B5JA 3N2IA 3VR2A 1OPXA 4QG7A 4R98A 1PV4A 1E1RD 4TT3D 2F43B 5J4YA 4JLPA 5KPJA 3NBYC 1G5TA 4TL7A 1I4DD 3THYA 2RGNA 1KKLA 1TU4A 4AI6A 1FX0A 1L2TA 2IYXA 1XXHA 2A3RA 3UKDA 4FXPA 4I4LA 4RJLA 2QM7A 4C0KA 4KYIB 3EARA 1DG1G 2ZRHA 2IXFA 4EIWA 2RGBA 2IYYA 1K5GA 1W2HA 2AD5A 3K0EA 3SJCA 2VPPA 2IEYA 4QJ4A 4UXHA 1DBSA 4A0RA 1FPMA 3CZQA 4HDOB 1II8A 2XOKD 3R9IA 2DPXA 4KV9A 4XOIA 1RJ9A 3U6KA 5FR1A 5BW8A 1VMAA 2DR3A 5BXQC 2WKRA 3GJ8A 4LGMA 2FJUA 1JALA 4R71A 2CNWA 2V3CC 4O0MA 5KDDA 1OFTA 2WIBA 3GJ3A 3SU8A 3PEUA 4PAQA 1MRSA 1DOAA 2WKPA 3QENA 3CR8A 2P0EA 4TQAA 1OFIA 4RD2A 4DLUA 1KI3A 2YC4C 1CLUA 1DADA 4URWR 2WJHA 2IXEA 3MWLA 1N3BA 5HTKA 4CT5A 1ZCAA 4Q01A 1RJ9B 5FPTA 4M1KA 2QNRA 2Q3HA 3GJXC 4HAUA 1CULC 2W2TA 1TUIA 3K0CA 4Q1CA 5FUWA 2JASA 3ADDA 3WNDA 1N6IA 3KKOA 5FOSA 1E3MA 1D8TA 3BIFA 1HH4A 1FQKA 3IKJA 1YHNA 2P67A 3UIEA 3EPJA 4I1SA 4JBXA 3HR8A 1XXHB 2CCGA 1KO7A 4YQFA 2ZI7A 1E9SA 2V1UA 1T9HA 5FTNA 1XTQA 1DVRA 2KJQA 1XJCA 1QG4A 1H8EA 1Z6AA 3L0IB 4F91B 1F2TA 4TYQA 1I4TD 1BIFA 3SFVA 1GL9B 2BM1A 5E3HA 1R8QA 4LJ6A 4PAOA 5L3QA 5AUQA 1W4CA 4W5JA 1E2KA 2QENA 2C98A 1GITA 1NRJB 3JVVA 4HLDA 4JL6A 4D4MA 1Q3TA 4HZUA 3K0AA 4H1UA 3AVYA 2FGKA 5JEEA 3OEHA 4CDGA 3NH9A 2RGXA 3T61A 1OB5A 2WZQA 2HF9A 5EZ6B 3D7MA 2XB2A 1E4VA 1UKZA 3RWMB 4HYYA 1XU4A 5GJWC 3HR7A 4YMTA 3NHBA 4KBFA 4JYBA 2G0NA 1P2SA 1YZUA 2YHSA 1DAKA 2IEZA 2QTHA 4L15A 1FOEB 2OT3B 1N5IA 3L2OB 5FPKA 4ZCIA 1CP2A 4XTCS 4ARZB 3KQUA 1GILA 4FWTA 2FV8A 1FMJA 3FKSA 4OI4A 2D7DA 1M7GA 4YXWD 4F93B 1JEEA 3UWOA 1KSJA 1I2DA 1R2QA 4B3GA 2BMFA 2JA1A 3VKHA 1KO1A 1IQPA 2N1BA 1QHHA 3SEAA 5C2JB 3RANA 1Z83A 3AF0A 3GCGA 1OXXK 5AR1A 4M1OA 4DT1B 3CRQA 2DHRA 1F5NA 3G82C 1CXZA 4IOLA 3LQQA 1GNQA 3E1SA 3I4LA 1FNNA 1XX6A 5DSZA 2QSZA 4KSBA 2J0SA 2P6UA 1W46A 5JZVA 1IXSB 2O8EB 3K8YA 3PUVA 1OIVA 2TMKA 4Q47A 2PCJA 2QG6A 4W7SA 4N0DA 3QBVA 4LBVA 3W6PA 4BEBA 3JZMA 2F1RA 5AWFC 3VQTA 3A8TA 1TUEA 3AKCA 3EIQA 4LY6A 5DGXA 3F3YA 4P4SB 2EVWX 2H16A 1KDPA 1Y63A 4JZKA 4LPKA 4OQFA 1XMSA 1GAJA 3R9WA 1SVWA 1UDWA 3QPWA 1SQ5A 1COWA 4YLGA 5KO2A 3V4RA 2YWEA 3KFXA 2RHMA 2ZXUA 3AVUA 1E2IA 1Q22A 3HJNA 1LNZA 3QE0A 1NP6A 1HTWA 1Z5ZA 4KVAA 5GADl 4RCYA 4DSNA 4LPSA 3RS0A 1NG9A 4JKIA 1WMSA 3EA5A 3NXSA 1YE8A 3H84A 4Z54A 2GRJA 2K5UA 2CE2X 2Y8EA 4FN5A 5J5CA 1W4AA 1V43A 3B9PA 2ZSDA 2QU8A 3KXIA 1NBME 1RRGA 2YWHA 3LNCA 2NIPA 2ZROA 4L16A 1TX4B 2Z43A 5FTMA 2AFIE 3BD9A 3GJ7A 3WRYC 4W5WA 1XXHE 1IN5A 4C0SA 2E9SA 2GXSA 3W3AA 4N3NA 4YXWA 4AKHA 3AP3A 1F2UA 3UANA 5L3RA 2QRNA 1E9RA 3A1SA 1X86B 1YZQA 1ZD9A 1W44A 4LI0A 3PR1A 4JLOA 5J4VA 3M4YA 1QHSA 1KO4A 3LD9A 1CR4A 1N2CE 3QXCA 1Z0JA 1VPLA 2RHDA 1IM2A 3F0TA 4Q4HB 5CITA 4AWXA 1LF5A 2OILA 4AG6A 4C2TA 3ASYA 1S4QA 4WOPA 2VP9A 1XEFA 2QORA 2RMKA 3HU1A 2XITA 4M9QA 1KO8A 3U7HB 2X1VA 1ODFA 3QVVA 1KZ7B 1PVOA 5FL3A 2OCAA 4KAXA 3BORA 1G7RA 3LV8A 5DN6A 2IYWA 3RLFA 2WJYA 3W90A 4C0JA 2ZS8A 1YZTA 3SI7A 4CEJA 3KJHA 1Z08A 2R44A 3TUIC 1OH8A 2KB0A 2CJWA 2VHUA 1IN7A 3MG9A 1M1YE 4OHVA 4HUQB 4GBMA 5EP2A 1E9DA 3AEZA 2F9LA 1HUQA 3LLMA 4F38A 3QXSA 2NPIA 2YVUA 4NH0A 1QF9A 1E79A 2JJ1D 2ZRMA 5E7JA 5IK2D 3C5CA 1JNYA 2WWIA 4OQMA 5G3ZA 2RB4A 5KPDA 3GEEA 1NJFA 4BEJA 3RVBA 1KDTA 5DHFA 1EFRA 3GJ6A 1X6VA 3NKVA 3U61B 4DIEA 1NNEA 3TKLA 1IJEA 1X1SA 4HLQB 3TVTA 3VR6A 1W48A 3TVDA 3A6PC 1OKKD 4Q9LA 2JGNA 4JLVA 4M1MA 1U0LA 3MRSA 2FX3A 2ZU6A 1AK2A 3SYKA 1AKYA 1ZCBA 4LJYA 3ZIAA 3B6EA 1N0UA 6Q21A 4C4PA 4XWKA 4QRHA 5E95A 2WAYA 4HAXA 4L9SA 2VP4A 3WMEA 1E99A 1Z0IA 3L43A 3CM0A 3FE2A 4DCSA 1FTSA 4PHHA 4PHTA 4Q7KA 2RGEA 4Q48A 2G83A 5HCIA 1KAOA 4MGIR 5JLJA 3AM1A 4IEIA 3RWOA 2DYKA 5FOWA 3TSOA 1UJ2A 1E1RA 4TT3A 4EPWA 2QTVB 3SR0A 4G5SA 2IT1A 5D3MA 1G4UR 4IKEA 4QBFA 5TXGA 2ZYVX 2AXPA 1Q12A 1M74A 3CZPA 1MT0A 5GJBA 1VKJA 4EKDA 1KMHB 2C5LA 1VCNA 4M9ZA 4ZV4A 5KYKA 3QF4B 2P6NA 2MSEB 1ZIOA 2GF0A 2V6JA 4TTPA 2F6RA 5IDVA 2JDIA 4ESVA 1XZQA 4RZUA 1G1MA 1E94E 4O3MA 4AKGA 1AS3A 2OHFA 2V8OA 3BB1A 2WJGA 1LFDB 1MRNA 1BMFA 1GSIA 3D8BA 1P4SA 4PQYA 1G7CA 2ZRPA 5AJXA 1G8YA 4WBSA 3TJZA 5L3SA 2WMOB 4M1YA 2WVJA 4V0KA 5SZKB 2B21A 2JLQA 1IY1A 1P72A 1I4LD 3VR4A 1UAAA 2FZ4A 4BFVA 4A8JA 3JZAA 3IIJA 4U5XA 4EFMA 2ZJZA 1P61B 5BN5A 1GNPA 1XEWY 4V0LA 1RRPA 3MCAA 2F1HA 5EUMA 2ODBA 1SXJC 4EDHA 4URXR 4DSUA 4ACBA 5IF9A 1E0AA 1NIPA 4BQSA 3QIAA 5HZKA 3L0SA 4WIAA 1Z6YA 2XSZD 1II8B 4AG5A 4K46A 2IBMA 4AKIA 3EPHA 3EC2A 5EE9A 5CDFE 2R6GA 4TL9A 2WWHA 5LDDC 1XPOA 1BMFD 2OESA 1BYUA 2VA8A 1VG9B 4K8OA 4POAA 1RRCA 3OE7D 1J2JA 2BBSA 3ND8A 3K70B 3EPKA 1CJVC 5CB6A 3IQWA 