4CXFA

Structure of cnrh in complex with the cytosolic domain of cnry
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
154
Chain Sequence
b'DADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDTFVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRAARLELARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA POLYMERASE SIGMA FACTOR CNRH
publication title The Crystal Structure of the Anti-Sigma Factor Cnry in Complex with the Sigma Factor Cnrh Shows a New Structural Class of Anti- Sigma Factors Targeting Extracytoplasmic-Function Sigma Factors.
pubmed doi rcsb
source organism Cupriavidus metallidurans ch34
molecule tags Transcription
total genus 60
structure length 154
sequence length 185
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cxfA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4cxfA01
1E17A 4MTDA 2V79A 5ICFA 5HLIA 1ZHFA 5L3BA 3O2PE 5EEHA 2WV0A 2JRTA 5AIQA 4ESBA 2VOOA 1IF1A 4BNCA 2RN7A 3ZMVA 1MZBA 4YG2F 4AD9A 1MDMA 1I6XA 2Y1EA 2K27A 5K5QA 4ZQHA 3RASA 3FM3A 2QQ9A 4M9ZA 1TW2A 4CICA 1DP7P 1XN7A 4OMYA 2JSCA 2RKHA 4GYIA 1WI9A 2FRHA 3ECHA 4A6EA 2PG4A 1R58A 1FOKA 1FX7A 4I2OA 1OMIA 1K79A 2VT3A 5HDNA 3TOAA 2J5PA 2HTJA 2CGPA 1D3YA 2PEXA 1J2XA 2DLLA 3I4PA 1AWCA 1MDMB 4XLPF 2Y1CA 3CUQB 4R1HA 2IA0A 1PP8F 4S04A 4MQVA 3GF2A 4KYWA 1MKMA 1KYWA 4G7HF 1HQCA 3DV8A 5TRDA 2NAZA 4BHPA 3J80K 3K0LA 2P5LC 4ZYEA 3E6MA 5ICEA 4IRHA 1FBSA 3E5XA 2ADUA 1SD7A 2FEZA 1H3LA 3K9TA 3RIRA 1A04A 2E1NA 4I98B 1YO5C 1JVSA 4GYGA 1IRGA 4U7DA 5HS7A 5CJ9A 4BHBA 2IT0A 1LDJA 4ZN6A 4A5NA 3WQQA 2FNAA 2LKPA 4G6QA 1SAXA 2P7VB 3F6VA 2EFWA 4ZZDA 3TGNA 4RCVA 2HFHA 4ZQEA 5H6RA 2R3SA 2A6HF 1B59A 1BBYA 4RB0A 3ZMZA 2ISZA 5DCMA 2HKOA 3E5QA 3UCQA 1BC8C 2VN2A 2HEOA 1IZ1A 3IWZA 2K02A 3LAPA 2XHKA 2WTEA 3GUDA 2HYFA 3M8EA 1NHAA 1ONVA 4UV9A 4XRFA 4CO8A 4A03A 3GX4X 3HSRA 5L3DA 1FBQA 5ED4A 3KE2A 5ILUA 2EK5A 4LMYA 3CZGA 3ANMA 3M1EA 3GVAA 4KA4A 3DP7A 2A5YB 4JK1X 3BJOA 2JZYA 1ZAOA 4UXNA 1XSDA 2MH9A 4KMUX 3FMSA 2OZUA 3BY6A 2QQBA 4IVNA 5DCMB 2XAFA 2XIGA 2HKXA 2XUBA 4MQ9F 2OQGA 3WG9A 1KQ8A 3GFJA 3U9GA 2NNYA 1XMAA 5DD4A 1XSXA 1V4RA 4WXCA 1LDDA 2O3FA 2VBXA 4GXOA 2HGCA 2PI0A 1B9MA 2ZNZA 1H9GA 3C3WA 2XKOA 3NQOA 3F8FA 2MLGA 3RDIA 1JHHA 2MAOA 1J59A 1S3JA 3J81K 1BI2A 4KNYA 4FLQA 3VOEA 4UVAA 3E6CC 1ZG5A 3DEUA 4MEYF 1R5HA 1SC5A 1W5SA 4Y13A 4KICA 1Z7UA 3F8MA 4M9SA 3IL2A 5E1XA 1MW0A 2DT5A 1J5YA 3ZPLA 2IA2A 3TOBA 3FMRA 1FYKA 1R0LA 1SFXA 1KU7A 1YFHA 2KKOA 1F5TA 1U2WA 2HR3A 2DBBA 4L0YB 3SHFA 3K1MA 4RS8A 1ZN2A 3MZHA 2UWMA 1P2FA 3NRVA 3JSOA 3ZQ7A 2W25A 1T2KA 2V1UA 3DF8A 3AU8A 3OOPA 2UZKA 3ZHZA 1ZREA 2MC3A 1YTYA 5ILSA 1P6RA 5K5OA 4NQWA 3OV8A 1WKMA 3WTXC 4CZZA 4FLRA 3EYYA 5FGMA 5FB2A 3BPVA 5L3GA 4HAMA 3HRMA 4M9XA 1ZGAA 2DPUA 2JCYA 1FSHA 2P5VA 1XCVA 3QAHA 2DK8A 2CYYA 2FU4A 5HS8A 2ZFWA 1DUXC 2IPQX 1BI0A 3KZZA 1ONPA 1ZGJA 4A6DA 3WTSC 2LF7A 2DI3A 4I09A 2OBPA 2Q8KA 3FMQA 4M71A 2UXNA 3F72A 2V1XA 3WGIA 1IXRC 1JGSA 4B09A 4TV7A 3IKVA 4ZZLA 1LDKB 3I53A 3ML6A 2NS0A 2PLYA 2IW5A 3I54A 4XBFA 5ILVA 1FNNA 4OIRF 1ZRCA 2CWEA 5LBQA 3BOQA 5E20A 4EGYA 3FWEA 3M9AA 3T0YA 3ZMUA 1RI7A 3QPHA 4M6YA 1O3SA 1TQIA 1KU2A 2QYOA 4UV8A 4HV6A 2L4MA 3GWZA 4L9NA 3DXJF 1KQ9A 2F5FA 4KIFA 4LB6B 2DU9A 3RPUA 1V3FA 1QO0D 4WCGA 3PFIA 5LGNA 2PQ8A 3Q5FA 3QP5A 4JQFA 2MA3A 3WTUC 3CZKA 4AVPA 4HW0A 1YG2A 3V4GA 1STZA 4P9UA 1XDUA 1D8JA 1B9NA 3FXUA 1T1SA 3BJ6A 5D5UB 3HIFA 3WODF 1Z9CA 4LUPA 2G7HA 3JSPA 2Y1DA 4LG0B 1F4KA 1ZYRF 5H6QA 2ZO4A 3K69A 1JG9A 5L3FA 1IXSB 1IUYA 3U1DA 3B73A 1KU9A 3W6JB 5D8KB 1SFEA 2K86A 3KLNA 5LGUA 3ZN1A 3ANNA 1EH7A 2H09A 2VBYA 4HBLA 1L0OC 5F64A 3I71A 3G73A 1LJ9A 1HKTA 1I1GA 2ZJ2A 4L9JA 4CGZA 1ZRDA 4G94A 1JHFA 1FLIA 2FBKA 1FY7A 3DFGA 3A06A 1HKSA 6PAXA 2FA5A 2MD5A 1HKQA 2TDXA 2JPBA 4GCVA 1USTA 2IA1A 3VB2A 1W7PB 2HWVA 1RZ4A 2VBWA 3EDPA 2QVOA 5CVRA 3HRUA 1G4DA 1XGOA 4XSZF 1BIAA 1WSUA 3CJNA 4H0EA 4LJZF 3MFKA 5FLXZ 3HUGA 2MLKA 3L2CA 1D5VA 2EFOA 4HDVA 3DPLC 2FMYA 1WRJA 2ETHA 3O6BB 1BM9A 4A0ZA 2CW0F 4HV5A 3KEQA 4LD5A 1TTYA 3H3ZA 1EH8A 3BROA 3FZVA 4HX8A 4U88A 3IHUA 2FBHA 2GA2A 1K7AA 1U5TC 1IN6A 1XCBA 5D5VB 1JE8A 3HTUA 3R4KA 4KMFA 5ICGA 4RAYA 4O6JA 2VODA 3LWFA 3ULQB 1MW3A 3AU9A 1ON1A 1QZZA 1QGPA 1FP2A 1RP3A 1KGSA 3F3XA 4HDUA 3HRSA 3VFZA 4Z2YA 5J6XA 3ROUA 4KN4X 3ZMTA 3ABUA 3BZ6A 4ENKA 3GO5A 3WTTC 3GLXA 1U78A 2D2WA 1SD6A 1R1UA 2OD5A 3FX3A 3D0SA 5HLHA 1HSTA 2JTVA 3RYPA 1TQMA 2GZWA 3LQRA 3U2RA 1FYMA 5LLQA 1R23A 2K4BA 3KZYA 1Z1DA 3ERED 3QP6A 3DKWA 3HOTA 2GIVA 2MAPA 1DPRA 5FO5A 5HDKA 1IW7F 4AYSA 3KCCA 3WU1B 1QPMA 4O3MA 2XAGA 1MD0A 3T8RA 1Q0QA 3KFWX 3CDHA 3NEUA 1T1RA 2Y1FA 5JFRA 1Q0HA 5CYVA 2HYGD 5JBIA 1BC7C 1R1TA 1T38A 4RGSA 1YQAA 1FZPB 3UEQA 3F23A 1S29A 3VEPA 4CDGA 2RV8A 3IRRA 2V1DA 5J8CA 4UVCA 3DQVC 2ZBKA 5DEQA 3R0JA 3N4MA 4MEXF 5K1YA 3COAC 4KDPA 2DQLA 2JPCA 2QLZA 1G3TA 1REPC 5E8IA 2A68F 5K5RA 4F7ZA 4ASNA 1T6SA 3WGHA 1UFMA 1AOYA 2LNBA 4LGWA 5E18F 1L3LA 1T0FA 2O8XA 3SFZA 3LFKA 3SQNA 2FMLA 4N0BA 2JCXA 3RKWA 2DK5A 2H6BA 2X0LA 2M30A 2CFXA 4CYDA 1UB9A 4EM1A 5DV5A 5BS6A 2D45A 1P4XA 1B1BA 3J80Z 2DTRA 2FF4A 5DULA 3HSEA 1LEBA 1XMKA 4I02A 5CVIA 2YSRA 3V8LA 3CZLA 1HXDA 1USSA 3MEXA 3R6SA 