4CXFA

Structure of cnrh in complex with the cytosolic domain of cnry
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
154
Chain Sequence
DADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDTFVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRAARLELARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA POLYMERASE SIGMA FACTOR CNRH
publication title The Crystal Structure of the Anti-Sigma Factor Cnry in Complex with the Sigma Factor Cnrh Shows a New Structural Class of Anti- Sigma Factors Targeting Extracytoplasmic-Function Sigma Factors.
pubmed doi rcsb
source organism Cupriavidus metallidurans ch34
molecule tags Transcription
total genus 60
structure length 154
sequence length 185
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cxfA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4cxfA01
2P4WA 3JW4A 3SZPA 3N4MA 3GO5A 2EA2A 4MHGA 1MW3A 4N9IA 3K0LA 1XSXA 3B02A 1KQ8A 3EUHA 3P9KA 2IPQX 4Y17A 2HTJA 3FM3A 4XBFA 1I6XA 2Z3YA 2RGVA 4BNCA 1IXCA 3OOPA 4M6YA 1IAWA 4G7OF 4S05A 1G5AA 3KP5A 1E2XA 1R1VA 4ZYDA 3CZEA 1FSEA 3MZYA 4OIPF 4LD5A 3HOSA 1UB9A 1J9IA 1K6OA 3TDUC 3RKYA 4UUVA 3KCCA 4FT8A 1ONNA 1UHMA 1ON2A 4Y67A 1EH6A 1BI3A 2GXGA 1ZHFA 4HX4A 3DQVC 3BJAA 2K27A 2RDPA 4UV8A 1XMKA 2FU4A 2D2WA 3KE2A 3KEOA 3TKYA 2QQBA 3F8CA 2STTA 3WE2A 4GYGA 4RGUA 3E6CC 1U3EM 3HRMA 4E70A 1YW7A 3GFMA 3V7RA 3PFIA 4HQEA 3U2RA 2QYOA 3I71A 4MNUA 1EV7A 2A61A 3KZYA 3K1PA 2V1DA 4RGSA 2Y1GA 3C7JA 1FBUA 2O0YA 2F5FA 2IT0A 2EV6A 5DYMA 1OMIA 2FRHA 1BI1A 1RZ4A 2DTRA 3ROUA 2IA0A 3CUQA 1Q0QA 3N97A 2ADUA 2LF7A 5E8GA 2NRAC 3BPVA 5BPIA 1T0FA 1JG9A 5HS7A 2WV0A 3HIFA 2KJBA 3RTRA 1ZRFA 1BOAA 2A6HF 4KFCA 1JGIA 4ZN6A 4ENMA 1WWXA 5K5QA 1TQIA 1AWCA 4BH9A 4HX8A 1YS7A 3JTGA 3LQQA 1DDNA 4MQVA 5CVVA 3E97A 1MDMA 3Q9SA 3L2CA 1OYYA 3IWFA 3ZMZA 3GZ5A 4CYDA 3JSPA 2ZCWA 5AIQA 1TLHB 4RB3C 2EV5A 1MW2A 4A0XA 4R79A 1DPRA 4ESJA 4HW0A 1B9MA 1H3LA 5LHIA 4DNCA 1CGPA 4I01A 2EV0A 1O7FA 4EVIA 3DXJF 4HA8A 2QWWA 1D8JA 4HBLA 2VC0A 3EYYA 1ULYA 5HOOA 1LDJA 4O5VA 2K86A 2CG4A 1UHWA 1O7LA 3CUQC 4ZZDA 4BQAA 2QBYB 4OIQF 2MLGA 2ISYA 5DCMB 3RKXA 3VB2A 1BM9A 4ZH4F 1Q1HA 4LFUA 4KMFA 1SMTA 3BWGA 3K1NA 1FP2A 2D45A 3SHFA 1JXSA 1XSDA 2HTSA 4WWCA 4PGGA 1J59A 3ISPA 3RKWA 5L3EA 4Q47A 1IN5A 3F8BA 3V4GA 3RPUA 1S3JA 2VONA 4ZQGA 2JPBA 3HYIA 5ILVA 1F4KA 3H3UA 3LQRA 3MCZA 4FLRA 1NHAA 1WQ2A 3CO6C 4ENNA 1XDSA 3REOA 2W25A 4UNOA 2Z9OA 2LKPA 1KU2A 1OR7A 1SC5A 1Z1DA 1TBXA 1ZREA 3CUQB 2CW0F 4G7HF 2KIFA 1XGNA 3HSFA 5ILSA 5H20A 2BBYA 2YX7A 2ZJ2A 4K2EA 1Q0LA 4AWXB 3R4KA 2ELHA 1RIOH 1FBSA 3E5QA 1ZS2A 3IIEA 4WF2A 2OZUA 1T6SA 2ZNYA 3R6SA 3ML6A 4U0YA 2FNPA 3FM5A 1W5TA 2W24A 3TQNA 4P55A 1MDMB 3MZHA 1D8KA 1R22A 2FBIA 4AIKA 4LLGF 2CWEA 1GXPA 1J5YA 5F6FA 3J7AO 4FLQA 4OMYA 3EETA 3RI4A 1O3TA 1T38A 4HF0A 2JSCA 4MTDA 5DUKA 1EH7A 3AU9A 2O7GA 2XROA 1SMYF 1J2XA 3IC7A 4UVBA 2UXXA 1TW2A 4BYYA 2HQRA 4MEXF 3ZMDA 5F64A 1BIAA 3RYRA 1T98A 2P5LC 4ON0A 4OOFA 3R0JA 4L5JA 2LNBA 1KU3A 4ASNA 3IKVA 3F8MA 4HX7A 1MD0A 3L09A 3KZZA 1T1RA 3TOBA 1IF1A 4A5MA 2O6GE 3ZPLA 4ZQEA 2FMYA 2FE3A 2VOOA 1P2FA 3E3VA 1ZH5A 2XHKA 5ILUA 3CZKA 1I1SA 1QO0D 1STZA 2M45A 2O3FA 2MC3A 1OPCA 4F7ZA 4I09A 3L9FA 2WC2A 4KIBA 4KP7A 2IJLA 3WTXC 1JVSA 1BI2A 4LK1F 2XVCA 1SD5A 5LGUA 3DPLC 3V8JA 3TDZC 4ESBA 3WTSC 2EFQA 2XIGA 3B73A 4U0WA 1I27A 4HDVA 1JGSA 2ZMEB 4RGRA 1XB4A 3QAHA 3M8EA 1FPQA 3V7CA 3SFZA 3RYPA 2FOKA 2YR2A 1ZRDA 4CO8A 2XAJA 1B1BA 2K4BA 1USSA 2VC1A 1TTYA 4HF1A 4FX4A 1IXSB 2YU3A 1O57A 2H09A 2ETHA 2C6YA 2PBIA 2V1XA 2EFNA 1V3FA 2GAUA 3E6DA 4XLNF 5D6EA 1HKTA 5CJ9A 3R60A 5JFRA 3QP5A 4L0YB 2A5YB 1U2WA 1J75A 1JHFA 1FWZA 1G6NA 5L3CA 4EGZA 4YFXF 1DUXC 3F6OA 1KA8A 3BZ6A 2IA2A 1H0MA 5CVIA 5FLXZ 1K5HA 3WGHA 3DV8A 1PUEE 4MEYF 1MJBA 2M8EA 3SQNA 5E1XA 2NAZA 1RUOA 2B0LA 2CFXA 4M9SA 1R1UA 1V4RA 5LGTA 4YIFA 5EEHA 2PN6A 1SFXA 1R00A 3HOTA 1PDNC 1ZGJA 1S6LA 1IRGA 2M5WA 3LA3A 1KYWA 3CLOA 3F21A 2JRTA 4R1HA 2F5DA 4PDKA 1S29A 2XAHA 3WGIA 3W6KB 2DAOA 5LLQA 1YYVA 3CZGA 1G4DA 1XN7A 1F5TA 3ANLA 3ECOA 2UXNA 2Y0MA 5D4SA 1OYWA 3JAMZ 3MEXA 4G9YA 3LFKA 2LSOA 1SAXA 2PMHA 2QZ8A 3ZI0A 5FGMA 4OIOF 1K78A 1O3SA 3T8RA 1HSJA 1TQMA 3W6JB 2VBZA 1YTYA 2DLLA 3WTZA 2DI3A 5LHGA 1R0KA 5CVUA 5ICEA 4LLNA 3KLNA 2MLKA 3KETA 1WKMA 1I1GA 1R58A 3L00A 1ZG5A 2RVCA 2XASA 5JMWA 4EQQA 5FD6A 4YG2F 5FLXK 3FZVA 2D1HA 2M30A 4EJVA 2RNJA 4LLLA 2YPRA 3E6MA 3AUAA 4Z2YA 5BS6A 4JQFA 1C0WA 5L3FA 2ZNZA 2QBYA 1MZBA 2R7FA 3R0AA 5DCMA 1FYKA 2DU9A 2YX4A 4I02A 5HVQC 4UVCA 2A68F 4OU0A 4HDUA 5ICGA 1YQAA 5JAZA 4WXCA 4WXDA 2H94A 4L18B 1K7AA 2ESNA 4AYSA 2DO7A 1HW5A 4LB6B 3RDIA 4EM0B 4ESFA 1TNSA 2R7DA 4OOIA 2Z5UA 2XAGA 2EB7A 3JAMK 1S7AA 3T0YA 4NB5A 1RUNA 2V6CA 3O3KA 4EMSA 5H6QA 4ZYGA 3WQQA 2CYYA 5K5RA 4M73A 2GXBA 3ZMSA 4FX0A 2AS5F 1YW9A 4IPAA 4HLXA 2JTVA 2P7VB 3O2PE 1P6RA 1LDKB 4RS8A 3LAPA 4HZFA 2VODA 1SFEA 3P7NA 2L54A 4KN4X 5K5OA 3ZP5A 3I64A 3WGGA 4YFKF 5CVRA 3T5XA 3GUDA 2Z99A 2DQLA 3GF2A 1MGTA 3KP4A 3FWEA 4P96A 1K78B 4IHTA 2VBXA 3F23A 2JT1A 5D5XB 5CYVA 3ABUA 3ANNA 3MAJA 3FX3A 2EGHA 5D8LB 1ZG1A 2JCYA 1OYIA 2RN7A 3CTAA 2H6CA 3DP7A 2FF4A 5FB2A 3C18A 1FYLA 1LDDA 1FC3A 4IJAA 2ZKZA 2LF8A 4KT5C 3GFIA 