4BZXA 2IW3A 1IN6A 2J9RA 1GOTA 1CR2A 4NYJQ 5EP1A 2NMVA 3RC3A 2FFAA 4G5RA 4PSAA 3CPJB 3O8RA 3DO6A 5FI0B 4LJ5A 1DAIA 4Q4AB 3VX4A 4V0ME 2Q9BA 3L8YA 1ELOA 3PIRA 5KOYA 5IRCD 4URYR 5FOUA 4HSEA 1A2BA 2HYDA 2EFEB 3IPYA 4RFSA 3QXHA 2G3YA 4DWJA 2AKAB 1XCGB 2HJGA 1X8KA 4M53A 3W5IA 5HZHA 2XXAB 2FSHA 2WAXA 4A6XA 4HUTA 1ZBDA 4UJ3A 1P62B 5K8LA 4UNSA 3ZVMA 4B6FA 5IK2A 2R6FA 5DN6D 1SKYB 1SVOA 4EPVA 4G5OA 1FZQA 5EXTA 4XH9B 3TIFA 3EWAA 1ONBA 2AXNA 1TEVA 1L4YA 1KJYA 1F3OA 4L9WA 5LPNA 4LYFA 1R8SA 5F98A 1E2PA 5SZHB 421PA 1DTSA 1HV8A 1OFHA 1IAQA 3F8TA 3CX7A 4MYUA 2B7BA 4DLVA 5FH9A 1Q1EA 3OEED 2ORIA 3P20A 4HLCA 2YWGA 2IX3A 3HDTA 3LH5A 2PMDA 2E1RA 2XJ9A 1G7TA 3TRFA 2O8DB 4GMDA 3I32A 1VHLA 1VIAA 1W1WA 3AVXA 1NIJA 4IDPA 4PSKA 5E7IA 4RZ2A 1QVAA 4MDFA 4B44A 4TMZA 2QL6A 4A2PA 2CVFA 3G5UA 4GT1A 1ZC3A 3MFYA 2PLFA 4HAVA 5EJEA 3L82B 4BECA 1JJVA 3HP1A 2IYUA 2D2EA 3CRRA 3DL0A 4JL5A 4ILEA 3VHLB 1I2MA 3BERA 1MO3A 3FMOB 2QAGC 4BLPA 4GDFA 3THWB 4O2RA 5M04A 4PTLA 2IUSA 1IOZA 2VF7A 4P4SA 1ETUA 4NZYA 4Q18A 2UVQA 2A5FA 1PUIA 4P33A 3R8FA 4WZAE 3BJIC 2V4ZA 3IEUA 4P0TA 1N5LA 1DO2A 4B6EA 2IS1A 1U98A 3U3OA 1D2EA 3B8HA 3K53A 3QG1A 1EFTA 3R20A 3SHFA 1L7VC 1HY3A 1Q1ZA 1W49A 3VMFA 1JPNA 1GRRA 1P73A 1YU9A 1G20E 1T4GA 3GLGB 2BJWA 1EFCA 1LB1B 8OHMA 1D6JA 2BCJQ 3QUSA 2ANBA 1EK0A 2BEKA 1P2TA 2FOLA 2GJ9A 3LX8A 1QHHB 3R7WA 1Z22A 1R6BX 1ANKA 4GOXA 3DHWC 2Q0HA 3UK6A 3CLVA 1AGPA 3RSOA 1OXSC 4A4DA 5F3WB 4Q9KA 2R65A 2YWFA 4EJSC 2ODWA 1PZNA 4MRRA 2F1IA 5B64A 4QJ5A 1SVMA 2BVNA 3RDPA 3OESA 4GRAA 1KAGA 5EE5B 2J0QA 2XNDA 2BKEA 2Z5FA 3B7GA 2EW1A 3LBHA 3Q5DA 5JHHB 5TMPA 1DEKA 1H65A 2F9MA 4P32A 1TF2A 1NL3A 4AKEA 1W4BA 2RGAA 4BFXA 4DHEA 4C30A 1UFQA 2XXAA 2GJ8A 1NN1A 3W6NA 4B43A 1S9HA 1Z0KA 2IL1A 2VH5R 3QKSA 4JLJA 3IO5A 1OH7A 2XAUA 4CW7A 3BRWD 5FBVB 2NO0A 4QGAA 3ZJYA 1NN5A 3ZS8A 1G3UA 2VSXA 3WYGA 1M7HA 1XTJA 1DE0A 2WMNB 4OI2A 4OHYA 1KI2A 4PO1A 1GP2A 2GXUA 1OSNA 2EQBA 5L3QB 4FD2A 1KK2A 1S1MA 5CYPA 3A1WA 4X8OA 1XFAA 2J5XA 3SN6A 1SULA 3BH0A 1E2JA 4S2EA 5CLLA 1KMQA 1E9BA 4HEJA 4KCGA 4MQBA 5JCZA 5KNCA 3HYTA 1IN8A 1CR1A 4YC7A 1HE8B 2ZJ2A 3LBNA 3BFXA 3K0FA 3LXRA 3SYLA 5G53C 5JJLA 4DDWA 4XTRA 4C9BA 3RC8A 1XP8A 2HLDD 2OEPA 4HAYA 3ZVNA 1XD8A 2WWWA 1KIMA 1K5DA 2V6IA 3UMSA 4QXAA 5B57C 3UATA 1II9A 2QAJA 5KNBA 1J8YF 2VO1A 2QA5A 4FMDB 2GBLC 2KSQA 4KU4A 2YYZA 2I4IA 3DM9B 1ZC4A 4FIDA 3U6BA 2F55A 4A15A 4CEHA 4KFTA 4IJMA 1Z2CA 2ZRNA 3FMPB 3MMPA 3V4FA 4OQNA 2UZ3A 2QGZA 2H7VA 5CJPA 3ZZUA 2BMEA 2QT1A 5J4HA 1UEIA 2ZRCA 3B1VA 5UKDA 2QPAA 1ZUIA 2YKGA 1AZSC 3C8UA 3GEHA 4XD7A 3ZH9B 5L3SB 2W58A 4PQRA 3BFVA 5JI3E 3E70C 3I72A 1HQCA 2WWGA 4FWIB 2VSOA 1UF9A 1VIYA 3QBTA 1N6OA 1KK1A 2AKYA 4B3XA 3AF2A 5EXXA 2NO9A 5E7MA 2QTFA 4FCTA 2X77A 3CPEA 3W6OA 3GLFB 1GM5A 1QHYA 3I8XA 1QZXA 3OAAD 1ZM7A 2C03A 2R8RA 3FHOA 4NPHA 4UXJA 1A4RA 1YZGA 2ZI3A 4KODA 4PQFA 2ZE5A 4PZLA 1FX0B 1Z63A 4Q5IA 2OLJA 4ZI3A 3BFKA 3RS4A 1KNXA 2DWPA 1VYUA 1W5SA 2OBMA 2P2LA 4MRPA 4NDZA 1ZU4A 2GETA 2FSGA 2N46A 4A36A 4PC7A 1E79D 2J41A 2JJ1A 3O47A 3KQHA 4Q19A 2IWRA 2JIZA 2ZETA 4KFUA 3ZD7A 2PZEA 1GL6A 4QBIA 2EFGA 3AVTA 3PXGA 2BIFA 3P27A 1JAHA 4RZ3A 5D3MB 1ZD8A 4JJKA 2QEQA 2PJRA 1T5LA 2JDID 2O0HA 4GPTA 2CL0X 1OIXA 1H8ED 4IVQA 1RZ3A 2KWIA 1SHKA 3KB1A 2ONJA 4ZI2A 2ZI4A 5JRZA 5EE0A 4H9GA 3BC1A 3BE4A 4HZIA 1KNQA 2YNMA 2IYZA 2IS4A 3B1ZA 2HJVA 1G3MA 1TNDA 2O8CA 2BHRA 4W9MC 2XNDD 2FSFA 2GAOA 3S1AB 4IEEA 3RRMA 1GG2A 2G0TA 1VHTA 2WSSA 2WJJA 3FFBA 4OJQA 3ZQJA 3CONA 4CEHB 1D9XA 5CIWA 2J59A 2A78A 2P3SA 2AR7A 2GCOA 4XVUA 4V0NA 2XZLA 3OZXA 3C16C 3WP1B 4BLRA 1F48A 4B73A 1E0SA 5TDHA 3A58B 2NG1A 2GJSA 2JLRA 4Y0AA 4C0HA 1OYYA 1QVRA 2VBCA 1SVLA 2QE7A 4JJZA 4H1VA 4HB0A 1Z2AA 4RKEA 2ZRKA 3EZ6A 5SZJA 5TB5A 4YMUA 2XZPA 2VRWA 3B9QA 2FMXA 3PG5A 3ZGXA 1Z6GA 1P5ZB 4NYIR 3K9HA 1T0JB 2WV9A 3MSXA 5JS8A 2RGDA 2VQSA 3EXAA 4F4JA 2MSDB 2FG5A 4LUCA 2WPDA 4ZPXA 5FBRB 3ZQ6A 3E2IA 2OO7A 3AF1A 3GJ5A 4TLCA 4Q9IA 2EWWA 4IFBA 4QNRA 2CK3D 4MGZR 4MRVA 3DZDA 3WHKA 5KSZA 3C7KA 3I73A 4JLNA 2P5SA 4NTZA 1DG3A 4GP7A 2ZRFA 5KDLA 4UKDA 2QGNA 1CR0A 2IK8A 4RFSB 4CT4B 2BJVA 2GJAA 2HEIA 2PCLA 2ANCA 3JVUA 4KFSA 3AQ4A 1KOFA 2C78A 3D6TB 4MUAA 2VEDA 4Q4AA 1OHHD 4KHZA 4QHYA 2JLZA 1YR9A 4Q1BA 3X2SA 1JR3E 3OIVA 1YKSA 1VYVA 4HB2A 4TTQA 1KI6B 5FI1B 5L8VA 3IQXA 4WVFA 3N70A 1NN0A 4TYPA 1N5JA 2EFDB 2JJ2D 3QKRB 5G3YA 4B3FX 2KBEA 4JSYA 1G8GA 4JIMA 4E09A 1UM8A 3RABA 4YMSA 3PUZA 3AGPA 4EFNA 1VTKA 1E96A 3ZS9A 4PPNA 4AURA 3B13B 1G8FA 1G21E 3TW8B 3KL4A 1CJUC 3TH5A 1G18A 3K9NA 