4ZYDA 1ZLKA 1YS6A 1ONNA 2KRFA 2AXLA 1FC3A 3CZEA 2OU2A 3ZHXA 3IKTA 2P6SA 3ANLA 1XGSA 2EB7A 3TKYA 2K7LA 3R61A 1R5GA 1Q0LA 2K4JA 3CUOA 2F5DA 2VT2A 2VONA 1Q1HA 1HSJA 3Q9SA 4EQQA 2HS5A 4HX4A 4L5IA 2IRFG 4WXDA 3QU6A 4M74A 4MGRA 2YPRA 3I64A 2M87A 5E1ZB 1XB4A 1Z6TA 5DD8A 1HBXG 1YIOA 4Q5SF 3QU3A 4EJTA 3Q9VA 4BXUA 1GHCA 2W84A 4BHCA 4ZH4F 4FLOA 1RNLA 2KIMA 2MBFA 3M7GA 1G3YA 3QPTA 5A2QZ 2RQPA 2MH2A 3REOA 3ZI0A 2ZXJA 2VE8A 1GXQA 1ONOA 1U5TA 2WC2A 1QNTA 2GXBA 3EETA 3CTAA 2HDCA 2FQ3A 1UHMA 4I7HA 1W7PD 3G3ZA 3IIEA 2DAOA 2WWYA 4BH9A 4D0PA 4UUVA 5TJJA 3L7WA 4BAYA 4HQEA 1KQ0A 2Q2EA 4EM0B 2VXZA 2PMHA 1O3RA 1J9IA 2L3DA 3RTRA 1U5TB 5JHUA 1Z6RA 2QBYA 3IC7A 3P9IA 3T8TA 2RGVA 5JVTA 1UCRA 3RJPA 1LNWA 4HF2A 4CHUA 4U0WA 2STWA 2KJBA 3IWFA 4U0VA 1R22A 2Z3YA 1ODDA 3EQLF 4Y17A 3F22A 3H3UA 2M45A 4ENMA 4LK1F 3C1DA 3LSTA 4BQAA 2XASA 3P9CA 5F6FA 2VC1A 3PQJA 4PCQA 4YFXF 3GFMA 3ZMSA 4WX9A 5JC1A 4RB3C 1TNTA 4BYYA 4G9YA 1IXCA 1IN5A 1RUOA 2W57A 2ESHA 4XSXF 5IT9Z 2G9WA 1IAWA 5JI6A 1R0KA 3M8FA 3JAMZ 4HLYA 4Y6SA 3V7RA 2Y75A 2BBYA 3R0IA 1HW5A 4OU0A 5HVQC 2HQRA 4RAZA 3WE2A 3KEOA 2PN6A 3E6BA 2DPDA 2YR2A 1I5ZA 5H20A 4ON0A 2L02A 3SZTA 3JW4A 3ZHYA 3I59A 5L3EA 2B0LA 1Z05A 2RVCA 4KFCA 4YIFA 4YFKF 1FT9A 2GXGA 1YW9A 2ELHA 2M8EA 2KJCA 5HS9A 4FX4A 1G3SA 1BOAA 4OOIA 3PQKA 1CF7A 5J8FA 1C0WA 1UHWA 3O3KA 1IN4A 3BDDA 1OKRA 2FSWA 3KP6A 2XAHA 4A2UA 2EFPA 5EEGA 1I1SA 2VOPA 4OIPF 4EJWA 4ETSA 2KIUA 2UXXA 3WTZA 3EYIA 3FF5A 5FLXK 2HQNA 1OR7A 3P9KA 1KYZA 1XD7A 4I0AA 2V9VA 5CVUA 2EV6A 1IRFA 1SD4A 1IN7A 3I5UA 2Y1GA 2JD1A 4EV0A 3MQ0A 2FNPA 3GZ5A 2DFIA 1CF7B 2A6EF 2ZKZA 2XAJA 4L0ZB 3RPQA 5CVJA 2H6CA 4P96A 3F6OA 1K78A 1MW2A 1H0MA 4OMZA 4ENNA 4Y6PA 4I0BA 5D6FA 3K1PA 4ZQFA 3GEZA 4UHTA 2O03A 3WTVC 5JMPA 3ISPA 5FD5A 2IP2A 5L3CA 4HF1A 4HA8A 3JTGA 3HHHA 4L18B 2P6TA 2HTSA 2OAZA 2EWNA 4MHGA 3A14A 1QQIA 2GWRA 3KP3A 2LDUA 1MJ9A 1PDNC 1YLFA 2NYXA 5LHHA 4P55A 4DQ2A 5DCFA 5AIPA 3V8KA 1S7AA 4IHTA 1OYYA 2QWWA 1K78B 4U0YA 2JD2A 4Q4ZF 3KP5A 4R8HA 3WGGA 1PUEE 3K1NA 3GW2A 2VE9A 5DYMA 2QQAA 4EJOA 1YW8A 2GQQA 3TO7A 3F8BA 4A0YA 4IRGA 4S05A 2F5CA 4ZQGA 4PGGA 3W6KB 1JGIA 1XGMA 4IJAA 2PBIA 1O7FA 1MJAA 3HSFA 5ERIA 1ZRFA 3BPXA 4L9VA 4UNOA 4Y67A 4AIJA 2RNJA 2M1BA 2XRNA 4K2EA 1TW3A 1J0RA 2O0YA 1I27A 4IF4A 3CUQA 1MJBA 3S2WA 4QWQA 2QENA 4HZFA 2PMUA 4GAEA 3E97A 3TQNA 3HRTA 3QOPA 4RB1A 5DDGA 3IRQA 1P4WA 1TLHB 2L4AA 4OIOF 4AICA 1U8RA 5D8LB 5FD6A 2E7XA 4E70A 5DUKA 2EV0A 1O57A 2LSOA 4NB5A 1FWZA 2RDPA 4HYEA 1G5AA 1ZS2A 2A69F 1R00A 3BWGA 2IJLA 4EM2A 1O3QA 4KIGA 1TBXA 1VTNC 3TO9A 3JTHA 5HLGA 4FHTA 3ZN0A 5D5WB 5F1RA 5AONA 1T39A 3MZYA 1S6LA 4M6XA 1FBUA 2FE3A 2FOKA 2KIFA 4EGZA 3LA7A 2HOEA 2XGXA 1BI3A 2X4HA 3P7NA 4XLNF 1XSVA 1OPCA 1QBJA 5CLSA 2A3SA 2QUFA 1K5HA 3KP2A 3TDZC 4OOEA 1SD5A 3T5XA 4ZYHA 2O7GA 5KVRA 4LK0F 3HTSB 3WQRA 2W24A 1PP7U 1LQ1A 2OQRA 2C82A 3E6DA 3WQSB 5LRSA 2ZNYA 5LGTA 1YYVA 3FHZA 5JNLA 4Y6RA 2XKPA 5JR3A 2E7WA 1R36A 4KIBA 4Y15A 1CGPA 4OIQF 4Q48A 3I0TA 1MVYA 2VBZA 2EFNA 3WE3A 1MGTA 2D1VA 3ABTA 3GXOA 3VODA 5LEKA 2LF8A 2JT1A 1TNSA 4HQMA 3RKYA 1XDSA 5A2QK 2Z99A 2A61A 3LA2A 5HOOA 4PZJA 2DQRA 3KP7A 1J7KA 4GO1A 4LLLA 3HHGA 1ZARA 3B02A 1GVJA 1O3TA 4CXFA 3EUHA 4L5JA 2W85A 1FYLA 5LEJA 1H9TA 4RB2C 3RYRA 1X3UA 2ESNA 2YX4A 2EV5A 4A5MA 3BJAA 2COMA 1LVAA 1T98A 3HYIA 3AAFA 5D5XB 5HDGA 2A07F 2EGHA 4RGXA 2C6YA 2ZMEA 1ZG3A 2DW4A 2NRAC 5JAZA 2ACJA 5JO0A 1RIOH 4JBAA 2BGCA 4G7OF 3T1BA 4G8XA 4FLSA 4AIHA 4LB5A 4IRIA 2BYVE 1LB2A 1P92A 1LEAA 4GGGA 2P5KA 3WTYC 2BEOA 1YW7A 2AS5F 3RI4A 4OOFA 3AUAA 3ZMDA 1BJAA 2ZMEB 5DUIA 5BMZA 3QRFF 3L00A 4MTEA 2DO7A 2QM3A 4OINF 1WWXA 1Y0UA 2JCVA 3WU0A 1QZYA 1R1VA 1U6GA 5IT9K 4ESJA 1W4MA 4HLXA 2HZTA 4ZYGA 1OYIA 5CVVA 3FXRA 4G6DA 4KP7A 2GA1A 3JAMK 2IVMA 5FFZA 4M72A 1S7OA 3GFIA 2VC0A 4EJVA 4KT5C 1P4AA 2XAQA 3C18A 3CUQC 3J7AO 1O7LA 3J81Z 5E1WA 2O61A 2Y0MA 1RUNA 2D1HA 2L01A 3D5LA 1DDNA 3V8JA 3R60A 4FT8A 3MWMA 4WWCA 1TQPA 3HOSA 1D8KA 1HW1A 2RC4A 5E8GA 3GYHX 2Z5UA 1ON2A 1XGNA 3K2ZA 5BPIA 1S46A 2Z9OA 2PFBA 4UVBA 3SXYA 2EJRA 4WXHA 3RKXA 2QBYB 4QLCU 1B6AA 3LA3A 5ICCA 4ENJA 2CSOA 4RGUA 2F2EA 1DPUA 5LHGA 1SMYF 4EJUA 2XV4S 4AIKA 2YX7A 3MCZA 2GAUA 3C7JA 4NHJA 1E2XA 4U7BA 2CG4A 4L9TA 1FPQA 4KUMA 2FXAA 1K6OA 2J5OA 5LRRA 1ZH5A 2XROA 2M5WA 3FM5A 4HF0A 4HOBA 3R0AA 4MNUA 4IHSA 5E17F 5KK1A 5BQTA 5BPDA 4KN7X 1YS7A 5LHIA 4LG0A 4RGRA 3H92A 2G7UA 3V7SA 4AWXB 2QZ8A 1OYWA 1ZG1A 1W5TA 3KP4A 3F21A 2EFQA 4M73A 1Z91A 3N97A 2JD0A 2L54A 1KA8A 2F5EA 1HW2A 1IN8A 3LAJA 1KU3A 2ZCWA 1FP1D 4I01A 3E5UA 4PDKA 4Q47A 4B8XA 1BI1A 1GXPA 2Y48A 4YFNF 2OA4A 3I59B 3F8CA 2P4WA 3GZ6A 3ELKA 2OZ6A 3FXQA 4IPAA 5JMWA 3BP8A 4G7ZF 2WPGA 3E3VA 2Q0OA 1MW1A 1ZLJA 1FSEA 1ULYA 4FX0A 1EV7A 4DNCA 2P7CB 1W7PA 2BV6A 2P8TA 3MAJA 2EA2A 4WK8F 2CQKA 2H27A 1SMTA 2NNNA 3L09A 3F8NA 2XVCA 4A0XA 1R7JA 1BN5A 4HX7A 5D6EA 4R79A 1S8NA 2STTA 5IT3A 5D4RA 3WTWC 1BIBA 2Z33A 4A12A 2ISYA 3ZP5A 1F9NA 1EH6A 5BOXA 4P5OA 3CO6C 2BE5F 2CO5A 2YU3A 4LLGF 4N9HA 3TO6A 1JXSA 3L9FA 3GFLA 3KLOA 3CLOA 4N9IA 3I58A 3LQQA 4EVIA 4LFUA 3V7CA 2E1CA 5D4SA 2V6CA 4ESFA 2FBIA 4O5VA 4WF2A 3SZPA 2H94A 2PJPA 3UERA 4PGHA 4EMSA 2R7DA 2O6GE 1U3EM 1B4AA 4IXAA 3DPTA 1SFUA 1WQ2A 3CO7C 4LLNA 3KETA 3ECOA 1G3WA 3TDUC 5FFXA 1G6NA 4P9FA 1J75A 2EA4A 4YIIA 2R7FA 1F1ZA
