4CXFA

Structure of cnrh in complex with the cytosolic domain of cnry
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
154
Chain Sequence
DADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDTFVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRAARLELARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA POLYMERASE SIGMA FACTOR CNRH
publication title The Crystal Structure of the Anti-Sigma Factor Cnry in Complex with the Sigma Factor Cnrh Shows a New Structural Class of Anti- Sigma Factors Targeting Extracytoplasmic-Function Sigma Factors.
pubmed doi rcsb
source organism Cupriavidus metallidurans ch34
molecule tags Transcription
total genus 60
structure length 154
sequence length 185
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cxfA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4cxfA01
3BROA 1TQMA 4M6XA 4LB5A 2DTRA 3TDZC 3FMQA 2GWRA 4WXHA 2C6YA 2JRTA 4N9HA 2P7CB 4LLNA 4WXDA 2EK5A 2K7LA 1J75A 3WQRA 5ERIA 3E5QA 5D8KB 3U9GA 4LG0B 1RZ4A 2XRNA 1KU7A 2ADUA 4ZH4F 2IT0A 1J7KA 1MW2A 4I98B 3BWGA 3CUQA 1QBJA 2FEZA 3CTAA 1KYZA 4Q48A 1REPC 1R0KA 2O03A 4P96A 2WPGA 4N0BA 4KT5C 3K1NA 3ZI0A 2RDPA 2DU9A 4BXUA 3T5XA 3RKXA 3ABTA 3I5UA 3LQQA 1G6NA 2MA3A 4M9SA 3SXYA 1TQPA 1XGSA 5E20A 5LEKA 1R5GA 3EUHA 3FXQA 2RN7A 5BS6A 3DV8A 1QNTA 1FYKA 2Z5UA 3LAPA 4EQQA 4U7DA 3TOAA 2MH2A 1I1SA 4PGHA 1R36A 3E5UA 3V4GA 4IVNA 2RGVA 2G9WA 2ZBKA 3QPHA 1T6SA 2LKPA 1OYWA 4ZN6A 1ZREA 3F8NA 6PAXA 5BMZA 3I59B 2HQRA 4O5VA 1TNTA 2O0YA 4I02A 3L2CA 4U0WA 3T1BA 1S29A 4KP7A 3TO6A 1YQAA 2YX7A 4RGXA 3WODF 5FB2A 1UHMA 2RNJA 2XAQA 4EGZA 3EETA 3F6VA 4RB3C 4AIKA 2RQPA 4ASNA 2VE9A 3COAC 2EFOA 4ZYEA 2TDXA 3S2WA 2X4HA 2XGXA 4EV0A 4G8XA 5J8CA 2GA1A 2E1CA 4M9ZA 4O3MA 4KIGA 4KN7X 4KDPA 3L7WA 3FX3A 5CYVA 1FPQA 4P9FA 5FFZA 1QZZA 1R1VA 1ZRCA 1Z05A 1MDMB 5JR3A 1IN4A 3QPTA 1YS7A 1FZPB 4UHTA 5K1YA 2HKXA 3TDUC 2BYVE 2JT1A 1SFUA 1K78B 3FWEA 3WE2A 4LMYA 2RKHA 4MNUA 2EA2A 2J5OA 3K69A 1KQ9A 1IRGA 4EGYA 4JBAA 1PP8F 2QQ9A 4IHSA 1XB4A 2Z3YA 2VE8A 4ENKA 5ICCA 3ERED 5LHIA 1FBUA 3VEPA 1T1SA 1U5TB 1U5TC 4CXFA 4RAYA 2UZKA 4BNCA 1LJ9A 2ZNZA 1O57A 2JZYA 3BPXA 1B4AA 4RS8A 4ZQEA 3B02A 1D3YA 2HYFA 1Z6TA 1SFEA 2XAGA 2VN2A 4A6EA 1PP7U 2QENA 5HS7A 2A3SA 3E3VA 4HV6A 3WQSB 2FE3A 3R0JA 4CHUA 3WGHA 2KKOA 1T1RA 2EFNA 3LA2A 5ICFA 5HOOA 3ZMDA 3MCZA 3HHHA 2Y1GA 2VONA 1PUEE 2QQBA 4ZQGA 4R1HA 2MAPA 2EV0A 1LEAA 3BY6A 2KIMA 1B59A 5DYMA 3TGNA 3I64A 2JTVA 1KQ8A 5D8LB 2AXLA 4XSZF 1A04A 2V1XA 4KUMA 2PJPA 5D5XB 3TQNA 4G9YA 4PZJA 4AIJA 3WE3A 3KZYA 1T0FA 2W85A 3HRTA 1ZAOA 1OMIA 1F5TA 4IXAA 3DPLC 4EM0B 1H3LA 3GFJA 5LGNA 3E97A 1ZS2A 2R3SA 3WTUC 2A5YB 2M45A 3I4PA 4ZYHA 1O7LA 5DCMB 4IRHA 3ZHZA 4HDVA 3JAMK 2LF8A 5LRRA 5L3GA 5E8GA 1FBQA 5K5QA 1B9NA 2JCVA 5CVIA 3GFMA 5ED4A 2HWVA 3R0AA 2XHKA 1BJAA 3NQOA 5LHHA 2STTA 2ELHA 1TW3A 5JBIA 2XUBA 5HDGA 4YIIA 1KA8A 4HZFA 1W7PD 1RIOH 5EEHA 1YG2A 1LDKB 1LNWA 3MAJA 5FD6A 3DF8A 4WF2A 1P92A 4HBLA 3GF2A 3NEUA 3HOSA 1F4KA 4Y15A 1CGPA 3LA3A 2L54A 2ESNA 4ZZDA 3J80Z 2PQ8A 3JW4A 4DNCA 1CF7A 4L9NA 2ESHA 1XDSA 2DT5A 3QU3A 3GUDA 3V8JA 2CSOA 5L3EA 5CVUA 1B1BA 4WCGA 3C7JA 2F2EA 3JSPA 4WX9A 3F8BA 5ILUA 2H09A 3DEUA 4XBFA 4A5MA 2O3FA 2GA2A 5H6QA 1LB2A 3J80K 1WSUA 1R22A 4GYGA 1DPUA 4IHTA 4PGGA 2DLLA 3F3XA 4YFKF 3MFKA 4F7ZA 4U88A 4FLSA 2CFXA 2A07F 1YW8A 4YG2F 4LLLA 2P6SA 2YX4A 5CLSA 4QLCU 4A0YA 3KP3A 2VBXA 2XAJA 3GLXA 5K5RA 5J6XA 2ZMEB 3DKWA 1OYYA 2DK8A 2XVCA 2HQNA 3BJOA 4ENNA 1DP7P 2CG4A 3I58A 4HW0A 5FD5A 5D5WB 1H9GA 4AVPA 3HSFA 2R7DA 3GFLA 1HXDA 1ZRFA 3RIRA 1BC7C 2DK5A 3ABUA 1W7PB 2GZWA 4GGGA 3SHFA 4M71A 1STZA 2FNAA 4UV8A 3WGIA 1V4RA 3HSRA 3TO7A 2FU4A 1P6RA 1O3RA 2JSCA 4DQ2A 5IT9Z 3SZTA 2NNNA 1XCVA 4UUVA 2VOPA 4Y67A 2ZFWA 2CGPA 1YYVA 3FMRA 1IW7F 2D2WA 3KFWX 3V8LA 5KK1A 4L5JA 4AD9A 2K4BA 3CUOA 2FA5A 1D5VA 1HKSA 4KA4A 2EA4A 3A14A 1XDUA 4EM2A 1R0LA 1XGMA 1FP1D 4XLPF 4ZQFA 3KZZA 5D5VB 4ZQHA 1YIOA 5E1XA 2K86A 1BM9A 4UVBA 2Y75A 5LLQA 1FSEA 4I09A 3SZPA 2A61A 4HLYA 5D4SA 5A2QK 2STWA 5LRSA 5DULA 5FO5A 2NRAC 4G7OF 1Z1DA 1S6LA 2MH9A 1SMYF 4CDGA 4M9XA 2NAZA 4FX4A 2Y1EA 4ZZLA 2PN6A 3V8KA 3AU8A 1FLIA 2JPBA 3E6DA 5JC1A 1U6GA 2ZXJA 3WU1B 4LFUA 1XMKA 1HQCA 3IRRA 4BHCA 2X0LA 1MKMA 3EYYA 4MTDA 3UERA 1OPCA 4LGWA 2FMYA 1FOKA 2BBYA 4N9IA 5ICGA 1HKTA 1HKQA 2P5KA 2KIUA 1VTNC 3BZ6A 1FYLA 4GXOA 4IF4A 1FC3A 1ZG3A 3WTXC 2GAUA 1EV7A 4R79A 5H6RA 3KP7A 4G7HF 5D5UB 2IA0A 3N4MA 2DW4A 1HW5A 1J9IA 1R23A 2CQKA 3LAJA 1Q1HA 4CZZA 4Q4ZF 2DQLA 2QQAA 5DUIA 1O3TA 4B09A 4BQAA 3R4KA 2QLZA 2HTJA 4AIHA 5IT3A 2F5DA 4ETSA 1TW2A 3TO9A 1YS6A 2EB7A 2OBPA 3D5LA 4UV9A 1HBXG 1LVAA 3CZEA 3KETA 3WG9A 2VC1A 3CZKA 4YFNF 1KQ0A 5HLHA 1IF1A 1EH8A 5JVTA 2W25A 3M1EA 4O6JA 3ELKA 4L18B 1MJAA 2ISZA 1EH6A 3KLNA 5JHUA 5F1RA 2L3DA 2O61A 4RCVA 1JXSA 4Y6RA 1ZLJA 1QO0D 3GX4X 3CZGA 3K9TA 4RGRA 4KIFA 3RTRA 3RASA 1Z9CA 3P9CA 4AYSA 4I0BA 1OKRA 4I0AA 1ONVA 4CGZA 3ANMA 3WTTC 5KVRA 1BC8C 5L3BA 2KIFA 5BPIA 2ZNYA 5BPDA 4L5IA 3P9IA 4HAMA 1SMTA 1YO5C 4S04A 5BOXA 3M8EA 1IAWA 3L9FA 1BIAA 2MD5A 3KP5A 1T98A 3RPQA 3IC7A 3F8CA 1T38A 4LD5A 3T8TA 2A6EF 1I5ZA 4U7BA 2JCXA 1ONNA 4KMFA 2ZO4A 2QWWA 2A6HF 4BYYA 3HUGA 3ROUA 3ANLA 