4CXFA

Structure of cnrh in complex with the cytosolic domain of cnry
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
154
Chain Sequence
DADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDTFVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRAARLELARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Anti-Sigma Factor Cnry in Complex with the Sigma Factor Cnrh Shows a New Structural Class of Anti- Sigma Factors Targeting Extracytoplasmic-Function Sigma Factors.
pubmed doi rcsb
source organism Cupriavidus metallidurans ch34
molecule tags Transcription
molecule keywords RNA POLYMERASE SIGMA FACTOR CNRH
total genus 60
structure length 154
sequence length 185
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cxfA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4cxfA01
4L18B 3SZPA 2EFWA 3SQNA 3MZHA 2H6BA 4FLQA 1R58A 3O3KA 2ZCWA 4Q48A 3KP4A 2LSOA 2OQGA 3BPXA 3BY6A 2JPBA 2V79A 4O5VA 4M72A 1KYWA 4JBAA 3ISPA 1QNTA 3CJNA 2IP2A 4K2EA 3F21A 3F22A 3JTHA 3KCCA 4XRFA 4A0ZA 1BI2A 1PP7U 1FLIA 3WU0A 1Z91A 3ROUA 2WC2A 5ICEA 1R5HA 4M9XA 2UWMA 5A2QZ 4AIJA 2V6CA 2HQRA 4FHTA 1LB2A 4KIGA 2K7LA 3M1EA 2MLKA 4HW0A 1IXSB 5CVUA 5K1YA 1XB4A 3JAMZ 4OIOF 5HS7A 2FBKA 5AONA 3DV8A 4GGGA 3U1DA 2QQAA 3TOBA 4RB3C 3CZEA 1JGIA 2HOEA 3RJPA 3RPUA 5D8KB 2A69F 3TQNA 1HXDA 1FBSA 3QRFF 2ZNYA 2A3SA 5HVQC 1BN5A 2XHKA 4UVCA 4LMYA 4HF1A 1KU7A 5FGMA 2B0LA 1F1ZA 4D0PA 1K79A 4FLOA 4IF4A 1TW2A 5L3FA 4I01A 3I64A 2FRHA 4UNOA 2RVCA 2YX4A 3H3UA 1RP3A 3Q5FA 3E3VA 2H94A 3OOPA 1G4DA 1ON2A 2E1NA 4S05A 2FBHA 3J81Z 1PUEE 3V7RA 1T1SA 2RKHA 5HLHA 4U7BA 3HIFA 4U0VA 3KE2A 1S46A 1P6RA 4O6JA 3WGIA 4A0XA 5LGNA 4KIFA 4OIRF 1Y0UA 4BHBA 4U0WA 3L00A 4RAYA 1K5HA 3B02A 5D4RA 5K5RA 3GLXA 1UFMA 1YYVA 2Y1DA 2ZXJA 1KYZA 2GQQA 5LLQA 2QZ8A 1ZHFA 2XKOA 3RKYA 1LJ9A 3IL2A 2RGVA 2D2WA 1PDNC 3CZKA 2WTEA 3O2PE 2D1VA 5L3CA 2LNBA 3GXOA 3I71A 4LLLA 3VODA 4RS8A 4XLPF 3ML6A 3AU8A 4PGHA 1OMIA 3BJ6A 3FMQA 3IKVA 5LBQA 3LFKA 1IAWA 3K1MA 1IRFA 4YIIA 5HS9A 2WV0A 4AVPA 3R4KA 4XSXF 4B8XA 5JHUA 5DCFA 4N0BA 1BBYA 4Z2YA 3L7WA 2J5OA 2F5FA 1LEAA 1U2WA 1Q0HA 2FEZA 3NRVA 3F6VA 1FOKA 4LK0F 1YW9A 4ASNA 4LUPA 1J2XA 3Q9SA 2ADUA 1S3JA 4HF0A 5D5WB 2O61A 1TQMA 1BIBA 2R7DA 1R00A 3E5QA 3HOTA 1XGSA 1CGPA 4ZYGA 1D8KA 3J81K 4HX4A 1J0RA 4WXHA 4EGYA 3C3WA 5ICCA 5LHGA 4CGZA 3CZGA 2ESHA 4H0EA 5D5UB 1RIOH 2YPRA 1BIAA 4L9TA 1JG9A 3R0IA 2VOOA 2R3SA 3V7SA 4P5OA 3K69A 4MQVA 1IN5A 5ICFA 1ZYRF 2EA2A 3P9KA 1QO0D 2Z9OA 1BJAA 1USSA 3ECOA 3EQLF 1FSEA 4HX7A 2FQ3A 1XDSA 2RC4A 3K2ZA 2CQKA 4WXDA 2KIFA 1OR7A 5FD6A 5AIPA 3HHHA 2O6GE 5D8LB 2IT0A 3WTZA 2COMA 1R1UA 3MQ0A 4OU0A 3HTSB 4MTDA 2VBWA 3R6SA 2K27A 4M9ZA 4OIPF 2L4AA 4RB2C 3I59B 5CYVA 3WTWC 2FXAA 2ESNA 3V4GA 2OZ6A 4FT8A 1MVYA 1YS7A 3WTXC 3U9GA 1FC3A 1OYWA 5JMWA 3G73A 1YFHA 1SC5A 1B6AA 4AIHA 1Q0QA 1EH8A 4I2OA 1XDUA 4A5MA 5IT9K 5IT9Z 2E7XA 3FMSA 3LQQA 5HDKA 1U5TC 3HRSA 2OU2A 2VONA 3D5LA 2ACJA 4RGRA 2ZKZA 2HDCA 4KYWA 1I27A 1XMAA 2FF4A 2L54A 2LF8A 4I02A 1T1RA 3I53A 4L0YB 4CHUA 3QU3A 5ERIA 2FMYA 1KA8A 1ODDA 1B9MA 3F72A 1MGTA 4YIFA 3P9IA 2JCYA 2Z5UA 1ZRDA 2VBXA 4ETSA 3HHGA 3LAJA 3DFGA 2EFQA 1G3SA 1CF7A 3LA2A 5J6XA 4KMUX 5L3EA 2VN2A 2W57A 3PFIA 2YX7A 4B09A 3DPLC 5D5XB 1CF7B 3BJAA 5D6EA 5LEKA 3HRUA 4MHGA 1XGMA 2PMHA 4OOEA 1R1TA 1SFXA 5K5QA 5CJ9A 4ESFA 3FHZA 4E70A 3L2CA 1WQ2A 4UV9A 2A5YB 3TOAA 3F8NA 4CYDA 4ZYHA 1WWXA 3L9FA 2DI3A 3TDZC 2Z3YA 1ULYA 2VBYA 5JBIA 3KEOA 3IHUA 1MDMB 4A03A 2P7CB 5EEHA 2C6YA 1R5GA 3J80K 3MWMA 4HQEA 1E2XA 1XGOA 3RKWA 2K02A 1LQ1A 2JD0A 2AXLA 4A2UA 1S8NA 2CYYA 4YG2F 1FYMA 1W4MA 4JK1X 5BPIA 2K86A 4LB5A 1IF1A 3T0YA 1T2KA 1GHCA 2PI0A 3P9CA 1XSXA 1ON1A 4EM0B 1IZ1A 2X4HA 2XAGA 1D3YA 2IW5A 4QWQA 3MEXA 3B73A 4WWCA 3QAHA 4Y15A 3FWEA 1SD4A 5FLXZ 4WK8F 3BJOA 1IN6A 1W5TA 1GXPA 3GZ5A 3M8EA 2MH2A 2IPQX 1H9TA 2DT5A 4Y6RA 1LDDA 2DFIA 3GFIA 1DPRA 1I5ZA 1P4WA 3COAC 1ZRCA 4EJTA 2JPCA 4KFCA 3GF2A 2FU4A 2BYVE 3T8RA 1IN4A 2FMLA 3OV8A 2GA2A 3KFWX 4BXUA 3J80Z 1ZG1A 3E5UA 4LG0A 4XSZF 5BS6A 3CZLA 2XAQA 3D0SA 1EH7A 3F3XA 3CTAA 1YO5C 4P9FA 3P7NA 1B4AA 2HYFA 1YS6A 5DUKA 1J7KA 4O3MA 1TQPA 1SMYF 2GZWA 3PQKA 2ISZA 1B9NA 1FZPB 3QP5A 4BYYA 4RB1A 2BE5F 2M8EA 1WSUA 3R0JA 5JFRA 2Z33A 3WODF 2A61A 3QPTA 1HQCA 2P8TA 2QVOA 4LGWA 2IJLA 3QP6A 3ZPLA 3K1NA 4OMZA 4LLGF 2WWYA 1REPC 3A06A 2L4MA 4EJVA 3E97A 5ILVA 3REOA 4P55A 3IKTA 5H6QA 4MGRA 4I0BA 2A6HF 1Z6TA 5KK1A 3RTRA 5HDGA 5DDGA 2EFPA 1XMKA 3ZMUA 5E8GA 2FNPA 3F8FA 1QPMA 4ZQEA 2VT3A 4RGXA 3M9AA 3WTSC 3KLOA 3JSPA 4HBLA 1KQ0A 1AWCA 2QLZA 5L3GA 1RI7A 1T6SA 4UHTA 2EB7A 4Y67A 1OKRA 2F5DA 3RKXA 4F7ZA 1W7PD 1J59A 2OQRA 3VEPA 2OAZA 3GO5A 4IRHA 1K6OA 5E1ZB 3IRRA 1MZBA 2DBBA 2ELHA 5DUIA 3E6MA 2MLGA 2QENA 5E1XA 3IRQA 3BDDA 2XASA 3IC7A 5EEGA 4HV6A 3ZN0A 4BHPA 2RQPA 2DQLA 4R8HA 2HR3A 2XAFA 1U5TA 5H6RA 4FX0A 2QQ9A 3F6OA 4ENKA 4L9JA 4KN4X 4OINF 2W85A 3JTGA 2HKOA 3U2RA 5DD8A 3R0AA 5DEQA 4CICA 1IUYA 1R1VA 2Y1GA 3UEQA 3ZMVA 3RI4A 2F5EA 4WF2A 2XAJA 4N9IA 4LK1F 3F8MA 1L3LA 4N9HA 2D1HA 3BROA 3LA3A 2HFHA 2MBFA 1TW3A 5H20A 5FB2A 2GXGA 4YFKF 4MEXF 4KN7X 3T5XA 3ZMSA 3WE2A 2VC0A 3FZVA 1ONNA 1HKSA 4EJUA 1P4XA 4LB6B 3SHFA 4MNUA 3GEZA 