chains in the Genus database with same CATH superfamily
1E17A 5LD2C 4XK4A 5FKMA 3S1MJ 4MTDA 2L0KA 2V79A 5ICFA 5HLIA 4J3BA 2R4GA 1ZHFA 3QYFA 5L3BA 2A6TA 1DU0A 3AG2H 2DJNA 3O2PE 5EEHA 2WV0A 2JRTA 5AIQA 4ESBA 2A7OA 4XMWA 2VOOA 1LPQA 1RKTA 4J19A 1IF1A 4BNCA 2RN7A 3BG5A 2LOOA 3ZMVA 3ZRGA 2LP0A 1MZBA 4YG2F 1S72I 5F0CA 4AD9A 1MDMA 1I6XA 2Y1EA 2K27A 3KPHA 5K5QA 4ZQHA 2XB5A 9ANTA 3SDGA 3A01B 3RASA 1ZKGA 3FM3A 1MBGA 3FHNA 4GAAA 2QQ9A 4M9ZA 1TW2A 4CICA 3QWLA 2TRTA 1U9OA 1XN7A 2ZJPF 1DP7P 4OMYA 2JSCA 3FU6A 4CCMA 1V5GA 2RKHA 5FKLA 4XRMA 5JLWA 4GYIA 4BJTA 4XOTA 1WI9A 2FRHA 3ECHA 4A6EA 3S2HJ 2PG4A 1R58A 4DYCA 1FOKA 1FX7A 4I2OA 2R7SA 3FTXA 4FASD 1MW7A 1OMIA 1K79A 2VT3A 5HDNA 3ABMH 1JT6A 1WJEA 2KP6A 4MO7A 3TOAA 5H2FC 3S1RJ 2J5PA 4ZQTA 2HTJA 2CGPA 1D3YA 3PFYA 3CCVI 2PEXA 2K9QA 4II3A 1J2XA 4ANJA 2DLLA 2WY7Q 3I4PA 4DPRA 1AWCA 4HSTA 2WV1A 5IYBJ 5DTDA 2KRHA 3BR3A 4PFPA 4R5VA 2GTQA 3GTGJ 1MDMB 4XLPF 2LKXA 1K6YA 2Y1CA 1SC7A 1WHUA 3CUQB 4R1HA 2IA0A 1I39A 4XLCA 1PP8F 4S04A 3ZQFA 3FBNB 4MQVA 1LVKA 1QRYA 1P9QC 2DFFA 3GF2A 3PSIA 1JUPA 3D5RC 4KYWA 1MKMA 1KYWA 3Q3SA 1VF9A 4G7HF 5EYRA 1HQCA 3DV8A 5TRDA 2NAZA 4BHPA 2VLAA 1EF4A 2HDWA 4ZDLA 3J80K 2GBYA 3M07A 1SVMA 4X1EA 3K0LA 4II2A 1MMAA 2P5LC 4ZYEA 3E6MA 5ICEA 2LBFA 1YX3A 3MZ8A 3CC2I 4E7SA 4IRHA 1FBSA 1BOBA 3E5XA 2OC6A 4A3IJ 2ADUA 2AQFA 3SYTA 1SD7A 4AR8A 3FXMA 2FEZA 1MSFC 3OYBA 1H3LA 3K9TA 1PUFB 2XPYA 3RIRA 2NOJB 1A04A 3H1CA 2E1NA 4I98B 3LSRA 5KNLA 3CD6I 1GW6A 3S8PA 1Y0NA 3CCJI 4RVBA 4PUSA 1YO5C 4B43A 4GYGA 1LUJB 1H8AC 1IRGA 1JVSA 4U7DA 1AKHA 5HS7A 4QUOA 5CJ9A 4RMNA 4PK4A 4BHBA 1R71A 2IT0A 4ZX5A 1LDJA 4ZN6A 3EBHA 4XN0A 2O9LA 4A5NA 3L2RA 2DMTA 5CPRB 3WQQA 2FNAA 4E4HA 2LKPA 4RBOA 4G6QA 2JVHA 4HG2A 1SAXA 4E7LA 2P7VB 3F6VA 2EFWA 4ZZDA 2JRMA 3CCLI 3TGNA 4RCVA 2HFHA 3G1MA 1DQUA 2CJJA 2X85A 4XNBA 3HGYA 4C3JJ 3HEFA 5H6RA 5DM7F 4ZQEA 4F91B 2R3SA 4JX6A 4NC8A 1A6IA 2LBFB 3FXLA 2A6HF 2KMUA 1B59A 1BBYA 2LLKA 4RB0A 1W0TA 3LSMA 3CHRA 2EZLA 3ZMZA 3A0BC 2ISZA 3F0CA 2IGNA 2X6OA 5DCMA 3BZCA 2OTJI 2HKOA 4LITA 3E5QA 3UCQA 1FIPA 1BC8C 2VN2A 3S3MA 2K9LA 2FD5A 3GMEA 1HF0A 1FOWA 2XF7A 4M3EA 2HEOA 1IZ1A 3IWZA 1I6HJ 4BBRJ 1WJDA 2K02A 3LAPA 2XHKA 2VL8A 1SG7A 3ESWB 2PX9A 3KZIC 3G1OA 2WTEA 3GUDA 1VQKI 2HYFA 3M8EA 1NHAA 1JXSA 1ONVA 2MFZA 4UV9A 4XRFA 3HOWJ 2B61A 2CS3A 4CO8A 4DBRA 4A03A 3GX4X 4K5LA 3PSFA 3HSRA 3PM1A 1FBQA 5L3DA 1LE8A 2XGDA 5ED4A 3KE2A 5ILUA 3LNQA 2EK5A 4LMYA 3JCUC 3ANMA 3CZGA 2K3FA 2L7KA 3M1EA 3GVAA 1J09A 4RDUA 4KA4A 3FK6A 3DP7A 4XMVA 4BEHA 2A5YB 3C2GA 4JK1X 3BJOA 2JZYA 1S5LC 1ZAOA 4UXNA 4ZYAA 2MH9A 1XSDA 4KMUX 3FMSA 2ZJRF 2OZUA 2VQGA 1BA5A 4A3FJ 2ELJA 3BY6A 2IEKA 2QQBA 4IVNA 1JKPC 5DCMB 4UY8I 1HS6A 2F5VA 1T56A 2XAFA 3TP0A 4BL0B 2JSPA 2XIGA 1BR2A 2HKXA 2IBDA 1BW6A 2XUBA 4MQ9F 2FFLA 2DA6A 1WH7A 3TW7A 3DEWA 3TEDA 1GUUA 2OQGA 2IS2A 3WG9A 1KQ8A 3GFJA 2QGUA 1D0ZA 1ETQA 1Y1WJ 3U9GA 2NNYA 1XMAA 2M2EA 1X2NA 2E36A 5DD4A 1XSXA 3BG9A 1V4RA 4WXCA 1LDDA 2O3FA 2VBXA 4GXOA 3RC8A 2HGCA 3BG6A 5EZGA 1LE8B 2PI0A 1VQ9I 3B7RL 1B9MA 2ZNZA 1H9GA 3MKYB 2A05A 2MC4A 3C3WA 4EEFG 3LSHA 2XKOA 3NQOA 1MBEA 3F8FA 3A4CA 1AA7A 2MLGA 4BEHB 4A3JJ 3RDIA 1JHHA 3ZGKA 4D5CA 2MAOA 1J59A 1S3JA 3J81K 3GTLJ 3H5NA 1BI2A 4KNYA 4FLQA 2X1DA 3VOEA 2E5ZA 4UVAA 3E6CC 1ZG5A 4NBQA 1ERDA 2XQ0A 3OR1C 3DEUA 4MEYF 4XOPA 1R5HA 4ABZA 1W36C 4ZTJA 1HA8A 1SC5A 1VQLI 2EIJH 1W5SA 1VQOI 4Y13A 4X0GA 4MKTA 4D5FA 4KICA 3CCUI 1Z7UA 4P1WA 3F8MA 3BLYA 4M9SA 2EH3A 4LIUA 3IL2A 3FUIA 5E1XA 3H0GJ 1MW0A 2DT5A 1J5YA 3ZPLA 2IA2A 3TOBA 3FMRA 1FYKA 2PGGA 1R0LA 2XPZA 1SFXA 3ONQA 1KU7A 1YFHA 3FDYA 2KKOA 2W1OA 3HZJA 1F5TA 1U2WA 2HR3A 4DOZA 2Y9YA 3CCRI 5F0HA 2DBBA 4L0YB 5EJCA 3SHFA 3K1MA 4RS8A 1ZN2A 3MZHA 3BTCA 2UWMA 1P2FA 3MMYB 3NRVA 1DU6A 3JSOA 3BZKA 1OQYA 3ZQ7A 3H5RA 4UB6C 2OV7A 3CJQB 3FBIB 3RCOA 1RR8C 2W25A 1T2KA 2O8KA 2V1UA 3DF8A 3AU8A 3VSLA 3OOPA 2UZKA 3CMYA 1ZREA 3ZHZA 4ARFA 2MC3A 1YTYA 2VQHA 5ILSA 1P6RA 4B3AA 2GXAA 4XO3A 2W4SA 5K5OA 5M3FJ 4NQWA 2E5NA 3S14J 3OV8A 1WKMA 3WTXC 4CZZA 2QKMB 2CH0A 2R0QC 4UUSA 5M5YJ 4R5TA 2CV1A 4FLRA 3EYYA 3CP8A 2MGQA 5FGMA 4A69C 4DW6A 5FB2A 2UUZA 4CSWA 4XN5A 5K7HA 3B34A 1A6QA 2DOFA 4PJ0C 3BPVA 5L3GA 4HAMA 2RJIA 2VPRA 1GDTA 3HRMA 1D5YA 4M9XA 3SFIA 1EKEA 4FE4A 5E3LA 1ZGAA 2DPUA 2JCYA 3K4JA 1FSHA 2P5VA 1XCVA 4G12A 3S2DJ 3QAHA 2DK8A 3C2BA 2CYYA 2FU4A 4AM3A 5HS8A 2ZFWA 1DUXC 2CW8A 2IPQX 1BI0A 2LC2A 3KZZA 5CQGA 5KCMA 1ONPA 1ZGJA 3OYFA 4A6DA 2W00A 3WTSC 2LF7A 2DI3A 4I09A 5EGOA 2OBPA 2Q8KA 3FMQA 4NQWB 2Y69H 4M71A 2R7VA 2UXNA 3QPSA 3F72A 3VVLA 3CXBA 3FKJA 2V1XA 3WGIA 1IXRC 3B3BA 1IV8A 1JGSA 1YITI 4B09A 2E60A 4TV7A 3IKVA 4ZZLA 3GTKJ 1LDKB 2QVWA 3I53A 3ML6A 2NS0A 5JHFA 2PLYA 2IW5A 3I54A 4XBFA 5ILVA 2LG4A 2V7FA 1FNNA 4IHXA 4OIRF 2YS9A 3CC7I 3OYLA 1ZRCA 2VUMJ 1TL8A 3H9JA 1K83J 1IRXA 2CWEA 5FLVA 4Y4RA 5LBQA 2NVQJ 3BOQA 3PUBA 2AO9A 4MFEA 5FWQA 1UHSA 5E20A 4EGYA 3FWEA 3M9AA 1BR4A 3T0YA 3ZMUA 1RI7A 3QPHA 4M6YA 1O3SA 3HG9A 2R5ZB 1TQIA 2VQLA 1KU2A 1X3ZA 2QYOA 2BY0A 4UV8A 2VKEA 4Z6YA 3DTEA 4HV6A 1VI0A 2L4MA 3GWZA 4L9NA 2L9RA 1Z21A 3DXJF 1KQ9A 