2E1NA 3VOEA 2EV5A 4KMUX 5JO0A 2RC4A 1W5TA 3WTWC 5ILSA 4Y6PA 4XLNF 4RB2C 4IJAA 1IRFA 5D6EA 1XGNA 2EFWA 1TNSA 2QM3A 4NB5A 3LA7A 2HTSA 4H0EA 4RGUA 4HV5A 5CVVA 4LK1F 5EEGA 1XCBA 3I53A 2P6TA 3ZMTA 3QU6A 1RNLA 1JGSA 4EJVA 3CDHA 2EGHA 1OYIA 2BE5F 3O6BB 4WWCA 1MW0A 4JK1X 1ZGJA 4CO8A 1FY7A 2O6GE 3ML6A 1Z91A 4LG0A 3MZHA 1FT9A 3K1PA 1XMAA 1DUXC 5HDKA 1K5HA 1E17A 1BIBA 3O3KA 4BHPA 5F64A 1GVJA 4ESBA 2CWEA 4LK0F 3WGGA 2GQQA 4KFCA 3FXUA 3JSOA 3G3ZA 3MWMA 3UEQA 2IA1A 3N97A 2L02A 2DQRA 1IXRC 2QUFA 3Q9SA 4IRGA 1ONPA 3JAMZ 2OD5A 2G7HA 4OMZA 1GXQA 2DBBA 3HHGA 4M72A 3DXJF 4HF1A 4I7HA 1UB9A 3U2RA 1XD7A 5K5OA 2OU2A 4U0YA 3LQRA 2FMLA 2OAZA 2P4WA 2OZ6A 2HYGD 2PFBA 3IIEA 3HIFA 4PDKA 2BV6A 2ZCWA 2JPCA 2VOOA 3KE2A 3BP8A 1JVSA 2YR2A 3KP4A 5ICEA 2HGCA 2H94A 3Q9VA 4A2UA 4OINF 3ZMVA 1SAXA 3H3ZA 3I59A 3HYIA 3IWFA 1Z6RA 2LNBA 2UXNA 2ZJ2A 1JHFA 4IPAA 1ZGAA 1FP2A 2FSWA 1S3JA 3FZVA 1R58A 4FHTA 2DO7A 3FMSA 3GZ5A 1SD7A 1ZG5A 1IUYA 1DDNA 3RKWA 1I1GA 2H27A 3SFZA 4UNOA 3CLOA 1U8RA 3MEXA 1ONOA 1T2KA 5D6FA 4RB1A 3CJNA 4ESFA 1R1UA 3R61A 3AU9A 4NQWA 1U2WA 4XRFA 5CJ9A 3ZPLA 3ZN0A 5DDGA 5DCFA 1ZRDA 5JI6A 2Y1CA 3FXRA 3F21A 1OR7A 1H9TA 2XAHA 4TV7A 3F23A 1MDMA 1QQIA 3CUQB 4B8XA 3JTHA 3CUQC 5FLXK 4S05A 2K4JA 3T0YA 1BI0A 1Y0UA 1IN7A 4P55A 2CO5A 1MW3A 2O8XA 1W4MA 1RUNA 3WQQA 1K78A 1ODDA 5L3CA 2P5VA 1USTA 1G3TA 3LWFA 2GXGA 2XASA 2CW0F 4NHJA 3BDDA 1SD6A 3IL2A 4A6DA 3ZHXA 4Y6SA 3QP5A 3RJPA 4I2OA 1U5TA 1IXSB 1J59A 1ZYRF 4UXNA 3OOPA 3L09A 2GIVA 4R8HA 2F5CA 5E8IA 3E6BA 1P4XA 2IPQX 2ETHA 3E6MA 3R0IA 3EYIA 1L3LA 2JD2A 2HFHA 3GZ6A 4KYWA 5AIPA 4G6QA 1SC5A 4ESJA 1F9NA 5E1WA 4D0PA 1RP3A 2Q2EA 1U78A 2E7XA 3IKTA 5H20A 1WI9A 2YPRA 4MGRA 3GYHX 2HEOA 3ZMSA 3ZMZA 1HSTA 1BBYA 3M7GA 3IRQA 4HX8A 3KLOA 2L4MA 3LFKA 5HLGA 3RDIA 1ZG1A 3GWZA 3G73A 3KCCA 2DAOA 1WKMA 3R6SA 4EJOA 1FNNA 1TBXA 2VODA 3FM3A 1ZLKA 2KRFA 4MQ9F 4LLGF 2H6CA 5JFRA 2C82A 2NNYA 5A2QZ 1XSXA 3HTSB 2D45A 1ZN2A 2LSOA 2Y48A 3AUAA 5ILVA 3ZHYA 1J0RA 1I6XA 2EV6A 2V6CA 1UCRA 3DP7A 3ZMUA 2DPUA 4XSXF 3ULQB 1JE8A 1IN5A 4I01A 1RI7A 4ENJA 3RKYA 1MW1A 4IRIA 3AAFA 2IVMA 3BPVA 5DCMA 1KU3A 4FT8A 1GHCA 1TQIA 3SQNA 4MTEA 2FQ3A 3I54A 4CYDA 3GXOA 4HQEA 4YFXF 1G5AA 3ANNA 1R00A 3RI4A 4FX0A 1AWCA 3JTGA 2Z99A 4L0ZB 5DD4A 5DD8A 3F8FA 1HSJA 2L01A 3NRVA 1QGPA 3E5XA 3UCQA 4ZYDA 2QVOA 2BGCA 1XN7A 2LF7A 3KP2A 3M9AA 2MAOA 4E70A 4OIPF 1X3UA 4Y17A 2G7UA 2M5WA 2V9VA 1LDJA 4Q47A 1B6AA 4HX4A 3P7NA 4EJUA 3O2PE 3QOPA 2V79A 1L0OC 4L9JA 3CZLA 3IWZA 5HDNA 5TJJA 2ISYA 4OOIA 1S46A 2XIGA 2MLKA 4UVAA 4PCQA 3GEZA 3RYRA 2R7FA 1IXCA 3GVAA 4Q5SF 1BI3A 3EDPA 2IW5A 5JAZA 3MZYA 3U1DA 3IHUA 4LUPA 3PQKA 4GCVA 2V1DA 3TOBA 5D4RA 5L3FA 3J81Z 2UXXA 2UWMA 5DUKA 3F8MA 4GO1A 1K79A 2F5FA 4M73A 1K7AA 3HRSA 3D0SA 1G3WA 2JCYA 1JHHA 1T39A 2ZMEA 3EQLF 5FFXA 5BQTA 2IP2A 3R60A 5LHGA 3FHZA 5JMWA 1KGSA 3VFZA 4ENMA 3PQJA 4A0ZA 5E1ZB 2IRFG 1IN6A 2K27A 2Y0MA 3J81K 2QYOA 2H6BA 2OQGA 1IN8A 1W7PA 2GXBA 1TLHB 4MHGA 3CO6C 3F6OA 1SD5A 1JGIA 4WXCA 4RAZA 1I27A 2OQRA 5HVQC 5CVRA 2YSRA 2PMHA 4FLQA 2ZKZA 1ZH5A 2E7WA 3ECHA 4QWQA 4OOFA 1BN5A 2FBHA 4OIQF 2RVCA 5AIQA 5HS8A 1LDDA 4KICA 4MQVA 1B9MA 4EJWA 2NS0A 2PMUA 3QP6A 4L9TA 1RUOA 5E18F 2ACJA 2M87A 2EFPA 1G3YA 4HA8A 1CF7B 3DQVC 4Z2YA 3MQ0A 4CICA 1H0MA 2A69F 3GW2A 1S7OA 4ZYGA 3GFIA 5HS9A 2L4AA 1R1TA 1LEBA 1WRJA 2DI3A 1Z7UA 1YLFA 2V1UA 2Y1FA 3ZP5A 1ON1A 1HW2A 2KJCA 4OU0A 2HKOA 2PBIA 3OV8A 3BOQA 4MEXF 3QAHA 3WTZA 4G7ZF 2P8TA 2COMA 3T8RA 3ISPA 4OIRF 2P7VB 1XSDA 2M1BA 3A06A 2PEXA 4KIBA 1KU9A 2JD1A 2VT2A 1XGOA 4KNYA 2W84A 3QRFF 2MBFA 2A68F 1U3EM 4LJZF 1FWZA 1Q0LA 3RPUA 4LB6B 4GAEA 2RV8A 2B0LA 2VBYA 4OIOF 2K02A 1PDNC 3GO5A 2FRHA 4UVCA 1D8JA 2WWYA 4WK8F 1SD4A 2MLGA 1YTYA 2IJLA 4EMSA 4BHBA 1MVYA 3E6CC 2F5EA 1ZARA 3HOTA 2HDCA 1O3QA 1YW9A 1YFHA 3HRUA 3DFGA 2NYXA 4HYEA 3KEOA 2QBYB 5LGTA 3BJAA 5HLIA 3LSTA 2XAFA 1J2XA 3VB2A 2KJBA 3H3UA 3FM5A 1MZBA 4BAYA 3HRMA 4A03A 4HOBA 3V7CA 4YIFA 2WV0A 3BJ6A 2PI0A 1KYWA 2HR3A 1LQ1A 4Y13A 3I71A 4MEYF 1EH7A 1P4WA 3C3WA 2WTEA 4K2EA 2FNPA 4L0YB 1HW1A 4G6DA 2Q8KA 1USSA 2VC0A 4AICA 1MJBA 2IA2A 3PFIA 2Y1DA 1GXPA 4HX7A 1MJ9A 5FLXZ 3DPTA 1K6OA 3V7RA 4HF0A 3CO7C 1FYMA 2HZTA 4OMYA 2FBIA 1NHAA 3F72A 3F22A 4A12A 4BH9A 2Z9OA 1O3SA 2EJRA 1SFXA 5J8FA 1R7JA 2OA4A 3VODA 3REOA 2WC2A 4FLOA 1J5YA 2CYYA 3KP6A 5JMPA 2HOEA 3J7AO 4FLRA 2Z33A 1WQ2A 4HLXA 2PG4A 1O7FA 2Q0OA 1UFMA 4U0VA 2LDUA 1Q0HA 1ON2A 3Q5FA 4A0XA 1BI1A 3W6KB 3RYPA 5F6FA 1Q0QA 2XV4S 4KN4X 3WTSC 4HQMA 1S7AA 1F1ZA 2AS5F 2YU3A 3HSEA 4P9UA 3ZQ7A 1QPMA 5LGUA 5JNLA 3V7SA 2BEOA 4M6YA 3WU0A 2MC3A 2VBZA 3H92A 1MGTA 2XKPA 1C0WA 4L9VA 4EVIA 5TRDA 4AWXB 2HS5A 3FF5A 2XROA 2FBKA 1FBSA 5LEJA 2FF4A 2OZUA 1V3FA 1QZYA 1FX7A 2VXZA 3KEQA 4RB0A 1IZ1A 1R5HA 3IKVA 3W6JB 1AOYA 3C1DA 1ULYA 4GYIA 2W57A 4P5OA 2M30A 3WTYC 4OOEA 4G94A 1P2FA 3I0TA 3C18A 2XKOA 1D8KA 4M74A 4ON0A 2JD0A 2P5LC 2VBWA 1DPRA 2EWNA 1G3SA 5CVJA 1KU2A 4JQFA 4RGSA 2PLYA 1BI2A 2FXAA 1E2XA 3B73A 3P9KA 1ZHFA 2QZ8A 2DPDA 2FOKA 1WWXA 3K1MA 1FSHA 3M8FA 3WTVC 2J5PA 4HDUA 2QBYA 4EM1A 1MD0A 1G4DA 2DFIA 5E17F 3K0LA 1P4AA 2W24A 4A5NA 3L00A 2EFQA 3TKYA 1UHWA 1W5SA 3K2ZA 3ECOA 1JG9A 5FGMA 5IT9K 2O7GA 4HF2A 2D1VA 5DV5A 1BOAA 5AONA 5DEQA 2D1HA 2M8EA 4EJTA 3HTUA 2VT3A 1TTYA 1XSVA 3ZN1A 1YW7A 1S8NA 5L3DA 5LBQA