1GKUB 4I1OA 1Z6TA 2NGRA 2CLDX 3SHWA 2IF0A 2W83A 1G8PA 1NMYA 3KKNA 3LVRE 1T3LA 4EPYA 5IHPA 5CM8B 5EP4A 1VECA 2I3BA 3T5GA 3AH8A 1CRQA 1P9WA 4MH0R 2EWVA 2W6IA 1JB1A 5KUTA 3AGQA 2FPLA 1OXVA 3FTQA 3L0PA 4GI7A 5KTYA 4NONA 1KJWA 4WW0A 3AVWA 2WJIA 2QN6A 1XZPA 3T1QA 5AK0A 1G17A 1CF4A 1Z47A 4CEIA 5JJIA 3BH7A 3U3RA 3ICQB 2OM2A 2REOA 3RS5A 4A0HA 4MDEA 1E2NA 3FMFA 3P4YA 3SBDA 1NJGA 3LA6A 4PZZA 2ZJAA 1O87A 3EC1A 1YZKA 4XWAA 2WPDD 4JS0A 3NBZC 5KSYA 2R6AA 2BOVA 3GLHE 4DKXA 2OE2A 2FPKA 2FPMA 2FDCA 3IO3A 4LV5B 3U2QA 5E4FA 2HXYA 1N25A 4HDQB 4US1R 3Q7PA 4D0LB 1ZUNB 1IJFA 2ZI6A 2KE5A 2BC9A 4B3DA 3KUDA 2C04A 2GBLA 3LLUA 1G41A 4XVQA 4DZZA 4FMDF 3UG6A 1J7KA 3RSLA 5FUXA 1YR7A 1QRAA 1VCMA 4Q7LA 1RKBA 1N6PA 2B6HA 3KDSE 2OBNA 4HB3A 3HPRA 1E2DA 2RH5A 3CWZA 4IDQA 2XTZA 2JLUA 2C9CA 4R2IA 3GLGE 1US8B 5DIFA 2ZRBA 3WRXC 1G19A 3GFOA 2C2HA 3C41J 1XJ0A 2CL6X 3T12A 5H68A 5JBQA 2IA5A 3X1WA 2D7CA 1CJTC 3REGA 4DEXA 2OUKA 5FPYA 2DWQA 2AX4A 2VP5A 4LWZA 3FMIA 3KKPA 4MKFA 3DM5A 5HE8A 4CIDA 5BN4A 2VF8A 3VKWA 1E4YA 3CRMA 5FR2A 4A92A 4CVNA 3WNCA 2ZJ8A 4IW3B 3N2EA 3GLHA 2PJZA 3OEHD 5FFMA 4M4SA 1KI8A 4A2WA 3FDIA 5FPHA 1WF3A 4B32A 1N6NA 2ZI9A 5BWMA 2O8BA 1FW6A 4NKRA 2L0XA 2GKSA 3U7GA 3KJIA 4QOSA 1DAHA 2OG2A 2CHQA 4QGGA 1C4OA 1AN0A 2CDNA 3KFVA 3AF4A 3LBIA 1L4UA 3G0HA 1R0ZA 4KBGA 3AKYA 3CB4A 3IHWA 1XMJA 4PHGA 2BKUA 4BFZA 4PZYA 4GFDA 5DH9A 1E2FA 1XMVA 2QPTA 2FE4A 1XPRA 2A30A 2ONKA 2ZJYA 1MO5A 4QBHA 4BPBA 1LS6A 3EPLA 1G5RA 2V1XA 3NWJA 1Z07A 2J46A 3D3QA 1J90A 1J99A 3IUYA 1EFRD 1U8ZA 4A8JB 1WA5A 1WE2A 2LCFA 4LJ4A 1GL7A 1NI3A 2ZE8A 1GDDA 3QPVA 5C1BA 5EQTA 2ZS7A 4A0FA 2JJ8A 4Q4HA 4HAZA 3KX2A 1KKMA 3KKQA 5JFGA 1DS6A 2PH1A 2QQEA 5DI9A 4D4KA 5JEDA 2UZIR 3A4NA 1N0WA 3LDAA 1VCIA 4OBEA 3EIEA 3THXB 4NCKA 3AKDA 4C7OA 2QAGA 1CS4C 3IILA 3EZ2A 2JLXA 1DAEA 3NBFA 2EFCB 5G41A 2HV8A 2W2XA 1G291 2GEUA 5JECA 2XGJA 2ATXA 1E0JA 2RAPA 3PUXA 2F43A 2ZQ5A 4YDSA 3VR3A 4GSYA 1W0JA 3ZVRA 2VIIA 4BASA 1JQLB 1S8FA 2QP4A 4C0AC 3GLHB 5ELXA 1ZINA 1KMHA 3DMDA 3EZ7A 2W0MA 3F5FA 3WP0A 4I1VA 2W6JA 3ETLA 1HQYE 2D3WA 4LOAA 4ZCMA 1WBBA 2HT6A 2FFHA 3I5XA 3SBEA 1DAMA 4JVNA 5JJKA 1FP6A 2AL7A 2DY1A 2FN4A 2UKDA 4JLAA 5FUVA 1JEDA 2A5YB 4JLMA 4MUBA 4V02A 4Q9JA 3BS4A 3LW7A 2HCBA 1KY3A 2WSMA 4XVRA 3T35A 4WXPA 3LX5A 1KI4A 1NVVQ 3SYNA 1BH2A 1NKTA 1U0JA 1E0KA 3CWQA 4B76A 3GLIA 1VG0B 2WOJA 2ERYA 3FGNA 3P32A 1G3QA 3SQXA 2Q9AA 4JL8A 4PX9A 4TLBA 4ZDIA 2CK3A 1U8AA 2IYLD 2WM9B 2PX3A 3ZZTA 3TK1A 2O8EA 2OZEA 4F92B 1P7CA 1ZNZA 1NVXQ 5DISB 3OIWA 2ZRLA 1O3YA 4RD4A 2ZRGA 4EUNA 4PC6A 4CZ2A 2N42A 1N6RA 1Q0UA 3SJBA 1Z06A 4P31A 5BN3A 1S1CA 4L8GA 1E98A 3VR5A 5DI3A 4EPTA 2IUUA 4DLZA 2BM0A 2QMUA 3EIHA 1UDXA 3B1XA 4DUGD 3P1JA 4N0EA 4FI3C 3V9PA 3W8RA 2J0VA 2GCOB 4I81A 2VHQA 4B3CA 4MGKR 5DE3A 2Q6TA 521PA 3U3KA 1M2OB 2OXRA 1YRBA 3RS7A 1XEXB 3U4QB 2OFWA 1NG1A 1XB2A 2PEZA 4HUQA 4NBSA 4EFLA 3TAUA 3NDBB 3J81k 2O8CB 1DPFA 2A5DA 1LF0A 2EU8A 1DO0A 4LJ8A 1IXZA 1KTVA 1YVDA 3AF3A 4MKIA 3T1OA 3T1TA 1G3IA 2JIZD 5FOVA 2DCUA 4NU0A 5AJVB 3PENA 2V55B 4EJSA 4LBWA 4JMPA 2IC5A 1T91A 1DAFA 5DHAA 3MWJA 4U00A 1T3HA 4B2LA 3QQ5A 1E9CA 3CNLA 5DNYB 4AYXA 4HZUB 1VDZA 4S35A 1RIFA 1KSHA 1KI9A 4GZLA 4PANA 1MOZA 4JLKA 1WCV1 2FFQA 2BMDA 2ZI5A 4NCIA 2WWXA 2DBYA 4RD0A 1Z29A 3NHAA 4MYTA 4DUGA 4JVLA 4TYYA 3LXXA 1E69A 2H18A 1L8QA 1P9RA 2OLKA 1Z0AA 4Z1MA 2IUTA 3VFDA 2XSZA 2HXSA 5FTJA 3EA0A 4JBYA 4MYCA 1P60A 5FBWB 5BQ5A 1GKYA 4DVGA 4OK6A 5KSOA 4LHZA 2GJKA 1LVGA 3A1TA 4IDOA 1WB9A 5KHOC 1YJ5A 2WHXA 4JLBA 3SNHA 1KHTA 2DFNA 3EW9A 4D25A 4PO8A 3X1XA 1DARA 4PC2A 4PAMA 2VHJA 2VP0A 4DC9A 2OCBA 3MLEA 5B58C 4P4TA 3LO5A 1KSGA 1Q21A 4HB4A 4A2QA 1P75A 1EX6A 1MO6A 3M1IA 1KYIA 3UMFA 2R2AA 4ZDJA 1IY0A 1SXJD 4NCHA 4ERNA 4BLQA 4B33A 2J0UA 3T06B 4BLOA 2YINC 4V03A 4JT2A 5FOXA 4U02A 1JR3D 1KK3A 1VG1A 4OK5A 1AS2A 1EFUA 1YR8A 1RC8A 4ZCLA 4LV6A 4ASUD 3TSWA 3OF5A 5HKKA 1TTTA 4LBYA 1GFIA 4WA7A 3B78A 4TSFA 4B2PA 4MKGA 3AUXA 3EG5A 1OFUX 2AD1A 2VHCA 2VHTA 1E6CA 1QHXA 4GMXA 1EESA 2YC2C 1UPTA 3Q85A 5K8IA 3IEVA 1KDRA 1E2HA 2F3TA 3VX3A 1HE1C 1XEWX 2ERXA 1F6BA 1GRQA 3TW4A 3BXZA 1ZAKA 2FNAA 4DT1A 2FFBA 1XDBA 1DELA 2J87A 5CJ2A 1TQ4A 5GJCA 1ZNXA 3PEWA 3UXMA 4WZ6A 3AKEA 4DCUA 4US0R 1NN3A 4BRUA 1R10A 5KSPA 3X1ZA 3I1FA 3DPUA 2GXAA 1SVKA 5GVRA 1FMLA 2XNSA 1U8YA 2QSYA 1E2GA 1NVWQ 5AJWA 1FFHA 1W36C 4DBLC 5K8UA 1AM4D 1WDTA 4B71A 2X2FA 1TPZA 1Q57A 1CKEA 1YR6A 2RGGA 3L0OA 2ZS9A 2ZYTX 2ZR0A 4KXFB 4QFMA 2PMKA 4BLSA 2XX3A 2QPOA 5F2EA 3I61A 2ORWA 3RYTC 5JHGB 5JS7A 2OV2A 2X8AA 