4M6XA 1P4AA 2BEOA 4L5JA 4ZH4F 3MAJA 4IPAA 2G7UA 1R36A 1UCRA 3W6KB 1YLFA 3G3ZA 5JAZA 1BM9A 2CW0F 3ZHYA 3R60A 5JMPA 1MW2A 2RN7A 4OOIA 3TDUC 3EUHA 4KT5C 1F5TA 2O7GA 1MDMA 3SXYA 4I7HA 4ENJA 1I1GA 3FXQA 1O7FA 4QLCU 3ERED 4CZZA 1OYIA 2ZNZA 1U6GA 4PGGA 1JHHA 1BI3A 1LEBA 4ON0A 3E5XA 2EWNA 2K4BA 3WGGA 1T0FA 4GXOA 3PQJA 4UXNA 4EVIA 2A6EF 3C1DA 4HDVA 1U3EM 1K78B 2PBIA 1YTYA 4WCGA 2M45A 4ESJA 4OMYA 4I98B 1TBXA 3VB2A 1ZN2A 4G94A 3WG9A 1FSHA 1HW1A 2Q0OA 4OOFA 2KJCA 4Y6PA 2JZYA 2QBYA 1I1SA 1R0KA 2PEXA 4FLSA 5D4SA 3RASA 2NYXA 3HRMA 1PP8F 3F8CA 2XKPA 3BWGA 2Y0MA 3GZ6A 1BI1A 3FF5A 5J8CA 2Y48A 4HV5A 1XD7A 4EV0A 5DD4A 2EV5A 3HRTA 2XUBA 2RNJA 5J8FA 2P4WA 1I6XA 3FM3A 3N97A 5TJJA 3SZTA 3HTUA 2A68F 4NHJA 1W7PA 1RNLA 1MJAA 2CG4A 3LQRA 3KLNA 3AUAA 4LFUA 1P92A 2E7WA 3BPVA 2P7VB 5E17F 5FLXK 1ZARA 2CWEA 2P5KA 3HYIA 1U5TB 3JW4A 4U0YA 1R0LA 2MC3A 2QYOA 3WTUC 3E6DA 5FFZA 4AYSA 1S7OA 1T98A 1S7AA 3KP5A 4GO1A 4KNYA 1UB9A 4Y17A 2M1BA 2MAPA 4EQQA 1TQIA 2V1XA 3JAMK 4ZZDA 3T1BA 2Q2EA 4ENMA 5AIQA 2X0LA 4LD5A 2DK8A 2ZMEB 4UUVA 5JVTA 2BV6A 1IN8A 4A6DA 3WU1B 4HF2A 1OYYA 2NS0A 1FWZA 1HSJA 5LRSA 3GUDA 2JSCA 1STZA 2Z99A 2O8XA 3V8LA 1BI0A 3J7AO 2J5PA 2BGCA 2EK5A 2GIVA 3ZQ7A 4GCVA 3LA7A 5BPDA 4AD9A 2M87A 2WPGA 3C18A 1P2FA 4CDGA 5HLIA 5D6FA 1XCBA 1SAXA 4EMSA 2ETHA 4ENNA 3I59A 3KP6A 2ISYA 1FYLA 4CXFA 3GX4X 2EGHA 3FM5A 5D5VB 2OD5A 3ZMZA 3F23A 4TV7A 1FPQA 2XGXA 2NAZA 4AIKA 4A12A 5IT3A 2IA2A 3DF8A 1UHWA 4BQAA 5FD5A 3TO9A 2P6SA 4A0YA 2OA4A 2DW4A 4I09A 3CUQA 3CO6C 1JXSA 2C82A 4IHTA 2HYGD 2Q8KA 4HYEA 1D5VA 5E8IA 1G5AA 5K5OA 4KP7A 5E20A 5CLSA 1J5YA 1O3RA 3GFLA 2VE9A 3KP2A 3KZZA 2GWRA 1ZH5A 3W6JB 3I4PA 2Y75A 3BOQA 4MTEA 3T8TA 3NEUA 2V1UA 1H9GA 1Z05A 2HEOA 4L5IA 3RYRA 2RV8A 5HOOA 3I58A 1HBXG 4IHSA 1RZ4A 1HKTA 3ZN1A 3DPTA 5TRDA 1Z6RA 2D45A 3K9TA 2KIUA 4R1HA 5LRRA 2EV6A 3K0LA 1MJBA 1XSVA 1J75A 2O0YA 4IXAA 3DEUA 1W5SA 3GW2A 2DO7A 1QGPA 1XSDA 4I0AA 1L0OC 4KMFA 1F9NA 3ECHA 3WGHA 2HKXA 2HWVA 1G3WA 3HSRA 1GVJA 5DYMA 4CO8A 1O3QA 2HGCA 1XGNA 1WKMA 1O7LA 3Q9VA 1ZRFA 5LHHA 2VE8A 1EV7A 2Y1CA 4JQFA 1T38A 3N4MA 3E6BA 4L9VA 1HW2A 4EM2A 4M9SA 5E1WA 3ANNA 1HW5A 4G9YA 2IVMA 2DPUA 3CUOA 1TNTA 1RUNA 2TDXA 4HAMA 1NHAA 1O57A 1S6LA 4BNCA 1ZG5A 3JSOA 2BBYA 3ANLA 2PJPA 4KIBA 3FX3A 3RPQA 1V3FA 2FNAA 2PG4A 5F64A 2MD5A 3L09A 4G6DA 2STWA 4RGSA 2AS5F 3WQSB 4ZYEA 2P6TA 4U7DA 2ZO4A 1IRGA 4A5NA 5JO0A 3ZHXA 2F2EA 2QQBA 2GA1A 2ZBKA 5LHIA 2EFOA 1KQ9A 1Q1HA 4UVBA 4KA4A 3EYYA 6PAXA 2Y1FA 5ICGA 5ILUA 4A6EA 5BQTA 5L3DA 4EM1A 4BHCA 1E17A 3O6BB 1SD6A 1DUXC 2CSOA 1UHMA 2XROA 2HZTA 3RDIA 5HDNA 1GXQA 1FT9A 1HKQA 1TLHB 1ZREA 4G6QA 1KU2A 2V9VA 3V8KA 4G7HF 3HSFA 1YG2A 1YW7A 4ZQGA 1BOAA 2XRNA 2IA0A 2JD2A 1YW8A 5ILSA 5JR3A 3A14A 2H09A 4GYIA 2FBIA 2GXBA 4ZYDA 4ZQFA 1FX7A 1U8RA 1U78A 1XCVA 4MEYF 1AOYA 4YFNF 3WTYC 1ZLKA 2CGPA 2CO5A 1JGSA 3EDPA 5HLGA 2FSWA 2JTVA 2KRFA 2QUFA 2LF7A 4R79A 1FBQA 2CFXA 1LDKB 2EJRA 2DQRA 3QPHA 1EH6A 1USTA 5BMZA 3KZYA 3FXUA 5A2QK 2RDPA 3FMRA 4M71A 4HA8A 1ZLJA 1YQAA 2XV4S 4S04A 2UXNA 2MAOA 3KP7A 2PMUA 5F6FA 1OPCA 3R61A 5JNLA 5CVRA 1ONOA 1SD5A 3RIRA 2A07F 1FP1D 3DKWA 3CUQC 4WX9A 4DQ2A 3F8BA 2DTRA 1B1BA 4G7ZF 2R7FA 5FFXA 3LSTA 3E6CC 5DULA 1LVAA 2DPDA 5LGUA 2VXZA 2XVCA 3EYIA 2VT2A 1G6NA 2W25A 1ZG3A 3LAPA 1KU9A 2G7HA 2VBZA 2VOPA 4BAYA 1Q0LA 2JCXA 3HUGA 4EGZA 1BC8C 4KDPA 1B59A 2MH9A 2PLYA 1K7AA 5DV5A 1ZGAA 1MKMA 4RCVA 4LG0B 2KKOA 1T39A 2ZMEA 2DU9A 3CUQB 1XN7A 3NQOA 2L01A 1MW0A 3VOEA 3C7JA 1R22A 4M74A 2HS5A 2LDUA 2VC1A 3WTVC 4Y6SA 2L3DA 5DCMA 3AU9A 4AICA 4KICA 2HTJA 4WXCA 4FX4A 4HX8A 4PZJA 4HQMA 3M7GA 1MD0A 4YFXF 4NB5A 1IW7F 4LJZF 4OIQF 2EV0A 4NQWA 3IIEA 1DP7P 1FBUA 1R23A 2STTA 4UVAA 2YR2A 4ZN6A 1FNNA 1FP2A 2JD1A 1LNWA 1MW1A 1QZYA 1O3SA 3WQRA 2EFNA 3GWZA 1WRJA 4GYGA 3SFZA 3S2WA 5HS8A 3HSEA 2JCVA 3EETA 5LGTA 3LWFA 1KGSA 1Z1DA 4HLYA 1JHFA 1G3TA 2O03A 1H0MA 1ONPA 3M8FA 2NNYA 1TTYA 2YU3A 3V7CA 3DQVC 3UERA 4M73A 1IN7A 4HDUA 2VODA 2V1DA 4IJAA 5FO5A 4IRGA 1JVSA 1QBJA 2K4JA 4GAEA 3GVAA 5CVJA 1X3UA 2OBPA 2MA3A 2Y1EA 2FOKA 4ESBA 5BOXA 3WQQA 2NNNA 4G8XA 2UZKA 2L02A 2XAHA 5DCMB 1HSTA 2NRAC 4ZZLA 4PCQA 4PDKA 1YIOA 1K78A 3CDHA 3V8JA 3ELKA 2ZJ2A 3MZYA 3WE3A 3DXJF 3CLOA 3ZMTA 2QM3A 2PN6A 1ZS2A 4Q47A 3MCZA 4Q4ZF 2LKPA 1DDNA 5CVVA 1RUOA 1WI9A 1SD7A 3UCQA 3I5UA 3WTTC 1QZZA 3KP3A 3H92A 3H3ZA 4IVNA 2PQ8A 3QOPA 1ONVA 2EA4A 2W24A 4XBFA 1W7PB 1FY7A 1V4RA 5LEJA 4U88A 3ANMA 3IWFA 4BH9A 4HZFA 4IRIA 5KVRA 4Q5SF 1TNSA 3HOSA 3QU6A 2QBYB 3MFKA 3RYPA 1MW3A 2H6CA 1QQIA 5F1RA 3TO6A 4DNCA 1KQ8A 4ZQHA 3TGNA 1VTNC 5JC1A 2JRTA 2GAUA 1IXCA 3DP7A 2JT1A 2KJBA 2UXXA 3GYHX 1BC7C 1C0WA 2IRFG 3I0TA 2DAOA 1R7JA 2DLLA 3I54A 3TKYA 4P9UA 2DK5A 4G7OF 3ABUA 2HTSA 2G9WA 2P5VA 2FE3A 3GFMA 4RB0A 4FLRA 3KETA 1Z9CA 4EJOA 4KUMA 4Y13A 2IA1A 1H3LA 4RGUA 1LDJA 2ZFWA 3CO7C 4M6YA 1KU3A 1Z7UA 2YSRA 3TO7A 1ZGJA 2M30A 5E18F 1O3TA 2M5WA 2OZUA 3ZI0A 4HLXA 5ED4A 2W84A 2FA5A 5L3BA 1IXRC 3KEQA 3ZHZA 4AWXB 1D8JA 4HOBA 3GFJA 1G3YA 4P96A 5JI6A 1S29A 5CVIA 4EJWA 2H27A 3IWZA 2F5CA 3K1PA 1SFEA 2O3FA 3FXRA 2QWWA 2PFBA 2KIMA 3AAFA 1JE8A 3BP8A 4LLNA 4RAZA 1MJ9A 1FYKA 2XIGA 1DPUA 4UV8A 3VFZA 1ZAOA 1J9IA 4MQ9F 4L0ZB 1SMTA 4L9NA 3ABTA 2P5LC 3ZP5A 4XLNF 2HQNA 1F4KA 3BZ6A 3ZMDA 1A04A 1SFUA 2E1CA 3ULQB