3F8NA 3F3XA 1IZ1A 3WU1B 3ZQ7A 4Y6PA 1QZYA 3GFLA 5D6FA 1BBYA 3M8FA 4L9JA 1Y0UA 1YLFA 4M6XA 4O6JA 4CHUA 3AU8A 2RKHA 1QPMA 1IUYA 1FBQA 4EGYA 2OAZA 5CLSA 4RGXA 3WTTC 5J8FA 1HKQA 3QOPA 3S2WA 3KEQA 3G3ZA 4IRHA 4PZJA 4WX9A 2VE8A 3CZLA 3ZHXA 5FFXA 5JMPA 3QU6A 3LAJA 4U7DA 3EDPA 5HS9A 3T8TA 4IRIA 2HWVA 3RJPA 4LG0B 4IXAA 4ENKA 1BI0A 3TO9A 3IL2A 3DKWA 1ZAOA 2ACJA 3EQLF 4KIFA 2NNYA 3I58A 5D5VB 2MH2A 2BGCA 4PGHA 4KA4A 1USTA 2HQNA 3I5UA 3K2ZA 2YSRA 2COMA 2EFOA 2ZMEA 1IW7F 3DFGA 3FF5A 2EJRA 4WCGA 1FT9A 1A04A 2O61A 4HQMA 3U1DA 5LRSA 2P8TA 1PP7U 3WTWC 3ZHZA 5LBQA 2XUBA 3CO7C 3FXQA 1XGOA 3ECHA 3E6BA 3G73A 4D0PA 4AICA 2HKXA 3GFJA 5E18F 5L3GA 5DDGA 1CF7A 2BYVE 5DEQA 2VBWA 2O03A 3SZTA 5ED4A 1W7PD 2ZO4A 5E8IA 4HV5A 4BHBA 5E20A 5LRRA 1QQIA 1T2KA 2Y1EA 4U0VA 1HXDA 3A14A 2HS5A 2FA5A 2FNAA 1LJ9A 3AAFA 2L4AA 2KIUA 1FYMA 1FZPB 4LGWA 4ZQFA 3LWFA 3NQOA 4I7HA 3U9GA 5HLGA 2WTEA 5IT9K 4KMUX 1XCBA 1IN7A 4EJWA 1F9NA 1R0LA 4KN7X 5BOXA 2DBBA 2G7HA 1IN8A 4UXNA 3GWZA 1JE8A 2J5PA 3HUGA 1GHCA 3WTYC 2RV8A 3I0TA 2W85A 5DCFA 2X0LA 3IKTA 1G3TA 2HOEA 4XSXF 3HSEA 2EK5A 1GVJA 3ERED 1VTNC 4EV0A 4Q4ZF 2W84A 1R5GA 1TNTA 2Y1FA 2RC4A 4FLOA 1G3YA 4XLPF 4AIHA 2MH9A 4Q5SF 2GA2A 2HZTA 4B8XA 3ZN1A 2PLYA 4UVAA 1B9NA 5E1WA 4OIRF 4RCVA 4L5IA 1JHHA 2VT3A 1MVYA 2CO5A 2E7WA 2MBFA 5AIPA 5ICFA 4G6DA 1HBXG 1WRJA 2L3DA 2WWYA 3WQRA 3T1BA 4L9VA 1J0RA 3I54A 1FP1D 2A6EF 4N0BA 1ZYRF 1KQ0A 3I59A 2ESHA 1IRFA 2Z33A 4U88A 1FX7A 3ELKA 4O3MA 3KP6A 2H27A 1BC8C 1RP3A 4N9HA 1R36A 3UERA 2GWRA 2QUFA 1P92A 1CF7B 2IVMA 3WTVC 2UZKA 3HRSA 1LEAA 4AD9A 1U8RA 2OU2A 3WTUC 5IT3A 5BMZA 4A6EA 1D3YA 3ANMA 5FFZA 2G9WA 1T39A 1P4WA 5EEGA 1PP8F 1F1ZA 1U78A 3HSRA 4I0AA 5DULA 2WPGA 3VEPA 3QPTA 3WODF 5JC1A 5JVTA 3LSTA 2XAFA 3I53A 5JHUA 3NRVA 4LUPA 4M9XA 4CXFA 5KK1A 1O3QA 3CJNA 4YIIA 4HOBA 1I5ZA 1OKRA 2A3SA 2VXZA 3BROA 2O8XA 1YFHA 1T1SA 3LA7A 4I98B 3M9AA 3MQ0A 1R7JA 4BXUA 4NQWA 4TV7A 3BDDA 2NS0A 5A2QZ 1ONVA 4GCVA 3GZ6A 1LNWA 2RQPA 2FXAA 3GVAA 2ISZA 2ZFWA 2M87A 3D0SA 3HTSB 2EFWA 2OQRA 2HR3A 3DF8A 3FXRA 4P9UA 4A5NA 2L01A 2P7CB 1BN5A 2P6TA 4BHPA 5JBIA 1G3WA 4ETSA 1ZRCA 3SXYA 1LB2A 1Z6RA 1QBJA 2XRNA 3I59B 4CICA 4HAMA 4HF2A 3BJOA 2GZWA 2KIMA 3D5LA 3R61A 3PQJA 3CUOA 2L4MA 5HLHA 1SD4A 2Q2EA 5DUIA 4Y6SA 2GIVA 3DPTA 3O6BB 4YFNF 4KNYA 2IW5A 2E7XA 1MJAA 3KP3A 3UCQA 2Y1CA 5BPDA 2K7LA 2CSOA 2GQQA 2EWNA 2P6SA 1BJAA 1GXQA 2DFIA 2HFHA 4EM2A 1YG2A 2ZXJA 2JD2A 2F2EA 1XDUA 5E17F 5D5UB 1KGSA 5H6RA 3CDHA 4LG0A 3GX4X 4KIGA 2HDCA 2VE9A 1ZN2A 4B09A 4A03A 2P5VA 5ICCA 2MD5A 4JBAA 2Y75A 1HW2A 5A2QK 4IHSA 4MGRA 3TO6A 1MW1A 4EJUA 2XAQA 2F5CA 3J81K 2CGPA 3F22A 5D4RA 2CQKA 4S04A 4GAEA 4L9NA 3Q5FA 3V8LA 4A0ZA 4A2UA 2H6BA 2W57A 5FO5A 2HEOA 1KU7A 2A07F 4G8XA 1FNNA 1R5HA 3FXUA 1IXRC 3IWZA 4MTEA 1RNLA 4ENJA 4G7ZF 5K1YA 1AOYA 3RPQA 4FHTA 1Z9CA 1MKMA 3ZMUA 1R1TA 2MAPA 1ZLJA 3DEUA 4I0BA 1HQCA 1RI7A 2XGXA 4M74A 1W7PA 2PI0A 4IF4A 2JD0A 4XRFA 1E17A 4GGGA 1XGMA 1XMAA 4MQ9F 4Y15A 2KKOA 4ZZLA 3VOEA 3GLXA 5ERIA 3IRQA 3PQKA 4EJOA 2Q0OA 2FSWA 1ODDA 1FOKA 1Z91A 3HHHA 1P4AA 3F72A 2FBHA 3BOQA 4M9ZA 1D5VA 2P5KA 1MW0A 3QP6A 1ZLKA 3TO7A 2FQ3A 3R0IA 4WK8F 1L3LA 2L02A 3FMSA 3HHGA 2OZ6A 1K79A 4G94A 3H3ZA 4A0YA 5L3DA 1EH8A 2QQ9A 5HDGA 2QM3A 4OOEA 3BY6A 1XSVA 3IHUA 4UV9A 3TOAA 2UWMA 4IRGA 3C1DA 3MWMA 3V8KA 4DQ2A 4Q48A 5IT9Z 1S7OA 1KU9A 5TJJA 2AXLA 1YW8A 4Y6RA 1U5TA 2PEXA 5LGNA 2VN2A 4QLCU 3F6VA 1W5SA 2BE5F 4OMZA 4I2OA 4RB1A 1S8NA 3ZN0A 1DPUA 1R23A 4UHTA 1LQ1A 2C82A 2Q8KA 4P9FA 3UEQA 1IN6A 4RAYA 2IRFG 3K9TA 4M71A 2DK5A 1H9TA 3IRRA 2BEOA 4L9TA 3FMRA 3M1EA 4A6DA 1O3RA 2K4JA 1YO5C 4GO1A 4P5OA 4LJZF 3QPHA 2XV4S 2VBYA 3E5XA 2JD1A 5E1ZB 3K1MA 1B4AA 4Y13A 2KRFA 2DQRA 3F8FA 1LEBA 2LDUA 4A12A 3MFKA 5HDKA 3QU3A 4KICA 5LEKA 3HTUA 3KP2A 2XKPA 2DT5A 3BP8A 5HLIA 3WG9A 1FY7A 1W4MA 1W7PB 3GW2A 4IVNA 1U5TC 1ONPA 1DP7P 3NEUA 3KP7A 4HYEA 2OA4A 2HGCA 5BQTA 1HSTA 6PAXA 5JNLA 4LMYA 4L0ZB 2HKOA 3COAC 4BHCA 3J80Z 4RB0A 3KFWX 4CDGA 1ON1A 3JTHA 2K02A 3GEZA 3E5UA 1YS6A 1IN4A 5L3BA 2X4HA 2IP2A 2PQ8A 4QWQA 3ZMTA 3A06A 5HS8A 2M1BA 4GYIA 4LB5A 2Y1DA 4M72A 3P9CA 3OV8A 4G6QA 1B6AA 2DK8A 1LVAA 1J7KA 4GXOA 1XD7A 1FSHA 2DW4A 2TDXA 4RAZA 2KJCA 1SD7A 2JZYA 4CZZA 1Z05A 2FBKA 4XSZF 5FD5A 2FEZA 2HYFA 3WQSB 1U5TB 2OD5A 5DD4A 4FLSA 3VFZA 1XGSA 3BJ6A 3C3WA 5J8CA 4R8HA 2DPDA 3FHZA 2BV6A 3RASA 4EM1A 1XCVA 3FMQA 5J6XA 2OQGA 4HLYA 3ULQB 5JR3A 1ZARA 1MJ9A 3V7SA 1SFUA 1Q0HA 2MA3A 3GYHX 2V1UA 3WE3A 1G3SA 4H0EA 3JSOA 2PJPA 2V79A 2NYXA 2JCXA 3ZHYA 1SD6A 2A69F 4KUMA 2DPUA 4BAYA 1UFMA 4U7BA 3J80K 1KYZA 3H92A 4AIJA 4AVPA 2F5EA 3HRUA 1ONOA 1HKSA 2VT2A 1WSUA 1QZZA 4ZYEA 4RB2C 1S46A 2PG4A 2V9VA 2E1NA 5TRDA 3I4PA 2OBPA 1ZG3A 4HV6A 4KDPA 1QNTA 1X3UA 1Z7UA 2XKOA 5AONA 4ZQHA 1UCRA 2JCVA 3M7GA 2PMUA 3ZMVA 3QRFF 4KYWA 3GXOA 3K69A 5HDNA 2QQAA 2E1CA 2Y48A 2EA4A 4OINF 2G7UA 5F1RA 1HW1A 1TW3A 2R3SA 4JK1X 2MAOA 3ABTA 5DD8A 1BIBA 4NHJA 2HYGD 1FLIA 3Q9VA 1YIOA 4ZYHA 4PCQA 2J5OA 1L0OC 5D8KB 2QENA 5DV5A 4EJTA 2PFBA 2IA1A 3P9IA 1U6GA 1B59A 2QVOA 2EFPA 3TGNA 2QLZA 1Z6TA 2JPCA 1WI9A 3EYIA 2NNNA 5JO0A 2FMLA 3LA2A 2ZBKA 2STWA 5D5WB 1BC7C 3HRTA 4WXHA 3WU0A 5JI6A 5KVRA 1ZGAA 3RIRA 1P4XA 3J81Z 1H9GA 3VODA 2VOPA 1KQ9A 4CGZA 3KLOA 5CVJA 3BPXA 5LHHA 1REPC 1QGPA 2D1VA 2GA1A 1TQPA 4LK0F 5LEJA 3L7WA