2F5FA 4KIFA 4NNJA 3OSGA 5J3LA 2KQRA 4LB6B 1MMNA 2DU9A 2LFBA 1W0UA 2Z2SB 1FOYA 3RPUA 4ZDOA 1V3FA 1QO0D 5GAGJ 4WCGA 3PFIA 5LGNA 2F4IA 2H1LA 2OCEA 2PQ8A 4JOMA 4OAZA 4XLEA 3QP5A 4RAGA 4FCYA 3Q5FA 4AR9A 2X51A 4JQFA 2MA3A 3WTUC 2CRGA 4HW0A 1YG2A 4AVPA 3CZKA 3JRGA 3V4GA 1STZA 4P9UA 5DYFA 1XDUA 2E2IJ 1D8JA 3EUAA 1B9NA 2WZFA 3FTUA 4IO9F 2LKSA 5M3MJ 3FXUA 1T1SA 3BJ6A 5D5UB 3OMYA 2R7WA 3HIFA 3WODF 1RR7A 3FU3A 5J4VA 1Z9CA 4LUPA 3OIOA 3OYMA 2G7HA 2VJIA 3HC7A 1A36A 2Y9ZA 1XTAA 3CESA 3JSPA 2Y1DA 4XM3A 3HW2A 5DS9A 4LG0B 1X4OA 3WHCA 1ZYRF 1F4KA 1UAAA 5H6QA 1X3ZB 2ZO4A 1RPWA 3K69A 1Y39A 1JG9A 3MD2A 1D1CA 5L3FA 2XF6A 1IXSB 1ETKA 3U1DA 2E2HJ 1JKQC 1IUYA 2LH9A 2ZSHB 2DA1A 3B73A 4ZW8A 1KU9A 2E34A 3HBLA 1U9NA 3W6JB 1QHGA 5D8KB 1SFEA 1UG2A 2K86A 1Z0XA 2GM4A 3KLNA 2HU9A 3ZQIA 5LGUA 3OYCA 3S1NJ 3ZN1A 3ANNA 1EH7A 1ORKA 2KHMA 2H09A 4UUTA 2VBYA 4HBLA 3TMOA 1L0OC 2DA4A 5F27A 5F64A 2DFEA 3I71A 1TZLA 3G73A 1LJ9A 1HKTA 4FTHA 1I1GA 4HNTA 2ZJ2A 4NDLA 4L9JA 4BE0A 1MMDA 4QIRA 2IS4A 3PNYA 3W2WA 2CMPA 2M8GX 2KZVA 2VASA 4CGZA 5E79C 4AC0A 1ZRDA 4XLHA 4G94A 1JHFA 1FLIA 2FBKA 1FY7A 3HGGA 4X2UA 4A3CJ 3DFGA 3A06A 1HKSA 2L5QA 4M3GA 6PAXA 2OUMA 3BG3A 2FA5A 2MD5A 1HKQA 2TDXA 5EZHA 4F3QA 2HZDA 3ASNH 2JPBA 4XICA 4GCVA 1QHHD 3I55I 1USTA 2IA1A 3VB2A 3Q0WA 1HC8A 1W7PB 5J1RA 2HWVA 4BDZA 1RZ4A 2WAFA 2VBWA 3EDPA 3OYGA 2R92J 2QVOA 5CVRA 3HRUA 1G4DA 1AU7A 2BHZA 2DYRH 2HOTA 1XGOA 4XSZF 1BIAA 1WSUA 3CJNA 4H0EA 4LJZF 3MFKA 2DDBA 3V42A 5FLXZ 2JK3A 2JA8J 5HODA 2QJ1A 3HUGA 4HNVA 2MLKA 2XC7A 3L2CA 1WGXA 1D5VA 2EFOA 4M3BA 2HVRA 4HDVA 4A3DJ 5FRMA 1ITYA 4R7LA 3NARA 3DPLC 4BXFA 2FMYA 1MIJA 3Q0VA 1WRJA 2ETHA 3L2VA 4K5MA 1TWAJ 3O6BB 1BM9A 3A03A 4A0ZA 1ETOA 1X1PA 4BUPA 4RM3A 5IP9J 3OL3A 2CW0F 3M8JA 4HV5A 1VQ4I 3KEQA 4LD5A 3K4NA 1TTYA 3CP2A 4XNFA 3H3ZA 1EH8A 1K61A 3BROA 3FZVA 4BU2A 1JUMA 1T95A 1S7EA 4HX8A 4U88A 2BZTA 3IHUA 2FBHA 2GA2A 3DKYA 1U5TC 1K7AA 1FEXA 1IN6A 2O7OA 2BY3A 5EG0B 1XCBA 1A5JA 5D5VB 2JN6A 2FOWA 1YJNI 1ZGWA 1DGWY 1XMXA 1JE8A 2YUSA 3HTUA 3R4KA 3IH2A 5ICGA 4KMFA 1H89C 4RAYA 4O6JA 2VODA 1ZR2A 3LWFA 3ULQB 1MW3A 1EA3A 1BJZA 2V9KA 3KYDB 2ZXIA 5M5WJ 3K70C 4BJ6C 5FJ8J 3AU9A 4FCAA 5FRNA 1ON1A 1QZZA 2EIMH 3MN2A 2M34A 3ZOBA 1QGPA 1FP2A 4N4OB 1XPXA 1YOVB 1RP3A 4IHVA 3PUUA 1KGSA 2DFHA 1X1BA 3F3XA 2COBA 4B4CA 4HDUA 2HPOA 4DJAA 2BOLA 3HRSA 4D7NA 3VFZA 4Z2YA 4K5OA 5J6XA 1IJWC 2ZSIB 1G2HA 3ROUA 3KYCB 4KN4X 3ZMTA 3KX2A 3JRDA 3K2AA 3ABUA 1JGGA 4ZW3A 4DBQA 2QKLB 3BZ6A 4ENKA 3ASOH 3GO5A 3WTTC 3GLXA 3JRHA 5J1UA 2H1KA 3CQZJ 1V55H 1U78A 2JQ7A 1VFCA 2D2WA 3CHSA 2DA2A 1SD6A 1R1UA 2OD5A 3FX3A 3D0SA 2B9SA 5EV7A 5KAIC 2DTZA 2RNGA 3N05A 5HLHA 3L2UA 2V4JC 5E3MA 1HSTA 3M1CA 1F36A 2JTVA 3FXJA 3RYPA 1TQMA 1JKRC 2GZWA 2WY8Q 3LQRA 2L2OA 3U2RA 1Z3YA 1YHQI 3A0HC 3LSKA 1FYMA 4QPEA 2DMNA 5LLQA 2NXNB 1R23A 1VNDA 2K4BA 4A93J 3KZYA 1OISA 1Z1DA 3ERED 3OYIA 3QP6A 2XPUA 3DKWA 3HOTA 2QSGX 2GIVA 3VDXA 4B3XA 4JX4A 2MAPA 2DA5A 5F1JA 1T33A 1DPRA 3EPZA 5FO5A 5BPPA 2HYJA 5EDNA 3RSNA 4XLFA 1IW7F 5HDKA 4AYSA 4A3MJ 1E0EA 3KCCA 4XMUA 3WU1B 1QPMA 3FUFA 3CF2A 2R72A 1MNEA 1POGA 2MYSA 4KISA 2XAGA 4O3MA 2LK2A 1MD0A 3T8RA 1Q0QA 3KFWX 1IDYA 3CDHA 2ICWG 3NEUA 4F55A 1T1RA 2Y1FA 5JFRA 1Q0HA 3H35A 5CYVA 2HYGD 3QODA 5JBIA 1BC7C 1R1TA 3PNVA 1YI2I 1T38A 4RGSA 4B47A 1YQAA 4X6AJ 1FZPB 3UEQA 3F23A 1S29A 3VEPA 4CDGA 2DN0A 4FQGA 2RV8A 3IRRA 3OIQA 4V2FA 4FE7A 3HKZN 3KEYA 1X4PA 2VKHA 3VPRA 1Y8RB 4DIQA 2R7UA 2V1DA 3PUFA 5J8CA 4UVCA 4QIWN 3DQVC 1GT0C 3B2XA 4IZZA 2ZBKA 4AUXA 2K85A 4AR1A 2XPWA 5DEQA 3JRFA 3LMMA 3R0JA 2XRLA 2DOAA 3N4MA 3OR2C 5K1YA 3COAC 4MEXF 1GV2A 4KDPA 3HPHA 2DQLA 2HVQA 1Q1VA 4J01A 3OYAA 1K4SA 4BQOA 2JPCA 2QLZA 1G3TA 1REPC 3AG3H 5E8IA 3FUNA 2A68F 5K5RA 4F7ZA 4ASNA 1T6SA 1NK3P 5K7ZA 3WGHA 1UFMA 1AOYA 2LNBA 4LGWA 3HOZJ 4BE1A 5E18F 1L3LA 4HPQA 4XQFA 1T0FA 2LY1A 1X19A 4CH7A 2O8XA 3J7ZI 3SFZA 3LFKA 3SQNA 2FMLA 4CZCA 4N0BA 1TWGJ 3RKWA 2JCXA 4I76A 4PW4A 2DK5A 2H6BA 4C2UA 4HRIA 4ITVA 4XN1A 2CV0A 3K4CA 2X0LA 1SANA 4AYBA 4PU2A 2M30A 1Y1VJ 1ETYA 4IEJA 3S1QJ 2CFXA 2M3AA 4CYDA 4K5NA 1UB9A 3BR5A 1ETVA 4EM1A 3AL0C 2BW3A 3OS0A 1FJLA 3ABLH 4AVZA 5DV5A 5BS6A 2D45A 1P4XA 2P81A 3FU5A 1AKHB 1B1BA 3J80Z 2DTRA 2FF4A 3LSJA 1MNMC 5DULA 3HSEA 1LEBA 1XMKA 4I02A 5CVIA 2YSRA 3V8LA 3CZLA 1HXDA 1USSA 3MEXA 3R6SA 4XR6A 4ZYDA 1ZLKA 3OIPA 1YS6A 1ONNA 3LSIA 2JWTA 2KRFA 3A2KA 3I4NJ 4Y33A 2AXLA 1FC3A 3CZEA 1B72A 1E3OC 2OU2A 1QZEA 4D9JA 4XIDA 3ZHXA 3IKTA 2P6SA 3ANLA 3HB9A 1XGSA 2YU9J 2EB7A 3OWTA 3TKYA 2K7LA 1Z3XA 2CV2A 1WJ5A 1GLNA 3R61A 1R5GA 1Q0LA 4XMYA 2K4JA 3CUOA 1X1DA 3FTVA 1YE9A 2F5DA 2CW7A 2XB0X 2VT2A 2VONA 3CHPA 1Q1HA 1HSJA 4ZW7A 3Q9SA 4EQQA 2HS5A 3RZOJ 3CLQA 4HX4A 4L5IA 4GDFA 2R59A 2IRFG 2BW3B 1TT0A 2R93J 2HOAA 2DQ6A 4YEJA 3DBRB 2DCEA 4HEA2 3DEEA 1JI8A 2EINH 4B48A 4DYRA 3DU6A 3CMEI 4WXDA 1ZQ3P 3QU6A 2ECCA 2WA0A 3PIOF 4M74A 3EBIA 3GTPJ 4MGRA 2YPRA 1P7JA 3I64A 3C2HA 2NVTJ 2M87A 5E1ZB 1FOXA 1B72B 1XB4A 2WAEA 1Z6TA 1UZCA 5DD8A 2R7TA 4Y7NJ 1HBXG 3FUMA 3GCMA 2OTLI 1YIOA 4Q5SF 2LVSA 3QU3A 4EJTA 3Q9VA 4BXUA 1IO2A 4C9YA 1GHCA 1G59A 2M7BA 2W84A 4BHCA 4ZH4F 2K9MA 4LG3A 4FLOA 2Y0SN 3W2VA 1RNLA 2KIMA 2MBFA 2R7OA 2AQEA 3M7GA 