chains in the Genus database with same CATH superfamily
5M5WJ 3SZPA 4L18B 2EFWA 2R92J 3J7AY 5J40A 3SQNA 2QSFX 3ZRGA 3MZHA 2H6BA 4FLQA 1R58A 3O3KA 2ZCWA 1MNDA 4Q48A 3KP4A 3CF5F 2LSOA 4J19A 2OQGA 3BPXA 2HU9A 3LNQA 2V9KA 3BY6A 4GFBA 3OIPA 5FWQA 1G8XA 4ZYAA 1MSEC 1X58A 4B43A 2JPBA 2V79A 4O5VA 4M72A 4C3JJ 1KYWA 4JBAA 1GDTA 4HNVA 3VSKA 3ISPA 1QNTA 3CJNA 2IP2A 4L5EA 4K2EA 4RM2A 4JX4A 4ABZA 1FMWA 3JTHA 3F22A 3F21A 3KCCA 4IQJA 4XRFA 3X2QH 4A0ZA 1BI2A 1PP7U 2HPMA 3CDIA 4Y33A 3WU0A 5EGOA 1FLIA 1Z91A 2CUJA 1SVOA 3ROUA 1N78A 2WC2A 3PO3J 2NS7A 1RPWA 5ICEA 1OCOH 1R5HA 4M9XA 4NBQA 3W2AA 3JRHA 3PIOF 2UWMA 4C30A 1PUFA 5A2QZ 4BBRJ 4AIJA 2V6CA 4R5XA 3OS0A 2LTPA 2GBYA 2HQRA 4FHTA 5F0HA 1LB2A 3JT1A 4A3FJ 4KIGA 4BXFA 2K7LA 2Q2EB 2MLKA 3M1EA 4E4HA 4HW0A 3FTZA 1IXSB 5CVUA 1JGGA 5K1YA 1XB4A 3JAMZ 4OIOF 3HPHA 4XK4A 2WADA 5HS7A 2R70A 3OYHA 2FBKA 1FOWA 5AONA 1X2MA 2KRHA 2BY2A 3DV8A 4GGGA 3U1DA 3RQIA 2CW7A 2QQAA 3AL0B 3TMOA 3TOBA 4RB3C 2HNHA 3VYRB 1JGIA 3CZEA 2HOEA 3RJPA 3RPUA 4AU7A 5D8KB 3K4CA 2P0WA 2LP0A 2LY2A 3IH2A 4QSHA 4M3DA 2A69F 4KJZA 4XN8A 2KRCA 1MBJA 3TQNA 1HXDA 2YS9A 2DJIA 2ECBA 1FBSA 1I39A 3HC7A 1FMVA 2BVMA 3W2WA 3QRFF 2ZNYA 3FUIA 3FH7A 2A3SA 5HVQC 1BN5A 2XHKA 4XONA 3CHOA 2XRLA 4UVCA 2M8GX 4LMYA 4HF1A 4IL6C 1KU7A 5FGMA 4B3XA 2B0LA 1F1ZA 1Y39A 4D0PA 2F6CA 1K79A 4I76A 2LD5A 4FLOA 4IF4A 4K5NA 1TW2A 3S3NA 5L3FA 4I01A 2VI6A 2VKHA 2IEKA 4XNFA 3I64A 2PX9A 2FRHA 2IGMA 3CF2A 2DXIA 4UNOA 3T8VA 2QVWA 3S1RJ 2RVCA 2YX4A 4AR9A 3H3UA 1YIJI 1YITI 1RP3A 3Q5FA 3E3VA 2H94A 3SDGA 4DOZA 4XLCA 3OOPA 1ETVA 4Y4RA 2QCOA 1YX5A 2DFHA 4C2MJ 3H5NA 1G4DA 1MBKA 4BU2A 1ON2A 2E1NA 4S05A 2FBHA 2WBMA 3K10A 3GMEA 1IDZA 2DOAA 3J81Z 1PUEE 3V7RA 1T1SA 2RKHA 5HLHA 4U7BA 3HIFA 2CV1A 4U0VA 2OV7A 3KE2A 1S46A 1P6RA 1WFXA 2IGOA 4O6JA 4A0XA 3WGIA 1LFPA 5LGNA 4KIFA 4OIRF 1Y0UA 3OSGA 3M07A 2O8KA 4BHBA 2XPYA 4U0WA 3L00A 2DA1A 1WJFA 2MYSA 4RAYA 1VQ7I 4UB6C 1K5HA 1LPQA 4IHXA 3B02A 5D4RA 5K5RA 3UKGA 3GLXA 1JKQC 1UFMA 1YYVA 2Y1DA 4A3DJ 2EZIA 2ZXJA 1KYZA 2GQQA 4Y52J 2HQ5A 3BR6A 5LLQA 4OAYA 2QZ8A 1ZHFA 2XKOA 3K4JA 3VSLA 3RKYA 4KITB 1LJ9A 3IL2A 2RGVA 4DBQA 2D2WA 1PDNC 1UAAA 3CZKA 2WTEA 3O2PE 2DJNA 2D1VA 4NUBA 5L3CA 2YU9J 1VQMI 2LNBA 2L7ZA 2DOFA 3GXOA 2JVGA 1U9OA 4LOCA 2JWTA 4RAFA 3I56I 4ZDPA 3I71A 4LLLA 4LITA 3VODA 1W36C 4RS8A 3OYIA 4XNDA 4XKBA 4PSWA 1Y6IA 4XLPF 2VJ8A 3ML6A 3AU8A 4PGHA 1J09A 2CUEA 1OMIA 3BJ6A 3FMQA 4NC8A 3IKVA 5LBQA 2L9NA 3LFKA 1IAWA 4K5LA 3K1MA 2LKSA 1IRFA 1Q1VA 4YIIA 3BG5A 4A3EJ 4L2LA 4QIRA 5HS9A 4S0HB 1GVDA 2WV0A 4AVPA 4D7NA 3NWSA 3R4KA 4XSXF 4B8XA 5LFAA 5JHUA 3CMMA 5DCFA 3HEFA 3G1LA 3B7TA 4N0BA 1BBYA 1QPIA 4Z2YA 3L7WA 3CCRI 2J5OA 2F5FA 4PW4A 1LEAA 2DQ6A 1U2WA 2DMQA 1YHQI 1Q0HA 1N75A 3C2BA 3IV5A 2FEZA 5GAEJ 3SEQA 1BW6A 3NRVA 3F6VA 1FOKA 4LK0F 2JA8J 3U9WA 3K2AA 4BJ5C 2XC7A 1YW9A 4ASNA 5KHDA 4M3BA 5C3EJ 2ICWG 4LUPA 1J2XA 3Q9SA 2ADUA 3DTEA 3BT9A 1S3JA 4AVZA 2LYCA 4HF0A 5D5WB 4Z6YA 2O61A 2R7SA 1TQMA 1BIBA 2X48A 2R7DA 1R00A 3E5QA 4BEHB 3HOTA 1XGSA 2EZHA 1CGPA 2A5WA 4ZYGA 1XMXA 2MFZA 2DT7B 1D8KA 3P5JA 3BG9A 3J81K 3ONQA 1J0RA 4HX4A 1WJDA 4WXHA 4EGYA 3MKZA 3C3WA 1OCTC 5ICCA 5LHGA 4CGZA 1VQLI 3CZGA 2ESHA 1X3ZB 2XF6A 4H0EA 5D5UB 3CHPA 2F48A 1RIOH 5E3OA 4XRSA 3HM5A 2YPRA 4XR6A 1JKRC 1LFBA 3K4BA 4XOTA 4J01A 1BIAA 1Y1VJ 2OPTA 2ZB9A 4L9TA 4XRMA 1YE9A 1JG9A 3R0IA 2JRMA 2VOOA 4QUOA 2R3SA 3BTCA 4P5OA 3V7SA 2RQQA 1R9TJ 3DTKA 3K69A 3OYAA 2RJIA 4MQVA 1IN5A 5ICFA 1OCZH 1MMDA 1ZYRF 1HCRA 2EA2A 1RKTA 3HBLA 3S1MJ 3P9KA 1QO0D 4E6KG 2Z9OA 1BJAA 1USSA 2HZDA 3ECOA 3EQLF 3H0DA 2FX0A 1FSEA 4HX7A 1JJ6C 2NVTJ 2FQ3A 4RM3A 1LUJB 1XDSA 2RC4A 3K2ZA 5HLTA 2A05A 2ZJRF 2CQKA 4WXDA 4HSTA 2KIFA 1OR7A 2BW3A 5FD6A 4ZX3A 5AIPA 2K9QA 1SAUA 3HHHA 1Z3YA 2O6GE 5D8LB 2R7VA 2IT0A 3WTZA 5AENA 2COMA 1R1UA 2ZXHA 3MQ0A 4OU0A 3HTSB 2KIQA 3NWTA 4MTDA 3B2PA 1NK2P 2VBWA 3R6SA 1ZTRA 1NTCA 2K27A 4M9ZA 4DYQA 4OIPF 2L4AA 1IO2A 2MSYA 3I59B 4RB2C 2BVLA 2XQ0A 5CYVA 2ECCA 3WTWC 2FXAA 2ESNA 3IUOA 3V4GA 2OZ6A 4FT8A 1YRNA 3FKJA 3MKWB 1MVYA 4XN4A 3CJQB 2VJ5A 3LMMA 2IAIA 1YS7A 2BY3A 1JTYA 3WTXC 3U9GA 3M1CA 1HOMA 2JUCA 1FC3A 4ITVA 2DA6A 1OYWA 5JMWA 4XKWA 1JT6A 3G73A 1YFHA 1SC5A 2JSPA 4YEJA 4BJ6C 1B6AA 1TWAJ 1SANA 2VL8A 4AIHA 1Q0QA 4ZQTA 1EH8A 4I2OA 1B8IA 1XDUA 4A5MA 1V55H 5IT9K 4C3HJ 5IT9Z 1X2NA 3CD6I 3TEDA 3DLAA 2E7XA 1E3HA 3FMSA 5B5EC 3LQQA 4CSWA 5HDKA 1U5TC 5EG0A 1V5EA 3HRSA 3RZOJ 2OU2A 4NDLA 2VONA 1I3AA 3D5LA 2ACJA 4RGRA 2ZKZA 2HDCA 1VQ9I 4KYWA 1I27A 1XMAA 1I6HJ 2FF4A 2QGUA 2L54A 2LF8A 2K3FA 4I02A 3RSNA 2M2EA 1T1RA 4DBRA 3I53A 4L0YB 4UUTA 3ZCOA 4HNUA 4CHUA 4BBSJ 3KIOA 4AUXA 1MBFA 3QU3A 2GXAA 1DP3A 5ERIA 4FCYA 1JJ8C 3I55I 2FMYA 1KA8A 3G1OA 1ODDA 1B9MA 3F72A 4F92B 2XGEA 3BQYA 1MGTA 1P7IA 4P1WA 1VQ4I 4YIFA 2AQFA 3P9IA 2HVRA 3C2HA 4A3MJ 4ZDOA 2JCYA 2Z5UA 1BJZA 1ZRDA 2VBXA 1LE8B 4ETSA 3HHGA 3LAJA 3DFGA 3ZQQA 1UHSA 2EFQA 4BL0B 3ASOH 1G3SA 2TRTA 4IHYA 3E1SA 3H1CA 1CF7A 1E0EA 2QQ8A 1X4OA 3LA2A 5J6XA 4KMUX 1DQUA 2DMNA 3IAS2 5M3MJ 4W1UA 5L3EA 2VASA 4X6AJ 2VN2A 2W57A 3PFIA 2YX7A 4PJNA 5EYRA 3SEZA 4B09A 3DPLC 2LY9A 3OYKA 5D5XB 