chains in the Genus database with same CATH superfamily
2LRDA 3G1LA 5EZHA 5DYFA 3M4OJ 2L7FP 5GTHC 2P4WA 3OYKA 3JW4A 2WB1A 3SZPA 4Y33A 2ZJRF 3AL0B 3N4MA 3GO5A 2BVLA 2V1NA 1JT0A 2KL4A 2EZIA 2Y9ZA 2GOMA 2EA2A 3A0BC 4MHGA 3S3OA 1MW3A 2OCEA 4N9IA 1WJFA 3K0LA 1YOVB 3IH2A 2K40A 1XSXA 3S3NA 3E1SA 3H5RA 4XMXA 3B02A 3PO2J 1KQ8A 3HZJA 1GV5A 3EUHA 3OYEA 3P9KA 4BY1J 1ETOA 2IPQX 4Y17A 2HTJA 3W6VA 4W1UA 3FM3A 4XBFA 2EZLA 3M8JA 1I6XA 1X3WB 2Z3YA 2RGVA 3SFIA 2EINH 4YEJA 1MW7A 4BNCA 1IXCA 3OOPA 3FTVA 1H8AC 4M6YA 1IAWA 2CUJA 4XM3A 4G7OF 3HOUJ 3C2GA 2DOEA 1V55H 4S05A 2X6OA 3BR1A 2R92J 1G5AA 1XS9A 3KP5A 3IP4B 3PNVA 1E2XA 1R1VA 4ZYDA 3CZEA 1FSEA 1OCOH 3MZYA 3QYBA 4OIPF 3GMEA 4LD5A 4C3IJ 1Z3XA 3HOSA 2DT7B 2W7NA 1UB9A 1J9IA 2R7RA 2CUFA 1VQ5I 2L7MP 1FJLA 1K6OA 4HNTA 4XO5A 3TDUC 4ARFA 2HDWA 2F4MB 2VB6A 4I76A 3KCCA 4FT8A 5B1BH 3RKYA 4UUVA 1ONNA 1UHMA 1ON2A 2DMPA 3DBRB 3ASNH 4Y67A 1EH6A 1BI3A 1HS6A 4BEHB 2GXGA 5M5YJ 1ZHFA 3PUUA 1WJAA 4HX4A 3DQVC 4L5EA 1A36A 3BJAA 1MNMC 2K27A 2RDPA 2LY2A 4UV8A 4DYCA 1XMKA 2FU4A 3OSFA 3PO3J 2D2WA 3KE2A 3KEOA 4XNFA 3TKYA 2QQBA 2X48A 3QYEA 3F8CA 4C9YA 2STTA 2NOGA 4QPQA 3WE2A 1Y6IA 4GYGA 4RGUA 3E6CC 1U3EM 2HXIA 3FBIB 3HRMA 4E70A 2M7AA 1YW7A 3GFMA 3V7RA 5GADJ 3PFIA 4HQEA 3U2RA 2QYOA 3I71A 4MNUA 4C30A 1EV7A 2A61A 3KZYA 4IHWA 1R49A 2ZXIA 3EUHC 3GTKJ 2HQAA 3K1PA 2V1DA 5HNFA 3HM5A 1Z0XA 4CCJA 4RGSA 4Y52J 3S16J 3B6AA 2Y1GA 3OWTA 4I6ZA 5EG0A 3C7JA 1FBUA 2O0YA 2F5FA 3RQ4A 5IP6A 3S3MA 2EV6A 4QTRA 2B9SA 4BU2A 2IT0A 4A3DJ 5DYMA 3M3YJ 1OMIA 2FRHA 1BI1A 2IXSA 1RZ4A 4FCYA 1LKXA 2E5ZA 2LH9A 3SYTA 4XORA 4XNDA 4E7KA 5M5XJ 4CH7A 2DTRA 3ROUA 2IA0A 2NS7A 3CUQA 3FXKA 2IGOA 1Q0QA 3N97A 4XMVA 2ADUA 3H9QA 4XMZA 2LF7A 1WJ5A 2ID3A 5E8GA 5TISC 2NRAC 4AIDA 1D5YA 2M2EA 3BPVA 5BPIA 1CQTA 2DA3A 1T0FA 4IQJA 1WZ2A 2VUMJ 2H8WA 1YHQI 1JG9A 5HS7A 2WV0A 2BVMA 2XRLA 2JMWA 4J01A 2E36A 2V4JC 3HIFA 4L2LA 2KJBA 3RTRA 1J09A 2WY8Q 1GVDA 1ZRFA 2PJRB 1BOAA 3B7UX 2R5ZB 2FFLA 2A6HF 2L7KA 4KFCA 3PUFA 1JGIA 3LOCA 4ZN6A 4ENMA 1WWXA 5J1YA 5KHDA 4X2UA 4GRIA 2ZB9A 5K5QA 3OY9A 1JJ8C 1TQIA 1AWCA 2IS4A 3OYJA 4BH9A 2PX9A 4HX8A 3S17J 1YS7A 2JN6A 1TZLA 3K4NA 3TW6A 3JTGA 4XMTA 3LQQA 4NC8A 2WZFA 1N75A 1DDNA 4MQVA 5CVVA 3HW2A 3E97A 1MDMA 3Q9SA 3L2CA 1ZR2A 2WZGA 1OYYA 3E7LA 3IWFA 3GZ5A 3ZMZA 4X1EA 4CYDA 2DMTA 3JSPA 2ZCWA 5AIQA 2K85A 1TLHB 3AFHA 2IGKA 3BT9A 1Y0NA 4RB3C 2EV5A 1MW2A 4A0XA 4R79A 1DPRA 4BJTA 4ESJA 4BGDA 2XF5A 2ELJA 4HW0A 2R7WA 1B9MA 2KRHA 1IGNA 1H3LA 2BY2A 5LHIA 4DNCA 4PUSA 3FHEA 3SZGA 4I01A 1CGPA 2EV0A 3FISA 1O7FA 1S5LC 4EVIA 3DXJF 4HA8A 1UG2A 2QWWA 4Y7NJ 3DEEA 3QPSA 3FK6A 3HG9A 4ITVA 1D8JA 4HBLA 3OL4A 2VC0A 3EYYA 2AQEA 1ULYA 3FIWA 5HOOA 2HPOA 1LDJA 4O5VA 2K86A 2CG4A 1TWHJ 1UHWA 5B66C 1O7LA 3CUQC 4ZZDA 1SVOA 4ZX6A 4BQAA 2RAEA 1RETA 3A0HC 4XICA 3SDBA 4DIQA 5GAHJ 2QBYB 1G8XA 4OIQF 3PFYA 1ETVA 3K4KA 1IUFA 2MLGA 1K4SA 3BTCA 1T0FC 4F52A 2ISYA 4KISA 4F93B 2DOFA 5DCMB 3A1YA 3Q44A 3RKXA 3MD2A 3VB2A 1BM9A 4ZH4F 5M5WJ 1Q1HA 4LFUA 4KMFA 1SMTA 1TT0A 2C5ZA 3BWGA 3K1NA 1V5EA 1FP2A 2CMPA 3FUFA 2D45A 2WB1N 3SHFA 4Y4RA 3GTQJ 1JXSA 1XSDA 2HTSA 1WJBA 4WWCA 1Y1VJ 4PGGA 2XPZA 1J59A 3ISPA 3MVPA 3RKWA 5L3EA 5E3NA 4Q47A 5FKMA 1YE9A 2KDOA 3D5RC 3B3BA 1IN5A 3F8BA 3AG3H 5HNHA 3V4GA 3RPUA 1S3JA 1D0XA 3GTJJ 2VONA 4ZQGA 2JPBA 3CQZJ 3HYIA 5ILVA 1F4KA 2VJIA 3H3UA 3LQRA 3MCZA 4FLRA 3H0DA 4BBRJ 4D7NA 1NHAA 1WQ2A 3CO6C 1I3QJ 3BZKA 5F04A 4ENNA 1XDSA 3GTLJ 1YX3A 4IKFA 1FIAA 3REOA 2W25A 2Y9YA 4UNOA 2Z9OA 2LKPA 3L2WA 1KU2A 4BQOA 3OYNA 1OR7A 2DA1A 2IGMA 2LLKA 3AG2H 1N25A 1Z1DA 4RMNA 1SC5A 1V5GA 1TBXA 2G0EA 3ESWB 1ZREA 1OCZH 2CW0F 3CUQB 3K4BA 5B3SH 4E7IA 4HSRA 2O9LA 4G7HF 3CJRB 4JYKA 2FOWA 3LSPA 4BE0A 4XN0A 2KIFA 1XGNA 3RKQA 4C2MJ 4XN5A 1VQPI 4XKCA 1MBKA 1DQUA 3B6CA 3HSFA 3ZQFA 5ILSA 5H20A 2BBYA 2YX7A 2ZJ2A 4K2EA 1Q0LA 3HEFA 4AWXB 3R4KA 2ELHA 1K83J 3ZOBA 2MGQA 1RIOH 1FBSA 4NBQA 3E5QA 4DBQA 1ZS2A 3IIEA 4WF2A 2GIZA 1OFCX 2OZUA 1T6SA 2ZNYA 3R6SA 3ML6A 4U0YA 1GW6A 2RJIA 2DFEA 5HODA 3F0CA 2ZJPF 2FNPA 4PJLA 4FCAA 4UB6C 3FM5A 2OTLI 1W5TA 1JI8A 2W24A 4PFPA 3TQNA 1ZR4A 4P55A 1MDMB 4K5PA 3MZHA 1D8KA 2HOTA 4JX6A 1R22A 2FBIA 4AIKA 3CJTB 2CWEA 2N8GA 2VKHA 4LLGF 1GXPA 1FEXA 4UUSA 1J5YA 3J7AY 5F6FA 3J7AO 2PGGA 2ZSHB 4FLQA 4OMYA 2L9VA 3EETA 3CCRI 3RI4A 1O3TA 1T38A 4HF0A 2JSCA 2L5QA 4MTDA 2XPWA 4MFEA 5DUKA 1EH7A 3AU9A 2O7GA 3L2RA 2XROA 1SMYF 1J2XA 3IC7A 4HSTA 4UVBA 1YRNA 2UXXA 5GAGJ 1TW2A 2MABA 3FUEA 5FWQA 4BYYA 2HQRA 4XMYA 1JKQC 4MEXF 3S2DJ 3ZMDA 3FUJA 5F64A 1BIAA 3RYRA 1T98A 2CQQA 2X9DA 4DBRA 4RLFA 4P1WA 4AC0A 4PJ0C 1ERDA 2ZMEC 5F27A 1SANA 2P5LC 4ON0A 4OOFA 3R0JA 4L5JA 2FQ4A 2LNBA 3JSZA 1OR7C 1KU3A 1UHSA 3G4SI 4ASNA 4C2UA 3IKVA 3F8MA 1ORKA 1POGA 4HX7A 1MD0A 3L09A 5F0HA 2DOAA 3KZZA 3WHCA 1T1RA 3TOBA 1IF1A 1A35A 4KT6A 4LIVA 2FUG2 4A5MA 2Z16A 2O6GE 3ZPLA 4ZQEA 4XKBA 2FMYA 2FE3A 1X2NA 2VOOA 3UR3C 3ABMH 3G2BA 2CUZA 2R7SA 2BY0A 1P2FA 3E3VA 1ZH5A 2XHKA 3RSNA 1PVEA 5ILUA 3CZKA 3MMYB 1TL8A 1I1SA 2V6EA 1QO0D 1STZA 2M45A 2O3FA 2KLOA 2LBFB 2MC3A 5FKLA 4QUOA 3OSGA 1OPCA 4F7ZA 4I09A 3L9FA 3SEQA 