3D31A 3U7FB 4CGZA 2CBZA 1OXUA 1W0KA 2RCNA 4IOKA 2OFXA 3W5JA 2R6DA 1UKEA 1US8A 4LC0A 3EX7C 2GEDA 4V0MA 1KY2A 5LB4A 3WYAA 4KI0A 4UJ5A 5EE1A 4F7WA 1GKIA 4LJ9A 1LV7A 3KB2A 3H2YA 1UEJA 2KI5A 2G6BA 1XTKA 3ONWA 4PPQA 2R62A 1OKKA 2IS6A 4GP6A 4XD7D 4ESHA 4HI0E 2D06A 2G1JA 5H1YA 4IVRA 4EPXA 4I1UA 3R9XA 1F2TB 4TMVA 4LC1A 2AK3A 4B3BA 3VNVA 3KXKA 1X8LA 1ESNA 4IOMA 2ZUCA 1KJZA 2PLRA 3TBKA 4DLYA 5FUYA 5A5GA 5JSZA 4MA4A 2CMKA 4LHWA 3QXXA 3VKGA 1E9FA 1NBMA 3K1JA 3KUCA 4Q02A 3DKVA 1HURA 2GZAA 1AKEA 5DYGA 4UNPA 3FB4A 1R4AA 3TGPA 4BWYA 1W5TA 3PJRA 4DLRA 1ZMXA 2V7QA 2XJ4A 1JPJA 3RRNA 4LHYA 1SVIA 2C99A 3SJAA 4L4UA 4PR0A 2VLIA 2A9KA 1YRAA 4KJZA 1FP7A 3TNFA 2XZOA 1VYTA 2ZSBA 5JCPA 5F9FA 2WKQA 2YV5A 4DB2A 1S2MA 5H8WA 3QNUA 2EYUA 3A4MA 2EYQA 3UG7A 4DDVA 4I99A 3X1DA 3FWYA 5C18A 1E32A 1ZUHA 4G0NA 1M8PA 4B74A 2IYRA 1RPZA 3CUEF 1IY2A 1RW4A 1G4AE 1TQ2A 2AK2A 1SGWA 1LTQA 2W6ID 1YZLA 3MUFA 5C4MA 1RVDA 1XCPA 5DYIA 1AQYA 4JVSB 3I8SA 3PUYA 4PSVA 2ZAMA 2F3RA 4M1TA 1E2MA 2ZJBA 2XB4A 4WZBE 3H86A 3BH6A 4LZZA 4D82A 5A4JA 4YDHB 3FKSD 1EX7A 4Q7MB 5HKKD 3K0FB 4B35A 4PXAA 1XMIA 3TQFA 3THYB 3CBQA 5L3VA 1GNRA 1ZIPA 5FTKA 4TLDA 3LAWA 1TADA 3B1WA 3QKRA 3WY9A 5JWOA 3FHTA 4DRZA 1OXTA 3KQKA 4JVMA 4D6PA 2ZREA 4MKHA 2MMGA 2DWOA 1KO5A 4ABYA 3B82A 1SXJE 4OQLA 4ZIRA 1T6NA 4D80A 2ZE6A 2GVZC 4V0OA 2ZR9A 3CKLA 4RD1A 2CCJA 2ZYUX 5D3QA 2GF9A 1S96A 1XCMA 2B8WA 4Z1MD 1B23P 2VYFA 4FMCF 4XSGA 4Z51A 4KSCA 2ASEA 2Z0MA 721PA 4A9AA 4TSFD 1G16A 1NY6A 1R5OA 2R9VA 4OKSA 4LK2A 4EJSB 3FOZA 1ZNYA 1H8HA 2NOAA 2BBWA 5DO9A 4E5UA 1LY1A 1M34E 3BOSA 3I3SR 3SE0A 4M9XA 3V00A 2PL3A 3UPUA 1BKDR 1GIAA 3OIUA 3RNLA 1SZPA 4LYAA 1D2NA 1U99A 4LCBA 4BFYA 1XEXA 1R0XA 1XWIA 1FL9A 3DOEA 4NP6A 2GK7A 1VG8A 2C95A 5AUOB 1QBKC 2A5GA 4HATA 4UNQA 4RSGA 3OEEA 1XF9A 3QKTA 1Z0DA 1PUJA 2V9PA 4G3XA 1TF5A 3KJGA 5DI3B 3R7WB 4AYTA 3LY5A 3OFNA 2FEOA 1P2VA 5CM9C 4B75A 1TEXA 1E9EA 3W34A 2X2EA 3GLGA 1HT1E 3KKMA 2FF7A 5AUNB 3Q5EA 4D81A 2J7PA 2QE7D 4OQXA 2QMHA 2REXB 2GCNA 4RD6A 3O8CA 4TQ9A 2X19A 4F4IA 3GQBA 1AZTA 4Q1EA 1KSFX 2NZ8A 1H8HD 4AK9A 3MD0A 1AGRA 1TU3A 2BEJA 3IBGA 4QBGB 2HDNB 5P21A 5C46F 2I1VB 3B60A 4BGDA 1E9AA 1ZD1A 4LYJA 2Q3MA 4IRUB 4RY2A 1U94A 1K6MA 1KGDA 3A1UA 4EAQA 1OB2A 5BYKA 3TUZC 1RFLA 4DCVA 3CR7A 1JXMA 3VR1A 5J4LA 5ANRB 2WBLC 3VTKA 4TL6A 1QHIA 2C77A 3M6AA 3P4XA 3CF2A 4TYWA 4ZKDA 1Z8FA 2GA8A 3BB3A 3T1VA 4M21A 4DIDA 4O2LA 1A7JA 4X8HA 1NBMD 4Q4JB 1E1QA 3CRW1 4QGHA 3SC3A 4G01B 1ZW6A 4EQ6B 4D0NA 4FCWA 3FYHA 1HEIA 2OCPA 5AUPB 2LKDA 4IDNA 4JT4A 4UNRA 5HR5A 4OI0A 1OIWA 1N6LA 2ZJ5A 2OBLA 3C5HA 2RGCA 2QAGB 4C7OB 3LWNA 3TUJC 3GLFA 4DLWA 3AUYA 5FOTA 1A5TA 1XBTA 5EUQB 5TY0A 2QM8A 4YONB 2OXCA 3GPLA 2MSCB 3BK7A 3RS2A 1JQJC 1Q3HA 3U60B 5LB2A 2QP3A 4Q7JB 2ZUBA 1XPUA 4QKQA 4PPFA 2HUPA 1MABB 4M9SA 5JWHA 2NZJA 5J4KA 1W7AA 3LW8A 4G5QA 4GOJA 5B30A 1XJQA 4JLDA 1MR3F 2ODEA 2WOOA 2Z6VA 2B7CA 4BLTA 1K8RA 2CCKA 4NYJR 3VU9A 3AP1A 1RYHA 3K70C 3PQCA 5FBQB 221PA 3I62A 1II0A 3GMTA 2IF2A 1EGAA 2IYSA 4TQUS 5AJYA 2QP9X 2GTPA 3X1YA 4AYWA 2ZSFA 3U44A 4JBWA 3IGFA 2IS2A 2QMOA 2V7QD 1PLLA 1G8HA 1SKQA 3NC1C 1NMZA 4AD8A 3ZYCA 4TZ0A 3Q8XB 1CBUA 1NSFA 2OAP1 4B47A 2CL7X 1U2RA 2ZU0C 3ND9A 2VL7A 2P5TB 2ZSAA 3NTUA 3SOPA 3LRPA 2J7KA 3CH4B 3SS8A 2J3EA 3KZ1E 1G6OA 3WMGA 1M6NA 2QMEA 2W00A 2XEXA 4BFTA 2YOHA 4DLSA 1Q1BA 4ZDKA 5JWRA 2W0SA 4OHZA 4QJ3A 5CIQA 2G88A 1JR6A 4UNNA 3U5ZB 4BFUA 1GZSA 1SHZA 4EPRA 1ZP6A 2BWJA 2NPFA 3WXMA 5HE9A 1M7BA 4FW9A 2JLSA 4A0GA 4A6PA 3CW2A 1W0JD 3QXJA 4JKYA 3VNUA 2H92A 2DFTA 1GRNA 4OK3A 2ZYWX 1X3SA 4CEJB 2QROA 5CK4A 1SVSA 4RD3A 3VU9B 1JECA 3GEIA 2F7SA 4YMWA 3DMNA 1Z28A 4P3YA 4KFRA 3CX8A 3T34A 1NKSA 1ZJ6A 2VSFA 2H17A 4Z8YA 2DFLA 4IOJA 3ASZA 4TMWA 1LW7A 2AN9A 2FEMA 3NIBA 1GUAA 4WAUA 4AC9A 2ZM5A 2D74A 3Q72A 2NO1A 2CHGA 4RKFA 4C0BA 1TAGA 1TF7A 5C4GB 2O5VA 3VHXA 5CK5A 1SXJA 2ODNA 3HWSA 4QL3A 3RRZA 2G1KA 3K0CC 1NF3A 4BZPA 4Q4LA 1WXQA 5FTLA 3QVUA 5CDFA 1XD2B 3KQLA 4A8JC 3KTAA 1A82A 1KI7A 1W4RA 1KK0A 1E2QA 2F1JA 1W0KD 2RKOA 2Z83A 1XRJA 2ZANA 4P4UA 5GJVC 4IDHA 1GWNA 3K09A 1YZNA 4URUR 1BYIA 3WHLA 1MKYA 1D5CA 3CF0A 3FFAA 2FZLA 3QF4A 4TL8A 5KNDA 1S3SA 3ZZ0A 2CLCX 1JAIA 3DVLA 1OV4A 3N5CA 3AVVA 1R5NA 4HDCA 2V54A 2PBRA 3HU2A 4DDTA 4O25A 3NG1A 4ASUA 1G64A 2PX0A 821PA 1ZRHA 2FU5C 3TLXA 4FINA 1EWQA 4CEIB 1R0WA 2O0KA 1ZM3A 3AV0B 1EXMA 4TLAA 4TMXA 1Q44A 4KYUA 3RAPR 4E07A 1CTQA 3NVAA 1XTSA 2GCPA 3KXLA 3BWDD 2PT5A 1HYQA 2CHVA 4TLEA 1KI1A 4II7A 4IXNA 2CE7A 2ZE7A 2AWNA 3THWA 1JR3A 5LD2B 3EASA 2ZSEA 1MO4A 4JYCA 3IIKA 2LWIA 2WWYA