1CF7B 3BJAA 5D6EA 3L2UA 2PUSA 5LEKA 3HRUA 4MHGA 4CZCA 1XGMA 2DOEA 2PMHA 1WZ2A 3CQZJ 4UB8C 1BR2A 4OOEA 1R1TA 1SFXA 2M34A 4MLOA 5K5QA 5CJ9A 2EIKH 3B6CA 2QJ1A 4ESFA 2HPTA 3DPUA 3CHSA 4ZDLA 2HPIA 4E70A 3L2CA 1WQ2A 4UV9A 3FHZA 3CLQA 5DYFA 3OYJA 2A5YB 4RMNA 3TOAA 3F8NA 1YI2I 3QYEA 2E2JJ 2R59A 4CYDA 2JA2A 4ZYHA 5EV7A 1WWXA 1JKOC 3PUUA 3L9FA 2DI3A 2Y0SN 3TDZC 3B34A 1SFKA 2Z3YA 4C2TA 1Z0XA 2VUMJ 1ULYA 1A36A 2O7OA 2CQQA 3W2VA 2VBYA 3JRDA 4Q4EA 5JBIA 3KEOA 3IHUA 1MDMB 2MGQA 2F5VA 4YIRX 3OSFA 3BZKA 2P7CB 4A03A 1YJ9I 5EEHA 4ZJZA 5JHFA 2C6YA 1R5GA 3FXLA 3J80K 3DEEA 3MWMA 2FOWA 4PK4A 3FUMA 4HQEA 4BDYA 1E2XA 1XGOA 2QKMB 2UUZA 5K7HA 3RKWA 4Y7NJ 2K02A 3FU3A 2X51A 1LQ1A 3OYCA 2E1MC 2JD0A 1VZ0A 2AXLA 4A2UA 1S8NA 4A3BJ 2CYYA 2G0EA 1VQ5I 1ZQ3P 3BQZA 5FROA 4YG2F 1FYMA 4JX6A 1W4MA 3JSZA 4JK1X 4RLFA 5BPIA 3V42A 2K86A 4LB5A 2M4KA 1IF1A 3T0YA 5F0CA 1T2KA 1GHCA 2PI0A 2TCTA 1XSXA 3P9CA 3GLLA 4XMVA 1BW5A 1ON1A 4EM0B 5IYDJ 1IZ1A 2X4HA 2XAGA 1D3YA 2R7OA 2IW5A 4QWQA 5JVGF 3TP0A 4E7JA 2GIZA 3HOYJ 3MEXA 3B73A 3TBIA 4WWCA 1IV8A 3L2VA 3QAHA 5EJCA 4Y15A 4FTHA 3FWEA 4BE0A 3FTXA 1SD4A 2JVHA 3H9GA 5FLXZ 1ITYA 4WK8F 3BJOA 1IN6A 1W5TA 1GXPA 3A02A 3GZ5A 3M8EA 3AL0C 2BW3B 2MH2A 2IPQX 3ERMA 4V19K 3FTSA 2Z1DA 1H9TA 2DT5A 4Y6RA 1LDDA 2DFIA 4BXXJ 2O9LA 4ZX4A 1SC7A 3G2BA 3GFIA 3CIAA 1DPRA 1I5ZA 1P4WA 3GTJJ 3COAC 5E3LA 2ZC2A 1ZRCA 3CC7I 4EJTA 2JPCA 3BG3A 1R71A 3GF2A 4KFCA 3HGGA 2FU4A 2BYVE 3T8RA 2R7WA 4XMXA 1IN4A 2HI3A 4MO7A 3OS1A 4RDUA 3OY9A 2FMLA 3OV8A 5C44J 2GA2A 3KFWX 4BKXA 3FUFA 4BXUA 3J80Z 1ZG1A 3E5UA 1D0XA 4LG0A 5HODA 4XSZF 5BS6A 3CZLA 4ZW7A 4BY7J 2XAQA 4D7MA 3D0SA 2X6WA 2E2IJ 1EH7A 3F3XA 4MIMA 3RCOA 3CTAA 1YO5C 4P9FA 3S1NJ 1X1AA 1HC8A 3P7NA 1B4AA 2E5ZA 2HOTA 2HYFA 3FTWA 1YS6A 5DUKA 4PU2A 4U87A 2L9RA 1J7KA 4O3MA 3BLYA 1TQPA 4JYKA 4G12A 1SMYF 2GZWA 2LVSA 3PQKA 2ISZA 1B9NA 1FZPB 3QP5A 4BYYA 4RB1A 1E3OC 2BE5F 2VJ4A 2M8EA 1WSUA 3CZ6A 3R0JA 5JFRA 2Z33A 3FTVA 3WODF 2L0KA 2A61A 4R7LA 3QPTA 1HQCA 1VNDA 2GOXB 2P8TA 2QVOA 3LL7A 3EBGA 4LGWA 1DGWY 1UG2A 2IJLA 1UZCA 3QP6A 3LSPA 3ZPLA 3OYNA 3K1NA 1Z21A 4HSRA 4OMZA 5CQEA 3LSIA 4NNJA 4LLGF 3L2WA 5B3SH 2WWYA 1REPC 3A06A 2L4MA 4EJVA 4C2UA 3E97A 4XN7A 5ILVA 1FOYA 2XAUA 3REOA 3GTGJ 4P55A 3U21A 3IKTA 2I10A 4MGRA 5H6QA 4D1QA 1X1DA 4I0BA 4BQQA 2A6HF 3GTMJ 2LLKA 2Y31A 1QHGA 1Z6TA 5KK1A 3RTRA 2WZFA 5HDGA 3GTPJ 5DDGA 2EFPA 2IS1A 4MFEA 4FISA 1XMKA 3OOUA 3ZMUA 2R7UA 5E8GA 4B44A 1LE8A 2FNPA 3DWLE 1S7EA 3CDLA 4XMWA 4ZW8A 4UY8I 5F27A 4PJLA 3F8FA 1QPMA 4ZQEA 2VT3A 3OYMA 5J1UA 1H89C 4RGXA 2R5ZB 3M9AA 3WTSC 3KLOA 3MVPA 3JSPA 4HBLA 1KQ0A 2F4MB 1AWCA 2QLZA 5L3GA 4AM3A 4LIUA 1RI7A 1T6SA 5EZGA 1QRYA 1R6RA 2L5QA 4UHTA 2EB7A 1QA6A 2VKVA 3CXBA 4Y67A 3DBLB 4XO5A 5B1AH 1OKRA 1R49A 2F5DA 4HPQA 3RKXA 5TGTA 4F7ZA 1W7PD 1RC9A 1J59A 2OQRA 4A3LJ 3VEPA 2OAZA 2X9DA 3ZOBA 3GO5A 4IRHA 1K6OA 3LSMA 5E1ZB 3IRRA 1MZBA 1ZK8A 2DBBA 1T8IA 3B3BA 3OMYA 2ELHA 1JKPC 2HOAA 3AG2H 3E6MA 5DUIA 3PJRA 3CC2I 5H2FC 1D0ZA 4XOPA 2FFLA 3HL2A 2MLGA 2QENA 4XLHA 5E1XA 4IO9F 1T08B 4DYRA 3IRQA 2H8RA 2X1EA 3BDDA 2XASA 2OCEA 3IC7A 5EEGA 4HV6A 4IOAF 2JUGA 3ZN0A 4BHPA 2VLAA 2RQPA 3ZQIA 5M5YJ 2DQLA 4GRIA 4QPEA 3MN2A 4R8HA 2VQHA 2HR3A 2XAFA 4E7ZA 1U5TA 5H6RA 3S15J 4FX0A 1D1CA 1XTAA 3WHCA 2QQ9A 2CV2A 2CQXA 3F6OA 4ENKA 4L9JA 4KN4X 2OCCH 4OINF 1K61A 1IJWC 2M3AA 2W85A 3JTGA 2KDOA 4HNTA 1LFUP 1MIJA 2HKOA 4CCNA 3U2RA 1A6IA 5DD8A 3R0AA 2A6TA 5DEQA 4ARFA 2I5UA 5FKKA 4CICA 2M7BA 1IUYA 1R1VA 4IHWA 2Y1GA 2KLOA 3UEQA 1W36D 3CMAI 2BOLA 3GTLJ 3K4MA 1T33A 4FCAA 2WY7Q 4BE1A 3ZMVA 3RI4A 2F5EA 3Q3SA 5IOZA 4WF2A 2AQEA 2XAJA 4N9IA 4A93J 4LK1F 3JRBA 1WJAA 2DMTA 3FUJA 3F8MA 1L3LA 3FTUA 4N9HA 2LRDA 2C5ZA 2D1HA 3BROA 3LA3A 5BNGA 2HFHA 2MBFA 1TW3A 1FIAA 5H20A 5FB2A 2GXGA 3FUEA 4YFKF 2JJ7A 4MEXF 2DN0A 2E36A 1ZR2A 4XMTA 3CESA 1GLNA 4KN7X 3SDBA 3T5XA 2XPVA 1N25A 3MMYB 4B47A 3U1KA 3ZMSA 3FUHA 2WV1A 3WE2A 2VC0A 4YRVA 3FZVA 1ONNA 1GT0C 1HKSA 3FDYA 2EILH 4EJUA 3HOXJ 1OCPA 3K70C 1SVMA 1FTZA 1LVKA 1P4XA 3CP8A 2W00A 4LB6B 4E7IA 3SHFA 2LG4A 4MNUA 2K9NA 4AR8A 3GEZA 3HKZN 4M6XA 1P4AA 1QHHD 2BEOA 4L5JA 4ZH4F 1R5ID 3AG3H 3MAJA 2B7EA 3KYLA 4QPQA 2JMWA 4IPAA 1YRNB 5CKTA 2CUFA 1R36A 2G7UA 1UCRA 3ASNH 3W6KB 1YLFA 3G3ZA 2FQ4A 5JAZA 1BM9A 2EH3A 1AKHA 2CW0F 4J3BA 3ZHYA 4B48A 2DODA 3R60A 2E34A 2O5RA 2WB1A 5JMPA 4HRIA 3VYTB 3J7YJ 1MW2A 2D5VA 2RN7A 4OOIA 4X0GA 2L7MP 3I4MJ 3TDUC 1MMSA 3EUHA 4KT5C 1W0TA 4NC7A 1F5TA 5EZHA 2ZXIA 3CMEI 4A3CJ 3CCSI 3SXYA 1MDMA 2O7GA 4I7HA 4ENJA 2WAEA 3FUNA 1I1GA 3FXQA 3OYBA 1QU3A 1O7FA 4QLCU 1FOXA 3ERED 4CZZA 3VYSB 2EIJH 3KEYA 1OYIA 2ZNZA 1U6GA 4PGGA 1JHHA 1BI3A 3HJEA 3VDXA 4ON0A 1LEBA 4XMYA 3HW2A 3E5XA 4XN9A 1OQYA 2EZLA 3OWTA 1RESA 2EWNA 3AG1H 2LKXA 2K4BA 3KEDA 3WGGA 1T0FA 2L7KA 1SVLA 4GXOA 3PQJA 4UXNA 4I6ZA 3DBHB 4N4NB 3OYFA 4EVIA 3CC4I 2A6EF 3C1DA 1HF0A 3S1QJ 4HDVA 2WY8Q 1U3EM 1K78B 3AKZA 1ZR4A 1GV5A 1NG7A 2PBIA 1YTYA 2ZXWH 4WCGA 3WG7H 2OUMA 2M45A 4ESJA 4OMYA 2JK3A 4I98B 1TBXA 1CQTA 3VB2A 4D5FA 1ZN2A 3Q44A 1W1WE 4G94A 3WG9A 3GCMA 4ZW3A 3DBRB 2VXDA 5KAIC 3ZQGA 5FLMJ 2R0QC 3FKIJ 1FSHA 3JRGA 2KT0A 1AKHB 2IS6A 1HW1A 2Q0OA 4OOFA 1D1AA 2KJCA 3FXOA 2JZYA 2KP6A 4FE7A 