5IP9J 2OTJI 2WC2A 3LSMA 3FTZA 4KIBA 1WFXA 4KP7A 2IJLA 2VJJA 3FXOA 3WTXC 1JVSA 2A05A 3LL7A 1BI2A 4LK1F 3IAS2 4XLEA 2XVCA 1SD5A 5LGUA 1PYVA 3DPLC 3V8JA 3TDZC 2WADA 1OQYA 4ESBA 4E4HA 3WTSC 2EFQA 4J00A 2XIGA 4BQQA 3B73A 1VQ9I 1UZCA 1R71A 1V54H 4U0WA 1I27A 3H36A 4HDVA 5FKKA 1JGSA 2ZMEB 2VASA 4RGRA 1XB4A 3QAHA 1R4NB 2WBMA 3M8EA 1FPQA 3V7CA 3SFZA 4AR8A 3OIPA 2LMDA 5GPCA 3ZXSA 3RYPA 4IX7A 2FOKA 4BE2A 1FMVA 2YR2A 1FTTA 1ZRDA 1MMAA 3FTXA 2LREA 4CO8A 2XAJA 1B1BA 4XOPA 3B7RL 2K4BA 3VYRB 3K70D 1HCRA 1MBEA 1USSA 2VC1A 1TTYA 4HF1A 4FX4A 2R59A 1IXSB 2YU3A 3Q43A 1O57A 2H09A 2ETHA 5FRMA 2KPMA 2CJJA 4E7JA 1T08B 2PBIA 2EFNA 2V1XA 2QF7A 2C6YA 1V3FA 2GAUA 2OCCH 3E6DA 4XLNF 5D6EA 1HKTA 2NXNB 5CJ9A 2JA2A 3R60A 5JFRA 3QP5A 2IAIA 1EJ9A 4L0YB 2A5YB 1U2WA 2CQNA 3ZRGA 1J75A 1JHFA 1FWZA 3BCBA 3LSJA 1G6NA 2WV1A 4BEHA 5L3CA 3I3LA 2HZDA 1MNDA 5J4VA 2NS8A 4EGZA 2V26A 4YFXF 3DTEA 5B5EC 5J47A 3KEDA 1DUXC 3F6OA 1KA8A 3BZ6A 2CV1A 2GLOA 2M8GX 4UUSB 2IA2A 1H0MA 5CVIA 5FLXZ 4LIUA 1K5HA 1ITYA 3WGHA 3DV8A 4OAZA 1MBJA 3IH4A 4J3BA 1PUEE 4ZYAA 3CCMI 2W1OA 4MEYF 3AL0C 2B61A 1MJBA 2M8EA 3SQNA 5E1XA 2NAZA 2XF6A 3LNQA 1RUOA 2B0LA 2CFXA 4M9SA 1GT0C 1R1UA 1V4RA 5LGTA 3FH5A 1LFPA 1YRNB 4YIFA 1VQ7I 1ETQA 1MBHA 2K9QA 1SG7A 5H2FC 5EEHA 2PN6A 2XGEA 3MKYB 3GTOJ 3S1RJ 1SFXA 4BKXA 3FTUA 3KX2A 3QJXA 1R00A 3HOTA 3TBIA 4FE4A 1PDNC 1ZTRA 1ZGJA 3J7YJ 4K5NA 1S6LA 1IRGA 2M5WA 3LA3A 3CLOA 1KYWA 4G6TB 3F21A 3AKZA 2HNHA 2JRTA 2ZC2A 4OAYA 4R1HA 2EPFA 2F5DA 1D1CA 4PDKA 2B63J 1S29A 2HI3A 2K9LA 1Q1VA 3CLQA 2XAHA 4F55A 3WGIA 2KIQA 3W6KB 1U9OA 2DAOA 5HLTA 5LLQA 1YYVA 3CZGA 3OYBA 1HOMA 3V42A 4ZDPA 4FQGA 4ZX4A 3HC7A 1W0TA 1G4DA 2LFBA 1N78A 1XN7A 1F5TA 1D0ZA 3ANLA 3L2UA 3BQYA 2E2JJ 4QPEA 3ECOA 3KZIC 1GLNA 1TWCJ 2UXNA 2Y0MA 3HBLA 5D4SA 2LD5A 1OYWA 1QZEA 4K5OA 4ZDLA 3JAMZ 3LSHA 3MEXA 3W2AA 2ZJQF 4RM2A 4G9YA 2R7UA 3LFKA 2LSOA 4KITB 4BE1A 4IQ4A 3WU2C 2PMHA 1SAXA 2PJRA 1VQ6I 4R5VA 2QZ8A 3BG9A 4M3GA 3ZQHA 3ZI0A 2Y69H 5FGMA 4OIOF 3JRHA 1K78A 4JOMA 2I8DA 4HPQA 1JUSA 3T8RA 1HSJA 1O3SA 1VZ0A 3VYUB 1N77A 2R7VA 1Y8QB 3KYLA 1DGWY 1OJLA 1TQMA 2X1EA 3JRCA 2NVYJ 4UB8C 1MSFC 3W6JB 2K3FA 2VBZA 1YTYA 2DLLA 2WAFA 3WTZA 2DI3A 5LHGA 3A03A 1R0KA 3OYCA 2Y30A 5CVUA 5ICEA 2R7QA 4LLNA 3KLNA 3NWSA 2MLKA 1WHUA 1HA8A 3KETA 1WKMA 1I1GA 2XPYA 1R58A 4K5MA 2VJ4A 3L00A 1ZG5A 4B3XA 2EIJH 2RVCA 1VQLI 2DXIA 2XASA 5EDNA 5JMWA 2MYSA 4G12A 1GDTA 4EQQA 5FD6A 1Z3YA 3PL8A 4FISA 2KZVA 4YG2F 5F1JA 3FZVA 3K10A 5FLXK 5AENA 1JGGA 2D1HA 2M30A 1UJ8A 4EJVA 2RNJA 4LLLA 2YPRA 3AG4H 3E6MA 3AUAA 4Z2YA 5BS6A 4JQFA 1C0WA 4HG2A 5L3FA 3JRAA 2QVWA 3FU3A 2YS9A 2ZNZA 2QBYA 1MZBA 2XB0X 1Z77A 4FASD 3SDGA 2R7FA 5F08A 3R0AA 4B4CA 3BR2A 4XMUA 5DCMA 3DTKA 4DYQA 3H3VK 1FYKA 2DU9A 2YX4A 4I02A 5HVQC 4UVCA 2A68F 2VQGA 4OU0A 4AUXA 4HDUA 5ICGA 1YQAA 5JAZA 4WXCA 3EBIA 4QHPA 3VSLA 1QPIA 3AG1H 2P81A 4XMWA 3VPRA 4WXDA 2H94A 4L18B 4V2GA 1K7AA 2ESNA 4AYSA 2HVSA 1ZGWA 2DO7A 4BXXJ 2MG4A 1HW5A 4LB6B 4DJAA 1R9TJ 3RDIA 4EM0B 4ESFA 1TNSA 2R7DA 2MD0A 4OOIA 3CMEI 2Z5UA 1QVUA 3OYHA 2XAGA 2EB7A 2TCTA 3JAMK 3HXLA 2OUMA 2EBIA 2E35A 1S7AA 3MKWB 3T0YA 4NB5A 1RUNA 2V6CA 1I50J 2JWTA 1R4MB 3O3KA 2E71A 2UUZA 4EMSA 5H6QA 4ZYGA 4RAFA 1I39A 3WQQA 3UKGA 2CYYA 5K5RA 4D7MA 2ECCA 4ZW5A 4M73A 4BJ5C 1W1WE 3TP3A 3VDXA 2GXBA 3QYFA 3ZMSA 2WAQN 4FX0A 2AS5F 2VJ8A 1YW9A 4IPAA 4HLXA 3ERMA 5KCMA 3W3CA 2JTVA 2P7VB 3H5NA 3O2PE 1QHGA 1P6RA 1UG0A 1LDKB 3H35A 4NUBA 4RS8A 2BHYA 3LAPA 4CCKA 4F92B 4HZFA 2VODA 1SFEA 4A3EJ 3P7NA 2L54A 4KN4X 3ZQIA 2AO9A 5K5OA 3ZP5A 2KZGA 3I64A 3WGGA 4YFKF 3MKZA 5J1RA 3CMYA 1NK2P 2IS1A 1IV6A 5CVRA 1JUMA 2JVHA 4XN3A 3T5XA 3GUDA 2Z99A 2DQLA 3GF2A 1MGTA 3KP4A 5E3OA 3VVMA 4YELA 1XTAA 2ME0A 3PIPF 1S7EA 4CCLA 4RVBA 3FWEA 4P96A 1K78B 4IHTA 2VBXA 3DU6A 3I56I 5B1AH 3F23A 3EPZA 3OR1C 4BQNA 4DZJA 2JT1A 5FKNA 5D5XB 4QPOA 5CYVA 3ABUA 3HOYJ 3ANNA 1RPWA 3MAJA 3FX3A 3FXMA 2EGHA 4Q4EA 4ZX5A 5DTDA 5D8LB 3MZ8A 1ZG1A 2JCYA 4M6VA 1OYIA 2RN7A 5CQEA 3LSRA 3CTAA 2H6CA 1D1AA 3CCYA 3BTLA 5J4YA 3FU0A 1TWFJ 4NDLA 4D1QA 3DP7A 4ANJA 2FF4A 3RZDJ 5FB2A 3PSIA 1QHHD 3C18A 4IOCF 1FYLA 1LDDA 2XAUA 1FC3A 4IJAA 2ZKZA 2LF8A 3HKZA 3GCMA 4KT5C 3GFIA 3F8NA 3F3XA 5GPAA 1IZ1A 4XRSA 3WU1B 3ZQ7A 2VQLA 4Y6PA 1QZYA 3GFLA 5D6FA 4XLHA 1ENHA 4PK4A 3OR2C 1BBYA 2QKLB 3M8FA 2HPMA 4L9JA 3EBGA 4A3GJ 4XN8A 2CQ7A 2F48A 1Y0UA 2H8RA 1YLFA 1ETXA 1ZQ3P 3CD6I 1MIJA 4HRIA 1MMGA 2LY9A 4M6XA 4O6JA 4CHUA 3AU8A 3LSGA 1BOBA 2RKHA 1QPMA 1IUYA 1FBQA 2E60A 4EGYA 1VI0A 2K5CA 2LR8A 4ZC3A 4PSWA 2KISA 3CC7I 2OAZA 5CLSA 1A31A 1RKTA 4RGXA 3WTTC 4A3CJ 5J8FA 3BG7A 1HKQA 4Q4IA 4B3AA 4AYBA 3QOPA 3K4MA 3RC8A 3S2WA 2JA8J 3SJMA 3UNGC 3KEQA 3G3ZA 4IRHA 4DW6A 2A6TA 4GFBA 2ME6A 4PZJA 3FKJA 1SFKA 4A3JJ 4WX9A 3HL2A 2VE8A 1D1BA 3U21A 3CZLA 3A4CA 1X3ZA 2XDVA 4F91B 3ZHXA 5FFXA 2LBFA 3QOEA 5JMPA 3QU6A 5C44J 3LAJA 2DMNA 2DODA 4U7DA 3EDPA 2I10A 5HS9A 2TRTA 4CYCA 3OS1A 3T8TA 4IRIA 2HWVA 3RJPA 4IHYA 4D5FA 4LG0B 4IXAA 4ENKA 4XNBA 1BI0A 2VQHA 2LTPA 2R72A 3TO9A 3IL2A 3DKWA 1LUJB 2ZXHA 1ZAOA 1IRZA 2ACJA 4DOZA 3EQLF 4B47A 4KIFA 2XC7A 2NNYA 3I58A 5D5VB 2MH2A 2BGCA 4PGHA 4XIDA 4KA4A 1USTA 5EV7A 1LFBA 2HQNA 3I5UA 3K2ZA 1E3PA 2YSRA 1Y1WJ 