chains in the Genus database with same CATH superfamily
3A25A 4EFDA 2FN7A 4OP1A 1MAHA 4QDZA 4C7KA 1U65A 4LNUA 2AE2A 2HPAA 2COEA 2WICA 3MWYW 1U90A 3ZU3A 1NBOA 1YIDA 3GHHA 4OHWA 4ESEA 4BXOA 1KYQA 2OUIA 3H7IA 1E7QA 1OBFO 1J9EA 1T9GR 3UJ9A 2O7VA 5DNUA 2I1QA 4M8IA 3KJXA 3PWZA 2O5RA 2M6RA 2C5GA 4FZ5A 4CLXA 1W34A 4CUJA 4A7PA 1EWYA 5EIOA 1NXTA 3ZXSA 4XD2A 1XK6A 2HT1A 1S9DA 3D3JA 3LPLA 3UAOA 4MKRA 5F9MA 3H16A 4UEKA 4TS4A 4WY5A 2BFBA 2Q41A 4ERXA 1SBQA 5KYXB 4WUVA 4HAWA 1QAMA 5HCNA 1WMDA 4XWOA 2VPWA 3ESXA 3WBJA 1L7QA 4XWTA 5JDIC 1V48A 1UXOA 1AQUA 5JXHA 4P9NA 1BSVA 3OE4A 3NETA 3EVCA 1LPAB 2VYNA 4TRJA 5I7HA 1FDTA 2BR3A 2C7VA 2CJWB 3OTIA 4PLFA 4MUIA 3EUWA 4RVCA 2FHPA 1FU8A 4J76A 3ZLJA 4YIHA 2OBYA 4R68A 1M1NB 2BGMA 3D81A 4IFTA 2XWPA 3EYAA 3OSUA 3OVMA 4RWZA 1J8MF 1ULAA 2XADA 4I3HA 1IN4A 4NNPA 2YWRA 4MS1A 4P5EA 4PR3A 4H1WA 4BC1A 3TQCA 4UOQA 4BVEA 2ESRA 2GN9A 3P9QA 4L8LA 2OGSA 4WSOA 3NBXX 3ZGVA 4CQNA 3IAS1 1XGKA 4OIFA 1J8QA 1E2EA 2MCFA 1WS6A 1FP1D 4AN4A 5KYWB 1GZ3A 4XB6B 3UH0A 2E87A 2NXWA 1ZNWA 1GA1A 3AJRA 5JPDA 3ADCA 2GESA 3TLGB 3KQNA 1NLYA 1C1XB 1G2OA 3FVVA 2O3TA 3EZFA 4Q21A 1U80A 4S04A 4GSKA 5A1JA 1LSJA 1HNZB 5HKBA 3LRTA 3CRVA 1EDDA 1CUEA 4TMKA 5AKIA 2VT3A 1IY9A 3SC2A 2ETVA 5A5EA 5C7IO 3FHCB 4INPA 4GL2A 2ONZA 4NPCA 1RE0A 1S01A 2ZG6A 4FDMA 3D0OA 3W8DA 3DT9A 3EAQA 4GZMA 5AVUA 3CUKA 2C3MA 3ERCA 2X76A 1B8PA 1S7CA 1T26A 1SU7A 3PKZA 5FL7A 1SRRA 1QFJA 1X7YA 4PAGA 3QEAZ 1XZEA 1FX1A 5IZCA 4CF4A 4W4TA 4KKXB 1QM5A 2JIOA 1QCDA 2Z4RA 3KHKA 4FK8A 4Y18A 5FWXA 4BE9A 4NZMA 2P2ZA 4CG0A 1Y8CA 5LZ2A 2NTYC 3VV3A 4AJ1A 4LX0A 3WQRA 3PRYA 4YO7A 4ALIA 4PIPA 2JAXA 1ZONA 1JJ7A 2G07A 5A3JA 3GYBA 1OTYA 5B1DA 2RHOA 2IYFA 3O3NB 1BN6A 3PITA 3KQWA 5IYZB 3AY6A 3WA7A 3G7UA 1XTZA 1K8ZB 1ZXXA 4D7AA 2DG2A 3VYSB 2IDJA 3ILHA 4P81A 2IYTA 1P4AA 4IKPA 5TV2A 2ZJ6A 3TL6A 4Q9AA 1OH6A 1U2EA 4C01A 1KZGB 3L6CA 1YQTA 3NO4A 4B3IA 4E7OA 2BY4A 3BMQB 1FP4A 4RQBA 2LKCA 3HCEA 1YO6A 1BEUB 4E31A 1QPGA 2P9ZA 3MJ4A 4LDJA 5G40A 3H2ZA 2QWXA 4N5IX 5CB4F 3HJGA 1XAGA 2I80A 2VK4A 3O8OA 4ONEA 4D2IA 3TTUA 5JVDA 4B6JA 5KNBH 2IXAA 3BBPA 5J47A 1KETA 4Z3KA 4NYMR 1S2NA 4KC0A 1PK7A 3UMVA 4NNOA 3OAAA 5T4EA 1RRKA 3VTAA 3A10A 1I30A 4ARIA 1ZCFA 2BFEA 5I4KA 4W5RA 2WIAA 1NURA 5TVKA 4NNJA 3OPYB 4LHVA 4XSHA 5A6SA 2O8BB 2Z5GA 4EJMA 3EGXB 1VIMA 5AHXA 1ISJA 5EXDA 3M5DA 5AIAA 3BHMA 4C4RA 3ZWBA 1RADA 4MQFA 5HFAA 1QYVA 1HSOA 1QE5A 2IXDA 3K94A 2GNOA 4PO3X 1AURA 2GERA 2VRCD 4FBGA 5FA6A 4D9KA 1BD4A 3ELYA 5CRIA 1U8CB 3KTAB 1XNJA 2GVNA 3PEVA 3P45A 4Y2SA 4DB4A 2Y71A 2YXDA 2ZWIA 1IAVA 1MV5A 1RXSA 2QQ0A 4BFSA 1X77A 4OGFA 3AG6A 3B8EA 4DJTA 2I7CA 2AOTA 2SNIE 3FDZA 4UZEA 2OL4A 3D4LA 4CDMA 2G70A 2AX3A 2PBZA 2B8TA 4BO2A 4EJ6A 2YXPX 1GR1A 2V4UA 5EZ5A 1N77A 3IQEA 4NFYA 4XQ0A 1X80B 4EB8A 1CDOA 2UYCA 4B31A 4UEJA 1CB0A 5JO0A 3FPGA 1QAQA 4KZKA 4A23A 3TG8A 1Z7WA 1ISHA 3B51X 3DVRX 2NU7B 4NYIQ 5IN4A 621PA 2P9GA 2PWPA 4LOJA 2ZDHA 2XNHA 4H6PA 4M0DA 3MINB 4XB1A 3RRBA 4BVAA 2XMSA 5GAJA 3DBIA 4RTPA 4GKVA 4O4JA 3UENA 3I23A 2JJ2A 3SIPA 2ATVA 3TD2A 1WXHA 1JW9B 2J6HA 3GW8A 1BO6A 3CISA 1X9HA 2O2GA 3HADA 3N2GB 1CUDA 4RFVA 3T38A 3W7BA 2FZEA 1TL7C 3AVQA 3EUEA 1UIRA 4XEUA 3IBYA 3H5IA 3LUHA 2WVAA 4N6NA 3DPSA 3EUAA 3ADBA 1WMEA 1I6MA 3ZV7A 4K03A 1QIGA 1ZK4A 3TRHA 3TMAA 3IPXA 4ROTA 4OBBA 3G0IA 5AYVA 5J40A 4G8JA 2VYVA 4HPWA 5EIEA 4DCCA 2RARA 3L1UA 3A4LA 4UATA 3VAAA 4FB5A 1WQ1R 3DMFA 5TT1A 3UJCA 1Y0BA 2DXIA 4EY8A 1ZU5A 2YRXA 3I39X 4GYKA 4M8KA 4US2R 4JP3A 3ZHVA 3ZBTA 2E5WA 3VOSA 5LQNA 2ZSIA 3U44B 2PSJA 3HRHA 2B92A 4M9RA 1WCIA 2JJQA 2Q5EA 4EVRA 3IOYA 2O52A 2VJKA 3FX2A 4FCCA 4WZAB 5LZ8A 5LQKA 4U7JA 2NUTA 2XAAA 2D0OB 3IKTA 4QAJA 3AFNA 1S8NA 3DBRA 2J0UB 3IDQA 3WKAA 3E7WA 1LRLA 3UEOA 3IT3A 1Y6GA 5LBIA 3O6VA 2P9CA 3NWBA 2FA9A 1OA1A 2X5XA 3BFPA 2OWEA 2Q5IA 2XPCA 4O2AA 5TQ0A 2W2VA 4Y7CA 3OIYA 4U2CA 2WWFA 5LWQA 3T3OA 1MABA 1T8TA 2DBZA 2VSYA 4ZVLA 2HPZA 5JXGA 2H4YA 3A3YA 2H8KA 5IDWA 1YRHA 1T8UA 1ZSNA 3F6BX 1XTRA 1P8JA 2C8VA 4D45A 5IJWA 4EUSA 5JY1A 1HT3A 1WP9A 1UBGA 1QRSA 1FVOA 2BFWA 1XRRA 2YZGA 1KDZA 2ZJOA 2PUDA 3U40A 3VZCA 2Z2ZA 3EYWA 3SHVA 3RVQA 4XQEA 3L7DA 4OL0A 5FL7D 1QQ6A 1A5BB 1EJ2A 3EIWA 4R7ZA 4Y3UA 5T57A 3RU2A 4DIOA 4DLXA 3PFBA 1Y3IA 1MOSA 5A4AA 3MAAC 4NICA 3PXXA 2AN5A 1CZRA 1XU9A 1Z4IA 5EJ4A 4X97A 4COKA 4JI4B 1CFZA 1FQJA 4BRZA 4GHWA 4PFSA 2PUHA 3WGOA 3NP9A 1G9XA 1I3LA 4ZJUA 4YR9A 2BISA 4K87A 3AZOA 4IIEA 5CYFA 4R4JA 1C8LA 1ZA2A 2ORYA 1EFHA 3MQFA 1JI0A 1TW2A 3UWSA 