chains in the Genus database with same CATH superfamily
2K5CA 4MKTA 3BROA 1TQMA 4M6XA 4BBRJ 4LB5A 4PJMA 2DTRA 3TDZC 3FMQA 3MN2A 3HGYA 2GWRA 4WXHA 1K61A 1D0YA 3BLYA 1ZGWA 3TL4X 3E1SA 1QA6A 2C6YA 2VASA 4MS6A 1SFKA 2LY2A 2JRTA 3FUKA 5EF6A 3NAUA 1A31A 4A3FJ 4N9HA 2P7CB 4LLNA 2UV1A 4WXDA 2EK5A 2K7LA 2QA4I 1J75A 1YRNA 4F91B 4E7IA 3WQRA 5ERIA 2L7FP 2OCCH 3E5QA 5D8KB 3U9GA 4LG0B 4B4CA 1BJZA 1RZ4A 4A69C 2XRNA 1KU7A 2ADUA 3BZKA 5DLLA 3DTEA 3I4NJ 2CV0A 3HOZJ 3BR0A 2M0CA 3H1CA 4ZH4F 3OL4A 2IT0A 2E5NA 2IGKA 5DS9A 2ZJRF 4BY7J 1J7KA 3HXLA 2HNHA 4XIDA 1MW2A 4I98B 3BWGA 4RSYA 2HPOA 3CUQA 1QBJA 2FEZA 5FWQA 2HDWA 3CTAA 1KYZA 1SVMA 4Q48A 2IS1A 3HOWJ 3OY9A 2IEKA 1REPC 2M4KA 1SFOJ 1R0KA 2CUZA 2O03A 4P96A 3SDBA 1JJ6C 2WPGA 2XF5A 4N0BA 4KT5C 3FU5A 1BA5A 3K1NA 3ZI0A 4PJ0C 2JA5J 2RDPA 2DU9A 2ELKA 4BXUA 3T5XA 4EEFG 3ABTA 3LQQA 3I5UA 4M9SA 1G6NA 2MA3A 2YUSA 2NS8A 3RKXA 3SXYA 3D5SC 4XLEA 3S1NJ 4AU7A 1TQPA 1XGSA 4QPOA 5E20A 5IPAA 5E3NA 5LEKA 1R5GA 3EUHA 3FXQA 3JSZA 2RN7A 5BS6A 2BXYA 3DV8A 3CCSI 1QNTA 2E2IJ 1DP3A 4XN9A 3A1YA 1FYKA 1P7JA 2FOWA 1GDTA 4F3QA 1T0FC 3QYEA 3VYRB 2Z5UA 3LAPA 2FUG2 4EQQA 1YI2I 4U7DA 3TOAA 2BHYA 5C4XJ 2BHZA 2PMZN 2R5ZA 2MH2A 4FQGA 1I1SA 2XSJC 2CQQA 4PGHA 1R36A 3E5UA 1EA3A 1XTAA 4IVNA 3V4GA 5IP9J 2RGVA 3RZOJ 2G9WA 2ZBKA 3CLQA 3QPHA 2ECCA 3HPHA 3CCEI 1T6SA 4JOMA 2LKPA 2QSFX 3EBGA 1OYWA 1W36C 4ZN6A 2A05A 1KONA 3P5JA 1ZREA 3F8NA 6PAXA 5BMZA 3CHQA 3IH3A 3I59B 2HQRA 2R7WA 3G1MA 1F43A 4O5VA 2X48A 2BY3A 1TNTA 2O0YA 3RQ4A 3RZDJ 1IJWC 5DYFA 1RR7A 1AKHA 4I02A 4C3IJ 3L2CA 4U0WA 3T1BA 4CH7A 3FUEA 1ETQA 1S29A 1OCRH 4KP7A 3TO6A 1YQAA 2YX7A 3CF2A 4RGXA 3WODF 5FB2A 1UHMA 1PUFB 2K9QA 2XPUA 3L2UA 2QCOA 2RNJA 4GRIA 2XAQA 2GOMA 3GZNB 4EGZA 4B47A 1Y0NA 3EETA 3F6VA 1VQPI 1H8AC 4RB3C 5F1JA 5C4JJ 3L2WA 4AIKA 3ZRGA 4E4HA 2RQPA 3G1LA 4ASNA 2VE9A 4UY8I 1HC8A 3COAC 2EFOA 3VYUB 4IO9F 3PL8A 4NQWB 1X3ZA 3Q0WA 3HM5A 3KX2A 4ZYEA 4PU2A 4BKXA 2TDXA 3S2WA 3M4OJ 3CC2I 2X4HA 2XGXA 4EV0A 1Z3XA 3DLAA 4G8XA 5J8CA 2GA1A 2E60A 4PSWA 2E1CA 4M9ZA 1GVDA 1I50J 4A3KJ 4O3MA 1T95A 2CW7A 2DOAA 4CUGA 4KIGA 4KN7X 4KDPA 1JKRC 4J00A 3L7WA 3GMEA 1Y39A 1GV2A 2OF7A 3FX3A 5B1BH 2LR8A 5CYVA 1FPQA 4MO7A 4P9FA 5FFZA 1MMAA 4II2A 1MNMC 1QZZA 1R1VA 1ZRCA 1Z05A 3IH2A 5JR3A 1MDMB 1IN4A 2LTPA 3G6EI 3G4SI 4ZW3A 4XN2A 3QPTA 1TWHJ 4Y4RA 3CMAI 1YS7A 2JK3A 1FZPB 3FXJA 4UHTA 4FE7A 5K1YA 3L2QA 2HKXA 3ZQQA 3TDUC 2LREA 2BYVE 1QRYA 2JT1A 4F55A 1SFUA 1K78B 3FWEA 4V2GA 2LG4A 2OTJI 3WE2A 4FETA 4LMYA 2RKHA 1X3WB 3JR9A 4MNUA 2EA2A 4ZTJA 2J5OA 3K69A 1KQ9A 1IRGA 4XR6A 4JBAA 4EGYA 1PP8F 2QQ9A 4IHSA 1XB4A 1I6HJ 5GPCA 2Z3YA 4YEJA 2VE8A 4CCJA 3HPGA 4ENKA 3ZGKA 4XN1A 5ICCA 3ERED 2EIMH 5LHIA 1FBUA 3VEPA 1T1SA 4IKFA 1JUPA 1U5TB 1R6RA 1U5TC 4CXFA 1Z7LA 5EEAA 2IGOA 4RAYA 2LYCA 2UZKA 3GCMA 4BNCA 1LJ9A 2ZNZA 1O57A 3FDYA 5FKOA 2X85A 2JZYA 3BPXA 2PMZA 1B4AA 2ZJQF 3O8HA 4RS8A 3BR1A 2C5ZA 2JA7J 4E7ZA 2JSPA 4ZQEA 3B02A 1D3YA 2HYFA 1Z6TA 1SFEA 2XAGA 4Z6YA 2VN2A 4A6EA 2ZJPF 1PP7U 3QWLA 2QENA 5HS7A 2A3SA 3E3VA 1BOBA 3GBGA 5CQGA 4HV6A 3WQSB 2FE3A 3R0JA 1YE9A 3LSIA 4UUSA 1MNDA 3WGHA 4CHUA 2Q2EB 1K83J 4YELA 2KKOA 1VFCA 2LY9A 1HF0A 1LE8A 1T1RA 3BQZA 4ZW8A 2EFNA 3LA2A 5ICFA 5HOOA 5M5WJ 2HVRA 3ZMDA 3MCZA 3HHHA 4BEHA 3DU5A 2Y1GA 2VONA 2M2EA 4PVBA 1PUEE 4NNJA 3PIOF 2WADA 1YX5A 4UUTA 2R0QC 2V1NA 2QQBA 2WA0A 3H9GA 4R1HA 4XKWA 4JX6A 1UG0A 2XQ0A 4ZQGA 2MAPA 2EV0A 1Y1VJ 2X6XA 1LEAA 2LBFA 2DMQA 4D5CA 3BY6A 2KIMA 1B59A 5DYMA 5GAEJ 4LIUA 4BDYA 3TGNA 3I64A 2JTVA 3ERMA 2RREA 1UHSA 4V2FA 1YIJI 5IP7J 1KQ8A 3FH5A 5D8LB 1N25A 2AXLA 4XSZF 2XSDC 1A04A 2V1XA 4KUMA 2PJPA 5D5XB 2CUJA 3B7SA 1V5FA 1NTCA 3TQNA 4G9YA 5M3FJ 4PZJA 4AIJA 2L2OA 3MD2A 3WE3A 3S15J 2VB6A 1T0FA 3KZYA 3EBHA 2W85A 3HRTA 5E3LA 1ZAOA 1OMIA 1F5TA 4IXAA 3DPLC 3WG7H 4EM0B 3CD6I 5EZHA 1H3LA 2R4GA 3GFJA 5LGNA 3PNTA 2LRDA 3OYIA 3L2RA 3E97A 2F5VA 1ZS2A 2R3SA 1UJ8A 3WTUC 1H19A 3FU6A 2A5YB 2BY2A 4FE4A 2M45A 3I4PA 1X1PA 3J7ZI 4ZYHA 1O7LA 5DCMB 2F48A 4IRHA 1ZQ3P 1BW5A 5J4YA 1U9OA 3ZHZA 4HDVA 1MH3A 2LF8A 5LRRA 4KT6A 3JAMK 5L3GA 5E8GA 2FFLA 1W1WE 1FBQA 5K5QA 1B9NA 2JCVA 3TW7A 5CVIA 3GFMA 5ED4A 2WY7Q 5GADJ 4GAAA 5GAGJ 4IL6C 2HWVA 3H5NA 3RC3A 5TISC 3R0AA 3BG5A 2XHKA 1BJAA 4RAFA 3NQOA 3ESWB 5LHHA 1TWCJ 2STTA 2L7KA 4Y3OA 2ELHA 3M07A 2DFEA 4HSTA 2HDDA 3JRAA 1TW3A 2R5YB 1BW6A 5JBIA 2XUBA 1RRJA 5HDGA 2W82A 2GXAA 4YIIA 3OS2A 1WJBA 1KA8A 3QOEA 4BXXJ 4BUPA 4HZFA 4J01A 1W7PD 3MKLA 1RIOH 3GTGJ 3FUDA 2VKDA 5EEHA 1YG2A 1LDKB 3ZQGA 3GTOJ 1LNWA 2DJIA 3MAJA 3PNYA 3PM1A 5FD6A 1YJWI 1H89C 2HQAA 3DF8A 4M3DA 4WF2A 1P92A 2LMDA 2Y30A 4HBLA 3GF2A 3SDGA 4AUXA 3NEUA 3HOSA 1HCRA 1F4KA 3CF5F 4Y15A 2CQ7A 4BQQA 1CGPA 3A01B 3LA3A 1R71A 4XK4A 2L54A 4BGDA 2ESNA 4ZZDA 4QMEA 3J80Z 2PQ8A 3JW4A 1ETXA 5JVGF 2HVSA 3ASNH 4DNCA 3CIAA 4HNUA 1CF7A 4L9NA 2ESHA 2I8DA 1XDSA 2DT5A 3QU3A 4XN4A 3GUDA 2E71A 3V8JA 3N05A 4R5XA 3OR1C 1WJ5A 5E79C 4DZJA 3H5RA 2CSOA 5L3EA 2GIZA 2M0MA 1B1BA 5CVUA 2ICWG 2Z1DA 1D1AA 4WCGA 3CESA 3U21A 3C2HA 2NVYJ 3C7JA 1NG7A 2F2EA 1B72A 4GDFA 3JSPA 4WX9A 3F8BA 2R7TA 3PO2J 3FU0A 5ILUA 