2COMA 2EFOA 4UUTA 2ZMEA 2K9NA 3SEZA 3OS0A 1LFUP 5TGTA 1IW7F 2W82A 2HQ5A 3DFGA 2DDBA 3FF5A 3QODA 2EJRA 4WCGA 3FUNA 5F0CA 5GP9A 1X1BA 1FT9A 1A04A 2O61A 3L2QA 1WI3A 5C3EJ 1JJ6C 4HQMA 3U1DA 5LRSA 2P8TA 1PP7U 3ONQA 2R7ZJ 2Q1ZB 3B37A 3FK7A 4IL6C 3WTWC 3ZHZA 2Y0SA 5LBQA 2XUBA 4Z6YA 1FMWA 3CO7C 3FXQA 2V7FA 1JKPC 1XGOA 2QSFX 3ECHA 3E6BA 2BW3B 4DZPA 1BR4A 3G73A 2RQQA 4D0PA 4J19A 4AICA 4BACA 2HKXA 3GFJA 4XRSG 5E18F 5L3GA 4BDZA 3B7TA 5DDGA 4QIWN 1CF7A 3JRIA 4RBOA 2BYVE 1ACIA 5DEQA 2VBWA 1JTYA 2O03A 3OMYA 3SZTA 5K7FA 2CRGA 3DU5A 1X1PA 5ED4A 1W7PD 1S72I 2DJIA 2ZO4A 5E8IA 4HV5A 3PUBA 4BHBA 4BXFA 3S1MJ 5E20A 4IOAF 5LRRA 1YJWI 1QQIA 3CP8A 1T2KA 2JJ7A 2R7TA 4XNAA 1VQKI 3BG6A 4JX4A 1WJEA 2LYCA 2V9PA 4B44A 2Y1EA 3IH3A 3OS2A 2K9MA 4U0VA 3ZR8X 1HXDA 3A14A 2FJ1A 4R5TA 2HS5A 2GXAA 3IV5A 2FA5A 1P7JA 1R6RA 2LC2A 2FNAA 2CV0A 1LJ9A 3AAFA 2L4AA 2KIUA 3K7AJ 1WVRA 1FYMA 1Z7LA 2LG4A 1FZPB 3S93A 4LGWA 4ZQFA 2HVQA 3LWFA 3NQOA 3OYLA 4I7HA 1FOWA 2JUGA 3U9GA 5HLGA 3OYMA 4ZTFA 2WTEA 5IT9K 4KMUX 1AHDP 3GTMJ 1XCBA 2VJ5A 1I6HJ 1TWAJ 5K7ZA 1XG1A 3OYAA 1IN7A 2A7OA 1OCPA 3J7ZI 4EJWA 1F9NA 4JP0A 5IYDJ 2QJ1A 1R0LA 4MFDA 4KN7X 5BOXA 2B7EA 2DBBA 2G7HA 1IN8A 4UXNA 2R0QC 4C3HJ 3GWZA 1JE8A 2J5PA 3HUGA 3QQAA 1K61A 1GHCA 2QKMB 3WTYC 4QMEA 2HDDA 2RV8A 3I0TA 1ZK8A 2W85A 5DCFA 3K70C 1VQOI 5FROA 2X0LA 4A3KJ 3M07A 1NK3P 3IKTA 1G3TA 5DM7F 1HDDC 2HOEA 4XSXF 2PMZA 3W2VA 2M7BA 1T8IA 1PUFA 4RSYA 2VLAA 1WCMJ 3VSKA 3HSEA 2EK5A 1GVJA 3ERED 5LFAA 1X3ZB 1VTNC 4EV0A 3HOWJ 4Q4ZF 4C3JJ 2OF7A 2W84A 1R5GA 2XGDA 3A02A 1TNTA 4RLQA 3VYSB 2Y1FA 2RC4A 4FLOA 1D0YA 5BNGA 1G3YA 4XLPF 1BW5A 2CW8A 5E3LA 4AIHA 4XQFA 3CCLI 2GM4A 4XK4A 2MH9A 4CYCB 4Q5SF 2I5UA 2GA2A 3CC2I 1WGXA 2HZTA 2L9RA 3T8VA 2Z2SB 4B8XA 1XC5A 3CHPA 3ZN1A 3NARA 2X6XA 2DA2A 1B9NA 4UVAA 5E1WA 2PLYA 3DBHB 3CCEI 3HGGA 4OIRF 4RCVA 4L5IA 1JHHA 2VT3A 4DGWB 4FTHA 2EILH 1MVYA 5KAIC 3K6GA 2CO5A 2E7WA 2MBFA 5AIPA 1DU6A 3PNTA 3B2XA 5JLWA 5ICFA 4A3BJ 4G6DA 2AQFA 4A3LJ 2WA0A 1QA6A 1LE8A 1HBXG 1WRJA 2L3DA 1MH3A 1E3HA 2WWYA 3WQRA 2WY7Q 3CDLA 4L9VA 1J0RA 3T1BA 1SVLA 2GBYA 4ZW8A 3I54A 4JX5A 1FP1D 3DLLF 3RC3A 2A6EF 4N0BA 4F3QA 2QSHX 1Y56A 3S1QJ 1ZYRF 2JRMA 1KQ0A 3I59A 4BY7J 2ESHA 2F5VA 5JVGF 1IRFA 2Z33A 4U88A 4X0GA 4FE7A 3DWLE 1FX7A 2YU9J 3CCVI 2CU7A 2W48A 3ELKA 4O3MA 3KP6A 2VXDA 1BC8C 2H27A 2DQMA 1RP3A 1IRXA 2KT0A 2M34A 4N9HA 3CESA 3LSKA 1R36A 3UERA 1IV8A 2GWRA 2QUFA 1P92A 1CF7B 2IVMA 1Y8RB 2HPIA 3WTVC 2UZKA 2IS6A 3HRSA 3FUMA 1M1EB 1LEAA 5CKTA 4AU7A 1FIPA 4AD9A 1F36A 1U8RA 2DDAA 2OU2A 1W5CC 3WTUC 2NVTJ 4XN1A 2MW8A 1XPXA 5IT3A 5BMZA 4A6EA 1D3YA 4AVZA 3ANMA 5FFZA 2G9WA 1T39A 3BZCA 2CV2A 1P4WA 2Y31A 3FH8A 2L7ZA 2H1LA 1P7IA 3O8GA 5EEGA 1PP8F 2QGUA 1F1ZA 5C4JJ 2ZXWH 1U78A 1HDPA 3FULA 3HSRA 1ZELA 1I3AA 5M3FJ 1JKOC 4JNDA 3BR6A 1AKHB 3IAM2 4I0AA 4PFOA 2VPLA 3CHOA 3CHRA 5DULA 3BG3A 2WPGA 4II3A 3VEPA 4U87A 3TL4X 3QPTA 3WODF 4XRMA 3RZOJ 5JC1A 5JVTA 3LSTA 2QA4I 2M0MA 2XAFA 3I53A 3TP0A 3CMMA 2XQ0A 1YX5A 4XN7A 5JHUA 2KDZA 2LY1A 3NRVA 1OCRH 1KZHA 4LUPA 3M1CA 4A3FJ 3HUGB 4M9XA 4CXFA 3LMMA 1RKWA 5KK1A 1O3QA 3CJNA 4YIIA 2VKVA 4CUGA 3NAUA 4HOBA 1DP3A 1I5ZA 1OKRA 2A3SA 2F4OB 2VXZA 4PSXA 4XO3A 2FX0A 3BROA 2O8XA 4XN4A 1A6QA 3FUDA 3PIOF 4DYRA 1YFHA 1OLTA 1WJDA 3CC4I 1IDYA 1F43A 1PUFB 1T1SA 3LA7A 2R5YB 4I98B 3M9AA 3MQ0A 1R7JA 5E3MA 4BXUA 4D5CA 3FTWA 4NQWA 2BOLA 3DKYA 4TV7A 3BDDA 2NS0A 5A2QZ 2H1KA 1ONVA 1W0UA 3VVLA 4GCVA 4B48A 3GZ6A 2BXZA 1LNWA 2RQPA 4HNUA 2X1CA 2FXAA 1VQ8I 3Q0UA 3S15J 4KJZA 3GVAA 5E79C 3HPHA 3JRFA 2ISZA 2ZFWA 4RAGA 4YRVA 1JTXA 2M87A 3CHQA 3D0SA 4PJNA 1G2HA 3HTSB 2EFWA 1TC3C 1TT5B 4PJMA 2OQRA 2JK3A 2HR3A 3EUAA 3DF8A 3FXRA 4P9UA 4A5NA 2L01A 2P7CB 1BN5A 3U1KA 1RR8C 2KQRA 5IP7J 1YJNI 4ZJZA 4R5XA 2P6TA 3PNYA 1LE8B 4BHPA 2VPRA 2W00A 3BQZA 5EJCA 5JBIA 1G3WA 2IBDA 4UY8I 4ETSA 4Y3OA 3PM1A 3SXYA 3JR9A 5J1UA 1ZRCA 1LB2A 3HPGA 1Z6RA 2BY1A 1QBJA 5BPPA 2XRNA 2M9HA 3I59B 3FTSA 4H4KC 1UELB 3BTJA 4CICA 4HAMA 2HXOA 4HF2A 1MH4A 2GOXB 2KP6A 3BJOA 4CSWA 1SQMA 3K4CA 3BLYA 2GZWA 2KIMA 4GDFA 1BA5A 3D5LA 2GTQA 3R61A 2PMZN 3EUKL 2EZHA 3PQJA 2JQ7A 4OWRB 3CUOA 1UMQA 2L4MA 2MC4A 5HLHA 1SD4A 2Q2EA 5DUIA 4Y6SA 4FETA 2CUEA 2GIVA 3DPTA 3TW7A 4S0HB 3S32A 1Z21A 3O6BB 4YFNF 5GTIC 4KNYA 2LKXA 1YJ9I 1H89C 1P9QC 2IW5A 3K4JA 2E7XA 1MJAA 3KP3A 3UCQA 2Y1CA 5BPDA 2K7LA 2HOAA 1WH7A 3CZ6A 1IC8A 2Z1DA 2CSOA 3FU6A 2GQQA 5FRNA 2EWNA 2P6SA 4ZW3A 1BJAA 1GXQA 2DFIA 2HFHA 2ELKA 3DKXA 1DGRM 4A69C 4EM2A 1WPKA 2NVXJ 1YG2A 5GAEJ 2ZXJA 2JD2A 2F2EA 2YUSA 1XDUA 2QEXI 5E17F 3JREA 5D5UB 2DCEA 1KGSA 1QU3A 5H6RA 3CDHA 5J3LA 4I99C 4LG0A 3GX4X 1A6IA 4KIGA 3G1MA 1IG7A 4BBSJ 2DT6A 2E1OA 1ETKA 3CIAA 2HDCA 3WHBA 2VE9A 1MMNA 1ZN2A 4B09A 2EH3A 4A03A 2P5VA 3CCQI 5ICCA 3FUKA 2MD5A 4JBAA 2Y75A 2XGCA 1HW2A 5A2QK 4IHSA 4MGRA 3TO6A 1MW1A 3MN2A 4ABZA 1KONA 4EJUA 2XAQA 4XO4A 2IEKA 4XR6A 2F5CA 3GLLA 3J81K 3F22A 2CGPA 3X2QH 2E2HJ 1FOYA 5D4RA 2CQKA 1T95A 1RESA 2VL8A 4S04A 4GAEA 4L9NA 2F4IA 3ZGKA 3Q5FA 3V8LA 1K6YA 4XOTA 4A0ZA 4A2UA 2H6BA 3RQIA 3BCAA 2NVQJ 2DQ6A 2W57A 1MBGA 5FO5A 3DLAA 2HEOA 1KU7A 1B8IB 2A07F 4G8XA 4R7LA 1IJWC 3FXLA 2HYJA 1V5FA 1FNNA 1R5HA 3FXUA 4IHXA 1K4TA 1IDZA 1IXRC 3IWZA 