2IYOA 4KXVA 5BQ3A 2ZIGA 4TYNA 3LOQA 4MIEA 1NUTA 1XWFA 3FIJA 1C9EA 1YFKA 4WCVA 2AN4A 3OPYI 4O0LA 1CHDA 1OAAA 3RC2A 1MVOA 2AMJA 1PR3A 1NR5A 1B0UA 1ZJJA 2I2DA 3AFGA 3BA1A 5JATA 1YDMA 3VISA 2RGNC 4TMTA 3K09C 4NMMA 2YFHA 4AIIA 4D3FA 1UM9B 4LHXA 2CXXA 4JGBA 1JVBA 2A7XA 1YU6A 3GGOA 5ES4B 2Y4NA 2YXEA 3EMBA 3P96A 4TLMB 4X66B 4ZMSA 5CVVA 3TW0A 4EHHA 5C80A 1C9YA 5EXEA 3RYFA 2VRNA 4B84A 4U9UA 3JARA 1YJ8A 2FPWA 4KW7A 3ZGZA 3NEYA 5DX0A 4C07A 5JD3A 4BMYA 1A7UA 3K16A 2BZ0A 3IHLA 3QSYA 1B26A 1W5AA 2Q3CA 1AK1A 3KQOA 3PCRB 4QGFA 1VHJA 5AVJA 4CG1A 2NX2A 2F1OA 2PKQO 1V4BA 1OQAA 4H7FA 4Z0TA 4DMFA 4GNRA 1NLFA 3DLAA 1RBQA 4W7HA 1ZH8A 3GT3A 1N7GA 1NA5A 1NRXA 4U8HA 3QU2A 5FPSA 1D0SA 1A3CA 4M8NE 5CNMA 1ZG3A 1NVUQ 1X7XA 4QBKA 3HU5A 2EEPA 2JANA 3E9MA 3N0XA 1L8XA 2EL9A 4FHCA 1LX7A 4BX3A 1GRCA 4ZVSA 1L7AA 5HMLA 4DUZB 4IXDA 2V45A 1MC1A 3NC0C 4W8GA 1FEZA 1SURA 3FTPA 3ZZNA 3BE5A 4Z86A 1SOMA 2IIQA 1V11A 1NVVR 3LQKA 3SSAA 3B1YA 1Q0QA 3P26A 3U3MA 3LX4A 4X7BA 4HAIA 3ZY6A 2FEKA 5LMZA 2CVZA 3IAFA 4LTNA 3WOHA 1T9CA 1UBTS 4Q6WA 3T15A 1Q7CA 2VH1A 1TK9A 4GWKA 3ZVLA 3L7AA 3INNA 5T8KC 2WHRA 2H5EA 4TWAA 3NDIA 3U9LA 1X80A 5HW0A 1CQXA 1NW7A 2EJVA 3SQWA 3ZWDA 4AJ9A 5IKMA 1QONA 1SB8A 1UEXC 2NT3A 1AXGA 4UC0A 1JMYA 3T7CA 1P0MA 1UWVA 3GEBA 4CM1A 4J07A 3CW9A 4JJGA 5GVSA 4J4HA 1KDOA 1TU0A 4DCTA 4DM4A 5IUJC 2YOGA 1E5LA 2VUHB 3R0IA 1IULA 4Q3NA 3LHDA 2AFVA 3Q6NA 4JJIA 2ADFA 3UMGA 1OW3B 3QHAA 1L7BA 3V1MA 2CVPA 2DOKA 5GWXA 4B48A 1TIKA 4BIMA 2CB0A 2A0UA 4NFSA 4U7DA 1IVSA 4JC4A 2A4MA 1XO1A 4TTTS 4XYEA 3S2EA 1RJGA 1OPXA 4Y9RA 5JAZA 5MDHA 3EGXA 5FO0A 2JL1A 3RFCA 1SQSA 2F43B 2E48A 1ADFA 2H9YA 4FQ7A 1FW8A 1J56A 1ZUWA 3NJRA 4JOQA 1I4DD 4TL7A 5I8ZA 4TV8A 3T0FA 3THYA 1SXGA 2C7GA 1OI2A 3GYGA 4YRSA 2JRLA 4KQ1A 4AROA 1FVHA 4CR8A 4ZYVA 2HSDA 3JVEA 2A5LA 4K0RA 2AD5A 2IYYA 3Q5GA 4KXQA 4N6GA 1B41A 4NLLA 2IEYA 3O8OB 3FMVA 4MCJA 3V7FA 1WCYA 1IMJA 2JIDA 1D4AA 1TVMA 1U1GA 3WMRA 2XOKD 1V1RA 5TNXA 4ID3A 2Q3JA 4H77A 3B89A 2DPXA 3RJZA 1XF1A 1RJ9A 3Q8WA 1EM8B 2H63A 1K6XA 1PFVA 3KPUA 2D6FA 2EX0A 4NY1A 3WYDA 1D2GA 2IOFA 3GJ8A 2BGKA 1LJUA 3BD7A 2FJUA 2C5AA 3JD4A 3PBKA 4AF7A 4CM9A 4F71A 5LKRA 2CNWA 4LVCA 3IAM6 2CHEA 4DADA 3FPLA 1NV9A 3GJ3A 4IIJA 4K6GA 5U4QA 1NT4A 3PEUA 1GQQA 4KDFA 4YRPA 4YYZA 2Q62A 3MILA 4D56A 5CFOA 2ZXEA 1A95A 3LCUA 4HYQA 1BNCA 3KPVA 3FNFA 1RBMA 3GPCA 3WGTA 2O2CA 5EJMA 3ZHOA 2DM6A 3IC5A 2OHGA 2IXEA 3MWLA 3RKUA 3FPJA 1ZCAA 4BNNA 2E4WA 3HXLA 3PZRA 3ZD8A 4DZTA 2VZ0A 3N7AA 3CSSA 1ABBA 1PZMA 3DBLA 3DZFA 3FR8A 2XCRB 3GJXC 4QFCA 3LPCA 4QA9A 5IAKA 3FHJA 2JASA 4AT1A 1N6IA 4NE9A 4EKEA 1GLGA 1HH4A 1J2UA 2X22A 1TLLA 1TJYA 3DWEX 3PJFA 5DGTA 1FQKA 3WJ1A 2P9JA 3GN2A 5KVVA 5LP6F 4JK3A 4WKPA 1GZ6A 1I5OA 2EX1A 1EFVB 3SYTA 3V6LA 2AMFA 4WX2B 4ZT6A 2D5CA 1E9SA 1J1ZA 1O96B 1P1JA 5ITSA 5IMBA 1XTQA 1XJCA 4U3JA 3SX0A 3L0IB 1ZAYA 3ITDA 1C1XA 1CUUA 1MBZA 2C83A 2WD8A 2WLTA 2C3PA 3MBKA 3CTPA 4H7IA 4OVKA 5D3KA 1T5OA 3K32A 3O9MA 2ZWPA 1KWKA 4GMFA 3U62A 3R3ZA 1W4CA 4W5JA 1MIOA 3N0RA 1I5EA 2BGGA 2CJXA 3JVVA 1A76A 1GITA 1NRJB 1CUHA 2BMWA 4HLDA 4JQZA 4D4MA 2PV0A 3ILSA 4Q4CA 1AUOA 1GHTA 4DC1A 1Q1AA 2C4WA 3P9SA 4CXMA 1OWPA 1GU0A 3QUCA 3QVTA 4YP0A 4LVUA 5EZYA 4PG4A 4HWPA 2HQOA 1WZIA 4GH5A 1ZJWA 1OB5A 2P62A 2VDJA 3EVFA 4ZOLF 1E4VA 1UKZA 1VLVA 3QVJA 5K2MA 1F17A 1WABA 4HS9A 4ES6A 1XU4A 2A0KA 2PA3A 5GJWC 3RG2A 3HR7A 2CDCA 2HIAA 2X14A 3I76A 1RCFA 3MS7A 5BSUA 4ALKA 3W5AA 2G0NA 3M3PA 2FWAA 1DAKA 3I0NA 1FOEB 1ORDA 4X92A 3HWWA 2JG3A 1LLDA 3PQ4A 3I01A 1GILA 3V7WA 1HRDA 1QKIA 1V3UA 2FV8A 4OI4A 4MI6A 3ZHTA 4BP8A 5AVZA 1ZMBA 3MYYA 3WYEA 3D6MA 2JB9A 2JJYA 4FHGA 3AINA 1DZ3A 4WTOA 4YXWD 4D3ZA 4PYLA 4YFVA 4N7RA 1KSJA 3GLUA 3N8IA 4RTNA 1ZUNA 1IZ8A 1ZWLA 1I2DA 1R2QA 4RVDA 3IP3A 1R16A 3T9DA 1IQPA 2EGUA 3NBKA 3G8BA 3SEAA 3ZDEA 3RANA 3LUCA 1Z83A 4G9BA 5HX7A 5K9ZA 2YWXA 5AR1A 4DT1B 1L4FA 1U8FO 5ICGA 1FLDA 1F5NA 3LPMA 4UW9A 1K2VN 1RSZA 3LQQA 1GNQA 2GEKA 2H1VA 3E1SA 1FNNA 4K6OA 4E33A 4KSBA 2Q5QA 1L1QA 4YJHB 4LNUB 3VNSA 1SUPA 1W46A 1J2RA 3C74A 5JZVA 3K8YA 3CG0A 1OIVA 3PUVA 3BMNB 4JXKA 1JKJB 4E5DA 4OTZA 2XMZA 3EG9B 1L5WA 3SX2A 4WNAB 4L27A 2PPLA 2G5GX 2PUTA 1L4HA 2QY6A 1Y5NA 5AWFC 3SHOA 3VQTA 3A8TA 3EIQA 2HGSA 5DGXA 2FUCA 2J3MA 3IJRA 3L0DA 3A6EA 4FFVA 3Q4GA 4M37A 3WL7A 4UM9B 4OQFA 5KJCA 3DBHB 2GZ1A 4PZAA 1QP7A 1L5ZA 2DPHA 4YAJA 5DX8A 5CM2Z 5GIOE 1YI1A 2PPVA 4HX2A 2P8SA 1COWA 3CZRA 4C7MA 3AVUA 2V58A 3TEJA 1PJ8A 2RHMA 3KV1A 1L8OA 1E2IA 4OU5A 5K0GA 4MW9A 1LNZA 2GARA 3KQQA 1UJNA 3UW3A 2ZT8A 3RYIB 