2H09A 3NARA 3DEUA 3CQZJ 4XBFA 4A5MA 2O3FA 4A3EJ 2GA2A 5H6QA 2A5WA 4K5OA 1LB2A 4L5EA 2NVUB 3J80K 1WSUA 2ID6A 1R22A 4GYGA 5E3MA 3OS0A 1DPUA 3OR2C 4IHTA 4PGGA 2DLLA 3ABMH 4BQNA 4D1QA 4XN0A 3F3XA 4YFKF 3MFKA 2ME6A 4F7ZA 4U88A 3FTXA 4FASD 4FLSA 1O4XA 2CFXA 2A07F 1YW8A 4YG2F 3L2VA 4LLLA 2P6SA 4I6ZA 2YX4A 5CLSA 4XNBA 1RC9A 4XMYA 2DQ6A 4IOAF 4QLCU 2M7AA 4ZQTA 4A0YA 1T56A 3KP3A 4ZYAA 2VL8A 3K6GA 2VBXA 2XAJA 4A3CJ 1U0JA 3GLXA 5K5RA 5J6XA 2ZMEB 2E36A 2H1KA 3DKWA 3HKZA 1OYYA 2ZMEC 3SYTA 1PJRA 2DK8A 2XVCA 1W0UA 2HQNA 3BJOA 4ENNA 1DP7P 2CG4A 3I58A 4HW0A 1JT0A 5FD5A 5D5WB 3JRBA 3LNQA 1H9GA 4BDZA 1FIPA 5F0HA 4AVPA 2BY0A 3HSFA 3VYSB 2OUMA 2R7DA 3GFLA 1HXDA 1ZRFA 3QPLA 3VPRA 3RIRA 5F04A 3ZQFA 1BC7C 2DK5A 3RPUD 1A36A 3ABUA 1W7PB 2GZWA 4GGGA 4DBQA 3K7AJ 1XPXA 3I4MJ 3SHFA 2ZB9A 4M71A 1STZA 3S32A 2FNAA 3A0BC 4UV8A 3WGIA 1V4RA 1LFUP 4A3GJ 1Y1WJ 3HSRA 3TO7A 3K4NA 1ETVA 2FU4A 1P6RA 1O3RA 1VQ5I 2JSCA 4DQ2A 1XS9A 5IT9Z 4PJJA 3SZTA 4RM3A 2NNNA 1XCVA 4UUVA 4DIQA 4C9YA 2QKMB 2VOPA 1X2NA 1YJNI 4Y67A 4B3AA 2DT6A 1YOVB 2ZFWA 2CGPA 1YYVA 3FMRA 1IW7F 2D2WA 3KFWX 3V8LA 5KK1A 4L5JA 4AD9A 1JKOC 3D5RC 3H9QA 2N8GA 4ZTFA 2K4BA 3CUOA 2FA5A 1D5VA 1MIJA 3OS1A 2MC4A 2UUZA 1HKSA 4KA4A 2EA4A 4B48A 1JJ8C 2WBMA 3FU3A 3HG9A 1QVTA 3A14A 1XDUA 3GTMJ 4AIDA 4EM2A 1VQ9I 1R0LA 4ARFA 1XGMA 1OCTC 1FP1D 4XLPF 1N78A 1SC7A 4ZQFA 3BTCA 3KZZA 5D5VB 2AQEA 3S17J 5AENA 3HB9A 5DM6F 4ZQHA 4XICA 1OCOH 2MW8A 3I56I 2Y9YA 1XX5A 1YIOA 5E1XA 3DEEA 1AA7A 2K86A 4M3FA 3KYLA 1BM9A 4D9JA 1Z77A 3ZQHA 3MZ8A 4A93J 4UVBA 2Y75A 5LLQA 1FSEA 4E7LA 2IS6A 3OIQA 4PFOA 4I09A 2WZGA 3SZPA 2A61A 4HLYA 1S7EA 4ABZA 2H1LA 5D4SA 2CFOA 3DTIA 2PJRA 3DBLB 5A2QK 2STWA 4BE2A 5LRSA 5DULA 5FO5A 2NRAC 4BE1A 1I3QJ 2DDBA 1Z1DA 5B3SH 1IV6A 1OISA 4G7OF 1MMGA 1S6LA 2MH9A 1SMYF 2KRHA 4CDGA 1MBGA 4M9XA 4HNTA 3OSFA 2F6CA 2NAZA 4D5FA 4FX4A 2Y1EA 3OYAA 4ZZLA 2PN6A 3V8KA 3AU8A 1FLIA 1DQUA 3LFUA 2JPBA 3E6DA 1MNEA 2AXTC 5FLMJ 2HOAA 1PYVA 2K9LA 5JC1A 2DT7B 1U6GA 2LVSA 2ZXJA 3WU1B 2M7BA 1SVLA 4LFUA 1XMKA 1T8IA 1HQCA 1JT6A 2OPTA 2HOSA 3IRRA 4BHCA 4HG2A 2OCEA 3BQYA 3OYLA 3K4BA 2X0LA 3M3YJ 1YX3A 4OAZA 1MKMA 5F0FA 2ELJA 3EYYA 3FIWA 4MTDA 3UERA 2BVLA 1OPCA 2VXDA 4LGWA 3A2KA 4M3BA 3K4LA 2FMYA 1OLTA 1GUUA 2VLAA 3UNGC 2NOJB 1FOKA 2BBYA 4N9IA 2VJ5A 5ICGA 1HKTA 3S93A 1HKQA 2P5KA 4A3MJ 2KIUA 3B2PA 1VTNC 3BZ6A 1FYLA 4GXOA 4IF4A 1FC3A 1ZG3A 3WTXC 3VWBA 4LIVA 3OYHA 2KP6A 2GAUA 1G8XA 2XF7A 3NWTA 1EV7A 1HDPA 2A6TA 2L9VA 4R79A 3E0JB 5H6RA 2HPTA 3VSLA 3KP7A 4G7HF 5D5UB 2F4MB 2IA0A 3N4MA 2DW4A 3H36A 1HW5A 1J9IA 4C2UA 4XOPA 4ZJZA 4B44A 1R23A 2CQKA 3LAJA 4XMTA 1Q1HA 3BCBA 4CZZA 4Q4ZF 2DQLA 2QQAA 1V5GA 1RETA 1TWGJ 5DUIA 4OAYA 5DM7F 1O3TA 5EV7A 4B09A 4BQAA 2VKHA 3R4KA 4MFEA 2QLZA 2HTJA 1MBKA 1APLC 3Q44A 1U8BA 4AIHA 3CHSA 5IT3A 2NXNB 2F5DA 1WFXA 2Z2SB 4DYCA 4ETSA 1TW2A 2WY8Q 3TO9A 1YS6A 2EB7A 2OBPA 3D5LA 4UV9A 5B5EC 1LVAA 5IP6A 1HBXG 3CZEA 3KETA 3WG9A 2VC1A 3CZKA 3WHCA 5HNHA 3OYEA 4YFNF 1KQ0A 5HLHA 1IF1A 3OIOA 4E7SA 1EH8A 5JVTA 2QEXI 2W25A 3M1EA 2JA2A 4O6JA 3ELKA 4L18B 2ZXHA 1AHDP 1MJAA 3IV5A 2ISZA 1EH6A 3KLNA 5JHUA 2I10A 3IP4B 3FUJA 5F1RA 1OJLA 2L3DA 2XPVA 2O61A 5EZGA 5J47A 4RCVA 1IG7A 4IZZA 1JXSA 2K40A 4NC7A 2W7NA 1JTXA 1ZLJA 4F93B 1QO0D 4Y6RA 2NVTJ 3GX4X 1WHUA 3CZGA 3OYKA 4XL9A 3K9TA 2ME0A 2JUCA 4KIFA 4RGRA 3RTRA 3RASA 3K10A 1Z9CA 3P9CA 4AYSA 1GW6A 4I0BA 1K4TA 1OKRA 2K3PA 4I0AA 1ONVA 2XPWA 2IGMA 2VJ4A 3NWSA 2VQGA 4CGZA 3ANMA 2E2HJ 1OCCH 3WTTC 4BJTA 1HOMA 5KVRA 1BC8C 2ZXIA 5L3BA 3S1QJ 2GTQA 2V7FA 1FTTA 2KIFA 4BE0A 5BPIA 5J1YA 2ZNYA 5CKTA 5EGOB 5BPDA 3CDIA 4L5IA 2W1OA 1YHQI 2R7OA 2Y2ZA 3P9IA 2IS2A 2KMUA 2M9HA 2MABA 2K85A 2DJNA 4HAMA 4IHXA 1SMTA 3J7YJ 4S04A 5BOXA 3M8EA 1YO5C 4AR9A 1IAWA 3B6AA 2YS9A 1U9NA 2X6YA 1VQ7I 2GLOA 1HA8A 5H2FC 2ZXGA 1Y8QB 1BIAA 3L9FA 5C44J 2CS3A 4II3A 2MD5A 1R5ID 3KP5A 1T98A 4X1EA 3RPQA 2HQ5A 3IC7A 4N4NB 5BNGA 5B66C 2KZVA 2GOXB 1OR7C 3F8CA 1T38A 4QTRA 4V19K 4LD5A 3T8TA 1I5ZA 2A6EF 4U7BA 2JV7A 2JCXA 1WPKA 5F27A 4CYCB 1LFPA 4KMFA 1ONNA 2ZO4A 3EBIA 2QWWA 1VQNI 2A6HF 3OL3A 3Q43A 4BYYA 1MBFA 3HUGA 3FUNA 2VUMJ 3ROUA 2QJ1A 1MBJA 3ANLA 2E1NA 2GBYA 3OYNA 4BBSJ 3VOEA 3DLLF 2EV5A 4P1WA 3RCOA 3A0HC 3OOUA 4KMUX 2JJ7A 5JO0A 5IYCJ 2D5VA 2RC4A 1W5TA 3WTWC 5ILSA 3K70D 4Y6PA 4XLNF 4RB2C 4IJAA 1R4NB 1SANA 3RKQA 3A02A 1IRFA 1BR4A 2R7SA 2R7UA 3BG7A 2O5RA 2PL5A 2K9SA 5D6EA 1XGNA 4DBRA 2EFWA 3IUOA 1TNSA 3KEYA 2QM3A 4NB5A 1XMXA 4KJZA 3LA7A 4W1UA 2HTSA 3FBNB 4H0EA 4RGUA 1D5YA 4HV5A 5CVVA 4LK1F 1G59A 5EEGA 2Y69H 1XCBA 1NG6A 3I53A 2L9SA 1RR8C 2P6TA 3QODA 3ZMTA 3QU6A 1RNLA 1JGSA 4EJVA 3S8PA 5HNFA 1ZELA 2QF7A 3CDHA 4BQOA 2EH3A 4HRIA 1VQKI 2PUSA 2EGHA 3BTLA 5HODA 1OYIA 2BE5F 3O6BB 3FTWA 3PSIA 1M1EB 4WWCA 3SZGA 2RAEA 1MW0A 4JK1X 2DXIA 3FH7A 1ZGJA 2AO9A 4CO8A 1FY7A 2O6GE 3ML6A 1Z91A 1MSFC 4LG0A 3KIOA 3MZHA 3QYBA 1E3HA 1Y56A 5KCMA 4ZX3A 3GTLJ 1FT9A 3K1PA 1XMAA 1DUXC 2DMNA 3H35A 5HDKA 1K5HA 3FHEA 1E17A 1BIBA 3O3KA 4BHPA 2L5QA 2O8KA 3S14J 5F64A 1GVJA 4NUBA 4ESBA 2CWEA 4LK0F 3WGGA 4XO5A 2HVQA 2GQQA 4W97A 4CZCA 4KFCA 3FXUA 3JSOA 2W48A 3G3ZA 3MWMA 3UEQA 2IA1A 3FULA 3K4CA 3HC7A 2H8WA 2L02A 3N97A 2V26A 2DQRA 2M4GA 1IXRC 