1TWHJ 2NVUB 2IS6A 1G3YA 3GLLA 3QPTA 5A2QZ 2RQPA 2PJRA 2QF7A 1YRNA 2MH2A 3CCEI 3REOA 2CUZA 2D5VA 3ZI0A 1SAUA 2ZXJA 2VE8A 5C44J 1GXQA 1ONOA 3EUKL 3LL7A 1U5TA 3H0DA 1MBHA 2WC2A 1QNTA 2GXBA 3EETA 3P5JA 3CTAA 3Q44A 1HLVA 4Y52J 4XN9A 2AHQA 1O4XA 2HDCA 1XC5A 1OCZH 3D5SC 4YELA 1LFBA 4XN2A 1WH5A 2FQ3A 1UHMA 2E71A 3W6VA 3DCFA 3GZNB 4I7HA 1W7PD 2X1CA 5TISC 2DMQA 3G3ZA 3IIEA 2JMWA 2DAOA 3FH8A 2WWYA 2JVGA 4IOAF 3PO3J 3K4BA 3K10A 4BH9A 3TW6A 3BR6A 4D0PA 3CHOA 4UUVA 5TJJA 3L7WA 2I10A 4BAYA 2EBIA 4HQEA 1KQ0A 5EEAA 5JVGF 2Q2EA 1DGRM 1R4NB 1LFPA 4EM0B 4N4NB 1JT0A 2VXZA 4XL9A 4XN8A 2PJRB 1YRNB 2X6XA 1NG7A 2PMHA 1O3RA 1J9IA 2L3DA 4A3BJ 1X58A 3RTRA 5TGTA 1U5TB 5JHUA 1Z6RA 4MIMA 2VB6A 3FTSA 3CJTB 2GOXB 2QBYA 3M4OJ 2Q1ZB 3IC7A 3P9IA 4L5EA 3T8TA 3ABKH 3HKZA 2RGVA 5GP9A 3U21A 5JVTA 1IDZA 1UCRA 3RJPA 1LNWA 2XPVA 4RA2A 2TCTA 4KT6A 1WVRA 4HF2A 4MFDA 4CHUA 4U0WA 2STWA 1QU3A 2KJBA 3IWFA 4C3IJ 3E0JB 1R22A 4U0VA 2Z3YA 1ODDA 2RAEA 2VKDA 3EQLF 4XN3A 4Y17A 3J7YJ 3F22A 3H3UA 2M45A 4ENMA 3HOVJ 4LK1F 4J00A 5EF6A 2LMDA 1MSEC 3DU5A 2HPMA 2R5YA 3C1DA 3LSTA 1JTXA 1VQPI 2JA6J 2A5WA 1VQ8I 4E7KA 1ENHA 2MG4A 4BQAA 3AG4H 2XASA 2NVYJ 3P9CA 5F6FA 2VC1A 2NVXJ 2OJED 1X1CA 3PQJA 2HNHA 3GFMA 4PCQA 4RLFA 3ZMSA 1X2MA 4YFXF 4WX9A 5JC1A 4RB3C 1TNTA 4BYYA 4G9YA 5C3EJ 1IXCA 2JA7J 2Q2EB 1IN5A 3AFHA 3M3YJ 3GTJJ 1RUOA 1PJRA 2DOEA 2W57A 1VQ7I 3BCBA 2ESHA 2N8GA 4HSRA 4XSXF 2G9WA 5IT9Z 3UR3C 1IAWA 1HCRA 1TC3C 5JI6A 3LOCA 1R0KA 3M8FA 4E7JA 3VSKA 1P7IA 3JAMZ 4HLYA 4Y6SA 4UUSB 3OYDA 3V7RA 3QOEA 2Y75A 2L7ZA 2BBYA 5CKTA 3S3NA 3B7TA 3R0IA 2GLOA 1HW5A 4OU0A 4CA0A 5HVQC 4CCNA 2HQRA 4RAZA 2XGEA 3SDBA 3WE2A 3KEOA 2PN6A 3E7LA 3E6BA 2DPDA 4QSHA 2YR2A 4A3LJ 1H88C 2R5YB 2LR8A 4ZC3A 1N25A 1I5ZA 3BCAA 5H20A 4ON0A 3B7SA 2L02A 1MMGA 4Q4IA 3SZTA 3EBGA 3JW4A 3ZHYA 3I59A 5L3EA 2B0LA 1Z05A 2RVCA 3CDIA 3OYJA 4KFCA 4YIFA 4YFKF 1FT9A 1MBJA 4QPOA 5HNHA 2DA3A 4JP0A 1RESA 1WPKA 2GXGA 1YW9A 2ELHA 5EGOB 3DLLF 2M0MA 1Z77A 2M8EA 4M6VA 3OS1A 2X48A 4XRSA 5IOYA 2KJCA 3IAM2 4BY1J 3A02A 3DTIA 5HS9A 4FX4A 1G3SA 2LY2A 1T0FC 3TP3A 5IOZA 1WI3A 2KL4A 5DLLA 1BOAA 4OOIA 3PQKA 1CF7A 5J8FA 1C0WA 1UHWA 3O3KA 3CHQA 1IN4A 3BDDA 1OKRA 5DM6F 4CYCA 3HOUJ 2FSWA 3AKZA 3KP6A 3MKLA 3MKWB 2XAHA 4A2UA 2WBMA 2EFPA 2KFDA 5FKOA 5EEGA 1I1SA 4W97A 4C2TA 4IKFA 2VOPA 2JUCA 3DPUA 4OIPF 4EJWA 4ETSA 4XORA 2I5UA 4BXXJ 1Y56A 2KIUA 2UXXA 3WTZA 3GTOJ 3EYIA 3FF5A 5FLXK 2HQNA 2ZB9A 5C4XJ 3H3VK 2DT7B 1OR7A 3F9KA 3P9KA 4I6ZA 1KYZA 1XD7A 2KIQA 1BW5A 2R7QA 2Y0SA 4I0AA 3G71I 2V9VA 2GIZA 4C30A 2MD0A 3BTLA 2EV6A 5CVUA 1IRFA 3BR1A 2G0EA 2CUFA 1SD4A 1IN7A 2WB1N 3I5UA 5GADJ 1YJWI 2KZGA 2JD1A 2Y1GA 4EV0A 3L2WA 4BDYA 3MQ0A 2CQ7A 2FNPA 3GZ5A 2DFIA 4IQ4A 1CF7B 2A6EF 2K3PA 3OOUA 1B8IA 2ZKZA 1LKXA 3FULA 2KISA 2XAJA 4L0ZB 3RPQA 1A31A 5CVJA 2H6CA 4P96A 2NOGA 4CCKA 3F6OA 1K78A 1MW2A 5JLXA 1UELB 5J1YA 1H0MA 4OMZA 4ENNA 3J7AY 2HVSA 2QA4I 3AL0B 1NH3A 2XDVA 3B2PA 4Y6PA 4AYBN 1I3AA 4I0BA 3HL2A 4AU7A 1Y8QB 5D6FA 3KYLA 4DZJA 2M4KA 1WJBA 4HNUA 3K1PA 2R7XA 4ZQFA 1ZTRA 4EATA 1MBFA 2EIKH 2HQAA 3IAS2 1TWFJ 3GEZA 4YRVA 2KDOA 4UHTA 2O03A 2XGCA 3WTVC 2NS8A 3ISPA 1OCRH 4XONA 5FD5A 5JMPA 2IP2A 2VJJA 5L3CA 4HF1A 4HA8A 3JSZA 3JTGA 1Z7LA 5FLMJ 3HHHA 4L18B 2M4GA 2P6TA 2IGOA 2HTSA 2OAZA 1BR1A 2EWNA 2OCCH 3IH4A 4MHGA 3A14A 1QQIA 4XKWA 2GWRA 3KP3A 2LDUA 3OL4A 1MJ9A 4OWRB 1PDNC 3VYUB 1YLFA 2NYXA 5LHHA 3IV5A 4P55A 4DQ2A 5DCFA 4ZTFA 1B8IB 5AIPA 3S17J 3PIPF 3OS2A 2E35A 3V8KA 4W1UA 1S7AA 4IHTA 1OYYA 2QWWA 3NWSA 4U0YA 1K78B 3NWTA 2JD2A 4Q4ZF 3FTZA 4IL6C 5B1BH 3CC4I 3KP5A 4R8HA 3WGGA 1PUEE 2VPLA 3K1NA 1IG7A 3GW2A 2VE9A 5DYMA 1N77A 1E3PA 2QQAA 4DGWB 4ZX4A 4EJOA 2AXTC 2DT6A 1YW8A 4BBSJ 2GQQA 3TO7A 3RKQA 2HI3A 3F8BA 1PVEA 2DMPA 4A0YA 4IRGA 2EQRA 4S05A 2DXIA 1Z67A 2F5CA 1WJAA 3HUGB 4ZQGA 3DWLE 3QQAA 1U0JA 5F08A 3TL4X 4PGGA 2FJ1A 1NK2P 3W6KB 1JGIA 3S32A 1XGMA 3K4LA 1VQMI 4QTRA 4IJAA 2PBIA 3X2QH 3K7AJ 1O7FA 1R6RA 1JJ8C 1QVUA 1MJAA 1WCMJ 4C2MJ 3S3OA 2XSDC 4XMXA 3ZQLA 3HSFA 1RETA 5ERIA 1TWCJ 3CCMI 1ZRFA 3RZDJ 4XO5A 3BPXA 3K4MA 1PYVA 4L9VA 4UNOA 2IGMA 4Y67A 3B7UX 4AIJA 2RNJA 2M1BA 2XRNA 3QJXA 2DDAA 4K2EA 1TW3A 1WJFA 4ZJZA 1J0RA 1OCCH 2O0YA 2V6EA 1I27A 3ZQCA 3T8VA 2LTPA 4IF4A 3ZQQA 3CUQA 1MJBA 5C4JJ 3S2WA 4QWQA 4CCLA 1GVDA 1Y6IA 2QENA 4HZFA 3OYKA 2PMUA 4GAEA 3E97A 3W3CA 3TQNA 3HRTA 2PL5A 4V2GA 3QOPA 4RB1A 2QSHX 5DDGA 3IRQA 3SJMA 3G2BA 1K4TA 2VXDA 1P4WA 4JNDA 1TLHB 2L4AA 4OIOF 4AICA 4IHWA 1U8RA 1SVOA 5D8LB 5FD6A 2LRDA 3U9WA 2BY2A 2WAQN 2L9NA 3DBHB 1U8BA 3U1KA 2E7XA 4D7MA 2LREA 5B3SH 4E70A 2X6WA 5DUKA 2EV0A 2ZFUA 1O57A 2JJ7A 1MH3A 1UJ8A 1XX5A 3RQ4A 2LSOA 4NB5A 1FWZA 2RDPA 4HYEA 3JR9A 1PUFA 1G5AA 1WFXA 1ZS2A 3RC3A 3LFUA 2A69F 1R00A 3BWGA 1R49A 2ZXGA 4ZDPA 1F43A 2IJLA 4EM2A 1NG6A 3BT9A 3K6GA 1W5CC 2HXOA 1O3QA 3FTWA 4KIGA 1S9HA 1TBXA 2M7AA 1VTNC 3TO9A 2Y2ZA 3JTHA 3FUKA 2W82A 3UKGA 5HLGA 4ZW6A 2E1OA 4FHTA 3ZN0A 2VIXA 5D5WB 2DQMA 3DBLB 4MS6A 5F1RA 2KLOA 3QYEA 5AONA 2HXIA 3FH7A 1T39A 4BE2A 3MZYA 1S6LA 3K70D 1QPIA 4M6XA 5GAHJ 1FBUA 2ZJQF 5F04A 2FE3A 2FOKA 2KIFA 4EGZA 3LA7A 2HOEA 2XGXA 2Y31A 2ID3A 1BI3A 1H19A 2X4HA 3P7NA 4XLNF 1XSVA 1OPCA 4IOCF 1QBJA 4IHYA 2WZGA 1V54H 5CLSA 