3S1NJ 4MTEA 5K7HA 1RNLA 4NQWB 2BW3A 3HGYA 4ENJA 1VQNI 2ZXGA 2X6YA 4G7ZF 5K1YA 2X1DA 1AOYA 2DJNA 2E34A 3RPQA 1OCTC 4FHTA 1Z9CA 1MKMA 3C2HA 1R1TA 2DMQA 3ZMUA 2MAPA 1JUPA 1ZLJA 3DEUA 1XMXA 4I0BA 1BR1A 1PJRA 1X58A 3CCUI 1HQCA 1RI7A 3CMAI 2UV1A 2XGXA 4M74A 5EF6A 1W7PA 4BJ6C 3K2AA 2PI0A 4AR1A 4IF4A 3D5SC 2JD0A 1ZKGA 4XRFA 1E17A 5FLMJ 2KMUA 1TP4A 4GGGA 1XGMA 1XMAA 3QPLA 2DA4A 4MQ9F 4MS6A 4Y15A 4BUPA 2KHMA 2KKOA 4ZZLA 4A3IJ 2IGNA 3VOEA 2DA7A 4IEJA 2VQCA 3GLXA 4XKVA 3FUIA 4HNVA 5ERIA 3IRQA 3PQKA 1SFOJ 4EJOA 3CF5F 1ETWA 2Q0OA 2FSWA 2AXTC 1ETYA 1ODDA 3EBHA 5EYRA 1FOKA 1Z91A 3HHHA 4E7ZA 2R4GA 1P4AA 3F72A 1U0JA 3ABLH 2FBHA 2XF7A 4M3FA 3TMOA 3BOQA 4QIRA 4M9ZA 1D5VA 2P5KA 1T33A 4NC6A 3A01A 1MW0A 3HOZJ 1HF0A 3GBGA 3QP6A 1ZLKA 4E7LA 2F6CA 4ZW7A 2KRCA 3TO7A 2FQ3A 4E7HA 4NC7A 3R0IA 2NVUB 1VF9A 4WK8F 4CCMA 1L3LA 2L02A 4XKWA 3DPUA 4II2A 3FXJA 2HU9A 3FMSA 3HHGA 3CJQB 3OYDA 2HPTA 2OZ6A 1K79A 4G94A 3H3ZA 4AM3A 4A0YA 2K3PA 5L3DA 4CCOA 1EH8A 2QQ9A 2Q2EB 5HDGA 2QM3A 4OOEA 3BY6A 4XLFA 1XSVA 3IHUA 4UV9A 1YITI 3TOAA 3CXBA 2E2IJ 5FLVA 2OV7A 5DLLA 3OIQA 2UWMA 3OYGA 4IRGA 2XSJC 4GAAA 3C1DA 3MWMA 3V8KA 2HVRA 4DQ2A 4Q48A 5IT9Z 3FKIJ 3KPHA 1S7OA 1KU9A 1MSEC 5TJJA 4HEA2 1TWGJ 2AXLA 3CCJI 1YW8A 1X1AA 4PW4A 3CP2A 4Y6RA 3U9WA 2EIMH 1U5TA 2IS2A 3H1CA 2JSPA 5J40A 2W4SA 4YIRX 3K4LA 2PEXA 5LGNA 3FUHA 2MSYA 3BR5A 2VN2A 5FJ8J 4QLCU 3F6VA 3G6EI 3OIOA 1W5SA 2BE5F 2E5NA 4CCNA 1BL0A 1YI2I 2XPVA 3JRDA 4OMZA 4I2OA 4RB1A 1S8NA 3Q3SA 2O7OA 3ZN0A 2R7XA 1DPUA 1R23A 4UHTA 1LQ1A 2C82A 2Q8KA 4W97A 4P9FA 3S8PA 3UEQA 4IO9F 3PSFA 5IYCJ 1IN6A 3CDIA 4RAYA 3FH7A 2OJED 4ZDOA 2PL5A 3DCFA 4RM3A 3W2WA 2DA5A 3K9TA 2IRFG 4M71A 5IYBJ 5M3MJ 2PUSA 3DBLB 2DK5A 1H9TA 3IRRA 2BEOA 4L9TA 3MKLA 1X4OA 3FMRA 3M1EA 3H5AA 2KFDA 3KYDB 3L2VA 2LP0A 4A6DA 5IOZA 2QSGX 1O3RA 2M4GA 4B1RA 2K4JA 1YO5C 4GO1A 2V9KA 1WJCA 5EGOA 1T56A 3I9V2 2A5WA 1E3OC 4P5OA 4LJZF 1EA3A 2EIKH 3P5JA 2DMUA 3QPHA 5CPRB 2XV4S 4A3MJ 3H9GA 2VBYA 4XLAA 3E5XA 4PJJA 5EG0B 1NTCA 2XSDC 1H88C 2JD1A 2OPTA 5E1ZB 3K1MA 1B4AA 1B72A 4Y13A 1RR7A 3ZCOA 2KRFA 2ZSIB 2XPUA 2DQRA 3KYCB 1WH5A 1O4XA 3F8FA 1LEBA 3CF2A 2LDUA 1G59A 3DEWA 4A12A 3MFKA 4E7SA 5HDKA 3QU3A 1MMSA 2E1MC 4KICA 5LEKA 5IPAA 2D5VA 3HTUA 3KP2A 2XKPA 4MLOA 3HOXJ 4ZTJA 3FHNA 5JHFA 2DT5A 3BP8A 1EKEA 4RA2A 4NNJA 5HLIA 2DYRH 3WG9A 1FY7A 1W4MA 2VKDA 2VKEA 1W7PB 3GW2A 4IVNA 1U5TC 3OOUA 2M0CA 5EEAA 3JRGA 4AR9A 5EZGA 1ONPA 1DP7P 1SEUA 3NEUA 4XN2A 3KP7A 1W36C 4HYEA 2OA4A 2HGCA 2Y2ZA 5JLXA 5BQTA 1HSTA 2DFFA 1X1CA 6PAXA 5JNLA 4LMYA 4L0ZB 4IHVA 3I4NJ 2HKOA 4D9JA 3COAC 3NWTA 4BHCA 4XLCA 5DM6F 3J80Z 1HLVA 4RB0A 4M3BA 2ID6A 2VIXA 3KFWX 1SC7A 4CDGA 4PU2A 1ON1A 3JTHA 2K02A 3ASOH 3GEZA 4MIMA 3E5UA 1HC8A 1AKHA 5C4XJ 1YS6A 1JKRC 1EF4A 1IN4A 5L3BA 3N05A 2QCOA 5DS9A 3L1PA 3A01B 2X4HA 4RDUA 2IP2A 2PQ8A 9ANTA 4QWQA 3ZMTA 3H0GJ 1BR2A 3TEDA 3A06A 2RREA 5HS8A 4MKTA 2M1BA 4LITA 2LOOA 4GYIA 4LB5A 3ZQGA 2CQXA 2CW7A 2NOJB 2HOSA 1NH3A 1QVTA 2Y1DA 2JA5J 3HJEA 4M72A 3P9CA 2DFHA 3OV8A 4G6QA 1B6AA 2DK8A 1LVAA 4IZZA 1J7KA 4GXOA 1XD7A 2R7OA 4A93J 3A2KA 1FSHA 1APLC 2DW4A 2TDXA 4RAZA 3O8HA 1LPQA 2KJCA 1SD7A 3G1OA 1X2MA 1RRJA 3E0JB 2JZYA 5IOYA 3FU5A 4X6AJ 4CZZA 2E1MB 1Z05A 3ZQCA 2FD5A 4DPRA 2AHQA 2FBKA 4XSZF 5FD5A 2VI6A 2FEZA 2HYFA 3WQSB 3BTIA 2R5YA 3S14J 2DYSH 5CQGA 3Q0VA 1U5TB 2OD5A 3GTGJ 5DD4A 1W36D 3I55I 2EQRA 1H19A 4FLSA 3VFZA 1XGSA 3BJ6A 3C3WA 5J8CA 4R8HA 2DPDA 3FHZA 4V19K 1X1DA 2BV6A 3RASA 4EM1A 1XCVA 3ZQQA 2LK2A 3FMQA 4PVBA 1UAAA 2COBA 1LVKA 3G71I 3HKZN 1VQ4I 2K9SA 5J6XA 2OQGA 3C2BA 4HLYA 3GTPJ 3ULQB 5JR3A 1ZARA 1MJ9A 3V7SA 2O8KA 3OL3A 1SFUA 1AU7A 1Y39A 2P0WA 3HB9A 3B2PA 3BC8A 1Q0HA 3RPUD 1MBFA 2X85A 1NG6A 2L2OA 2MA3A 3GYHX 2V1UA 5FKOA 3WE3A 5EGOB 1S9HA 4LOCA 1G3SA 4QSHA 1MMDA 1FOXA 4H0EA 3JSOA 2PJPA 2V79A 1MNEA 2NYXA 2JCXA 3ZHYA 1SD6A 2A69F 2BY3A 1VNDA 3JCUC 4KUMA 4V2FA 2DPUA 4BAYA 1GV2A 4AYBN 1UFMA 2M4KA 1B72B 4U7BA 3J80K 1KYZA 3H92A 5F0FA 4AIJA 4AVPA 1X3WA 2F5EA 4LG3A 2JA7J 4BDYA 3HRUA 1ONOA 2BHZA 1HKSA 3FBNB 2CFOA 2VT2A 1WSUA 4N4NB 3JT1A 4EEFG 3BR0A 1R5ID 1QZZA 4ZYEA 4RB2C 3LFUA 1S46A 4E6KG 1A5JA 2PG4A 2LVSA 2V9VA 3KEYA 2E1NA 3H9JA 5TRDA 3I4PA 2WAQA 1FTZA 2OBPA 5KNLA 1SVMA 2EZKA 1ZG3A 4HV6A 4KDPA 1QNTA 1X19A 1X3UA 2QQ8A 1OCCH 4MO7A 3D1NI 1RC9A 1Z7UA 2XKOA 2L9NA 3VYTB 1OISA 3LSIA 1GUUA 5AONA 5LD2C 4ZQHA 1UCRA 3F9KA 3VWBA 1IO2A 5IY5H 2R70A 2JCVA 3M7GA 2PMUA 3ZMVA 1BW6A 3QRFF 4KYWA 3GXOA 3K69A 2DTZA 4ZX3A 5HDNA 1QRYA 2RNGA 3GZNB 2QQAA 4BL0B 3BG5A 2M3AA 4XL9A 5KAFC 2E1CA 2ZFUA 1XX5A 3QWLA 1Z67A 2XB5A 1SAUA 3S2HJ 2Y48A 1DU0A 2EA4A 4OINF 1U8BA 4M3DA 4ZQTA 2X6WA 1U9NA 2BXYA 2G7UA 5F1RA 3OYFA 1HW1A 1TW3A 2R3SA 4JK1X 2MAOA 2CH0A 2R93J 4ZW6A 3ABTA 4B43A 5DD8A 1BIBA 4NHJA 2HYGD 1FLIA 2Y0SN 3Q9VA 1YIOA 4CA0A 2WAEA 4C2TA 4ZYHA 2L0KA 2OC6A 1X4PA 3B7SA 3PJRA 2DA6A 2LKSA 4PCQA 1AA7A 2ICWG 2J5OA 1L0OC 5D8KB 4N4OB 2DN0A 1NG7A 2QENA 3KIOA 4CZCA 5DV5A 4EJTA 2PFBA 2IA1A 3P9IA 4EATA 1U6GA 1B59A 2QVOA 3OYIA 4BS9A 3HDDA 2EFPA 1B8IA 3TGNA 1VFCA 3FDYA 2JUCA 2QLZA 2JVGA 1Z6TA 2JPCA 4XN9A 1WI9A 3JRBA 3EYIA 2NNNA 2MFZA 1YIJI 1E0EA 5JO0A 2FMLA 3LA2A 1JT6A 2ZBKA 2STWA 2X51A 3BR3A 5D5WB 4K5LA 1BC7C 3HRTA 4WXHA 4XONA 3WU0A 5JI6A 5KVRA 1ZGAA 2L9SA 3ZQLA 3DTIA 1BJZA 2E19A 3RIRA 1P4XA 3J81Z 2JV7A 3RCOA 1H9GA 3VODA 2VOPA 1KQ9A 4M3EA 4CGZA 1VQMI 3B34A 3KLOA 3WG7H 2CS3A 3IUOA 5CVJA 3BPXA 5LHHA 3CHSA 3HOVJ 1REPC 3I4MJ 2ECBA 1QGPA 2D1VA 2GA1A 1TQPA 4LK0F 3FTYA 2BZTA 2R5ZA 2JA6J 5LEJA 3Q0WA 2O5RA 3L7WA 3CCSI 3ABKH