2QUFA 3W2VA 3Q9SA 4IRGA 1ONPA 3JAMZ 4XMVA 1VI0A 2OD5A 1V5EA 2G7HA 3FUHA 4OMZA 4UB6C 1GXQA 2DBBA 4BS9A 2DA1A 4BACA 1F36A 2V9KA 1WJFA 2L7ZA 3HHGA 2FD5A 1BR2A 3KPHA 4M72A 2FX0A 2KQRA 2MGQA 3DXJF 1VQOI 4HF1A 4ZDOA 2MG4A 4I7HA 1HLVA 1UB9A 3U2RA 1XD7A 5K5OA 3GTPJ 1UMQA 2OU2A 3AG1H 4YRVA 4U0YA 3LQRA 4RM2A 2FMLA 2OAZA 2P4WA 1E0EA 1SQMA 4C30A 2OZ6A 3ZCOA 4X2UA 3FXLA 2E1OA 2HYGD 4BJ5C 2PFBA 3HKZN 3IIEA 3HIFA 4PDKA 3Q0UA 2BV6A 2ZCWA 2JPCA 2VOOA 3KE2A 5FKKA 1IUFA 3BP8A 3Q3SA 2KLOA 1JVSA 5EG0B 1YITI 2YR2A 1A6QA 3KP4A 2HZDA 5ICEA 2V4JC 2HGCA 2H94A 3Q9VA 4A2UA 4OINF 3ZMVA 1SAXA 3H3ZA 2K9NA 5B1AH 2LLKA 3I59A 3HYIA 3IWFA 1Z6RA 2LNBA 2UXNA 2ZJ2A 1JHFA 2ZC2A 4IPAA 1ZGAA 1FP2A 2FSWA 1S3JA 3FZVA 1P7IA 2KDOA 1G2HA 1R58A 2JN6A 4IQJA 2F4IA 4FHTA 2DO7A 3FMSA 3G1OA 3GZ5A 5IYBJ 3H3VK 1SD7A 1ZG5A 1IUYA 1PUFA 1DDNA 3RKWA 1I1GA 2H27A 1S72I 3SFZA 4UNOA 3CLOA 1U8RA 4XN5A 2JMWA 4M3EA 3MEXA 4DGWB 3ZQCA 3DBHB 1ONOA 1T2KA 5D6FA 2HPIA 5EDNA 4RB1A 2DA4A 1D0ZA 3CJNA 3FTSA 4ESFA 5KAIC 1R1UA 2HI3A 3M1CA 3FUIA 3HBLA 3VSKA 3R61A 3BC8A 3AU9A 3LSKA 4NQWA 1U2WA 2DYSH 4XRFA 4E7JA 4A3DJ 5CJ9A 3ZPLA 3ZN0A 2CH0A 3JT1A 1YRNB 3LOCA 5DDGA 5DCFA 1ZRDA 5JI6A 2CW8A 1LPQA 3W6VA 4ITVA 4R5VA 2HU9A 3X2QH 3OWTA 5KNLA 2Y1CA 3FXRA 1ETWA 3F21A 1DU6A 1OR7A 2LK2A 5E3OA 1JI8A 2CU7A 3CCUI 1H9TA 2XAHA 2MD0A 4TV7A 1IV8A 3S2DJ 2DA3A 2DMTA 1QHGA 3F23A 1MDMA 2V9PA 1X58A 5GTIC 1QQIA 2L9RA 3CUQB 4B8XA 3JTHA 3CUQC 5FLXK 4S05A 2K4JA 3T0YA 1FMVA 3ZQLA 4XNFA 1BI0A 5HLTA 1Y0UA 1IN7A 2KT0A 4D7NA 3CJRB 4AC0A 1X4PA 5J1UA 4XLHA 1IDZA 3DKYA 4P55A 2CO5A 4MIMA 4B1RA 1MW3A 3RSNA 2O8XA 1EJ9A 1W4MA 1RUNA 3WQQA 1K78A 1MBEA 1ODDA 4QSHA 5L3CA 3AL0B 1OCZH 3AL0C 4A3IJ 2P5VA 3VYTB 1USTA 1UAAA 1G3TA 5DTDA 1X3WA 3QJXA 3LWFA 4PJLA 4EATA 2CV2A 2GXGA 2XASA 3S2HJ 1VQ8I 2CW0F 4NHJA 3BDDA 3EUHC 1SD6A 4XLAA 1TT5B 2X6WA 3TP3A 3IL2A 1BL0A 4A6DA 3CXBA 4XORA 3CCVI 3ZHXA 1ETKA 3B7RL 1A35A 4Y6SA 2AQFA 2EZHA 2EINH 3QP5A 3RJPA 2RJIA 4I2OA 2IAIA 1U5TA 3SFIA 1IXSB 1J59A 4IHYA 2XB5A 3CHRA 1ZYRF 4UXNA 3OOPA 3L09A 2GIVA 3PUFA 4R8HA 2F5CA 5E8IA 2DTZA 2X1DA 2R5ZB 2HXIA 3BG3A 4IHVA 3A03A 3CDLA 3E6BA 1P4XA 1Z67A 2IPQX 4PK4A 5IY5H 2CV1A 2ETHA 3E6MA 4KISA 3R0IA 1ENHA 3EYIA 1L3LA 4U87A 4AVZA 1BR1A 2LKSA 2IBDA 4RLQA 2JD2A 3HZJA 2AHQA 2HFHA 3GZ6A 1JKQC 1MMNA 3O8GA 5AIPA 4KYWA 4G6QA 4I99C 4H4KC 4ESJA 1SC5A 1WVRA 2K3FA 3BZCA 1F9NA 2L0KA 5E1WA 4D0PA 1RP3A 3FH8A 2Q2EA 4HEA2 1U78A 2OC6A 3FUFA 2E7XA 5J4VA 4RVBA 3IKTA 5H20A 2M34A 3BG9A 1FOWA 1WI9A 1MSEC 2YPRA 4MGRA 4D7MA 4CCNA 2KIQA 3GYHX 2HEOA 3ZMSA 2KHMA 5C3EJ 3ZMZA 4LG3A 1WJEA 3FTVA 4AR8A 2XGEA 1HSTA 1BBYA 3KYCB 3M7GA 3CCLI 4AR1A 3IRQA 2R59A 4HX8A 3KLOA 2L4MA 3LFKA 1RKTA 2DA7A 3RDIA 5HLGA 1ZG1A 3GWZA 4S0HB 3G73A 2ZSHB 2DAOA 1WKMA 3KCCA 3K4MA 3R6SA 4BU2A 4EJOA 3TW6A 1FNNA 1TBXA 4R5TA 2E34A 2VODA 1D1CA 3FM3A 4FISA 4Y7NJ 1ZLKA 4IQ4A 2KRFA 4MQ9F 4LLGF 4CCKA 1OFCX 5J3LA 3JREA 2H6CA 5JFRA 3KZIC 3D1NI 2C82A 2XGDA 1X3ZB 2XPZA 3PJRA 2QSGX 1FJLA 2NNYA 4MFDA 5A2QZ 1QPIA 1XSXA 2CQXA 4XN3A 4AYBA 2D45A 3HTSB 1ZN2A 2LSOA 1WJDA 2Y48A 3AUAA 5ILVA 4XO4A 3ZHYA 3IAS2 1D0XA 3BG6A 1J0RA 1I39A 1I6XA 4HSRA 3OIPA 1LUJB 2EV6A 3LSMA 2K9MA 2VKVA 2V6CA 1UCRA 1VZ0A 3B2XA 3BR2A 4CSWA 1QZEA 3DP7A 3ZMUA 3J7AY 2DPUA 4G6TB 4RAGA 1RPWA 4XSXF 3ULQB 4DYQA 1JE8A 1IN5A 2ZSIB 1RI7A 4I01A 3RKYA 4ENJA 1MW1A 4IRIA 5K7ZA 3AAFA 2IVMA 3BPVA 5DCMA 1NH3A 2DOEA 1IO2A 4XNDA 2WZFA 1KU3A 5EG0A 4FT8A 1GHCA 1FOXA 1TZLA 1TQIA 3SQNA 4JYKA 4MTEA 2FQ3A 3FTYA 3I54A 4CYDA 3MKYB 3GXOA 4HQEA 2WAEA 3OMYA 1LKXA 2CMPA 3ZQIA 4YFXF 1G5AA 4B3XA 3ANNA 1R00A 2R5YA 3RI4A 1IRXA 3B7TA 4FX0A 1AWCA 3JTGA 1H88C 2Z99A 5M5XJ 1ACIA 4L0ZB 4F92B 5DD4A 3DEWA 3RC8A 4C2MJ 3CMEI 4K5PA 5DD8A 2XC7A 3F8FA 3MKWB 4HPQA 2BZTA 1HSJA 2WV1A 2WAQN 2L01A 3E7LA 3NRVA 3JRDA 1QGPA 3B34A 1WI3A 3PO3J 3FUMA 3TBIA 4BY1J 3E5XA 3UCQA 5M3MJ 5JHFA 4ZYDA 3SEZA 4ZX5A 2VJIA 2DA6A 2QVOA 2BGCA 1XN7A 2LF7A 3KP2A 4ANJA 3M9AA 2MAOA 4E70A 5GTHC 4OIPF 3A01A 2M8GX 1X3UA 4Y17A 5FLVA 2W4SA 2ZFUA 5FRMA 2G7UA 3FXOA 2M5WA 3LSJA 2V9VA 2KL4A 1LDJA 4Q47A 1B6AA 4NDLA 4UUSB 2LOOA 2VQHA 3CHPA 3S16J 4HX4A 3P7NA 3CZ6A 4EJUA 1WGXA 1LE8B 3O2PE 2X9DA 3QOPA 4XKCA 2V79A 3HOVJ 1GLNA 1P9QC 5FKLA 1L0OC 1CQTA 4L9JA 1IGNA 2OTLI 1POGA 4BEHB 3CZLA 3CJQB 3IWZA 5HDNA 3QYFA 5TJJA 4IX7A 2ISYA 4OOIA 4ZW5A 1S46A 4G12A 4DPRA 2XIGA 3FHNA 1MW7A 2MLKA 1VQ4I 2JA8J 3H5AA 4NBQA 2HXOA 4JX5A 4UVAA 2I5UA 4PCQA 2V6EA 4QUOA 3GEZA 1SAUA 2XB0X 4Y52J 4Q4EA 3DWLE 3OYGA 2Z16A 1E3PA 2LBFB 3RYRA 4DZPA 2R7FA 2BW3B 1IXCA 3GVAA 4Q5SF 3S3MA 2EZKA 1VQ6I 2YU9J 1DGRM 1BI3A 4QHPA 2G0EA 4Q4IA 3TP0A 3DU6A 3OYJA 3EDPA 2LH9A 1MMDA 3VDXA 1VNDA 4ZX4A 2IW5A 1X2MA 5BPPA 5JAZA 2WAFA 3MZYA 3U1DA 3IHUA 4LUPA 3PQKA 3FTZA 2DYRH 2NS7A 2ECBA 4GCVA 2V1DA 3TOBA 1SG7A 5D4RA 5L3FA 3J81Z 2UXXA 2UWMA 4XMUA 1A6IA 5DUKA 3CHOA 4JNDA 3F8MA 5JLXA 1Z21A 3CMYA 3LL7A 4GO1A 2ZXWH 1K79A 1B8IB 1Y6IA 2RQQA 2F5FA 4M73A 1V55H 2KFDA 2VQCA 1K7AA 3CCYA 3HRSA 3D0SA 1G3WA 3B7UX 2JCYA 2E35A 1JHHA 3I9V2 1T39A 2ZMEA 3FXKA 4C3JJ 1FMWA 3KEDA 3EQLF 4NC6A 5FFXA 2DODA 5BQTA 3B37A 3WU2C 2IP2A 3R60A 2CRGA 1WJAA 2L7MP 5F0CA 5LHGA 3FHZA 3AFHA 5JMWA 3JRFA 1KGSA 3VFZA 2E2JJ 