3DEZA 4ND4A 4KX3A 2O54A 1O9BA 3RS0A 2C31A 1SCKA 2DECA 1YE8A 3DR3A 3NT2A 4OP2A 5TSDA 4ZK6A 2GFHA 3VPCA 2UZAA 1QH0A 3IULA 3HUFA 5HM8A 3C6QA 1X7WA 4FN5A 3I2IA 1MOPA 1TYDE 4D43A 1UC4B 2EP7A 1GA4A 3FCCA 1NBME 4FZVA 5TEWA 3TNYA 4D5EA 2V7PA 2XCSB 4I4TB 2ZROA 3WRYC 5JC1A 2AFIE 1OCEA 5KQRA 2FP3A 1UMBB 3I9JA 3HJTA 4C0SA 3BHJA 2GXSA 1FFWA 2QHXA 3IHKA 3R6LA 3W3AA 5B3JA 5SYAA 3HXPA 3PNKA 3G88A 4HNRA 5E1MA 3FYTA 1BKYA 4I55B 1W44A 1RXWA 1DJOA 2XNJA 3PR1A 3KU1A 5J4VA 2F67A 1QHSA 4NE7A 2A67A 2I65A 4UBMA 3ZQUA 4BWVA 4UQLA 4INJA 1Z8NA 4MWCA 5F1OA 4JB0A 4ZPJA 1N2CE 3DTYA 3H2IA 2X7HA 4OFXA 5DNCA 1XDSA 3F0TA 1QTRA 4Q4HB 2E18A 2OILA 1H66A 1GDTA 5LOVF 3AUKA 4FJ2A 5GMOA 5IG2A 2GWRA 3PX7A 1ZEMA 5CA1B 1XEFA 2QORA 1UT8A 2RMKA 3EOZA 4M9QA 4ZMBA 1KO8A 4IWYA 2XXBA 1KH1A 4RHFA 2V7UA 4DLLA 4L8VA 2OD7A 1ODFA 1U0EA 1ZX1A 3AETB 3N6RA 4RMNA 1SG0A 4B1FA 5F7OA 4Z4GA 1XNRB 5EHXA 1EBFA 1G7RA 5AXBA 5FA8A 4N5HX 2ZULA 1R0BA 2I6GA 2WJYA 5ALPA 4L6CA 2C82A 2P9TA 4RENA 3L4JA 3PA8A 2H4WA 2ZS8A 3NS7A 1IE3A 3SI7A 4CEJA 3UB4A 3C7AA 2KB0A 1IZ0A 1W2WB 4RKYA 1E4EB 2YV2A 2AN3A 3NM6B 3L7IA 5JH7B 3UUWA 1FPQA 2FW9A 4HUQB 4GBMA 2WTBA 4KWIA 1SKAA 1U0GA 2VQEB 2QYHA 3MWFA 5FULA 3ZH2A 3VVLA 2JVJA 4KO1S 4FFRA 2Q4EA 3ZE7A 4QATA 2WV7A 5DX1A 1JNYA 1EHCA 1Q0ZA 2LD4A 4YUWA 3RTDA 3FYSA 5E2AA 1NJFA 1M1YA 3RVBA 1TAQA 1X70A 4KAAA 1Y9ZA 2D1SA 3GJ6A 3NHZA 1PFYA 1Q91A 4HMPA 1E62A 5DHFA 3U13A 4DC0A 4DIEA 1IJEA 1JG1A 1W48A 2G9UA 4HNTA 3IBTA 4Q9LA 4JLVA 4M1MA 2OR3A 1QJ4A 3UWDA 5KYTA 1AKYA 3S8EA 3DCIA 4PE5B 4AZVA 3PJEA 1R4NA 3HGMA 4JXJA 4BUCA 4BFCA 3IQZA 4QRHA 4TSRA 2W9XA 3RYHB 4CM3A 4GI1A 4OFWA 4U7FA 2E7ZA 1E3LA 1LBSA 1Z0IA 2B4YA 2HX1A 3ASVA 4FNAA 3FE2A 3WMEA 2G82A 1FTSA 1N2HA 4HXYA 5ECGC 4Q48A 2G83A 1SOVA 1KAOA 4FUTA 1NNSA 4E70A 4ZGBA 1M1ZA 5FLEX 1W7AA 4HR7A 2PRKA 2OTCA 5FD8A 2XOEA 5JW6A 4R7GA 4BNHA 4QUKA 3KLPX 3RAJA 2O1WA 1PDOA 3SR0A 3RIYA 4H7KA 2MINB 1HO3A 5D3MA 2IT1A 2R7MA 4IKEA 1VI2A 4CKYA 5C8DA 3RVSA 1OX4B 4WK6A 5LQRA 3DOUA 3LUGA 2ET6A 3G2JA 1MJGA 1BJTA 3K4QA 2GN2A 1AKQA 1DUVG 3P9ZA 2VR1A 2Q1XA 3V8MA 1T2CA 2IGTA 4ID9A 4F86A 1ZIOA 3R6TA 4FGKA 5D6OA 2F6RA 3OUUA 4ENWA 1TKCA 3HB5X 2Q27A 2PXHA 4A8TA 4Z2YA 3PDCA 4JT8A 3HYSA 3R75A 2JA2A 2Y1LA 5PNTA 1G1MA 1JH9A 2AI2A 2XYHA 3GRKA 3HV2A 1UKBA 3G7SA 4P3PA 2WJGA 3LOUA 5HF5A 1MRNA 1IG0A 5AKGA 4OM8A 4PQYA 4HGYA 1WOYA 1VFPA 4F7DA 1P2GA 3E05A 1WSBA 1YA8A 5FLYA 4N54A 2WE7A 1B0ZA 1QYWA 3AFOA 1MLDA 2ZB7A 1CF2O 1HZJA 2Z30A 4RPIA 5CVEA 3V8VA 2WMOB 3NKFA 5L3SA 2WVJA 4AF6A 1NQTA 5KYNA 1JFTA 3TIGA 3C3DA 4KAJA 4BLUA 1K9SA 1N9GA 4FKBA 4F8JA 5EJ8A 1P72A 4Z3DA 4FOLA 3S2UA 1K0UA 1VKNA 3LDUA 4X7MA 1MH9A 3UM9A 1UQTA 3C5EA 3IIJA 1GNSA 1SCUA 1PUXA 5C8YB 2ZJZA 1P61B 2PRYA 4Z9XA 1CY7A 3FUVA 1CW2B 5D00A 1FFDA 3ZWCA 1QS0B 5EUMA 3MCAA 1D5WA 1TYBE 4ZP1A 2ODBA 5DULA 5FYQA 1SXJC 1EUCB 3NNNA 2G0AA 5F1PA 3UUEA 4YCBA 1U4OA 1QIIA 2WYOA 3E3OA 3OA2A 3NHSA 3HUEA 5LP6B 1Z6YA 2XSZD 1JHOA 1Y1SA 3WHIA 3PNBA 5TPZD 4CMGA 2JCBA 1FB5A 3IAM1 4G0MA 4JROA 3ZHRA 1QCYA 3TTWA 1AX9A 1Z62A 3FFXA 3IE0A 3HNPA 3ZDYB 1QRTA 3EPHA 4ADSG 2Q1SA 2RI1A 2WWHA 3DA8A 1CX9B 1JLLB 1RM0A 3A9WA 4Q6BA 1BMFD 4FNMA 4QULA 1XPOA 5B4VA 2FUKA 5E38A 4Z0PA 2WAMA 2FR1A 1LFAA 2AZMA 2NACA 4PICA 4POAA 4OATA 3UKJA 4O08A 1MPXA 2GYYA 3EPKA 1EVEA 2I99A 3PDHA 2C8JA 1YGPA 5K5EA 2Y1FA 3IELA 3CRZA 2YN4A 3OTHA 3FVRA 3PGMA 2WU0A 3BRWA 3OQBA 4M88A 4Y6SA 3UA4A 2V6FA 5EP1A 2NMVA 5HMMA 2YJ5A 1TGVA 3IKMB 1P4JA 4JQSA 3RTGA 4ZHQF 2H29A 5IJ0B 1QU3A 1DAIA 1LBIA 1OR8A 4R0VA 1QGED 2IPAB 3F74A 4P4NA 4PXSA 5KOYA 4URYR 3QEBZ 1LV8A 3TNLA 5NULA 3GEMA 1I13A 3H5RA 1G2QA 2H48A 4RFSA 3OECA 3QXHA 4OYYA 2AKAB 1V9CA 1YF3A 3IV6A 1X8KA 1XA0A 2R96A 4M53A 3W5IA 4WCDA 1XZKA 3SJUA 4P36A 3RT9A 3ABQB 4LDZA 2PD6A 3EGDA 3KXDA 4HUTA 3GAAA 4BVBA 5K8LA 4Y2XA 3ZVMA 4AO6A 1KEUA 4PSUA 2R6FA 5IK2A 5T6BA 2AA3A 4GVLA 3AR3A 4M1QA 4HXFB 4TSKA 1KBZA 5DIZA 2HK8A 2P9YA 4OU4A 4UBIA 5EXTA 3G2LA 3IOEA 3PZBA 4TTJA 1NQXA 1E63A 5CTAA 3EWAA 1ONBA 3QGMA 3E9ZA 3U56A 4GLOA 1AUVA 1V11B 2C29D 4IBOA 5EKSA 2JIPA 4DCOA 2J48A 3M1LA 4OQDA 4XWYA 2PT6A 4CMJA 2C2WA 1M9NA 1G8MA 2KS6A 1NU6A 2RFLA 5IAAA 3I9MA 3PA6A 3S40A 1UXHA 1XC7A 3OEED 3NWOA 2ON6A 4IXTA 3P20A 4FQ8A 4AG3A 1JX6A 2H1WA 3PDIA 1QK4A 3TW6A 1QAOA 3CLSC 1TZCA 1GPWB 5C7LO 2XJ9A 1G7TA 3QH4A 3TRFA 1X7XB 5GTDA 4UHKA 5AJTA 2RHLA 1VIAA 2I7DA 1W1WA 3G02A 3OLVA 4IGKA 3T5MA 2OV3A 4NWIA 1KKUA 3V4LA 2O2HA 3HUTA 4PSKA 4GDMA 2YIMA 5JC8A 2H0RA 2X8JB 4CMBA 2CVFA 4ETWA 2XRMA 1ZC3A 4GT1A 2VTBA 4NDAA 