2A3SA 2WB1A 3E1SA 2QUFA 3LSGA 1K5HA 3FUHA 1YX5A 2L9VA 2ELKA 3KP2A 3TDZC 4XMTA 4XN4A 1MMSA 2H8WA 4BY7J 2DA7A 1ZR4A 4U87A 4OOEA 3Q0UA 1SD5A 1X1AA 3IH3A 5FROA 3T5XA 4M3FA 3FH5A 2CUEA 3VYTB 1V5EA 3CZ6A 2VJ8A 4ZYHA 1DP3A 1SFKA 2O7GA 5KVRA 2JUGA 1OLTA 4IX7A 4LK0F 3HTSB 2BHYA 2EZHA 3ZXSA 4DYQA 1ZELA 4XO4A 3WQRA 2W24A 4BGDA 1PP7U 1LQ1A 2OQRA 3FUDA 4PJJA 4KITB 5IYDJ 2C82A 3E6DA 3OYHA 5FKNA 1XS9A 1ZK8A 2PMZN 2L7FP 1VQ6I 3SZGA 3WQSB 3O8HA 4NC7A 2ZNYA 5LRSA 3CIAA 5LGTA 2KT0A 1YYVA 4FISA 4BJ5C 3FHZA 4Y6RA 2VJ4A 2MSYA 5JNLA 2XKPA 5JR3A 3CMMA 2E7WA 2K40A 2E2JJ 1R36A 4KIBA 3FUJA 1OR7C 3QPLA 4Y15A 5IP7J 1CGPA 4OIQF 3BG7A 4Q48A 3I0TA 4V19K 2VBZA 1MVYA 3L1PA 2P0WA 2H8RA 2EFNA 3WE3A 1MGTA 5E3NA 2D1VA 3ABTA 3GXOA 3GTQJ 3VODA 2L9SA 5LEKA 2K5CA 2LF8A 1QA6A 2JT1A 1TNSA 4HQMA 3RKYA 3FISA 1XDSA 3KEDA 5A2QK 2Z99A 1VZ0A 2A61A 3LA2A 4AIDA 5HOOA 4PZJA 2DQRA 4JYKA 3KP7A 3L2QA 2JV7A 3JRBA 1J7KA 4GO1A 4LLLA 2E1MC 3HHGA 1ZARA 3B02A 1GVJA 3JREA 1O3TA 4CXFA 3EUHA 4L5JA 2W85A 4GRIA 2LYCA 3H5AA 5IY5H 1FYLA 4S0HB 4XLAA 5LEJA 1H9TA 4RB2C 3RYRA 4F52A 1T8IA 4B44A 1X3UA 4BQQA 4XNAA 2ESNA 1I50J 1G8XA 2YX4A 3D1NI 2EV5A 3JRAA 3B6CA 4A5MA 3BJAA 1IUFA 2COMA 2Z1DA 1GV5A 3BR0A 1T98A 1LVAA 3HYIA 3PL8A 3AAFA 5D5XB 2XAUA 1ACIA 5HDGA 2F4MB 4CUGA 2A07F 2EGHA 4RGXA 2C6YA 4A3EJ 2ZMEA 4MLOA 2LY9A 1ZG3A 2DW4A 3RPUD 2NRAC 3HOYJ 2HQ5A 2ACJA 5JAZA 5JO0A 1RIOH 3H9GA 4JBAA 2FUG2 2BGCA 4G7OF 3T1BA 2W48A 1TT5B 2QCOA 1OFCX 3FKIJ 3ZCOA 4G8XA 3HJEA 1BL0A 1M1EB 4FLSA 4AIHA 3OYEA 3ERMA 4LB5A 2CQNA 4IRIA 2Z16A 2HDDA 2BYVE 5J40A 1LB2A 1OCPA 1P92A 1LEAA 4GGGA 1FIAA 2EZKA 3HPGA 2P5KA 3WTYC 2BEOA 2CQQA 5HLTA 3CJRB 1YW7A 1N75A 2XSJC 4NUBA 2AS5F 1N78A 1KONA 2E19A 5BNGA 3RI4A 4OOFA 1ETWA 4XNDA 3AG1H 4LOCA 3AUAA 3S15J 3ZMDA 1BJAA 2ZMEB 3SEZA 5DUIA 2WAQA 5BMZA 2V26A 3QRFF 3HXLA 3HDDA 2GOMA 3L00A 3I4MJ 1MH4A 3G1LA 2VKVA 2M9HA 4MTEA 3Q43A 1UG0A 2DO7A 2QM3A 4OINF 1D1AA 1WWXA 1Y0UA 2JCVA 4BQNA 3WU0A 3BR2A 5CQEA 1QZYA 1R1VA 2X9DA 5FKKA 1D0YA 3FIWA 1U6GA 5IT9K 4ESJA 1W4MA 4HLXA 3JRIA 3W2AA 3DKXA 2HZTA 2BY1A 3JRCA 3FXKA 1OCOH 4ZYGA 1R5ID 1OYIA 5CVVA 3FXRA 4G6DA 2PUSA 2XF5A 4KP7A 2GA1A 3JAMK 1FTZA 2IVMA 5FFZA 4BS9A 4M72A 4NC6A 3TBIA 3I3LA 1S7OA 4C3HJ 3DTKA 3GFIA 2VC0A 4EJVA 5K7FA 4R5XA 3BTIA 4KT5C 1P4AA 2XAQA 5E3OA 3C18A 3CUQC 2X6YA 5B1AH 3ZQGA 3J7AO 1SVLA 1XG1A 4D1QA 4RSYA 1R4MB 2ME0A 1O7LA 5KAFC 2KDZA 3J81Z 5E1WA 4Q4EA 2O61A 2Y0MA 1E3HA 3CCQI 1JJ6C 1RUNA 2D1HA 2L01A 3I9V2 2BVLA 1WJCA 2ID6A 3D5LA 2V9PA 1SFOJ 1DDNA 4A3KJ 2M0CA 2IXSA 5F0FA 3V8JA 3R60A 4FT8A 2MABA 3CF5F 3WHBA 4DZPA 3MWMA 4WWCA 1TQPA 3HOSA 1D8KA 2R70A 1HW1A 2RC4A 2L7MP 5E8GA 2B7EA 3GYHX 4BACA 2Z5UA 3BC8A 1FMVA 2I8DA 5GPAA 1ON2A 4PFOA 1XGNA 3K2ZA 2HOSA 2BXZA 3FUEA 3FK7A 5IP6A 5BPIA 1S46A 2QSFX 4FETA 3VYSB 2Z9OA 2PFBA 4UVBA 4F92B 2R5ZA 2R7RA 4ZW5A 4RAFA 1RKWA 4F93B 3SXYA 4CCJA 2EJRA 4WXHA 1W36D 2ZXHA 4Y3OA 3RKXA 4QLCU 1B6AA 2EILH 3LA3A 2QBYB 2OF7A 2R7ZJ 3WG7H 5ICCA 4ENJA 2CSOA 2EPFA 4RGUA 1RC9A 2HPIA 2F2EA 1DPUA 5LHGA 2CUJA 1SMYF 4EJUA 2PMZA 2XV4S 3H36A 4UB8C 1RRJA 2JA2A 4AIKA 2YX7A 4G6TB 4XKCA 3MCZA 2GAUA 2DMUA 4ZX6A 1W1WE 3GBGA 4OAYA 4PJMA 3C7JA 4NHJA 3IP4B 2WADA 1VQ5I 1E2XA 4U7BA 4IQJA 2CG4A 2EZIA 2OPTA 4L9TA 1FPQA 3BTJA 3I56I 3BQYA 3H9QA 4KUMA 2FXAA 5LFAA 1JUSA 1QVTA 2J5OA 4XKBA 5B66C 1YJ9I 1K6OA 4PJLA 5LRRA 1ZH5A 4YIRX 2VI6A 3K4KA 2XROA 2M5WA 1IV6A 3FM5A 4HF0A 4HOBA 4KJZA 3R0AA 2JA5J 2FX0A 4MNUA 3VYRB 1OCTC 4IHSA 5E17F 4H4KC 2CU7A 5KK1A 2F6CA 5BQTA 3HOXJ 2ZC2A 5BPDA 2HPTA 4KN7X 1YS7A 1UMQA 4QPQA 3FXOA 5LHIA 4LG0A 4RGRA 3H92A 3S93A 3UNGC 4E7HA 2G7UA 2DJIA 3V7SA 4AWXB 2QZ8A 1AHDP 1IGNA 1WZ2A 2MW8A 1OYWA 1ZG1A 1W5TA 3KP4A 3F21A 4CCOA 2EFQA 4M73A 5B5EC 1Z91A 3N97A 1JTYA 1JKOC 1IRZA 2JD0A 5GTHC 3A1YA 1NTCA 2L54A 3RQIA 1KA8A 4JX5A 2F5EA 3BQZA 1HW2A 5J47A 1IN8A 2BVMA 4XN7A 5AENA 3LAJA 3G4SI 3CMAI 1KU3A 2ZCWA 4E6KG 1X3WA 1MBKA 1FP1D 5J4YA 4GFBA 4I01A 1SQMA 2C5ZA 3E5UA 4PDKA 4Q47A 4L2LA 1FTTA 2K9SA 3GTMJ 4B8XA 2FQ4A 1BI1A 1GXPA 4PSXA 5HNFA 2Y48A 4YFNF 2RREA 2OA4A 3I59B 3ZR8X 3F8CA 2P4WA 3GZ6A 2IGKA 3ELKA 1APLC 1HDDC 2OZ6A 1IC8A 1CQTA 3FXQA 4IPAA 5JMWA 1SEUA 1OJLA 3MVPA 5GTIC 3BP8A 2UV1A 4G7ZF 2NS7A 2WPGA 3E3VA 2Q0OA 2VJ5A 1MW1A 1ZLJA 1FSEA 4PSWA 1ULYA 4FX0A 1EV7A 4DNCA 3MKZA 3IUOA 4XMZA 2P7CB 1R9TJ 4PJNA 1T08B 4M3DA 1W7PA 2CQXA 2CFOA 3NAUA 2KRCA 2BV6A 2P8TA 3MAJA 2QQ8A 3OSFA 2BXYA 4B1RA 1VQNI 2EA2A 4WK8F 4BKXA 2CQKA 3DLAA 3LSPA 2H27A 1SMTA 2NNNA 3EUHC 4CYCB 4K5PA 3L09A 1X3WB 2ZXWH 3F8NA 2XVCA 4A0XA 1R7JA 1BN5A 4HX7A 5D6EA 4R79A 2B63J 1S8NA 2STTA 5IT3A 1I3QJ 5D4RA 1BIBA 3WTWC 2Z33A 4A12A 4A3GJ 1ETXA 2ISYA 4RM2A 3ZP5A 1F9NA 3B6AA 1EH6A 3PJRA 5BOXA 4P5OA 3VWBA 3CO6C 2KPMA 3WU2C 2BE5F 2DODA 3CDLA 2ZMEC 2CO5A 1D0XA 4QMEA 2YU3A 2F48A 3CCYA 4LLGF 3HM5A 4N9HA 3TO6A 5EG0A 3L9FA 3ZQHA 3GFLA 3KLOA 3CLOA 1FMWA 1TP4A 2DYSH 4N9IA 3I58A 3LQQA 4XRSG 4EVIA 1LFUP 2Y30A 3S16J 4RLQA 3FU0A 4LFUA 3B37A 3V7CA 2O5RA 2E1CA 5D4SA 2V6CA 2W7NA 2IAIA 4ESFA 5IPAA 2FBIA 4O5VA 3KIOA 1D1BA 2RQQA 2X1EA 2IS1A 2E1MB 5GAEJ 5KHDA 4LIVA 2F4OB 4WF2A 3SZPA 2H94A 2PJPA 3UERA 4PGHA 2VQCA 3OYNA 4E7IA 4EMSA 2QEXI 1YIJI 3JT1A 2R7DA 5GPCA 4I99C 1U3EM 1B4AA 2O6GE 4IXAA 3DPTA 1SFUA 1V5FA 1WQ2A 3CO7C 2V1NA 4LLNA 2LD5A 1EJ9A 4E7ZA 1KZHA 3G6EI 4ZX3A 3KETA 3QYBA 3OY9A 3A01A 3PNTA 3FTYA 3ECOA 1G3WA 1HOMA 3FHEA 3TDUC 5FFXA 1G6NA 2ME6A 1A35A 4P9FA 3VVMA 5IYCJ 3O8GA 1J75A 1MNDA 5M5XJ 4PVBA 1HDPA 2EA4A 4YIIA 3PO2J 2ECBA 4XKVA 2R7FA 4QHPA 2K9NA 1F1ZA 3CCSI 3SEQA