5GAHJ 1X1CA 1RKWA 3K4JA 4ENMA 3PQJA 4A0ZA 2WB1N 1X1AA 5E1ZB 2IRFG 1IN6A 2K27A 3S3NA 2EZIA 1XC5A 2DA5A 4K5LA 2Y0MA 3J81K 2QYOA 2H6BA 1X19A 1IN8A 2OQGA 3HDDA 4FCAA 1W7PA 5K7HA 4XN7A 3S1MJ 2GXBA 1T33A 1TLHB 2XDVA 1LVKA 1I3AA 1QU3A 3ABKH 3OYCA 4MHGA 1X4OA 3CO6C 3F6OA 2JA6J 1SD5A 1JGIA 4N4OB 4WXCA 3CJTB 1I27A 4RAZA 2KRCA 2OQRA 5HVQC 2NVXJ 5CVRA 2YSRA 1VQLI 2WAQA 2PMHA 2B7EA 4FLQA 2BOLA 2ZKZA 3M8JA 1ZH5A 3DPUA 2XRLA 4F52A 3Q0VA 2JVHA 2E7WA 3DCFA 3ECHA 4ZW6A 4QWQA 3UR3C 1BN5A 2FBHA 4OIQF 4OOFA 2CUFA 2RVCA 2BXZA 4NC8A 5AIQA 3B3BA 5HS8A 1LDDA 1W5CC 4XM3A 1E3OC 2ID3A 4KICA 2BVMA 4MQVA 3RQIA 5LFAA 1B9MA 3EPZA 4EJWA 2L9NA 2NS0A 4FCYA 5FKNA 2PMUA 3QP6A 4L9TA 3HL2A 1RUOA 4XMXA 2DFHA 5E18F 2ACJA 2M87A 2XAUA 2EBIA 2EFPA 4ZC3A 4DOZA 4FTHA 1G3YA 2DFFA 1AU7A 3OYFA 1S9HA 2E1MB 2VJJA 3C2BA 4HA8A 2R70A 2E1MC 1CF7B 3DQVC 4Z2YA 1V54H 4K5NA 3MQ0A 4RBOA 2R7VA 4CICA 2DA2A 3CC4I 3LSRA 1H0MA 2A69F 3GW2A 1S7OA 4XLCA 4ZYGA 5HS9A 3GFIA 2HOTA 2L4AA 1R1TA 4XOTA 1WRJA 2DI3A 2DMUA 2VPLA 1LEBA 1Z7UA 4OWRB 2O9LA 1YLFA 2PGGA 2EILH 2V1UA 4J3BA 1IC8A 2Y1FA 2BY1A 3ZP5A 3CCRI 1X1DA 1B72B 3FKIJ 1ON1A 3EUAA 1HW2A 2HYJA 2KJCA 1Y8RB 4OU0A 2HKOA 1ETOA 1MBHA 2PBIA 3JCUC 2CUEA 2LFBA 3OV8A 3BOQA 4MEXF 2QKLB 3IH4A 2Y9ZA 3QAHA 5LD2C 1FEXA 3WTZA 4G7ZF 1HS6A 2P8TA 2COMA 3T8RA 4J19A 1HDDC 3ISPA 4OIRF 3TEDA 4C2TA 3FKJA 4XLFA 2MYSA 2P7VB 1XSDA 4M6VA 4QIRA 4A3JJ 2XF6A 4UB8C 4BXFA 2R7XA 1W0TA 2M1BA 3A06A 1JUMA 2PEXA 4KIBA 4L2LA 3FISA 1KU9A 2JD1A 2W00A 1DGWY 2R92J 2CJJA 2NVQJ 1UZCA 2VT2A 4XQFA 1XGOA 3CCQI 4KNYA 2W84A 4GFBA 1KZHA 3QRFF 1R9TJ 4ZW7A 2MBFA 4RMNA 2DQMA 2A68F 1U3EM 3QQAA 4LJZF 1FWZA 1Q0LA 4RDUA 5CPRB 3RPUA 4LB6B 4GAEA 3K2AA 2RV8A 5KHDA 3BTJA 4PJNA 1ZTRA 4RA2A 2B0LA 4DYRA 3VVLA 2VBYA 3HGGA 3W3CA 4OIOF 3BR6A 2K02A 1PDNC 3SJMA 4BJ6C 3GO5A 5K7FA 2FRHA 3UKGA 4UVCA 2WB1A 1D8JA 4PFPA 2R93J 1ZR4A 2WWYA 2DDAA 4WK8F 1SD4A 3DBRB 3ZOBA 2MLGA 1YTYA 2QSHX 2IJLA 4EMSA 1WCMJ 4BHBA 2A7OA 1OQYA 1YJ9I 2Y0SN 1MVYA 9ANTA 3OSGA 2X51A 3E6CC 1TT0A 2F5EA 1ERDA 3JRIA 3DTKA 3MMYB 4CCMA 1ZARA 3AKZA 3HOTA 2HDCA 1O3QA 1YW9A 1YFHA 3VVMA 3HRUA 1GT0C 3DFGA 2NYXA 3SEQA 2BW3A 2VKEA 4HYEA 3KEOA 2FQ4A 4I76A 2X6OA 3WHBA 2XPYA 2QBYB 5LGTA 3BJAA 3AG4H 5HLIA 3LSTA 2XAFA 3KYDB 1J2XA 4QIWN 1R4MB 3MKZA 3VB2A 2OV7A 4XONA 2X1EA 3LMMA 2KJBA 2LC2A 3H3UA 3PFYA 3OYDA 4X6AJ 3FM5A 1MZBA 4BAYA 4ZX6A 3HRMA 4E7KA 4A03A 2PX9A 4HOBA 3U1KA 3K70C 5FROA 3V7CA 4YIFA 1Z3YA 2WV0A 2R72A 3JRCA 3BJ6A 5GPAA 4XO3A 3HW2A 3U9WA 3FK7A 4E6KG 1B8IA 2PI0A 1KYWA 3HOYJ 2HR3A 1ORKA 2NOGA 1PVEA 3AG2H 1ZK8A 5KAFC 1LQ1A 4Y13A 1TL8A 3I71A 1N77A 4MEYF 2LY1A 2B9SA 1EKEA 2OJED 1EH7A 1P4WA 2KISA 3C3WA 2Y31A 4XKBA 4X0GA 1FOYA 4DW6A 2WTEA 4K2EA 4IHWA 3EUKL 2FNPA 4L0YB 5CQEA 5TGTA 2PJRB 2EPFA 1HW1A 4G6DA 2Q8KA 1USSA 2VC0A 3PUUA 1WJCA 2E5ZA 4AICA 1MJBA 3BR5A 2IA2A 3PFIA 2Y1DA 1GXPA 4HX7A 1JGGA 5GP9A 5EGOA 1MJ9A 5FLXZ 2DN0A 3DPTA 1K6OA 1X1BA 3V7RA 4HF0A 2VJ8A 2EIJH 3CO7C 1FYMA 3BCAA 1VQMI 3LSPA 2HZTA 5J1RA 4OMYA 5FKMA 3CC7I 1ZKGA 2FBIA 1NHAA 3F72A 2LP0A 3F22A 4A12A 4AYBN 4BH9A 2Z9OA 4QPQA 1O3SA 2EJRA 3ZR8X 1SFXA 5J8FA 3PIPF 1R7JA 2OA4A 3VODA 3HJEA 4JP0A 4CCLA 3REOA 1MMSA 3I55I 2WC2A 4FLOA 1SVOA 1J5YA 4CA0A 1NK2P 3H0GJ 1JKPC 2CYYA 2TCTA 3KP6A 5JMPA 2VQLA 4XKVA 2KDZA 2EQRA 2HOEA 3JRGA 1TWAJ 1TWFJ 1FTZA 2Q1ZB 3J7AO 4R7LA 4FLRA 1GV5A 4CCOA 2Z33A 1WQ2A 5IYDJ 4ZDPA 4CYCA 3HOUJ 4XMZA 2TRTA 4HLXA 1WZ2A 2PG4A 1O7FA 2Q0OA 4E7HA 1UFMA 2R7RA 3A4CA 2JVGA 2KPMA 2LDUA 3CP8A 4U0VA 4IOCF 3JRHA 1Q0HA 1ON2A 5IOYA 3Q5FA 4A0XA 1BI1A 3W6KB 3RYPA 3CCMI 5F6FA 3OYMA 2R7ZJ 1Q0QA 2XV4S 2VIXA 4KN4X 3WTSC 2COBA 3HOXJ 1ZR2A 4HQMA 5F08A 1S7AA 4K5MA 1F1ZA 3BT9A 2DCEA 2Y0SA 1ETYA 2AS5F 4MLOA 3PSFA 1OCPA 5EYRA 2YU3A 3HSEA 4P9UA 3H0DA 2F4OB 3ZQ7A 1QPMA 3ZXSA 5LGUA 2GM4A 3F9KA 5JNLA 3V7SA 3C2GA 2BEOA 4M6YA 3WU0A 2MC3A 2VBZA 3H92A 4Y33A 1K4SA 1MGTA 2DMPA 2XKPA 5J40A 4XRSG 3BR3A 3BTIA 1LFBA 1S5LC 1C0WA 1Q1VA 3CP2A 4L9VA 4EVIA 2KZGA 4A3BJ 1Z0XA 5TRDA 4AWXB 2HS5A 3FF5A 2XROA 5M5YJ 2FBKA 1FBSA 5LEJA 2FF4A 2OZUA 4LITA 1V3FA 3S1RJ 1QZYA 1FX7A 2FJ1A 3H9JA 2VXZA 3CMMA 3LSGA 2B63J 3KEQA 4RB0A 1IZ1A 1MH4A 1R5HA 2HPMA 3IKVA 4PSXA 3F0CA 3I3LA 2LD5A 4HNVA 4DJAA 3K4KA 3W6JB 1AOYA 2MSYA 3C1DA 2MFZA 4JX4A 1ULYA 3GTJJ 4GYIA 2X1CA 1SEUA 3GTKJ 2W57A 4P5OA 2M30A 3W2WA 3HEFA 4IEJA 3QPSA 1ITYA 2EZLA 3WTYC 4OOEA 4G94A 1P2FA 2QVWA 2LKXA 3I0TA 1K6YA 4XMWA 1IDYA 2IGNA 3C18A 3TMOA 2XKOA 1D8KA 3FTUA 1AKHB 2B61A 4PW4A 4PUSA 2QGUA 4KITB 4XNAA 4M74A 4ON0A 1JTYA 5FJ8J 2JD0A 5FRNA 2P5LC 1J09A 2VBWA 1JUSA 1N75A 1DPRA 2EWNA 1G3SA 4YIRX 2JRMA 1TC3C 4XRMA 2XGCA 5CVJA 3V42A 2JQ7A 1KU2A 2IXSA 4A3LJ 4JQFA 4RGSA 2PLYA 2JWTA 1BI2A 2FXAA 1E2XA 1EF4A 1T08B 3B73A 3LSHA 2CQNA 2VI6A 1TP4A 3P9KA 4XRSA 1ZHFA 2QZ8A 2DPDA 1D1BA 3FK6A 2FOKA 1WWXA 2DOFA 2IS4A 3K1MA 3L1PA 2QQ8A 1FSHA 1QHHD 3AG3H 2J5PA 3M8FA 3WTVC 4HDUA 2QBYA 3MVPA 1NK3P 4EM1A 2E19A 1MD0A 1G4DA 2DFIA 5E17F 1UELB 1WH5A 3K0LA 1P4AA 3S3OA 2W24A 4LOCA 4A5NA 2VPRA 3L00A 1R49A 2M3AA 2EFQA 3GLLA 4RLFA 3TKYA 1UHWA 1W5SA 3K2ZA 3IAM2 4C3HJ 3ABLH 3PNVA 3T8VA 1DU0A 1A5JA 3ECOA 2JUGA 3HUGB 3PUBA 1JG9A 3DKXA 4QPEA 1XG1A 5FGMA 3CCJI 3G2BA 4ZDLA 5IT9K 2O7GA 4HF2A 3GTQJ 2D1VA 2O7OA 5DV5A 3FXMA 1BOAA 3FBIB 4M3GA 3ONQA 4XN8A 5AONA 5DEQA 4BL0B 2P0WA 3OYBA 3B6CA 2D1HA 2M8EA 4AM3A 4EJTA 2P81A 1UG2A 3G71I 3HTUA 2H8RA 1W36D 1FIAA 4B43A 2VT3A 1TTYA 3W2AA 1XSVA 2RNGA 5EJCA 3ZN1A 1RESA 1YW7A 5IOZA 1VF9A 1WH7A 2EIKH 2R7QA 5JLWA 1QVUA 1S8NA 3ASOH 5L3DA 1IRZA 5LBQA