2QBYA 1KONA 1I1SA 3J7ZI 1N77A 3JRAA 2VPLA 1R0KA 5EF6A 3FULA 2PEXA 3H5AA 4FLSA 5D4SA 3RASA 2NYXA 4DPRA 3HRMA 1PP8F 3F8CA 4BQNA 1A35A 1WH5A 3I9V2 2GM4A 2XF7A 2XKPA 3BWGA 2Y0MA 3GZ6A 1MNEA 1P9QC 3CHRA 1BI1A 3FF5A 2DA5A 5J8CA 5IY5H 2E35A 2Y48A 1VQNI 3SZGA 4HV5A 1XD7A 2AO9A 2BHYA 4EV0A 3CHQA 4XN2A 2LC2A 3BR0A 3K4LA 5DD4A 2EV5A 2NVUB 3HRTA 4Y3OA 2A7OA 3A2KA 3FU5A 4BS9A 2XUBA 3FHNA 2RNJA 2IGKA 5J8FA 2P4WA 3A0BC 1S5LC 1I6XA 3FM3A 3N97A 1D5YA 5TJJA 3SZTA 1JI8A 3MZ8A 3HTUA 2A68F 3C2GA 3G71I 4NHJA 1W7PA 4F55A 4KISA 1RNLA 4E7LA 1JTXA 2V7FA 1MJAA 2CG4A 3LQRA 3KLNA 2LREA 2QSHX 3AUAA 4LFUA 4F93B 1P92A 3BZCA 4DYCA 1A31A 1MH4A 2E7WA 3BPVA 4JX5A 1VF9A 1YX3A 2Y0SA 2P7VB 4E7KA 5F04A 1G59A 5E17F 5FLXK 1ZARA 4H4KC 2CWEA 3VPRA 2BY0A 1K4SA 2P5KA 3HYIA 1U5TB 3JW4A 4U0YA 1R0LA 3CJTB 4CYCA 2DDBA 3JCUC 3Q0WA 4EATA 1WJCA 2MC3A 2QYOA 4ZC3A 3M4OJ 1JUPA 3WTUC 3HOUJ 2VJJA 5TISC 1MH3A 3E6DA 1RKWA 5FFZA 4AYSA 1S7OA 2JA6J 2NS8A 1T98A 1S7AA 2JV7A 2JN6A 3F0CA 3KP5A 4XO3A 4BUPA 4GO1A 4KNYA 1UB9A 4Y17A 3G1MA 1HS6A 1EF4A 2M1BA 2MAPA 3S8PA 1WH7A 2QF7A 5IPAA 2E60A 4EQQA 2X6OA 1YOVB 2ZSIB 1TQIA 2V1XA 2H1LA 3JAMK 4DZPA 1K6YA 2COBA 4GDFA 4ZZDA 3T1BA 2Q2EA 2QEXI 4ENMA 2I8DA 2VQCA 1WJ5A 3EBHA 2XGCA 5AIQA 3FISA 1ZELA 2X0LA 4LD5A 1PJRA 2PL5A 3VYUB 2VQGA 5FKNA 3TL4X 2WAFA 3PFYA 2DK8A 5IYBJ 1XC5A 2ZMEB 1MBGA 4UUVA 4R5TA 1M1EB 5JVTA 2BV6A 1IN8A 4A6DA 3WU1B 4HF2A 1IRXA 1OYYA 3IH4A 2NS0A 4ZX6A 3OIQA 1WCMJ 1Z77A 3HPGA 1FWZA 2LBFA 1AA7A 3LSHA 3CCVI 1HSJA 5LRSA 3GUDA 3LOCA 4B1RA 2JSCA 2DQMA 1STZA 3BCBA 3E0JB 2Z99A 1Y1WJ 2O8XA 3V8LA 1BI0A 3J7AO 2J5PA 2BGCA 5J1YA 2EK5A 2GIVA 3ZQ7A 4GCVA 3LA7A 5BPDA 3EBIA 3QYFA 4AD9A 4N4OB 4B4CA 2M87A 4XORA 2WPGA 3RQ4A 4AYBN 3C18A 1P2FA 4CDGA 2IBDA 5HLIA 5D6FA 1VQ8I 1XCBA 2LOOA 1SAXA 4EMSA 2DA4A 3HGYA 2ETHA 2BXZA 4ENNA 2K9SA 3I59A 4DJAA 3KP6A 2ISYA 3I3LA 1FYLA 4CXFA 3GX4X 2JA7J 1XS9A 3OR1C 4PSXA 5JLXA 3FM5A 2EGHA 3DKYA 2OD5A 4NQWB 5D5VB 3GBGA 2VQLA 3ESWB 3ZMZA 3F23A 2Y69H 4TV7A 1FPQA 2DFFA 2XGXA 2NAZA 4FQGA 2Z16A 4AIKA 4A12A 5FRMA 3IAM2 5IT3A 2IA2A 2CQ7A 3DF8A 1UHWA 5J3LA 4BQAA 1G2HA 2OJED 5FD5A 3TO9A 3QPSA 2P6SA 4A0YA 4ZTJA 1VI0A 2OA4A 3UR3C 4DIQA 3D5RC 1Z7LA 2DW4A 4I09A 1IV6A 3B37A 1VFCA 3CUQA 5M5XJ 1OCCH 3CO6C 2CV0A 1JXSA 2C82A 4IHTA 2HYGD 1ERDA 2Q8KA 1T56A 4HYEA 2L2OA 4FASD 1D5VA 5E8IA 1G5AA 1OLTA 4XNAA 5K5OA 4KP7A 5E20A 5J4VA 3OL3A 5CLSA 1MMAA 4X2UA 1J5YA 2CUZA 5FKLA 1O3RA 2N8GA 3GFLA 2VE9A 3KP2A 1X3WB 3KZZA 2FJ1A 2GWRA 1WVRA 3QWLA 4II2A 1ZH5A 2LY1A 3W6JB 3FK6A 2ZXGA 3I4PA 2WZGA 5K7FA 1F36A 2Y75A 3BOQA 1RETA 5IYCJ 2NXNB 3FHEA 4MTEA 3T8TA 3GTQJ 3NEUA 5F1JA 2V1UA 1H9GA 1Z05A 2HEOA 5LD2C 4L5IA 2XSDC 3L1PA 3RYRA 2RV8A 2EPFA 4CCJA 5HOOA 2DTZA 3I58A 4UUSB 1HBXG 1ACIA 3HOZJ 1A6QA 4IHSA 3D5SC 2R5YB 1RZ4A 3L2RA 1HKTA 2BY1A 4W97A 4XO4A 1B72B 3ZN1A 3DPTA 1RR8C 1EA3A 3EUAA 5TRDA 3KZIC 1Z6RA 5GTIC 2D45A 2XGDA 3Q43A 3K9TA 2DFEA 2KIUA 2V9PA 4RA2A 4R1HA 3K4KA 2BXYA 5LRRA 2B61A 2EV6A 2L9SA 4ZW5A 1WPKA 3K0LA 1MJBA 2VJIA 1XSVA 3RC3A 2HXOA 2HDDA 3DEWA 1X1PA 3HZJA 1J75A 2O0YA 3KPHA 4IXAA 2V1NA 3DEUA 4GAAA 1W5SA 1WGXA 2V26A 3GW2A 2DO7A 2IGNA 3RPUD 1QGPA 1XSDA 4I0AA 2OTLI 1L0OC 4MFDA 1Y56A 3D1NI 4KMFA 1F9NA 2R7TA 2E1OA 3H36A 5EEAA 3ECHA 3WGHA 2GTQA 2HKXA 2HWVA 1G3WA 3HSRA 1GVJA 1IRZA 5DYMA 3SFIA 2Y9ZA 2DYSH 1X3WA 2H1KA 4CO8A 1O3QA 3QYBA 2HGCA 3LSRA 1XGNA 3S2HJ 1WKMA 1O7LA 3Q9VA 1H8AC 1ZRFA 4XKVA 5LHHA 2VE8A 3CCQI 4C3IJ 1EV7A 2Y1CA 4JQFA 1T38A 3N4MA 2F4IA 3E6BA 5EG0B 1T0FC 4L9VA 1HW2A 2LR8A 4K5PA 5DM6F 1H19A 4EM2A 2AXTC 4M9SA 5E1WA 1NK3P 3ANNA 1HW5A 4G9YA 1VQ6I 2UV1A 1GUUA 2IVMA 2DPUA 3CUOA 3L2QA 3DU6A 1TNTA 2XPZA 1RUNA 2TDXA 4HAMA 4DZJA 2R7ZJ 1F43A 1JUSA 1NHAA 2E19A 1UG0A 3BR1A 1O57A 1S6LA 5B1BH 4BNCA 1ZG5A 3JSOA 2HOSA 4NC6A 1X1BA 4BY1J 3ZQHA 4KT6A 2BBYA 4XLAA 1Z67A 3ANLA 2PJPA 2NOGA 3JRFA 4BE2A 1S9HA 4KIBA 3FX3A 3RPQA 1V3FA 2FNAA 2PG4A 2NVXJ 5F64A 2MD5A 3L09A 4G6DA 2STWA 5DS9A 4RGSA 4R5VA 2AS5F 5GP9A 3WQSB 2X6YA 4ZYEA 2P6TA 4U7DA 3S16J 2GOMA 2ZO4A 4MS6A 4A3JJ 1IRGA 1K83J 5EDNA 4A5NA 3I4NJ 5JO0A 3ZHXA 2F2EA 5KCMA 2QQBA 2GA1A 2ZBKA 2ELKA 3IH3A 5LHIA 1MSFC 2EFOA 1KQ9A 1Q1HA 4UVBA 3MKYB 4KA4A 3EYYA 5BPPA 6PAXA 1Y8RB 2Y1FA 2QKLB 3PUFA 4M3GA 3OYDA 2KISA 5ICGA 5ILUA 3G6EI 4BQOA 2ID3A 4A6EA 2XPWA 4IOCF 4CCMA 5HNHA 4M3FA 5BQTA 4IHVA 5L3DA 5GPAA 1MBHA 3EUKL 2ZSHB 1TP4A 2HDWA 4EM1A 3FK7A 5J4YA 2MC4A 4BHCA 2KMUA 1E17A 3O6BB 2KQRA 3FUDA 3PO2J 3KYDB 3QODA 2W82A 3DU5A 1SD6A 2CFOA 1DUXC 4MKTA 2E5NA 2CSOA 1UHMA 3HG9A 2XROA 4ZW6A 2HZTA 4PFPA 3WU2C 3RDIA 1DU0A 4I99C 5HDNA 1GXQA 1FT9A 2H8WA 1HKQA 1TLHB 1ZREA 2YUSA 4G6QA 1KU2A 1FIPA 1X3ZA 2V9VA 3A0HC 3V8KA 1TWGJ 4G7HF 3HSFA 1YG2A 1YW7A 4ZQGA 1APLC 5FJ8J 1BOAA 2HXIA 2P81A 4A3GJ 3DKXA 1FEXA 4X1EA 2Y2ZA 1B8IB 2XRNA 2IA0A 2R72A 2M9HA 2JD2A 1YW8A 1BA5A 3CCYA 5ILSA 3LSJA 3LSKA 4LG3A 5JR3A 3A14A 2H09A 2EIMH 1HLVA 2WAQN 4GYIA 2FBIA 1FTTA 4CCOA 1OJLA 1TL8A 2Y9YA 2GXBA 4RLQA 2PMZA 4ZYDA 4CYCB 4ZQFA 1FX7A 2X85A 1BL0A 1U8RA 1U78A 2DA2A 2HPOA 1O4XA 5FKOA 2Q1ZB 1XCVA 4MEYF 3M8JA 1ETKA 3ABMH 2RREA 4XICA 3JR9A 4XIDA 3OYGA 1AOYA 1V54H 4YFNF 2VPRA 3WTYC 1ZLKA 3Q0VA 4G6TB 2CGPA 4JNDA 2CO5A 