chains in the Genus database with same CATH topology
1E17A 4MTDA 2V79A 5ICFA 5HLIA 4J3BA 1ZHFA 5L3BA 3O2PE 5EEHA 2WV0A 2JRTA 5AIQA 4ESBA 2A7OA 4XMWA 2VOOA 1IF1A 4BNCA 2RN7A 3ZMVA 1MZBA 4YG2F 4AD9A 1MDMA 1I6XA 2Y1EA 2K27A 5K5QA 4ZQHA 3RASA 3FM3A 4GAAA 2QQ9A 4M9ZA 1TW2A 4CICA 1DP7P 1XN7A 4OMYA 2JSCA 3FU6A 2RKHA 4GYIA 1WI9A 2FRHA 3ECHA 4A6EA 2PG4A 1R58A 1FOKA 1FX7A 4I2OA 3FTXA 1OMIA 1K79A 2VT3A 5HDNA 3TOAA 2J5PA 4ZQTA 2HTJA 2CGPA 1D3YA 2PEXA 1J2XA 2DLLA 3I4PA 4DPRA 1AWCA 4R5VA 2GTQA 1MDMB 4XLPF 2Y1CA 3CUQB 4R1HA 2IA0A 1PP8F 4S04A 4MQVA 3GF2A 4KYWA 1MKMA 1KYWA 4G7HF 1HQCA 3DV8A 5TRDA 2NAZA 4BHPA 2VLAA 3J80K 3K0LA 2P5LC 4ZYEA 3E6MA 5ICEA 4IRHA 1FBSA 3E5XA 2ADUA 1SD7A 4AR8A 2FEZA 1H3LA 3K9TA 2XPYA 3RIRA 1A04A 2E1NA 4I98B 1GW6A 4RVBA 1YO5C 1JVSA 4GYGA 1IRGA 4U7DA 5HS7A 4QUOA 5CJ9A 4BHBA 2IT0A 4ZX5A 1LDJA 4ZN6A 3EBHA 4A5NA 3WQQA 2FNAA 2LKPA 4G6QA 1SAXA 2P7VB 3F6VA 2EFWA 4ZZDA 3TGNA 4RCVA 2HFHA 4XNBA 4ZQEA 5H6RA 2R3SA 2A6HF 1B59A 1BBYA 4RB0A 3CHRA 3ZMZA 2ISZA 5DCMA 2HKOA 3E5QA 3UCQA 1BC8C 2VN2A 2HEOA 1IZ1A 3IWZA 2K02A 3LAPA 1SG7A 2XHKA 2WTEA 3GUDA 2HYFA 3M8EA 1NHAA 1ONVA 4UV9A 4XRFA 2B61A 4CO8A 4A03A 3GX4X 4K5LA 3HSRA 5L3DA 1FBQA 5ED4A 3KE2A 5ILUA 2EK5A 4LMYA 3CZGA 3ANMA 3M1EA 3GVAA 4KA4A 3DP7A 4XMVA 2A5YB 4JK1X 3BJOA 2JZYA 1ZAOA 4UXNA 1XSDA 2MH9A 4KMUX 3FMSA 2OZUA 3BY6A 2QQBA 4IVNA 5DCMB 1HS6A 2XAFA 2XIGA 2HKXA 2XUBA 4MQ9F 2FFLA 2OQGA 3WG9A 1KQ8A 3GFJA 3U9GA 2NNYA 1XMAA 5DD4A 1XSXA 1V4RA 4WXCA 1LDDA 2O3FA 2VBXA 4GXOA 3RC8A 2HGCA 2PI0A 3B7RL 1B9MA 2ZNZA 1H9GA 3C3WA 2XKOA 3NQOA 3F8FA 2MLGA 3RDIA 1JHHA 2MAOA 1J59A 1S3JA 3J81K 1BI2A 4KNYA 4FLQA 3VOEA 4UVAA 3E6CC 1ZG5A 2XQ0A 3DEUA 4MEYF 1R5HA 1SC5A 1W5SA 4Y13A 4MKTA 4KICA 1Z7UA 3F8MA 4M9SA 3IL2A 3FUIA 5E1XA 1MW0A 2DT5A 1J5YA 3ZPLA 2IA2A 3TOBA 3FMRA 1FYKA 2PGGA 1R0LA 2XPZA 1SFXA 1KU7A 1YFHA 2KKOA 1F5TA 1U2WA 2HR3A 2DBBA 4L0YB 3SHFA 3K1MA 4RS8A 1ZN2A 3MZHA 2UWMA 1P2FA 3NRVA 3JSOA 3ZQ7A 2W25A 1T2KA 2V1UA 3DF8A 3AU8A 3OOPA 2UZKA 3ZHZA 1ZREA 4ARFA 2MC3A 1YTYA 5ILSA 1P6RA 4XO3A 5K5OA 4NQWA 3OV8A 1WKMA 3WTXC 4CZZA 4R5TA 4FLRA 3EYYA 5FGMA 5FB2A 4XN5A 3B34A 3BPVA 5L3GA 4HAMA 2RJIA 3HRMA 4M9XA 1ZGAA 2DPUA 2JCYA 1FSHA 2P5VA 1XCVA 3QAHA 2DK8A 2CYYA 2FU4A 5HS8A 2ZFWA 1DUXC 2IPQX 1BI0A 3KZZA 1ONPA 1ZGJA 4A6DA 3WTSC 2LF7A 2DI3A 4I09A 2OBPA 2Q8KA 3FMQA 4M71A 2UXNA 3VVLA 3F72A 2V1XA 3WGIA 1IXRC 3B3BA 1JGSA 4B09A 4TV7A 3IKVA 4ZZLA 1LDKB 2QVWA 3I53A 3ML6A 2NS0A 2PLYA 2IW5A 3I54A 4XBFA 5ILVA 1FNNA 4OIRF 1ZRCA 2CWEA 5LBQA 3BOQA 5FWQA 5E20A 4EGYA 3FWEA 3M9AA 3T0YA 3ZMUA 1RI7A 3QPHA 4M6YA 1O3SA 1TQIA 1KU2A 1X3ZA 2QYOA 4UV8A 4HV6A 2L4MA 3GWZA 4L9NA 3DXJF 1KQ9A 2F5FA 4KIFA 4LB6B 2DU9A 3RPUA 1V3FA 1QO0D 4WCGA 3PFIA 5LGNA 2PQ8A 3Q5FA 3QP5A 4AR9A 4JQFA 2MA3A 3WTUC 3CZKA 4AVPA 4HW0A 1YG2A 3V4GA 1STZA 4P9UA 5DYFA 1XDUA 1D8JA 3FTUA 1B9NA 2WZFA 3FXUA 1T1SA 3BJ6A 5D5UB 3HIFA 3WODF 3FU3A 1Z9CA 4LUPA 2G7HA 3JSPA 2Y1DA 4LG0B 1F4KA 1ZYRF 5H6QA 2ZO4A 3K69A 1JG9A 5L3FA 1IXSB 1IUYA 3U1DA 3B73A 4ZW8A 1KU9A 3W6JB 5D8KB 1SFEA 2K86A 3KLNA 5LGUA 3ZN1A 3ANNA 1EH7A 2H09A 2VBYA 4HBLA 1L0OC 5F64A 3I71A 3G73A 1LJ9A 1HKTA 1I1GA 2ZJ2A 4L9JA 4QIRA 4CGZA 1ZRDA 4G94A 1JHFA 1FLIA 2FBKA 1FY7A 4X2UA 3DFGA 3A06A 1HKSA 6PAXA 2FA5A 2MD5A 1HKQA 2TDXA 2JPBA 4GCVA 1USTA 2IA1A 3VB2A 1W7PB 2HWVA 1RZ4A 2VBWA 3EDPA 2QVOA 5CVRA 3HRUA 1G4DA 1XGOA 4XSZF 1BIAA 1WSUA 3CJNA 4H0EA 4LJZF 3MFKA 5FLXZ 2QJ1A 3HUGA 2MLKA 3L2CA 1D5VA 2EFOA 4HDVA 4R7LA 3DPLC 2FMYA 4K5MA 1WRJA 2ETHA 3O6BB 1BM9A 4A0ZA 2CW0F 4HV5A 3KEQA 4LD5A 1TTYA 3H3ZA 1EH8A 3BROA 3FZVA 4HX8A 4U88A 3IHUA 2FBHA 2GA2A 1K7AA 1U5TC 1IN6A 1XCBA 5D5VB 1JE8A 3HTUA 3R4KA 4KMFA 5ICGA 4RAYA 4O6JA 2VODA 3LWFA 3ULQB 1MW3A 3AU9A 4FCAA 1ON1A 1QZZA 1QGPA 1FP2A 1RP3A 3PUUA 1KGSA 3F3XA 4HDUA 2HPOA 3HRSA 3VFZA 4Z2YA 4K5OA 5J6XA 3ROUA 4KN4X 3ZMTA 4ZW3A 3ABUA 3BZ6A 4ENKA 3GO5A 3WTTC 3GLXA 1U78A 2D2WA 3CHSA 1SD6A 1R1UA 2OD5A 3FX3A 3D0SA 5EV7A 5HLHA 1HSTA 2JTVA 3RYPA 1TQMA 2GZWA 3LQRA 3U2RA 1FYMA 4QPEA 5LLQA 1R23A 2K4BA 3KZYA 1Z1DA 3ERED 3QP6A 3DKWA 3HOTA 2GIVA 2MAPA 1DPRA 5FO5A 5BPPA 5HDKA 1IW7F 4AYSA 3KCCA 4XMUA 3WU1B 1QPMA 3FUFA 2R72A 4O3MA 2XAGA 1MD0A 3T8RA 1Q0QA 3KFWX 3CDHA 3NEUA 1T1RA 2Y1FA 5JFRA 1Q0HA 5CYVA 2HYGD 5JBIA 1BC7C 1R1TA 1T38A 4RGSA 1YQAA 1FZPB 3UEQA 3F23A 1S29A 3VEPA 4CDGA 2RV8A 3IRRA 2V1DA 5J8CA 4UVCA 3DQVC 3B2XA 2ZBKA 4AR1A 5DEQA 3R0JA 3N4MA 4MEXF 5K1YA 3COAC 4KDPA 2DQLA 2JPCA 2QLZA 1G3TA 1REPC 5E8IA 3FUNA 2A68F 5K5RA 4F7ZA 4ASNA 1T6SA 3WGHA 1UFMA 1AOYA 2LNBA 4LGWA 5E18F 1L3LA 1T0FA 2O8XA 3SFZA 3LFKA 3SQNA 2FMLA 4N0BA 2JCXA 3RKWA 4PW4A 2DK5A 2H6BA 4XN1A 2X0LA 4PU2A 2M30A 2CFXA 4K5NA 4CYDA 1UB9A 4EM1A 5DV5A 5BS6A 2D45A 1P4XA 3FU5A 1B1BA 3J80Z 2DTRA 2FF4A 5DULA 3HSEA 1LEBA 1XMKA 4I02A 5CVIA 2YSRA 3V8LA 3CZLA 1HXDA 1USSA 3MEXA 3R6SA 