chains in the Genus database with same CATH topology
4MKTA 3BROA 1TQMA 4M6XA 4LB5A 2DTRA 3TDZC 3FMQA 2GWRA 4WXHA 2C6YA 4MS6A 2JRTA 3FUKA 4N9HA 2P7CB 4LLNA 4WXDA 2EK5A 2K7LA 1J75A 3WQRA 5ERIA 3E5QA 5D8KB 3U9GA 4LG0B 1RZ4A 2XRNA 1KU7A 2ADUA 5DLLA 4ZH4F 2IT0A 1J7KA 1MW2A 4I98B 3BWGA 4RSYA 2HPOA 3CUQA 1QBJA 2FEZA 5FWQA 3CTAA 1KYZA 4Q48A 1REPC 1R0KA 2O03A 4P96A 2WPGA 4N0BA 4KT5C 3FU5A 3K1NA 3ZI0A 2RDPA 2DU9A 4BXUA 3T5XA 3RKXA 3ABTA 3I5UA 3LQQA 1G6NA 2MA3A 4M9SA 3SXYA 1TQPA 1XGSA 5E20A 5LEKA 1R5GA 3EUHA 3FXQA 3JSZA 2RN7A 5BS6A 3DV8A 4XN9A 1QNTA 1FYKA 2Z5UA 3LAPA 4EQQA 4U7DA 3TOAA 2MH2A 1I1SA 4PGHA 1R36A 3E5UA 3V4GA 4IVNA 2RGVA 2G9WA 2ZBKA 3QPHA 1T6SA 2LKPA 3EBGA 1OYWA 4ZN6A 1ZREA 3F8NA 6PAXA 5BMZA 3CHQA 3I59B 2HQRA 4O5VA 1TNTA 2O0YA 5DYFA 4I02A 3L2CA 4U0WA 3T1BA 3FUEA 1S29A 4KP7A 3TO6A 1YQAA 2YX7A 4RGXA 3WODF 5FB2A 1UHMA 2RNJA 2XAQA 4EGZA 3EETA 3F6VA 4RB3C 4AIKA 2RQPA 4ASNA 2VE9A 3COAC 2EFOA 1X3ZA 4ZYEA 4PU2A 4BKXA 2TDXA 3S2WA 2X4HA 2XGXA 4EV0A 4G8XA 5J8CA 2GA1A 2E1CA 4M9ZA 4O3MA 4KIGA 4KN7X 4KDPA 3L7WA 3FX3A 5CYVA 1FPQA 4P9FA 5FFZA 1QZZA 1R1VA 1ZRCA 1Z05A 1MDMB 5JR3A 1IN4A 4ZW3A 4XN2A 3QPTA 1YS7A 1FZPB 4UHTA 5K1YA 2HKXA 3TDUC 2BYVE 2JT1A 1SFUA 1K78B 3FWEA 3WE2A 4LMYA 2RKHA 4MNUA 2EA2A 2J5OA 3K69A 1KQ9A 1IRGA 4EGYA 4JBAA 1PP8F 2QQ9A 4IHSA 1XB4A 2Z3YA 2VE8A 4ENKA 4XN1A 5ICCA 3ERED 5LHIA 1FBUA 3VEPA 1T1SA 1U5TB 1U5TC 4CXFA 4RAYA 2UZKA 4BNCA 1LJ9A 2ZNZA 1O57A 2JZYA 3BPXA 1B4AA 4RS8A 2C5ZA 4ZQEA 3B02A 1D3YA 2HYFA 1Z6TA 1SFEA 2XAGA 2VN2A 4A6EA 1PP7U 2QENA 5HS7A 2A3SA 3E3VA 4HV6A 3WQSB 2FE3A 3R0JA 4CHUA 3WGHA 2KKOA 1T1RA 4ZW8A 2EFNA 3LA2A 5ICFA 5HOOA 3ZMDA 3MCZA 3HHHA 2Y1GA 2VONA 1PUEE 2QQBA 2XQ0A 4ZQGA 4R1HA 2MAPA 2EV0A 1LEAA 3BY6A 2KIMA 1B59A 5DYMA 3TGNA 3I64A 2JTVA 1KQ8A 3FH5A 5D8LB 2AXLA 4XSZF 1A04A 2V1XA 4KUMA 2PJPA 5D5XB 3B7SA 3TQNA 4G9YA 4PZJA 4AIJA 3WE3A 3KZYA 1T0FA 3EBHA 2W85A 3HRTA 1ZAOA 1OMIA 1F5TA 4IXAA 3DPLC 4EM0B 1H3LA 3GFJA 5LGNA 3E97A 1ZS2A 2R3SA 3WTUC 1H19A 3FU6A 2A5YB 2M45A 3I4PA 4ZYHA 1O7LA 5DCMB 4IRHA 3ZHZA 4HDVA 3JAMK 2LF8A 5LRRA 5L3GA 5E8GA 2FFLA 1FBQA 5K5QA 1B9NA 2JCVA 5CVIA 3GFMA 5ED4A 4GAAA 2HWVA 3RC3A 3R0AA 2XHKA 1BJAA 3NQOA 5LHHA 2STTA 2ELHA 1TW3A 5JBIA 2XUBA 5HDGA 4YIIA 1KA8A 4HZFA 1W7PD 1RIOH 3FUDA 5EEHA 1YG2A 1LDKB 1LNWA 3MAJA 5FD6A 3DF8A 4WF2A 1P92A 4HBLA 3GF2A 3NEUA 3HOSA 1F4KA 4Y15A 1CGPA 3LA3A 2L54A 2ESNA 4ZZDA 4QMEA 3J80Z 2PQ8A 3JW4A 4DNCA 3CIAA 1CF7A 4L9NA 2ESHA 1XDSA 2DT5A 3QU3A 4XN4A 3GUDA 3V8JA 4R5XA 2CSOA 5L3EA 5CVUA 1B1BA 4WCGA 3C7JA 2F2EA 3JSPA 4WX9A 3F8BA 3FU0A 5ILUA 2H09A 3DEUA 4XBFA 4A5MA 2O3FA 2GA2A 5H6QA 4K5OA 1LB2A 3J80K 1WSUA 1R22A 4GYGA 1DPUA 4IHTA 4PGGA 2DLLA 3F3XA 4YFKF 3MFKA 4F7ZA 4U88A 3FTXA 4FLSA 2CFXA 2A07F 1YW8A 4YG2F 4LLLA 2P6SA 2YX4A 5CLSA 4XNBA 2DQ6A 4QLCU 4ZQTA 4A0YA 3KP3A 2VBXA 2XAJA 3GLXA 5K5RA 5J6XA 2ZMEB 3DKWA 1OYYA 2DK8A 2XVCA 2HQNA 3BJOA 4ENNA 1DP7P 2CG4A 3I58A 4HW0A 5FD5A 5D5WB 1H9GA 4AVPA 3HSFA 2R7DA 3GFLA 1HXDA 1ZRFA 3RIRA 1BC7C 2DK5A 3ABUA 1W7PB 2GZWA 4GGGA 3SHFA 4M71A 1STZA 2FNAA 4UV8A 3WGIA 1V4RA 3HSRA 3TO7A 2FU4A 1P6RA 1O3RA 2JSCA 4DQ2A 5IT9Z 3SZTA 2NNNA 1XCVA 4UUVA 2VOPA 4Y67A 2ZFWA 2CGPA 1YYVA 3FMRA 1IW7F 2D2WA 3KFWX 3V8LA 5KK1A 4L5JA 4AD9A 2K4BA 3CUOA 2FA5A 1D5VA 1HKSA 4KA4A 2EA4A 3FU3A 3A14A 1XDUA 4EM2A 1R0LA 4ARFA 1XGMA 1FP1D 4XLPF 4ZQFA 3KZZA 5D5VB 5AENA 4ZQHA 1YIOA 5E1XA 2K86A 1BM9A 4UVBA 2Y75A 5LLQA 1FSEA 4I09A 2WZGA 3SZPA 2A61A 4HLYA 5D4SA 5A2QK 2STWA 5LRSA 5DULA 5FO5A 2NRAC 4G7OF 1Z1DA 1S6LA 2MH9A 1SMYF 4CDGA 4M9XA 2NAZA 4FX4A 2Y1EA 4ZZLA 2PN6A 3V8KA 3AU8A 1FLIA 2JPBA 3E6DA 5JC1A 1U6GA 2ZXJA 3WU1B 4LFUA 1XMKA 1HQCA 3IRRA 4BHCA 2X0LA 1MKMA 3EYYA 4MTDA 3UERA 1OPCA 4LGWA 2FMYA 2VLAA 1FOKA 2BBYA 4N9IA 5ICGA 1HKTA 1HKQA 2P5KA 2KIUA 3B2PA 1VTNC 3BZ6A 1FYLA 4GXOA 4IF4A 1FC3A 1ZG3A 3WTXC 2GAUA 1EV7A 4R79A 5H6RA 2HPTA 3KP7A 4G7HF 5D5UB 2IA0A 3N4MA 2DW4A 1HW5A 1J9IA 1R23A 2CQKA 3LAJA 4XMTA 1Q1HA 4CZZA 4Q4ZF 2DQLA 2QQAA 5DUIA 5EV7A 1O3TA 4B09A 4BQAA 3R4KA 2QLZA 2HTJA 3Q44A 4AIHA 3CHSA 5IT3A 2F5DA 4ETSA 1TW2A 3TO9A 1YS6A 2EB7A 2OBPA 3D5LA 4UV9A 1HBXG 1LVAA 3CZEA 3KETA 3WG9A 2VC1A 3CZKA 5HNHA 4YFNF 1KQ0A 5HLHA 1IF1A 1EH8A 5JVTA 2W25A 3M1EA 4O6JA 3ELKA 4L18B 1MJAA 2ISZA 1EH6A 3KLNA 5JHUA 3FUJA 5F1RA 2L3DA 2O61A 4RCVA 1JXSA 4Y6RA 1ZLJA 1QO0D 3GX4X 3CZGA 3K9TA 4RGRA 4KIFA 3RTRA 3RASA 1Z9CA 3P9CA 4AYSA 1GW6A 4I0BA 1OKRA 4I0AA 1ONVA 4CGZA 3ANMA 3WTTC 5KVRA 1BC8C 5L3BA 2GTQA 2KIFA 5BPIA 2ZNYA 5BPDA 4L5IA 3P9IA 4HAMA 1SMTA 1YO5C 4S04A 5BOXA 3M8EA 4AR9A 1IAWA 2ZXGA 3L9FA 1BIAA 2MD5A 3KP5A 1T98A 3RPQA 3IC7A 3F8CA 1T38A 4LD5A 3T8TA 2A6EF 1I5ZA 4U7BA 2JV7A 2JCXA 1ONNA 4KMFA 2ZO4A 3EBIA 2QWWA 2A6HF 3Q43A 4BYYA 3HUGA 3FUNA 2QJ1A 3ROUA 3ANLA 2E1NA 3VOEA 2EV5A 4KMUX 5JO0A 2RC4A 1W5TA 3WTWC 5ILSA 4Y6PA 4XLNF 4RB2C 