1BR1A 1JGSA 3VVLA 4BJTA 3ZXSA 3EDPA 1TT5B 3SJMA 2FSWA 2JTVA 2KRFA 2QUFA 5HLGA 2LF7A 4R79A 3OIOA 3BR5A 1FBQA 1MW7A 4PJJA 2CFXA 1SFOJ 1LDKB 1OFCX 2EJRA 1MNMC 2DQRA 3LFUA 1EH6A 3QPHA 1IUFA 1YJWI 1USTA 2KPMA 5E79C 3IP4B 5BMZA 3KZYA 5IP9J 3FXUA 2Y30A 5A2QK 2RDPA 4XLFA 4AR1A 3FMRA 4M71A 3VWBA 2ME0A 5GTHC 4HA8A 1ZLJA 1YQAA 5IP7J 4XN1A 3CCMI 3ZGKA 4ZTFA 2XV4S 4JOMA 4S04A 2QSGX 4FE4A 2UXNA 2MD0A 3AFHA 2KZGA 2MAOA 3OYEA 4D5CA 3KP7A 3AG4H 4EEFG 1YJNI 2PMUA 3FBIB 2MABA 5F6FA 1OPCA 3PL8A 3R61A 1X1CA 5JNLA 3NAUA 1XX5A 4XN0A 5CVRA 1ONOA 1SEUA 1JT0A 2JA5J 1SD5A 1E3PA 3RIRA 5GPCA 2A07F 1FP1D 2CRGA 3DKWA 1TWHJ 3CUQC 3HUGB 2XB0X 1ZGWA 1WJBA 5DTDA 2IS2A 3QPLA 3HXLA 4WX9A 4DQ2A 3F8BA 1TC3C 2DTRA 1B1BA 4G7ZF 3ABKH 2R7FA 5FFXA 4FETA 2R7XA 3LSTA 1LKXA 1UJ8A 4OWRB 1W0UA 3CCEI 2RNGA 3E6CC 1V5FA 5DULA 2E1MB 2FUG2 4QPOA 4BEHA 1IG7A 3BTJA 1LVAA 4RAGA 3GTKJ 3A01B 4XLEA 3FU0A 2DPDA 3KYCB 3O8HA 5LGUA 2IXSA 3BTIA 2V6EA 2VXZA 2XVCA 1MBEA 3EYIA 1IC8A 3TP3A 2VT2A 1G6NA 2W25A 2NVQJ 4A3KJ 5B66C 1EJ9A 4HG2A 4BACA 1ZG3A 3LAPA 2LMDA 4Q4IA 1A5JA 1KU9A 4A3IJ 2G7HA 3N05A 2VBZA 1T95A 1X4PA 2R5YA 2VOPA 3BR2A 4BAYA 1Q0LA 5FLVA 1IDYA 2L7FP 1S72I 3FH8A 5GAGJ 2JCXA 3HUGA 4EGZA 5C4JJ 1BC8C 4KDPA 4RVBA 1ETOA 3S2DJ 1WI3A 1B59A 4PJ0C 1ETYA 2MH9A 2GLOA 2HVSA 2PLYA 2K85A 1OR7C 2MW8A 4IQ4A 1K7AA 4HEA2 5DV5A 1ZGAA 1MKMA 5GADJ 5IOYA 1HA8A 4RCVA 3PNYA 4LG0B 2K9MA 1TZLA 2KKOA 1Y8QB 1T39A 2ZMEA 1UMQA 4QMEA 2DU9A 3NARA 1AU7A 2R93J 1MMGA 3CUQB 1XN7A 3NQOA 2K5CA 2DMUA 2L01A 1MW0A 3VOEA 1TWFJ 4PUSA 5J47A 3C7JA 3VVMA 1R22A 4M74A 2CW8A 2HS5A 2LDUA 2VC1A 3CCUI 3WTVC 3TW6A 4Y6SA 4XKCA 4RSYA 2L3DA 1MMNA 5DCMA 3S14J 3RC8A 3AU9A 4AICA 3S3MA 5E3NA 4KICA 3B7UX 4CCKA 2HTJA 2KHMA 4WXCA 4FX4A 1TWCJ 1HDPA 4II3A 4HX8A 4XNBA 4PZJA 3FIWA 5F08A 5E3MA 1D0YA 4E7HA 1SG7A 1ETQA 3G4SI 1POGA 2X1CA 4HQMA 3DCFA 1FJLA 3PSFA 1P7JA 4K5MA 3M7GA 1MD0A 4Y6PA 1Y0NA 4ANJA 4YELA 1I3QJ 4NB5A 4YFXF 1IW7F 4LJZF 4CH7A 5FKMA 4OIQF 2EV0A 1DGRM 2VIXA 4J00A 4IEJA 4NQWA 3IIEA 2ME6A 1AHDP 1DP7P 1B72A 1NG6A 3H3VK 1FBUA 1QVTA 1R23A 3OR2C 2DT6A 2STTA 1W5CC 4UVAA 3ZQFA 5EGOB 2L9VA 2YR2A 3S32A 3H0GJ 1FNNA 1FP2A 2JD1A 4ZN6A 3FH5A 1K4TA 1LNWA 1MW1A 2PJRB 1QZYA 1O3SA 3WQRA 1Z3XA 2CQNA 2HVQA 1GV2A 2JQ7A 2PMZN 2R7RA 2EFNA 3GWZA 2MG4A 1WRJA 4GYGA 2KDZA 1U0JA 3SFZA 3S2WA 5HS8A 5J1RA 3UNGC 3HSEA 2JCVA 4XMZA 3EETA 5LGTA 1PYVA 3LWFA 3H9JA 1KGSA 1Z1DA 3CMYA 4HLYA 1JHFA 2VKEA 1G3TA 5FRNA 3PIPF 3FXJA 2K9LA 3QQAA 4CCLA 2O03A 1H0MA 1ONPA 2HYJA 2NOJB 3M8FA 2DA7A 2NNYA 1TTYA 2YU3A 2LFBA 3V7CA 3DQVC 3UERA 4M73A 1IN7A 4HDUA 2VODA 2WA0A 3JRIA 2V1DA 4IJAA 5FO5A 4IRGA 3KX2A 4JP0A 2XF5A 1JVSA 1QBJA 2K4JA 4GAEA 3GVAA 4IX7A 2CMPA 5CVJA 1X3UA 4AIDA 3S3OA 2OBPA 2MA3A 1V5GA 2Y1EA 1R4MB 2FOKA 3DLLF 4F91B 4ESBA 1NH3A 5BOXA 2CU7A 2DDAA 3WQQA 5IP6A 1XG1A 1VQOI 1TT0A 2VB6A 3K70D 2NNNA 3RKQA 4G8XA 5KNLA 2UZKA 3OS2A 2L02A 2XAHA 3H5RA 5DCMB 4PFOA 1HSTA 2NRAC 4K5OA 4BDZA 3K4NA 2B9SA 3S17J 4ZZLA 2VKDA 4PCQA 4PDKA 1VQPI 1YIOA 3W6VA 2K40A 2F4OB 3HOWJ 1K78A 2KL4A 3CDHA 3A4CA 1UELB 5CQGA 3S93A 2B63J 3V8JA 1HDDC 2CH0A 5DM7F 3ELKA 2ZJ2A 3MZYA 3PNVA 3WE3A 3DXJF 3CLOA 4XQFA 1XPXA 3ZMTA 2QM3A 2KFDA 2M0CA 2XB5A 5K7ZA 1PUFB 2E71A 1OISA 4M6VA 1U9NA 2PN6A 1ZS2A 4PJMA 4Q47A 3MCZA 3E7LA 5F0FA 3BG6A 2LKPA 4Q4ZF 1DDNA 4QHPA 5CVVA 1RR7A 3JREA 1WI9A 1RUOA 1SD7A 3UCQA 2R5ZA 4ZX5A 3EUHC 5GAHJ 2PGGA 3I5UA 5KAFC 3WTTC 1QZZA 4F3QA 3KP3A 2PJRA 2CS3A 3H92A 3H3ZA 1JUMA 3TW7A 3BCAA 2QA4I 3FUKA 3QOEA 4IVNA 1EKEA 2PQ8A 3QOPA 4DGWB 2W48A 1ENHA 1ONVA 1X19A 1SQMA 2LBFB 2EA4A 1I50J 2W24A 4XBFA 1W7PB 3ZQCA 4E7SA 1FY7A 1V4RA 1ZKGA 5LEJA 4U88A 3ANMA 1QVUA 3OL4A 3IWFA 2XPUA 3ZQLA 4BH9A 5DLLA 3FTYA 4HZFA 3B2XA 3BTLA 4M3EA 3O8GA 4IRIA 5KVRA 2Z2SB 4XRSG 1BR4A 5C4XJ 4F52A 4XM3A 2ID6A 5HNFA 4Q5SF 3FU6A 1TNSA 2RAEA 4V2GA 3HOSA 2IS4A 2V4JC 4PVBA 4CUGA 3OYLA 2ELJA 3QU6A 1ORKA 1ETWA 3H35A 2ZMEC 3HKZA 3MFKA 2QBYB 1PVEA 3RYPA 1MW3A 2H6CA 2BZTA 1QQIA 3PUBA 5F1RA 3TO6A 2DYRH 4C9YA 3EPZA 4DNCA 2M4GA 2E2HJ 2CJJA 1KQ8A 4ZQHA 3PSIA 2W4SA 3A03A 4LIVA 3TGNA 3M3YJ 1DU6A 3SYTA 1VTNC 3RZDJ 4BGDA 3K7AJ 2OC6A 9ANTA 3CCLI 5JC1A 2JRTA 2GAUA 3F9KA 3BR3A 3MD2A 1IXCA 3DP7A 3WHBA 1QZEA 3CCJI 2EZKA 2M7AA 2JT1A 2KJBA 2UXXA 3B7RL 3GYHX 1BC7C 1C0WA 2IRFG 2KZVA 3GZNB 3I0TA 3W3CA 3ZR8X 2EINH 2DAOA 2W1OA 2ZJPF 2ZJQF 1R7JA 2WB1N 4XMUA 2DLLA 2AHQA 2K3PA 3I54A 3TKYA 3BG7A 4P9UA 2ZFUA 2DK5A 4AYBA 3HB9A 4G7OF 4B3AA 3ABUA 2HTSA 2G9WA 5M3FJ 2LH9A 4RBOA 3PM1A 4D9JA 2P5VA 2FE3A 1GW6A 3GFMA 4RB0A 4FLRA 4QIWN 3PNTA 2EBIA 4UUSA 3KETA 1Z9CA 2W7NA 1WHUA 4EJOA 2LK2A 4KUMA 4Y13A 2IA1A 2HQAA 4RGUA 1H3LA 1LDJA 2ZFWA 2R4GA 1U8BA 5JLWA 3CO7C 4M6YA 1KU3A 3CJRB 1KZHA 1Z7UA 3HOVJ 2YSRA 3TO7A 4IZZA 1ZGJA 2M30A 5E18F 1O3TA 2WAQA 2M5WA 1D1BA 2X6XA 1IGNA 3B7SA 3ABLH 2OZUA 3A1YA 4QTRA 4CA0A 2OTJI 3ZI0A 4HLXA 3HDDA 4XL9A 5ED4A 2W84A 3LSGA 1OCRH 2FA5A 3MKLA 5L3BA 1IXRC 3KEQA 3K6GA 3A01A 3ZHZA 3FXKA 4AWXB 4V2FA 1D8JA 4HOBA 3GFJA 2OF7A 2NVYJ 1G3YA 3CP2A 3B6AA 4P96A 5JI6A 1S29A 1R4NB 2BHZA 2DA3A 5CVIA 4EJWA 3Q0UA 2DCEA 2H27A 3IWZA 2FD5A 4A69C 2F5CA 2R7QA 3K1PA 2XSJC 1SFEA 2EQRA 2O3FA 3FXRA 4IKFA 3DTIA 2QWWA 4OAZA 3QJXA 2PFBA 2KIMA 3AAFA 5CPRB 1JE8A 3BP8A 4LLNA 3JRCA 4RAZA 1MJ9A 4XN3A 1RRJA 1FYKA 2X1DA 1BOBA 1WJEA 2M0MA 2XIGA 1DPUA 4UV8A 3VFZA 1ZAOA 3H9QA 1J9IA 4AC0A 4MQ9F 4L0ZB 1SMTA 3GTOJ 3FBNB 3FXMA 3BC8A 4L9NA 1ETXA 3ABTA 2P5LC 3ZP5A 2XDVA 4XLNF 2HQNA 4XN5A 1VQKI 1F4KA 1H88C 2DMPA 3BZ6A 3ZMDA 4DW6A 1A04A 1SFUA 2E1CA 3ULQB