4DNQA 2J3QA 2E4UA 5HJ5A 4NF2A 5EJEA 3PDUA 1LTHR 4WJZA 3P52A 3MBIA 5LNK1 3HO8A 2DSNA 4E4RA 2P9HA 4WBXC 4OXQA 4ILEA 5TJ9A 1CR6A 4FDUA 1YQUA 3VBEA 4E08A 1Z2DA 1ZQ1A 2E4YA 1DQYA 1UCFA 3V1TC 3MS2A 5J1TB 4L4YA 1MO3A 3EBOA 1PNQA 1QH1A 3W6ZA 4H7HA 4HLNA 3LVFO 2YTZA 5AI9A 4ETMA 1EWTA 2FRDA 1ETUA 1OWLA 1KTIA 3W4JA 1RWNA 2OC4A 2UVQA 5DNEA 2YZMA 5DWDA 5BW6B 4UE3S 3BJIC 3MC1A 5TS3A 3R8FA 5G0VA 5SY9A 4KP7A 1N5LA 1DO2A 1NAIA 4IG9A 2O57A 2OSVA 2D59A 1RWOA 1UJBA 4L5AA 1YRYE 2V03A 2YJNA 2AV6A 1SUAA 2V7VA 1EFTA 1XKQA 3C4QA 4IYRA 4QFDA 4BNIA 1L7VC 1HY3A 1Q1ZA 4JCCA 1MN6A 4RPLA 3V2IA 3UV7A 1PEKE 4TUYA 4DILA 5C8ZA 5CHEA 3T9CA 1ISGA 1T4GA 1XHEA 5EEGA 4B79A 4XUDA 4PCUA 8OHMA 2PWBA 1EGVB 2ANBA 2BEKA 3L7KA 3PDIB 3VR4H 3IA7A 3P9PA 3DT6A 3LX8A 5AI6A 5KHLB 2WMDA 2H4ZA 3R9KA 5I3ZA 1TECE 1QE0A 1R6BX 1ANKA 1ORWA 1UC8A 2WD7A 2Q0HA 3FUXA 1YULA 4GOXA 5LMUB 1AGPA 3RSOA 3UJ3X 4B7XA 4KRYA 2CXNA 2BM8A 1X94A 3D8RA 2FQQA 4XOUA 3FBGA 5T4HA 4RL4A 1PZNA 4EL0A 4D8WA 3P9YA 1LPPA 2X13A 2EBFX 3QRWA 4D9FA 1DZIA 3KYDB 3OESA 2GZ2A 2VYND 3KE8A 1MTOA 2AJTA 4A27A 4J9UE 4NV3A 4XJTA 3NJ4A 2Z5FA 2OENG 2EW1A 2F62A 3B7GA 4X00A 2QSJA 2IE8A 4NAHA 4P32A 4CMAA 2G08A 1N2GA 3S70A 3F6PA 1OX5A 3EGDB 2BGTA 3VMMA 3NV7A 1W4BA 4DHEA 5DHRA 2OHOA 2GJ8A 2REQA 4KMRA 3QYJA 4XVHA 4K28A 4JLJA 3GZJA 1ND5A 3IO5A 5REQB 4XIYA 4ZREA 1R12A 4JC5A 4CW7A 3BRWD 4E4YA 1ZISA 1SUDA 2NO0A 1JYFA 4IDFA 3ZS8A 1WTAA 4ZXPA 1N8NA 3WYGA 1EJ6A 2VPTA 1M7HA 5IJ0A 1DE0A 4H6WA 1N32B 4NJMA 2WMNB 3OY2A 2JLBA 3HUUA 4NS4A 3TXXA 1U9YA 1XMOB 1GP2A 1RLTA 4BAGA 1OSNA 2EQBA 5IEBA 1T0UA 1HZZA 1DX6A 2R3SA 4FD2A 3ZQ4A 2BYTA 1KAMA 1C50A 2H08A 3SN6A 1JDUA 1E2JA 3AT1A 3QPDA 4MZXA 2EP5A 1KMQA 1RD4A 3TD9A 2CJFA 3A4YA 4DXHA 4E5PA 1IN8A 1G8KA 4G85A 1HE8B 1TCCA 1MIHA 1I32A 3K0FA 3AUTA 4ARUA 5KYUB 3T1HB 2P8JA 4CKXA 3N39C 3F9CA 5JJLA 3G2MA 4XTRA 3UY4A 2QZPA 3IVMA 3RC8A 1XP8A 2KQUA 3BICA 2OEPA 3QUQA 3K5PA 2WWWA 3UMSA 3WGHA 1X13A 1Z74A 4LY9A 4OHOA 4TKLA 2R6JA 1GCIA 2GFQA 1JU3A 3WAKA 5KNBA 2HZBA 4X45A 1J8YF 2YJ6A 2QA5A 4MJXA 2GBLC 1ULUA 4ISCA 1XP5A 2ZUTA 3TGLA 3DM9B 4IG4A 3GCXA 4TYMA 4ALMA 1KZ4A 3RYCA 1MX1A 1QS0A 5HUJA 1ESCA 2XB8A 2ZJ0A 2O6LA 5DPMA 5EJIA 2INGX 3VR0A 4Z1OA 2JPDA 3AEXA 2ZBGA 3FMPB 3MMPA 3V4FA 3VR6H 3O2QB 2KHZA 2QGZA 3L06A 5FCDA 4ETIA 2G06A 5CDSA 4BNTA 2BMEA 3TTYA 2QU7A 3GLRA 2I87A 2P69A 2QT1A 2CLKB 3VRHA 1CSEE 1EK1A 1W6UA 4PAWA 1RZUA 1C7FA 1FQOA 3IUEA 2C58A 1I6WA 1ZUIA 5ALEA 2FSVA 5G1PA 2E37A 1V8ZA 2EBWA 3VYRB 1KXJA 1ZIDA 1B2LA 3ZH9B 5L3SB 4H59A 2ZBFA 2DWCA 1WCXA 1OA0A 2AOTB 2ZVJA 2X5OA 2QVCA 3K6RA 1QZZA 2C0CA 5HQ3B 4YI5A 5I8PA 3VC3A 2WWGA 3ETGA 3H13A 4H31A 1Q0LA 2ZWAA 2Y1EA 2AKYA 2R1UA 3U3XA 4FC7A 1NVMB 5F3RA 3NHWA 1FTWA 3UOWA 2GN6A 3I34X 3W6OA 4CLOA 1UK9A 3A26A 4UXJA 4EY3A 2QR5A 1ZM7A 3OAAD 3RT1A 4UPVA 3INYA 4QOGA 4KODA 5L4SA 3IE1A 3CMMA 3TDMA 3BFKA 1GSAA 2FW8A 3T52A 5EHIA 1GAWA 1VYUA 4C4TA 2OBMA 2QRKA 2ZBUA 3ML1A 4R5HA 3RFVA 3IR5A 3N05A 3FTNA 3ULKA 4C87A 5KTOA 5ETJA 2EZ8A 3O93A 4U5QA 2JJ1A 4QTTB 3JALA 3R3VA 3KLBA 4N49A 2AFIB 2I4TA 3GXOA 3ZD7A 3S0JA 1NX9A 4ROSA 4TWIA 3ANSA 4QBIA 1M5RA 4C3VA 2UZ4A 2BIFA 1JAHA 1H5NA 5BOVA 3B3FA 5D3MB 3H2GA 1ZD8A 2PJUA 4JJKA 3VNRA 1HR0B 1YJQA 4G6ZA 2Z6AA 5LP6C 2JDID 4FNOA 3E7FA 2CL0X 3BMQA 3DR5A 5IVPA 1RZ3A 3UUGA 2FX2A 4CV3A 2RGYA 3U4DA 1UKAA 3BXOA 1D7AA 1Q16A 5EE0A 1NXQA 4H9GA 2CWDA 3BE4A 3BC1A 4D92A 3K1AB 1L4KA 2IYZA 1V3VA 2WC1A 2JI4A 3CB2A 3ZDDA 5LA6F 3HZZA 2C5EA 3E9CA 2IS4A 4LOLA 4BBAA 4BMZA 4EYSA 1TD1A 3NRBA 3ROXA 4FS8A 3LUPA 4PGAA 4DTCA 1P39A 5AQ1A 4OJQA 1QO7A 3IBSA 3ZQJA 1DAOA 3PYXA 4CEHB 3T3IA 2A78A 2P3SA 2QQGA 2XMBA 1E89A 2CFTA 3ICVA 3RUFA 4AZ0B 3CF4A 3GRRA 4KVFA 2ZCJA 2XZLA 2M1XA 4RZIA 1F48A 4K9KA 2GD6A 3L40A 1Y5RA 3OIFA 1WSWA 4OM7A 4WNCA 5DOZA 5JY6A 3KUKA 4HEA1 2QV7A 4AJKA 5KOJB 1VE3A 1DDGA 3V32A 3X1KA 3LLCA 4RSMA 3ZX5A 3DVAB 2EIHA 3GUYA 1PR9A 4Q7QA 4WFJA 3FJ1A 4RKEA 3EZ6A 4BB6A 3WS7A 1ECJA 2VRWA 3B9QA 2GSDA 5J43A 5BT9A 3C2QA 3GPIA 1U3CA 3ZGXA 2EWMA 2PX4A 3PXBA 5J2UF 3HXOA 1NPTO 1PL8A 2GX6A 3T7DA 4BO3A 1SXPA 3K9HA 1QV6A 3NWPA 2OXTA 1FFBA 5IYZF 5C8XA 3F5MA 4GPBA 1T0PA 3DE5X 1RAEA 3LKBA 1T5DX 1V41E 5HF6A 4EHIA 3AWDA 1JEYA 4LUCA 2WPDA 3KEQA 1NF9A 1SNYA 2Q8PA 4RK6A 4Q9IA 5F2NA 3RVJA 1HLDA 4IFBA 5A5VA 2CK3D 3GO4A 4I6JA 3HB7A 3JQ8B 4PYMA 3C7KA 4TTAA 4IJUA 3HM9A 3UOAB 2BSXA 4YO8A 4Q9NA 4X0EA 3RS8A 3RSCA 1S89A 2CNKA 2BGLA 1JIUA 4K6KA 1NQ5A 5FF9A 4E5NA 2A6PA 2ANCA 1F8XA 3EOAI 4KFSA 3AQ4A 3OLYA 3OZ7A 2TYSB 3Q3GE 4GUAA 1WHSA 4MUAA