4IJAA 1IRFA 2PL5A 5D6EA 1XGNA 2EFWA 1TNSA 2QM3A 4NB5A 3LA7A 2HTSA 4H0EA 4RGUA 4HV5A 5CVVA 4LK1F 5EEGA 1XCBA 3I53A 2P6TA 3ZMTA 3QU6A 1RNLA 1JGSA 4EJVA 5HNFA 3CDHA 2PUSA 2EGHA 1OYIA 2BE5F 3O6BB 3FTWA 4WWCA 1MW0A 4JK1X 3FH7A 1ZGJA 4CO8A 1FY7A 2O6GE 3ML6A 1Z91A 4LG0A 3MZHA 4ZX3A 1FT9A 3K1PA 1XMAA 1DUXC 5HDKA 3FHEA 1K5HA 1E17A 1BIBA 3O3KA 4BHPA 5F64A 1GVJA 4ESBA 2CWEA 4LK0F 3WGGA 4XO5A 2GQQA 4KFCA 3FXUA 3JSOA 3G3ZA 3MWMA 3UEQA 2IA1A 3FULA 3N97A 2L02A 2DQRA 1IXRC 2QUFA 3Q9SA 4IRGA 1ONPA 3JAMZ 4XMVA 2OD5A 2G7HA 3FUHA 4OMZA 1GXQA 2DBBA 3HHGA 4M72A 3DXJF 4HF1A 4I7HA 1UB9A 3U2RA 1XD7A 5K5OA 2OU2A 4U0YA 3LQRA 1SQMA 2FMLA 2OAZA 2P4WA 2OZ6A 4X2UA 2HYGD 2PFBA 3IIEA 3HIFA 4PDKA 2BV6A 2ZCWA 2JPCA 2VOOA 3KE2A 3BP8A 1JVSA 2YR2A 3KP4A 5ICEA 2HGCA 2H94A 3Q9VA 4A2UA 4OINF 3ZMVA 1SAXA 3H3ZA 3I59A 3HYIA 3IWFA 1Z6RA 2LNBA 2UXNA 2ZJ2A 1JHFA 4IPAA 1ZGAA 1FP2A 2FSWA 1S3JA 3FZVA 1R58A 4FHTA 2DO7A 3FMSA 3GZ5A 1SD7A 1ZG5A 1IUYA 1DDNA 3RKWA 1I1GA 2H27A 3SFZA 4UNOA 3CLOA 1U8RA 4XN5A 3MEXA 1ONOA 1T2KA 5D6FA 4RB1A 3CJNA 3FTSA 4ESFA 1R1UA 3FUIA 3R61A 3AU9A 4NQWA 1U2WA 4XRFA 5CJ9A 3ZPLA 3ZN0A 3JT1A 5DDGA 5DCFA 1ZRDA 5JI6A 4R5VA 2Y1CA 3FXRA 3F21A 1OR7A 1H9TA 2XAHA 4TV7A 3F23A 1MDMA 1QQIA 3CUQB 4B8XA 3JTHA 3CUQC 5FLXK 4S05A 2K4JA 3T0YA 1BI0A 5HLTA 1Y0UA 1IN7A 4P55A 2CO5A 1MW3A 2O8XA 1W4MA 1RUNA 3WQQA 1K78A 1ODDA 5L3CA 2P5VA 1USTA 1G3TA 1X3WA 3QJXA 3LWFA 2GXGA 2XASA 2CW0F 4NHJA 3BDDA 1SD6A 3IL2A 4A6DA 3ZHXA 3B7RL 4Y6SA 3QP5A 3RJPA 2RJIA 4I2OA 1U5TA 1IXSB 1J59A 3CHRA 1ZYRF 4UXNA 3OOPA 3L09A 2GIVA 4R8HA 2F5CA 5E8IA 3E6BA 1P4XA 2IPQX 2ETHA 3E6MA 3R0IA 3EYIA 1L3LA 2JD2A 4PVBA 2HFHA 3GZ6A 4KYWA 5AIPA 4G6QA 1SC5A 4ESJA 1F9NA 5E1WA 4D0PA 1RP3A 3FH8A 2Q2EA 1U78A 3FUFA 2E7XA 4RVBA 3IKTA 5H20A 1WI9A 2YPRA 4MGRA 3GYHX 2HEOA 3ZMSA 3ZMZA 3FTVA 4AR8A 1HSTA 1BBYA 3M7GA 4AR1A 3IRQA 2R59A 4HX8A 3KLOA 2L4MA 3LFKA 5HLGA 3RDIA 1ZG1A 3GWZA 3G73A 3KCCA 2DAOA 1WKMA 3R6SA 4EJOA 1FNNA 1TBXA 4R5TA 2VODA 3FM3A 1ZLKA 2KRFA 4MQ9F 4LLGF 2H6CA 5JFRA 2C82A 2XPZA 2NNYA 5A2QZ 1XSXA 3HTSB 2D45A 1ZN2A 2LSOA 2Y48A 3AUAA 5ILVA 4XO4A 3ZHYA 1J0RA 1I6XA 2EV6A 2V6CA 1UCRA 3B2XA 3DP7A 3ZMUA 2DPUA 4XSXF 3ULQB 1JE8A 1IN5A 4I01A 1RI7A 4ENJA 3RKYA 1MW1A 4IRIA 3AAFA 2IVMA 3BPVA 5DCMA 4XNDA 2WZFA 1KU3A 4FT8A 1GHCA 1TQIA 3SQNA 4MTEA 2FQ3A 3FTYA 3I54A 4CYDA 3GXOA 4HQEA 4YFXF 1G5AA 3ANNA 1R00A 3RI4A 3B7TA 4FX0A 1AWCA 3JTGA 2Z99A 4L0ZB 5DD4A 3RC8A 4K5PA 5DD8A 3F8FA 1HSJA 2L01A 3NRVA 1QGPA 3B34A 3FUMA 3E5XA 3UCQA 4ZYDA 4ZX5A 2QVOA 2BGCA 1XN7A 2LF7A 3KP2A 3M9AA 2MAOA 4E70A 4OIPF 1X3UA 4Y17A 2G7UA 2M5WA 2V9VA 1LDJA 4Q47A 1B6AA 3CHPA 4HX4A 3P7NA 4EJUA 3O2PE 3QOPA 2V79A 1L0OC 4L9JA 3CZLA 3IWZA 5HDNA 5TJJA 2ISYA 4OOIA 4ZW5A 1S46A 4DPRA 2XIGA 2MLKA 4QUOA 4UVAA 4PCQA 3GEZA 4Q4EA 3RYRA 2R7FA 1IXCA 3GVAA 4Q5SF 1BI3A 4QHPA 4Q4IA 3EDPA 4ZX4A 2IW5A 5JAZA 5BPPA 3MZYA 3U1DA 3IHUA 4LUPA 3PQKA 3FTZA 4GCVA 2V1DA 3TOBA 1SG7A 5D4RA 5L3FA 3J81Z 2UXXA 2UWMA 4XMUA 5DUKA 3CHOA 4JNDA 3F8MA 4GO1A 1K79A 2F5FA 4M73A 1K7AA 3HRSA 3D0SA 1G3WA 3B7UX 2JCYA 1JHHA 1T39A 2ZMEA 3KEDA 3EQLF 5FFXA 5BQTA 3B37A 2IP2A 3R60A 5LHGA 3FHZA 5JMWA 1KGSA 3VFZA 4ENMA 3PQJA 4A0ZA 5E1ZB 2IRFG 1IN6A 2K27A 4K5LA 2Y0MA 3J81K 2QYOA 2H6BA 2OQGA 1IN8A 4FCAA 1W7PA 4XN7A 2GXBA 1TLHB 4MHGA 3CO6C 3F6OA 1SD5A 1JGIA 4WXCA 4RAZA 1I27A 2OQRA 5HVQC 5CVRA 2YSRA 2PMHA 4FLQA 2ZKZA 1ZH5A 2E7WA 3ECHA 4ZW6A 4QWQA 4OOFA 1BN5A 2FBHA 4OIQF 2RVCA 5AIQA 3B3BA 5HS8A 1LDDA 4KICA 4MQVA 1B9MA 4EJWA 2NS0A 2PMUA 3QP6A 4L9TA 1RUOA 4XMXA 5E18F 2ACJA 2M87A 2EFPA 1G3YA 4HA8A 2R70A 1CF7B 3DQVC 4Z2YA 4K5NA 3MQ0A 4CICA 1H0MA 2A69F 3GW2A 1S7OA 4ZYGA 3GFIA 5HS9A 2L4AA 1R1TA 1LEBA 1WRJA 2DI3A 1Z7UA 1YLFA 2PGGA 2V1UA 4J3BA 2Y1FA 3ZP5A 1ON1A 1HW2A 2KJCA 4OU0A 2HKOA 2PBIA 3OV8A 3BOQA 4MEXF 3QAHA 1HS6A 3WTZA 4G7ZF 2P8TA 2COMA 3T8RA 3ISPA 4OIRF 2P7VB 1XSDA 4QIRA 2M1BA 3A06A 2PEXA 4KIBA 4L2LA 1KU9A 2JD1A 2VT2A 1XGOA 4KNYA 2W84A 3QRFF 4ZW7A 2MBFA 2DQMA 2A68F 1U3EM 4LJZF 1FWZA 1Q0LA 3RPUA 4LB6B 4GAEA 2RV8A 2B0LA 3VVLA 2VBYA 4OIOF 2K02A 1PDNC 3GO5A 2FRHA 4UVCA 1D8JA 2WWYA 4WK8F 1SD4A 2MLGA 1YTYA 2IJLA 4EMSA 4BHBA 2A7OA 1MVYA 3E6CC 2F5EA 1ZARA 3HOTA 2HDCA 1O3QA 1YW9A 1YFHA 3VVMA 3HRUA 3DFGA 2NYXA 4HYEA 3KEOA 2XPYA 2QBYB 5LGTA 3BJAA 5HLIA 3LSTA 2XAFA 1J2XA 3VB2A 2KJBA 3H3UA 3FM5A 1MZBA 4BAYA 4ZX6A 3HRMA 4A03A 4HOBA 3V7CA 4YIFA 2WV0A 2R72A 3BJ6A 4XO3A 3U9WA 2PI0A 1KYWA 2HR3A 1LQ1A 4Y13A 3I71A 4MEYF 1EH7A 1P4WA 3C3WA 2WTEA 4K2EA 2FNPA 4L0YB 1HW1A 4G6DA 2Q8KA 1USSA 2VC0A 3PUUA 4AICA 1MJBA 2IA2A 3PFIA 2Y1DA 1GXPA 4HX7A 1MJ9A 5FLXZ 3DPTA 1K6OA 3V7RA 4HF0A 2VJ8A 3CO7C 1FYMA 2HZTA 4OMYA 2FBIA 1NHAA 3F72A 3F22A 4A12A 4BH9A 2Z9OA 1O3SA 2EJRA 1SFXA 5J8FA 1R7JA 2OA4A 3VODA 3REOA 2WC2A 4FLOA 1J5YA 2CYYA 3KP6A 5JMPA 2HOEA 3J7AO 4R7LA 4FLRA 2Z33A 1WQ2A 4XMZA 4HLXA 2PG4A 1O7FA 2Q0OA 1UFMA 4U0VA 2LDUA 1Q0HA 1ON2A 3Q5FA 4A0XA 1BI1A 3W6KB 3RYPA 5F6FA 1Q0QA 2XV4S 4KN4X 3WTSC 4HQMA 1S7AA 4K5MA 1F1ZA 2AS5F 2YU3A 3HSEA 4P9UA 3ZQ7A 1QPMA 5LGUA 5JNLA 3V7SA 2BEOA 4M6YA 3WU0A 2MC3A 2VBZA 3H92A 1MGTA 2XKPA 1C0WA 4L9VA 4EVIA 5TRDA 4AWXB 2HS5A 3FF5A 2XROA 2FBKA 1FBSA 5LEJA 2FF4A 2OZUA