chains in the Genus database with same CATH topology
4L18B 3SZPA 2EFWA 3SQNA 3MZHA 2H6BA 4FLQA 1R58A 3O3KA 2ZCWA 4Q48A 3KP4A 2LSOA 2OQGA 3BPXA 3BY6A 5FWQA 2JPBA 2V79A 4O5VA 4M72A 1KYWA 4JBAA 3ISPA 1QNTA 3CJNA 2IP2A 4K2EA 3F21A 3F22A 3JTHA 3KCCA 4XRFA 4A0ZA 1BI2A 1PP7U 1FLIA 3WU0A 1Z91A 3ROUA 2WC2A 5ICEA 1R5HA 4M9XA 2UWMA 5A2QZ 4AIJA 2V6CA 4R5XA 2HQRA 4FHTA 1LB2A 3JT1A 4KIGA 2K7LA 3M1EA 2MLKA 3FTZA 4HW0A 1IXSB 5CVUA 5K1YA 1XB4A 3JAMZ 4OIOF 5HS7A 2R70A 2FBKA 5AONA 3DV8A 4GGGA 3U1DA 2QQAA 3TOBA 4RB3C 3CZEA 1JGIA 2HOEA 3RJPA 3RPUA 5D8KB 2A69F 4XN8A 3TQNA 1HXDA 1FBSA 3QRFF 2ZNYA 3FUIA 3FH7A 2A3SA 5HVQC 1BN5A 2XHKA 3CHOA 4UVCA 4LMYA 4HF1A 1KU7A 5FGMA 2B0LA 1F1ZA 4D0PA 1K79A 4FLOA 4IF4A 4K5NA 1TW2A 5L3FA 4I01A 3I64A 2FRHA 4UNOA 3T8VA 2QVWA 2RVCA 2YX4A 4AR9A 3H3UA 1RP3A 3Q5FA 3E3VA 2H94A 3OOPA 1G4DA 1ON2A 2E1NA 4S05A 2FBHA 3J81Z 1PUEE 3V7RA 1T1SA 2RKHA 5HLHA 4U7BA 3HIFA 4U0VA 3KE2A 1S46A 1P6RA 4O6JA 3WGIA 4A0XA 5LGNA 4KIFA 4OIRF 1Y0UA 4BHBA 2XPYA 4U0WA 3L00A 4RAYA 1K5HA 3B02A 5D4RA 5K5RA 3GLXA 1UFMA 1YYVA 2Y1DA 2ZXJA 1KYZA 2GQQA 5LLQA 2QZ8A 1ZHFA 2XKOA 3RKYA 1LJ9A 3IL2A 2RGVA 2D2WA 1PDNC 3CZKA 2WTEA 3O2PE 2D1VA 5L3CA 2LNBA 3GXOA 3I71A 4LLLA 3VODA 4RS8A 4XNDA 4XLPF 2VJ8A 3ML6A 3AU8A 4PGHA 1OMIA 3BJ6A 3FMQA 3IKVA 5LBQA 3LFKA 1IAWA 4K5LA 3K1MA 1IRFA 4YIIA 4L2LA 4QIRA 5HS9A 2WV0A 4AVPA 3R4KA 4XSXF 4B8XA 5JHUA 5DCFA 3B7TA 4N0BA 1BBYA 4Z2YA 3L7WA 2J5OA 2F5FA 4PW4A 1LEAA 2DQ6A 1U2WA 1Q0HA 2FEZA 3NRVA 3F6VA 1FOKA 4LK0F 3U9WA 1YW9A 4ASNA 4LUPA 1J2XA 3Q9SA 2ADUA 1S3JA 4HF0A 5D5WB 2O61A 1TQMA 1BIBA 2R7DA 1R00A 3E5QA 3HOTA 1XGSA 1CGPA 4ZYGA 1D8KA 3J81K 4HX4A 1J0RA 4WXHA 4EGYA 3C3WA 5ICCA 5LHGA 4CGZA 3CZGA 2ESHA 4H0EA 5D5UB 3CHPA 1RIOH 2YPRA 1BIAA 4L9TA 1JG9A 3R0IA 2VOOA 4QUOA 2R3SA 3V7SA 4P5OA 3K69A 2RJIA 4MQVA 1IN5A 5ICFA 1ZYRF 2EA2A 3P9KA 1QO0D 2Z9OA 1BJAA 1USSA 3ECOA 3EQLF 1FSEA 4HX7A 2FQ3A 1XDSA 2RC4A 3K2ZA 5HLTA 2CQKA 4WXDA 2KIFA 1OR7A 5FD6A 4ZX3A 5AIPA 3HHHA 2O6GE 5D8LB 2IT0A 3WTZA 5AENA 2COMA 1R1UA 3MQ0A 4OU0A 3HTSB 4MTDA 3B2PA 2VBWA 3R6SA 2K27A 4M9ZA 4OIPF 2L4AA 4RB2C 3I59B 2XQ0A 5CYVA 3WTWC 2FXAA 2ESNA 3V4GA 2OZ6A 4FT8A 1MVYA 4XN4A 1YS7A 3WTXC 3U9GA 1FC3A 1OYWA 5JMWA 3G73A 1YFHA 1SC5A 1B6AA 4AIHA 1Q0QA 4ZQTA 1EH8A 4I2OA 1XDUA 4A5MA 5IT9K 5IT9Z 2E7XA 3FMSA 3LQQA 5HDKA 1U5TC 3HRSA 2OU2A 2VONA 3D5LA 2ACJA 4RGRA 2ZKZA 2HDCA 4KYWA 1I27A 1XMAA 2FF4A 2L54A 2LF8A 4I02A 1T1RA 3I53A 4L0YB 4CHUA 3QU3A 5ERIA 2FMYA 1KA8A 1ODDA 1B9MA 3F72A 1MGTA 4YIFA 3P9IA 2JCYA 2Z5UA 1ZRDA 2VBXA 4ETSA 3HHGA 3LAJA 3DFGA 2EFQA 1G3SA 1CF7A 3LA2A 5J6XA 4KMUX 5L3EA 2VN2A 2W57A 3PFIA 2YX7A 4B09A 3DPLC 5D5XB 1CF7B 3BJAA 5D6EA 2PUSA 5LEKA 3HRUA 4MHGA 1XGMA 2PMHA 4OOEA 1R1TA 1SFXA 5K5QA 5CJ9A 2QJ1A 4ESFA 2HPTA 3CHSA 3FHZA 4E70A 3L2CA 1WQ2A 4UV9A 5DYFA 2A5YB 3TOAA 3F8NA 2R59A 4CYDA 4ZYHA 5EV7A 1WWXA 3PUUA 3L9FA 2DI3A 3TDZC 3B34A 2Z3YA 1ULYA 2VBYA 4Q4EA 5JBIA 3KEOA 3IHUA 1MDMB 4A03A 2P7CB 5EEHA 2C6YA 1R5GA 3J80K 3MWMA 3FUMA 4HQEA 1E2XA 1XGOA 3RKWA 2K02A 3FU3A 1LQ1A 2JD0A 2AXLA 4A2UA 1S8NA 2CYYA 4YG2F 1FYMA 1W4MA 3JSZA 4JK1X 5BPIA 2K86A 4LB5A 1IF1A 3T0YA 1T2KA 1GHCA 2PI0A 3P9CA 1XSXA 4XMVA 1ON1A 4EM0B 1IZ1A 2X4HA 2XAGA 1D3YA 2IW5A 4QWQA 3MEXA 3B73A 4WWCA 3QAHA 4Y15A 3FWEA 3FTXA 1SD4A 5FLXZ 4WK8F 3BJOA 1IN6A 1W5TA 1GXPA 3GZ5A 3M8EA 2MH2A 2IPQX 3FTSA 1H9TA 2DT5A 4Y6RA 1LDDA 2DFIA 4ZX4A 3GFIA 3CIAA 1DPRA 1I5ZA 1P4WA 3COAC 1ZRCA 4EJTA 2JPCA 4KFCA 3GF2A 2FU4A 2BYVE 3T8RA 4XMXA 1IN4A 2FMLA 3OV8A 2GA2A 3KFWX 4BKXA 3FUFA 4BXUA 3J80Z 1ZG1A 3E5UA 4LG0A 4XSZF 5BS6A 3CZLA 4ZW7A 2XAQA 3D0SA 1EH7A 3F3XA 3CTAA 1YO5C 4P9FA 3P7NA 1B4AA 2HYFA 3FTWA 1YS6A 5DUKA 4PU2A 1J7KA 4O3MA 1TQPA 1SMYF 2GZWA 3PQKA 2ISZA 1B9NA 1FZPB 3QP5A 4BYYA 4RB1A 2BE5F 2M8EA 1WSUA 3R0JA 5JFRA 2Z33A 3FTVA 3WODF 2A61A 4R7LA 3QPTA 1HQCA 2P8TA 2QVOA 3EBGA 4LGWA 2IJLA 3QP6A 3ZPLA 3K1NA 4OMZA 4LLGF 2WWYA 1REPC 3A06A 2L4MA 4EJVA 3E97A 4XN7A 5ILVA 3REOA 4P55A 3IKTA 5H6QA 4MGRA 4I0BA 2A6HF 1Z6TA 5KK1A 3RTRA 2WZFA 5HDGA 5DDGA 2EFPA 1XMKA 3ZMUA 5E8GA 2FNPA 4XMWA 4ZW8A 3F8FA 1QPMA 4ZQEA 2VT3A 4RGXA 3M9AA 3WTSC 3KLOA 3JSPA 4HBLA 1KQ0A 1AWCA 2QLZA 5L3GA 1RI7A 1T6SA 4UHTA 2EB7A 4Y67A 4XO5A 1OKRA 2F5DA 3RKXA 4F7ZA 1W7PD 1J59A 2OQRA 3VEPA 2OAZA 3GO5A 4IRHA 1K6OA 5E1ZB 3IRRA 1MZBA 2DBBA 3B3BA 2ELHA 5DUIA 3E6MA 2FFLA 2MLGA 2QENA 5E1XA 3IRQA 3BDDA 2XASA 3IC7A 5EEGA 4HV6A 3ZN0A 4BHPA 2VLAA 2RQPA 2DQLA 4QPEA 4R8HA 2HR3A 2XAFA 1U5TA 5H6RA 4FX0A 2QQ9A 3F6OA 4ENKA 4L9JA 4KN4X 4OINF 2W85A 3JTGA 2HKOA 3U2RA 5DD8A 3R0AA 5DEQA 4ARFA 4CICA 1IUYA 1R1VA 2Y1GA 3UEQA 4FCAA 3ZMVA 3RI4A 2F5EA 4WF2A 2XAJA 4N9IA 4LK1F 3FUJA 3F8MA 1L3LA 3FTUA 4N9HA 2C5ZA 2D1HA 3BROA 3LA3A 2HFHA 2MBFA 1TW3A 5H20A 5FB2A 2GXGA 3FUEA 4YFKF 4MEXF 4XMTA 4KN7X 3T5XA 3ZMSA 3FUHA 3WE2A 2VC0A 3FZVA 1ONNA 1HKSA 4EJUA 