4ZYDA 1ZLKA 1YS6A 1ONNA 2KRFA 2AXLA 1FC3A 3CZEA 2OU2A 3ZHXA 3IKTA 2P6SA 3ANLA 1XGSA 2EB7A 3TKYA 2K7LA 3R61A 1R5GA 1Q0LA 2K4JA 3CUOA 3FTVA 2F5DA 2VT2A 2VONA 3CHPA 1Q1HA 1HSJA 4ZW7A 3Q9SA 4EQQA 2HS5A 4HX4A 4L5IA 2R59A 2IRFG 2DQ6A 4WXDA 3QU6A 4M74A 3EBIA 4MGRA 2YPRA 3I64A 2M87A 5E1ZB 1XB4A 1Z6TA 5DD8A 1HBXG 3FUMA 1YIOA 4Q5SF 3QU3A 4EJTA 3Q9VA 4BXUA 1GHCA 2W84A 4BHCA 4ZH4F 4FLOA 1RNLA 2KIMA 2MBFA 3M7GA 1G3YA 3QPTA 5A2QZ 2RQPA 2MH2A 3REOA 3ZI0A 2ZXJA 2VE8A 1GXQA 1ONOA 1U5TA 2WC2A 1QNTA 2GXBA 3EETA 3Q44A 3CTAA 4XN9A 2HDCA 4XN2A 2FQ3A 1UHMA 4I7HA 1W7PD 3G3ZA 3IIEA 2DAOA 3FH8A 2WWYA 4BH9A 4D0PA 3CHOA 4UUVA 5TJJA 3L7WA 4BAYA 4HQEA 1KQ0A 2Q2EA 4EM0B 2VXZA 4XN8A 2PMHA 1O3RA 1J9IA 2L3DA 3RTRA 1U5TB 5JHUA 1Z6RA 3FTSA 2QBYA 3IC7A 3P9IA 3T8TA 2RGVA 5JVTA 1UCRA 3RJPA 1LNWA 4HF2A 4CHUA 4U0WA 2STWA 2KJBA 3IWFA 4U0VA 1R22A 2Z3YA 1ODDA 3EQLF 4Y17A 3F22A 3H3UA 2M45A 4ENMA 4LK1F 3C1DA 3LSTA 4BQAA 2XASA 3P9CA 5F6FA 2VC1A 3PQJA 4PCQA 4YFXF 3GFMA 3ZMSA 4WX9A 5JC1A 4RB3C 1TNTA 4BYYA 4G9YA 1IXCA 1IN5A 1RUOA 2W57A 2ESHA 4XSXF 5IT9Z 2G9WA 1IAWA 5JI6A 1R0KA 3M8FA 3JAMZ 4HLYA 4Y6SA 3V7RA 2Y75A 2BBYA 3B7TA 3R0IA 1HW5A 4OU0A 5HVQC 2HQRA 4RAZA 3WE2A 3KEOA 2PN6A 3E6BA 2DPDA 2YR2A 1I5ZA 5H20A 4ON0A 3B7SA 2L02A 4Q4IA 3SZTA 3EBGA 3JW4A 3ZHYA 3I59A 5L3EA 2B0LA 1Z05A 2RVCA 4KFCA 4YIFA 4YFKF 1FT9A 5HNHA 2GXGA 1YW9A 2ELHA 2M8EA 2KJCA 5HS9A 4FX4A 1G3SA 5DLLA 1BOAA 4OOIA 3PQKA 1CF7A 5J8FA 1C0WA 1UHWA 3O3KA 3CHQA 1IN4A 3BDDA 1OKRA 2FSWA 3KP6A 2XAHA 4A2UA 2EFPA 5EEGA 1I1SA 2VOPA 4OIPF 4EJWA 4ETSA 2KIUA 2UXXA 3WTZA 3EYIA 3FF5A 5FLXK 2HQNA 1OR7A 3P9KA 1KYZA 1XD7A 4I0AA 2V9VA 5CVUA 2EV6A 1IRFA 1SD4A 1IN7A 3I5UA 2Y1GA 2JD1A 4EV0A 3MQ0A 2FNPA 3GZ5A 2DFIA 1CF7B 2A6EF 3FULA 2ZKZA 2XAJA 4L0ZB 3RPQA 5CVJA 2H6CA 4P96A 3F6OA 1K78A 1MW2A 1H0MA 4OMZA 4ENNA 3B2PA 4Y6PA 4I0BA 5D6FA 3K1PA 4ZQFA 3GEZA 4UHTA 2O03A 3WTVC 5JMPA 3ISPA 5FD5A 2IP2A 5L3CA 4HF1A 4HA8A 3JSZA 3JTGA 3HHHA 4L18B 2P6TA 2HTSA 2OAZA 2EWNA 4MHGA 3A14A 1QQIA 2GWRA 3KP3A 2LDUA 1MJ9A 1PDNC 1YLFA 2NYXA 5LHHA 4P55A 4DQ2A 5DCFA 5AIPA 3V8KA 1S7AA 4IHTA 1OYYA 2QWWA 1K78B 4U0YA 2JD2A 4Q4ZF 3FTZA 3KP5A 4R8HA 3WGGA 1PUEE 3K1NA 3GW2A 2VE9A 5DYMA 2QQAA 4ZX4A 4EJOA 1YW8A 2GQQA 3TO7A 3F8BA 4A0YA 4IRGA 4S05A 2F5CA 4ZQGA 4PGGA 3W6KB 1JGIA 1XGMA 4IJAA 2PBIA 1O7FA 1MJAA 4XMXA 3HSFA 5ERIA 1ZRFA 4XO5A 3BPXA 4L9VA 4UNOA 4Y67A 3B7UX 4AIJA 2RNJA 2M1BA 2XRNA 3QJXA 4K2EA 1TW3A 1J0RA 2O0YA 3T8VA 1I27A 4IF4A 3CUQA 1MJBA 3S2WA 4QWQA 2QENA 4HZFA 2PMUA 4GAEA 3E97A 3TQNA 3HRTA 2PL5A 3QOPA 4RB1A 5DDGA 3IRQA 1P4WA 4JNDA 1TLHB 2L4AA 4OIOF 4AICA 1U8RA 5D8LB 5FD6A 3U9WA 2E7XA 4E70A 5DUKA 2EV0A 1O57A 2LSOA 4NB5A 1FWZA 2RDPA 4HYEA 1G5AA 1ZS2A 3RC3A 2A69F 1R00A 3BWGA 2ZXGA 2IJLA 4EM2A 3FTWA 1O3QA 4KIGA 1TBXA 1VTNC 3TO9A 3JTHA 3FUKA 5HLGA 4ZW6A 4FHTA 3ZN0A 5D5WB 2DQMA 4MS6A 5F1RA 5AONA 3FH7A 1T39A 3MZYA 1S6LA 4M6XA 1FBUA 2FE3A 2FOKA 2KIFA 4EGZA 3LA7A 2HOEA 2XGXA 1BI3A 1H19A 2X4HA 3P7NA 4XLNF 1XSVA 1OPCA 1QBJA 2WZGA 5CLSA 2A3SA 2QUFA 1K5HA 3FUHA 3KP2A 3TDZC 4XMTA 4XN4A 4OOEA 1SD5A 3T5XA 3FH5A 2VJ8A 4ZYHA 2O7GA 5KVRA 4LK0F 3HTSB 3WQRA 4XO4A 2W24A 1PP7U 1LQ1A 2OQRA 3FUDA 2C82A 3E6DA 3WQSB 5LRSA 2ZNYA 3CIAA 5LGTA 1YYVA 3FHZA 5JNLA 4Y6RA 2XKPA 5JR3A 2E7WA 1R36A 4KIBA 3FUJA 4Y15A 1CGPA 4OIQF 4Q48A 3I0TA 1MVYA 2VBZA 2EFNA 3WE3A 1MGTA 2D1VA 3ABTA 3GXOA 3VODA 5LEKA 2LF8A 2JT1A 1TNSA 4HQMA 3RKYA 1XDSA 3KEDA 5A2QK 2Z99A 2A61A 3LA2A 5HOOA 4PZJA 2DQRA 3KP7A 2JV7A 1J7KA 4GO1A 4LLLA 3HHGA 1ZARA 3B02A 1GVJA 1O3TA 4CXFA 3EUHA 4L5JA 2W85A 1FYLA 5LEJA 1H9TA 4RB2C 3RYRA 1X3UA 4XNAA 2ESNA 2YX4A 2EV5A 4A5MA 3BJAA 2COMA 1LVAA 1T98A 3HYIA 3AAFA 5D5XB 5HDGA 2A07F 2EGHA 4RGXA 2C6YA 2ZMEA 1ZG3A 2DW4A 2NRAC 5JAZA 2ACJA 5JO0A 1RIOH 4JBAA 2BGCA 4G7OF 3T1BA 4G8XA 4FLSA 4AIHA 4LB5A 4IRIA 2BYVE 1LB2A 1P92A 1LEAA 4GGGA 2P5KA 3WTYC 2BEOA 5HLTA 1YW7A 2AS5F 3RI4A 4OOFA 4XNDA 3AUAA 3ZMDA 1BJAA 2ZMEB 5DUIA 5BMZA 3QRFF 3L00A 4MTEA 3Q43A 2DO7A 2QM3A 4OINF 1WWXA 1Y0UA 2JCVA 3WU0A 1QZYA 1R1VA 1U6GA 5IT9K 4ESJA 1W4MA 4HLXA 2HZTA 4ZYGA 1OYIA 5CVVA 3FXRA 4G6DA 2PUSA 4KP7A 2GA1A 3JAMK 2IVMA 5FFZA 4M72A 1S7OA 3GFIA 2VC0A 4EJVA 4R5XA 4KT5C 1P4AA 2XAQA 3C18A 3CUQC 3J7AO 4RSYA 1O7LA 3J81Z 5E1WA 4Q4EA 2O61A 2Y0MA 1RUNA 2D1HA 2L01A 3D5LA 1DDNA 3V8JA 3R60A 4FT8A 2R70A 3MWMA 4WWCA 1TQPA 3HOSA 1D8KA 1HW1A 2RC4A 5E8GA 3GYHX 2Z5UA 1ON2A 1XGNA 3K2ZA 3FUEA 5BPIA 1S46A 2Z9OA 2PFBA 4UVBA 4ZW5A 3SXYA 2EJRA 4WXHA 3RKXA 2QBYB 4QLCU 1B6AA 3LA3A 5ICCA 4ENJA 2CSOA 4RGUA 2F2EA 1DPUA 5LHGA 1SMYF 4EJUA 2XV4S 4AIKA 2YX7A 3MCZA 2GAUA 4ZX6A 3C7JA 4NHJA 1E2XA 4U7BA 2CG4A 4L9TA 1FPQA 4KUMA 2FXAA 1K6OA 2J5OA 5LRRA 1ZH5A 2XROA 2M5WA 3FM5A 4HF0A 4HOBA 3R0AA 4MNUA 4IHSA 5E17F 5KK1A 5BQTA 5BPDA 2HPTA 4KN7X 1YS7A 5LHIA 4LG0A 4RGRA 3H92A 2G7UA 3V7SA 4AWXB 2QZ8A 1OYWA 1ZG1A 1W5TA 3KP4A 3F21A 2EFQA 4M73A 1Z91A 3N97A 2JD0A 2L54A 1KA8A 2F5EA 1HW2A 1IN8A 4XN7A 5AENA 3LAJA 1KU3A 2ZCWA 1X3WA 1FP1D 4I01A 1SQMA 2C5ZA 3E5UA 4PDKA 4Q47A 4L2LA 4B8XA 1BI1A 1GXPA 5HNFA 2Y48A 4YFNF 2OA4A 3I59B 3F8CA 2P4WA 3GZ6A 3ELKA 2OZ6A 3FXQA 4IPAA 5JMWA 3BP8A 4G7ZF 2WPGA 3E3VA 2Q0OA 1MW1A 1ZLJA 1FSEA 1ULYA 4FX0A