chains in the Genus database with same CATH topology
5DYFA 2P4WA 3JW4A 3SZPA 3N4MA 3GO5A 2EA2A 4MHGA 1MW3A 4N9IA 3K0LA 1XSXA 4XMXA 3B02A 1KQ8A 3EUHA 3P9KA 2IPQX 4Y17A 2HTJA 3FM3A 4XBFA 1I6XA 2Z3YA 2RGVA 4BNCA 1IXCA 3OOPA 3FTVA 4M6YA 1IAWA 4G7OF 4S05A 1G5AA 3KP5A 1E2XA 1R1VA 4ZYDA 3CZEA 1FSEA 3MZYA 4OIPF 4LD5A 3HOSA 1UB9A 1J9IA 1K6OA 4XO5A 3TDUC 4ARFA 3RKYA 4UUVA 3KCCA 4FT8A 1ONNA 1UHMA 1ON2A 4Y67A 1EH6A 1BI3A 1HS6A 2GXGA 1ZHFA 3PUUA 4HX4A 3DQVC 3BJAA 2K27A 2RDPA 4UV8A 1XMKA 2FU4A 2D2WA 3KE2A 3KEOA 3TKYA 2QQBA 3F8CA 2STTA 3WE2A 4GYGA 4RGUA 3E6CC 1U3EM 3HRMA 4E70A 1YW7A 3GFMA 3V7RA 3PFIA 4HQEA 3U2RA 2QYOA 3I71A 4MNUA 1EV7A 2A61A 3KZYA 3K1PA 2V1DA 5HNFA 4RGSA 2Y1GA 3C7JA 1FBUA 2O0YA 2F5FA 2IT0A 2EV6A 5DYMA 1OMIA 2FRHA 1BI1A 1RZ4A 4XNDA 2DTRA 3ROUA 2IA0A 3CUQA 1Q0QA 3N97A 4XMVA 2ADUA 4XMZA 2LF7A 5E8GA 2NRAC 3BPVA 5BPIA 1T0FA 1JG9A 5HS7A 2WV0A 3HIFA 4L2LA 2KJBA 3RTRA 1ZRFA 1BOAA 3B7UX 2FFLA 2A6HF 4KFCA 1JGIA 4ZN6A 4ENMA 1WWXA 4X2UA 5K5QA 1TQIA 1AWCA 4BH9A 4HX8A 1YS7A 3JTGA 4XMTA 3LQQA 2WZFA 1DDNA 4MQVA 5CVVA 3E97A 1MDMA 3Q9SA 3L2CA 2WZGA 1OYYA 3IWFA 3ZMZA 3GZ5A 4CYDA 3JSPA 2ZCWA 5AIQA 1TLHB 4RB3C 2EV5A 1MW2A 4A0XA 4R79A 1DPRA 4ESJA 4HW0A 1B9MA 1H3LA 5LHIA 4DNCA 3FHEA 1CGPA 4I01A 2EV0A 1O7FA 4EVIA 3DXJF 4HA8A 2QWWA 1D8JA 4HBLA 2VC0A 3EYYA 1ULYA 5HOOA 2HPOA 1LDJA 4O5VA 2K86A 2CG4A 1UHWA 1O7LA 3CUQC 4ZZDA 4ZX6A 4BQAA 2QBYB 4OIQF 2MLGA 2ISYA 5DCMB 3Q44A 3RKXA 3VB2A 1BM9A 4ZH4F 1Q1HA 4LFUA 4KMFA 1SMTA 2C5ZA 3BWGA 3K1NA 1FP2A 3FUFA 2D45A 3SHFA 1JXSA 1XSDA 2HTSA 4WWCA 4PGGA 2XPZA 1J59A 3ISPA 3RKWA 5L3EA 4Q47A 3B3BA 1IN5A 3F8BA 5HNHA 3V4GA 3RPUA 1S3JA 2VONA 4ZQGA 2JPBA 3HYIA 5ILVA 1F4KA 3H3UA 3LQRA 3MCZA 4FLRA 1NHAA 1WQ2A 3CO6C 4ENNA 1XDSA 3REOA 2W25A 4UNOA 2Z9OA 2LKPA 1KU2A 1OR7A 1SC5A 1Z1DA 1TBXA 1ZREA 3CUQB 2CW0F 4G7HF 2KIFA 1XGNA 4XN5A 3HSFA 5ILSA 5H20A 2BBYA 2YX7A 2ZJ2A 4K2EA 1Q0LA 4AWXB 3R4KA 2ELHA 1RIOH 1FBSA 3E5QA 1ZS2A 3IIEA 4WF2A 2OZUA 1T6SA 2ZNYA 3R6SA 3ML6A 4U0YA 1GW6A 2RJIA 2FNPA 4FCAA 3FM5A 1W5TA 2W24A 3TQNA 4P55A 1MDMB 4K5PA 3MZHA 1D8KA 1R22A 2FBIA 4AIKA 4LLGF 2CWEA 1GXPA 1J5YA 5F6FA 3J7AO 2PGGA 4FLQA 4OMYA 3EETA 3RI4A 1O3TA 1T38A 4HF0A 2JSCA 4MTDA 5DUKA 1EH7A 3AU9A 2O7GA 2XROA 1SMYF 1J2XA 3IC7A 4UVBA 2UXXA 1TW2A 3FUEA 5FWQA 4BYYA 2HQRA 4MEXF 3ZMDA 3FUJA 5F64A 1BIAA 3RYRA 1T98A 2P5LC 4ON0A 4OOFA 3R0JA 4L5JA 2LNBA 3JSZA 1KU3A 4ASNA 3IKVA 3F8MA 4HX7A 1MD0A 3L09A 3KZZA 1T1RA 3TOBA 1IF1A 4A5MA 2O6GE 3ZPLA 4ZQEA 2FMYA 2FE3A 2VOOA 1P2FA 3E3VA 1ZH5A 2XHKA 5ILUA 3CZKA 1I1SA 1QO0D 1STZA 2M45A 2O3FA 2MC3A 4QUOA 1OPCA 4F7ZA 4I09A 3L9FA 2WC2A 3FTZA 4KIBA 4KP7A 2IJLA 3WTXC 1JVSA 1BI2A 4LK1F 2XVCA 1SD5A 5LGUA 3DPLC 3V8JA 3TDZC 4ESBA 3WTSC 2EFQA 2XIGA 3B73A 4U0WA 1I27A 4HDVA 1JGSA 2ZMEB 4RGRA 1XB4A 3QAHA 3M8EA 1FPQA 3V7CA 3SFZA 4AR8A 3RYPA 2FOKA 2YR2A 1ZRDA 3FTXA 4CO8A 2XAJA 1B1BA 3B7RL 2K4BA 1USSA 2VC1A 1TTYA 4HF1A 4FX4A 2R59A 1IXSB 2YU3A 3Q43A 1O57A 2H09A 2ETHA 2C6YA 2PBIA 2V1XA 2EFNA 1V3FA 2GAUA 3E6DA 4XLNF 5D6EA 1HKTA 5CJ9A 3R60A 5JFRA 3QP5A 4L0YB 2A5YB 1U2WA 1J75A 1JHFA 1FWZA 1G6NA 5L3CA 4EGZA 4YFXF 3KEDA 1DUXC 3F6OA 1KA8A 3BZ6A 2IA2A 1H0MA 5CVIA 5FLXZ 1K5HA 3WGHA 3DV8A 4J3BA 1PUEE 4MEYF 2B61A 1MJBA 2M8EA 3SQNA 5E1XA 2NAZA 1RUOA 2B0LA 2CFXA 4M9SA 1R1UA 1V4RA 5LGTA 3FH5A 4YIFA 1SG7A 5EEHA 2PN6A 1SFXA 4BKXA 3FTUA 3QJXA 1R00A 3HOTA 1PDNC 1ZGJA 4K5NA 1S6LA 1IRGA 2M5WA 3LA3A 1KYWA 3CLOA 3F21A 2JRTA 4R1HA 2F5DA 4PDKA 1S29A 2XAHA 3WGIA 3W6KB 2DAOA 5HLTA 5LLQA 1YYVA 3CZGA 4ZX4A 1G4DA 1XN7A 1F5TA 3ANLA 4QPEA 3ECOA 2UXNA 2Y0MA 5D4SA 1OYWA 4K5OA 3JAMZ 3MEXA 4G9YA 3LFKA 2LSOA 1SAXA 2PMHA 4R5VA 2QZ8A 3ZI0A 5FGMA 4OIOF 1K78A 1O3SA 3T8RA 1HSJA 1TQMA 3W6JB 2VBZA 1YTYA 2DLLA 3WTZA 2DI3A 5LHGA 1R0KA 5CVUA 5ICEA 4LLNA 3KLNA 2MLKA 3KETA 1WKMA 1I1GA 2XPYA 1R58A 4K5MA 3L00A 1ZG5A 2RVCA 2XASA 5JMWA 4EQQA 5FD6A 4YG2F 5FLXK 3FZVA 5AENA 2D1HA 2M30A 4EJVA 2RNJA 4LLLA 2YPRA 3E6MA 3AUAA 4Z2YA 5BS6A 4JQFA 1C0WA 5L3FA 2QVWA 3FU3A 2ZNZA 2QBYA 1MZBA 2R7FA 3R0AA 4XMUA 5DCMA 1FYKA 2DU9A 2YX4A 4I02A 5HVQC 4UVCA 2A68F 4OU0A 4HDUA 5ICGA 1YQAA 5JAZA 4WXCA 3EBIA 4QHPA 4XMWA 4WXDA 2H94A 4L18B 1K7AA 2ESNA 4AYSA 2DO7A 1HW5A 4LB6B 3RDIA 4EM0B 4ESFA 1TNSA 2R7DA 4OOIA 2Z5UA 2XAGA 2EB7A 3JAMK 1S7AA 3T0YA 4NB5A 1RUNA 2V6CA 3O3KA 4EMSA 5H6QA 4ZYGA 3WQQA 2CYYA 5K5RA 4ZW5A 4M73A 2GXBA 3ZMSA 4FX0A 2AS5F 2VJ8A 1YW9A 4IPAA 4HLXA 2JTVA 2P7VB 3O2PE 1P6RA 1LDKB 4RS8A 3LAPA 4HZFA 2VODA 1SFEA 3P7NA 2L54A 4KN4X 5K5OA 3ZP5A 3I64A 3WGGA 4YFKF 5CVRA 3T5XA 3GUDA 2Z99A 2DQLA 3GF2A 1MGTA 3KP4A 3VVMA 4RVBA 3FWEA 4P96A 1K78B 4IHTA 2VBXA 3F23A 2JT1A 5D5XB 5CYVA 3ABUA 3ANNA 3MAJA 3FX3A 2EGHA 4Q4EA 4ZX5A 5D8LB 1ZG1A 2JCYA 1OYIA 2RN7A 3CTAA 2H6CA 3FU0A 3DP7A 2FF4A 5FB2A 3C18A 1FYLA 1LDDA 1FC3A 4IJAA 2ZKZA 2LF8A 4KT5C 3GFIA 3F8NA 3F3XA 