1P4XA 4LB6B 3SHFA 4MNUA 4AR8A 3GEZA 4M6XA 1P4AA 2BEOA 4L5JA 4ZH4F 3MAJA 4IPAA 2G7UA 1R36A 1UCRA 3W6KB 1YLFA 3G3ZA 5JAZA 1BM9A 2CW0F 4J3BA 3ZHYA 3R60A 5JMPA 1MW2A 2RN7A 4OOIA 3TDUC 3EUHA 4KT5C 1F5TA 2O7GA 1MDMA 3SXYA 4I7HA 4ENJA 3FUNA 1I1GA 3FXQA 1O7FA 4QLCU 3ERED 4CZZA 1OYIA 2ZNZA 1U6GA 4PGGA 1JHHA 1BI3A 1LEBA 4ON0A 3E5XA 4XN9A 2EWNA 2K4BA 3KEDA 3WGGA 1T0FA 4GXOA 3PQJA 4UXNA 4EVIA 2A6EF 3C1DA 4HDVA 1U3EM 1K78B 2PBIA 1YTYA 4WCGA 2M45A 4ESJA 4OMYA 4I98B 1TBXA 3VB2A 1ZN2A 3Q44A 4G94A 3WG9A 4ZW3A 1FSHA 1HW1A 2Q0OA 4OOFA 2KJCA 4Y6PA 2JZYA 2QBYA 1I1SA 1R0KA 3FULA 2PEXA 4FLSA 5D4SA 3RASA 2NYXA 4DPRA 3HRMA 1PP8F 3F8CA 2XKPA 3BWGA 2Y0MA 3GZ6A 3CHRA 1BI1A 3FF5A 5J8CA 2Y48A 4HV5A 1XD7A 3CHQA 4EV0A 4XN2A 5DD4A 2EV5A 3HRTA 2A7OA 3FU5A 2XUBA 2RNJA 5J8FA 2P4WA 1I6XA 3FM3A 3N97A 5TJJA 3SZTA 3HTUA 2A68F 4NHJA 1W7PA 1RNLA 1MJAA 2CG4A 3LQRA 3KLNA 3AUAA 4LFUA 1P92A 2E7WA 3BPVA 2P7VB 5E17F 5FLXK 1ZARA 2CWEA 2P5KA 3HYIA 1U5TB 3JW4A 4U0YA 1R0LA 2MC3A 2QYOA 3WTUC 3E6DA 5FFZA 4AYSA 1S7OA 1T98A 1S7AA 2JV7A 3KP5A 4XO3A 4GO1A 4KNYA 1UB9A 4Y17A 1HS6A 2M1BA 2MAPA 4EQQA 1TQIA 2V1XA 3JAMK 4ZZDA 3T1BA 2Q2EA 4ENMA 3EBHA 5AIQA 2X0LA 4LD5A 2PL5A 2DK8A 2ZMEB 4UUVA 4R5TA 5JVTA 2BV6A 1IN8A 4A6DA 3WU1B 4HF2A 1OYYA 4ZX6A 2NS0A 1FWZA 1HSJA 5LRSA 3GUDA 2JSCA 2DQMA 1STZA 2Z99A 2O8XA 3V8LA 1BI0A 3J7AO 2J5PA 2BGCA 2EK5A 2GIVA 3ZQ7A 4GCVA 3LA7A 5BPDA 3EBIA 4AD9A 2M87A 2WPGA 3C18A 1P2FA 4CDGA 5HLIA 5D6FA 1XCBA 1SAXA 4EMSA 2ETHA 4ENNA 3I59A 3KP6A 2ISYA 1FYLA 4CXFA 3GX4X 2EGHA 3FM5A 5D5VB 2OD5A 3ZMZA 3F23A 4TV7A 1FPQA 2XGXA 2NAZA 4AIKA 4A12A 5IT3A 2IA2A 3DF8A 1UHWA 4BQAA 5FD5A 3TO9A 2P6SA 4A0YA 2OA4A 2DW4A 4I09A 3B37A 3CUQA 3CO6C 1JXSA 2C82A 4IHTA 2HYGD 2Q8KA 4HYEA 1D5VA 5E8IA 1G5AA 4XNAA 5K5OA 4KP7A 5E20A 5CLSA 4X2UA 1J5YA 1O3RA 3GFLA 2VE9A 3KP2A 3KZZA 2GWRA 1ZH5A 3W6JB 2ZXGA 3I4PA 2WZGA 2Y75A 3BOQA 3FHEA 4MTEA 3T8TA 3NEUA 2V1UA 1H9GA 1Z05A 2HEOA 4L5IA 3RYRA 2RV8A 5HOOA 3I58A 1HBXG 4IHSA 1RZ4A 1HKTA 4XO4A 3ZN1A 3DPTA 5TRDA 1Z6RA 2D45A 3Q43A 3K9TA 2KIUA 4R1HA 5LRRA 2B61A 2EV6A 4ZW5A 3K0LA 1MJBA 1XSVA 3RC3A 1J75A 2O0YA 4IXAA 3DEUA 4GAAA 1W5SA 3GW2A 2DO7A 1QGPA 1XSDA 4I0AA 1L0OC 4KMFA 1F9NA 3ECHA 3WGHA 2GTQA 2HKXA 2HWVA 1G3WA 3HSRA 1GVJA 5DYMA 1X3WA 4CO8A 1O3QA 2HGCA 1XGNA 1WKMA 1O7LA 3Q9VA 1ZRFA 5LHHA 2VE8A 1EV7A 2Y1CA 4JQFA 1T38A 3N4MA 3E6BA 4L9VA 1HW2A 4K5PA 1H19A 4EM2A 4M9SA 5E1WA 3ANNA 1HW5A 4G9YA 2IVMA 2DPUA 3CUOA 1TNTA 2XPZA 1RUNA 2TDXA 4HAMA 1NHAA 1O57A 1S6LA 4BNCA 1ZG5A 3JSOA 2BBYA 3ANLA 2PJPA 4KIBA 3FX3A 3RPQA 1V3FA 2FNAA 2PG4A 5F64A 2MD5A 3L09A 4G6DA 2STWA 4RGSA 4R5VA 2AS5F 3WQSB 4ZYEA 2P6TA 4U7DA 2ZO4A 4MS6A 1IRGA 4A5NA 5JO0A 3ZHXA 2F2EA 2QQBA 2GA1A 2ZBKA 5LHIA 2EFOA 1KQ9A 1Q1HA 4UVBA 4KA4A 3EYYA 5BPPA 6PAXA 2Y1FA 5ICGA 5ILUA 4A6EA 5HNHA 5BQTA 5L3DA 4EM1A 4BHCA 1E17A 3O6BB 3FUDA 1SD6A 1DUXC 4MKTA 2CSOA 1UHMA 2XROA 4ZW6A 2HZTA 3RDIA 5HDNA 1GXQA 1FT9A 1HKQA 1TLHB 1ZREA 4G6QA 1KU2A 1X3ZA 2V9VA 3V8KA 4G7HF 3HSFA 1YG2A 1YW7A 4ZQGA 1BOAA 2XRNA 2IA0A 2R72A 2JD2A 1YW8A 5ILSA 5JR3A 3A14A 2H09A 4GYIA 2FBIA 2GXBA 4ZYDA 4ZQFA 1FX7A 1U8RA 1U78A 2HPOA 1XCVA 4MEYF 1AOYA 4YFNF 3WTYC 1ZLKA 2CGPA 4JNDA 3VVLA 2CO5A 1JGSA 3EDPA 5HLGA 2FSWA 2JTVA 2KRFA 2QUFA 2LF7A 4R79A 1FBQA 2CFXA 1LDKB 2EJRA 2DQRA 3QPHA 1EH6A 1USTA 5BMZA 3KZYA 3FXUA 5A2QK 2RDPA 4AR1A 3FMRA 4M71A 4HA8A 1ZLJA 1YQAA 4XN1A 2XV4S 4S04A 2UXNA 2MAOA 3KP7A 2PMUA 5F6FA 1OPCA 3R61A 5JNLA 5CVRA 1ONOA 1SD5A 3RIRA 2A07F 1FP1D 3DKWA 3CUQC 4WX9A 4DQ2A 3F8BA 2DTRA 1B1BA 4G7ZF 2R7FA 5FFXA 3LSTA 3E6CC 5DULA 1LVAA 3FU0A 2DPDA 5LGUA 2VXZA 2XVCA 3EYIA 2VT2A 1G6NA 2W25A 1ZG3A 3LAPA 4Q4IA 1KU9A 2G7HA 2VBZA 2VOPA 4BAYA 1Q0LA 3FH8A 2JCXA 3HUGA 4EGZA 1BC8C 4KDPA 4RVBA 1B59A 2MH9A 2PLYA 1K7AA 5DV5A 1ZGAA 1MKMA 4RCVA 4LG0B 2KKOA 1T39A 2ZMEA 4QMEA 2DU9A 3CUQB 1XN7A 3NQOA 2L01A 1MW0A 3VOEA 3C7JA 3VVMA 1R22A 4M74A 2HS5A 2LDUA 2VC1A 3WTVC 4Y6SA 4RSYA 2L3DA 5DCMA 3RC8A 3AU9A 4AICA 4KICA 3B7UX 2HTJA 4WXCA 4FX4A 4HX8A 4XNBA 4PZJA 1SG7A 4HQMA 4K5MA 3M7GA 1MD0A 4YFXF 4NB5A 1IW7F 4LJZF 4OIQF 2EV0A 4NQWA 3IIEA 1DP7P 1FBUA 1R23A 2STTA 4UVAA 2YR2A 4ZN6A 1FNNA 1FP2A 2JD1A 3FH5A 1LNWA 1MW1A 1QZYA 1O3SA 3WQRA 2EFNA 3GWZA 1WRJA 4GYGA 3SFZA 3S2WA 5HS8A 3HSEA 2JCVA 4XMZA 3EETA 5LGTA 3LWFA 1KGSA 1Z1DA 4HLYA 1JHFA 1G3TA 2O03A 1H0MA 1ONPA 3M8FA 2NNYA 1TTYA 2YU3A 3V7CA 3DQVC 3UERA 4M73A 1IN7A 4HDUA 2VODA 2V1DA 4IJAA 5FO5A 4IRGA 1JVSA 1QBJA 2K4JA 4GAEA 3GVAA 5CVJA 1X3UA 2OBPA 2MA3A 2Y1EA 2FOKA 4ESBA 5BOXA 3WQQA 2NNNA 4G8XA 2UZKA 2L02A 2XAHA 5DCMB 1HSTA 2NRAC 4K5OA 4ZZLA 4PCQA 4PDKA 1YIOA 1K78A 3CDHA 3V8JA 3ELKA 2ZJ2A 3MZYA 3WE3A 3DXJF 3CLOA 3ZMTA 2QM3A 2PN6A 1ZS2A 4Q47A 3MCZA 4Q4ZF 2LKPA 1DDNA 4QHPA 5CVVA 1RUOA 1WI9A 1SD7A 3UCQA 4ZX5A 2PGGA 3I5UA 3WTTC 1QZZA 3KP3A 3H92A 3H3ZA 3FUKA 4IVNA 2PQ8A 3QOPA 1ONVA 1SQMA 2EA4A 2W24A 4XBFA 1W7PB 1FY7A 1V4RA 5LEJA 4U88A 3ANMA 3IWFA 4BH9A 5DLLA 3FTYA 4HZFA 3B2XA 4IRIA 5KVRA 5HNFA 4Q5SF 3FU6A 1TNSA 3HOSA 4PVBA 3QU6A 2QBYB 3MFKA 3RYPA 1MW3A 2H6CA 1QQIA 5F1RA 3TO6A 4DNCA 1KQ8A 4ZQHA 3TGNA 1VTNC 5JC1A 2JRTA 2GAUA 1IXCA 3DP7A 2JT1A 2KJBA 2UXXA 3B7RL 3GYHX 1BC7C 1C0WA 2IRFG