1IZ1A 3WU1B 3ZQ7A 4Y6PA 1QZYA 3GFLA 5D6FA 1BBYA 3M8FA 4L9JA 3EBGA 4XN8A 1Y0UA 1YLFA 4M6XA 4O6JA 4CHUA 3AU8A 2RKHA 1QPMA 1IUYA 1FBQA 4EGYA 2OAZA 5CLSA 4RGXA 3WTTC 5J8FA 4Q4IA 1HKQA 3QOPA 3RC8A 3S2WA 3KEQA 3G3ZA 4IRHA 4PZJA 4WX9A 2VE8A 3CZLA 1X3ZA 3ZHXA 5FFXA 5JMPA 3QU6A 3LAJA 4U7DA 3EDPA 5HS9A 3T8TA 4IRIA 2HWVA 3RJPA 4LG0B 4IXAA 4ENKA 4XNBA 1BI0A 2R72A 3TO9A 3IL2A 3DKWA 1ZAOA 2ACJA 3EQLF 4KIFA 2NNYA 3I58A 5D5VB 2MH2A 2BGCA 4PGHA 4KA4A 1USTA 5EV7A 2HQNA 3I5UA 3K2ZA 2YSRA 2COMA 2EFOA 2ZMEA 1IW7F 3DFGA 3FF5A 2EJRA 4WCGA 3FUNA 1FT9A 1A04A 2O61A 4HQMA 3U1DA 5LRSA 2P8TA 1PP7U 3B37A 3WTWC 3ZHZA 5LBQA 2XUBA 3CO7C 3FXQA 1XGOA 3ECHA 3E6BA 3G73A 4D0PA 4AICA 2HKXA 3GFJA 5E18F 5L3GA 3B7TA 5DDGA 1CF7A 2BYVE 5DEQA 2VBWA 2O03A 3SZTA 5ED4A 1W7PD 2ZO4A 5E8IA 4HV5A 4BHBA 5E20A 5LRRA 1QQIA 1T2KA 4XNAA 2Y1EA 4U0VA 1HXDA 3A14A 4R5TA 2HS5A 2FA5A 2FNAA 1LJ9A 3AAFA 2L4AA 2KIUA 1FYMA 1FZPB 4LGWA 4ZQFA 3LWFA 3NQOA 4I7HA 3U9GA 5HLGA 2WTEA 5IT9K 4KMUX 1XCBA 1IN7A 2A7OA 4EJWA 1F9NA 2QJ1A 1R0LA 4KN7X 5BOXA 2DBBA 2G7HA 1IN8A 4UXNA 3GWZA 1JE8A 2J5PA 3HUGA 1GHCA 3WTYC 4QMEA 2RV8A 3I0TA 2W85A 5DCFA 2X0LA 3IKTA 1G3TA 2HOEA 4XSXF 4RSYA 2VLAA 3HSEA 2EK5A 1GVJA 3ERED 1VTNC 4EV0A 4Q4ZF 2W84A 1R5GA 1TNTA 2Y1FA 2RC4A 4FLOA 1G3YA 4XLPF 4AIHA 2MH9A 4Q5SF 2GA2A 3T8VA 2HZTA 4B8XA 3CHPA 3ZN1A 2PLYA 4UVAA 1B9NA 5E1WA 4OIRF 4RCVA 4L5IA 1JHHA 2VT3A 1MVYA 2CO5A 2E7WA 2MBFA 5AIPA 3B2XA 5ICFA 4G6DA 1HBXG 1WRJA 2L3DA 2WWYA 3WQRA 3T1BA 4L9VA 1J0RA 4ZW8A 3I54A 3RC3A 1FP1D 2A6EF 4N0BA 1ZYRF 1KQ0A 3I59A 2ESHA 1IRFA 2Z33A 4U88A 1FX7A 3ELKA 4O3MA 3KP6A 2H27A 1BC8C 2DQMA 1RP3A 4N9HA 1R36A 3UERA 2GWRA 2QUFA 1P92A 1CF7B 2IVMA 3WTVC 2UZKA 3FUMA 3HRSA 1LEAA 4AD9A 1U8RA 2OU2A 3WTUC 4XN1A 5IT3A 5BMZA 4A6EA 1D3YA 3ANMA 5FFZA 2G9WA 1T39A 1P4WA 3FH8A 5EEGA 1PP8F 1F1ZA 1U78A 3FULA 3HSRA 4JNDA 3CHOA 4I0AA 3U9WA 5DULA 3CHRA 2WPGA 3VEPA 3QPTA 3WODF 5JC1A 5JVTA 3LSTA 2XAFA 3I53A 2XQ0A 4XN7A 5JHUA 3NRVA 4LUPA 4M9XA 4CXFA 5KK1A 1O3QA 3CJNA 4YIIA 4HOBA 1I5ZA 1OKRA 2A3SA 2VXZA 4XO3A 3BROA 2O8XA 4XN4A 3FUDA 1YFHA 1T1SA 3LA7A 4I98B 3M9AA 3MQ0A 1R7JA 4BXUA 3FTWA 4NQWA 4TV7A 3BDDA 2NS0A 5A2QZ 1ONVA 3VVLA 4GCVA 3GZ6A 1LNWA 2RQPA 2FXAA 3GVAA 2ISZA 2ZFWA 2M87A 3CHQA 3D0SA 3HTSB 2EFWA 2OQRA 2HR3A 3DF8A 3FXRA 4P9UA 4A5NA 2L01A 2P7CB 1BN5A 4R5XA 2P6TA 4BHPA 5JBIA 1G3WA 4ETSA 1ZRCA 3SXYA 1LB2A 1Z6RA 1QBJA 5BPPA 2XRNA 3I59B 3FTSA 4CICA 4HAMA 4HF2A 3BJOA 1SQMA 2GZWA 2KIMA 3D5LA 2GTQA 3R61A 3PQJA 3CUOA 2L4MA 5HLHA 1SD4A 2Q2EA 5DUIA 4Y6SA 2GIVA 3DPTA 3O6BB 4YFNF 4KNYA 2IW5A 2E7XA 1MJAA 3KP3A 3UCQA 2Y1CA 5BPDA 2K7LA 2CSOA 3FU6A 2GQQA 2EWNA 2P6SA 4ZW3A 1BJAA 1GXQA 2DFIA 2HFHA 4EM2A 1YG2A 2ZXJA 2JD2A 2F2EA 1XDUA 5E17F 5D5UB 1KGSA 5H6RA 3CDHA 4LG0A 3GX4X 4KIGA 3CIAA 2HDCA 2VE9A 1ZN2A 4B09A 4A03A 2P5VA 5ICCA 3FUKA 2MD5A 4JBAA 2Y75A 1HW2A 5A2QK 4IHSA 4MGRA 3TO6A 1MW1A 4EJUA 2XAQA 4XO4A 2F5CA 3J81K 2CGPA 3F22A 5D4RA 2CQKA 4S04A 4GAEA 4L9NA 3Q5FA 3V8LA 4A0ZA 4A2UA 2H6BA 2DQ6A 2W57A 5FO5A 2HEOA 1KU7A 2A07F 4G8XA 4R7LA 1FNNA 1R5HA 3FXUA 1IXRC 3IWZA 4MTEA 1RNLA 2ZXGA 4ENJA 4G7ZF 5K1YA 1AOYA 3RPQA 4FHTA 1Z9CA 1MKMA 3ZMUA 1R1TA 2MAPA 1ZLJA 3DEUA 4I0BA 1HQCA 1RI7A 2XGXA 4M74A 1W7PA 2PI0A 4AR1A 4IF4A 2JD0A 4XRFA 1E17A 4GGGA 1XGMA 1XMAA 4MQ9F 4MS6A 4Y15A 2KKOA 4ZZLA 3VOEA 3GLXA 3FUIA 5ERIA 3IRQA 3PQKA 4EJOA 2Q0OA 2FSWA 1ODDA 3EBHA 1FOKA 1Z91A 3HHHA 1P4AA 3F72A 2FBHA 3BOQA 4QIRA 4M9ZA 1D5VA 2P5KA 1MW0A 3QP6A 1ZLKA 4ZW7A 3TO7A 2FQ3A 3R0IA 4WK8F 1L3LA 2L02A 3FMSA 3HHGA 2HPTA 2OZ6A 1K79A 4G94A 3H3ZA 4A0YA 5L3DA 1EH8A 2QQ9A 5HDGA 2QM3A 4OOEA 3BY6A 1XSVA 3IHUA 4UV9A 3TOAA 5DLLA 2UWMA 4IRGA 4GAAA 3C1DA 3MWMA 3V8KA 4DQ2A 4Q48A 5IT9Z 1S7OA 1KU9A 5TJJA 2AXLA 4PW4A 1YW8A 4Y6RA 1U5TA 2PEXA 5LGNA 3FUHA 2VN2A 4QLCU 3F6VA 1W5SA 2BE5F 4OMZA 4I2OA 4RB1A 1S8NA 3ZN0A 1DPUA 1R23A 4UHTA 1LQ1A 2C82A 2Q8KA 4P9FA 3UEQA 1IN6A 4RAYA 3FH7A 2PL5A 2IRFG 3K9TA 4M71A 2PUSA 2DK5A 1H9TA 3IRRA 2BEOA 4L9TA 3FMRA 3M1EA 4A6DA 1O3RA 2K4JA 1YO5C 4GO1A 4P5OA 4LJZF 3QPHA 2XV4S 2VBYA 3E5XA 2JD1A 5E1ZB 3K1MA 1B4AA 4Y13A 2KRFA 2DQRA 3F8FA 1LEBA 2LDUA 4A12A 3MFKA 5HDKA 3QU3A 4KICA 5LEKA 3HTUA 3KP2A 2XKPA 2DT5A 3BP8A 5HLIA 3WG9A 1FY7A 1W4MA 1W7PB 3GW2A 4IVNA 1U5TC 4AR9A 1ONPA 1DP7P 3NEUA 4XN2A 3KP7A 4HYEA 2OA4A 2HGCA 5BQTA 1HSTA 6PAXA 5JNLA 4LMYA 4L0ZB 2HKOA 3COAC 4BHCA 3J80Z 4RB0A 3KFWX 4CDGA 4PU2A 1ON1A 3JTHA 2K02A 3GEZA 3E5UA 1YS6A 1IN4A 5L3BA 2X4HA 2IP2A 2PQ8A 4QWQA 3ZMTA 3A06A 5HS8A 4MKTA 2M1BA 4GYIA 4LB5A 2Y1DA 4M72A 3P9CA 3OV8A 4G6QA 1B6AA 2DK8A 1LVAA 1J7KA 4GXOA 1XD7A 1FSHA 2DW4A 2TDXA 4RAZA 2KJCA 1SD7A 2JZYA 3FU5A 4CZZA 1Z05A 4DPRA 2FBKA 4XSZF 5FD5A 2FEZA 2HYFA 3WQSB 1U5TB 2OD5A 5DD4A 1H19A 4FLSA 3VFZA 1XGSA 3BJ6A 3C3WA 5J8CA 4R8HA 2DPDA 3FHZA 2BV6A 3RASA 4EM1A 1XCVA 3FMQA 4PVBA 5J6XA 2OQGA 4HLYA 3ULQB 5JR3A 1ZARA 1MJ9A 3V7SA 1SFUA 3B2PA 1Q0HA 2MA3A 3GYHX 2V1UA 3WE3A 1G3SA 4H0EA 3JSOA 2PJPA 2V79A 2NYXA 2JCXA 3ZHYA 1SD6A 2A69F 4KUMA 2DPUA 4BAYA 1UFMA 4U7BA 3J80K 1KYZA 3H92A 4AIJA 4AVPA 1X3WA 2F5EA 3HRUA 1ONOA 1HKSA 2VT2A 1WSUA 3JT1A 1QZZA 4ZYEA 4RB2C 1S46A 2PG4A 2V9VA 2E1NA 5TRDA 3I4PA 2OBPA 1ZG3A 4HV6A 4KDPA