4CXFA

Structure of cnrh in complex with the cytosolic domain of cnry
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
154
Chain Sequence
b'DADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDTFVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRAARLELARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Anti-Sigma Factor Cnry in Complex with the Sigma Factor Cnrh Shows a New Structural Class of Anti- Sigma Factors Targeting Extracytoplasmic-Function Sigma Factors.
pubmed doi rcsb
molecule keywords RNA POLYMERASE SIGMA FACTOR CNRH
source organism Cupriavidus metallidurans ch34
molecule tags Transcription
total genus 60
structure length 154
sequence length 185
ec nomenclature
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04542 Sigma70_r2 Sigma-70 region 2
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cxfA02
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 4cxfA01
2VBZA 3D5LA 5K1YA 2P7VB 5DCFA 1SD4A 1FWZA 3ABTA 2MH9A 1TBXA 2V1UA 3BJOA 1B1BA 2L4MA 1ZH5A 2EFOA 3RKYA 4JBAA 4Y6SA 1Q0LA 2D1VA 3FM3A 4Q4ZF 2Z33A 2L3DA 2HQNA 2V6CA 2OA4A 2GIVA 5FB2A 4M9XA 3RJPA 2DPUA 2C6YA 4WCGA 2PMUA 4ENNA 1T0FA 4BHCA 2QBYB 3V8KA 1YIOA 4KN7X 5JI6A 2JT1A 2JD1A 4AIHA 3GYHX 1OYWA 3F8NA 1FBSA 3LSTA 2FU4A 1Z6TA 4RGXA 2M1BA 1I1GA 3FMSA 3KEOA 4A12A 3CLOA 3VOEA 3GUDA 4U0YA 3KP4A 2FXAA 3I5UA 3J81Z 1T38A 1ODDA 4HQEA 5A2QK 1U3EM 1Z05A 4YG2F 1JE8A 4I09A 3E3VA 1KQ0A 2ZBKA 4BQAA 2YSRA 4KFCA 4A0ZA 1DDNA 3RI4A 2PFBA 1S7AA 2IJLA 2RKHA 3ANNA 2CGPA 5K5RA 4ZZDA 1R23A 2CQKA 2VE9A 1FYLA 2W84A 4ON0A 3PFIA 5CYVA 3ECHA 3WG9A 4ZQEA 1SMYF 2KJBA 3QPHA 2O3FA 3U9GA 2P4WA 3ZQ7A 5CVUA 3L00A 4IXAA 4OIQF 2TDXA 2JCXA 4ZN6A 1XMAA 5E8IA 4AYSA 3T8RA 4RGUA 4BNCA 3VODA 2STTA 3WTVC 2DFIA 3LQQA 4RAYA 1YW9A 5L3DA 1H3LA 1MJ9A 1KYWA 3HSFA 4N9HA 3MFKA 1HKQA 2W24A 2GQQA 2JRTA 2ZFWA 1ZHFA 1LDJA 1LDDA 2M45A 4L9JA 2A6EF 1L3LA 1B6AA 4OINF 1E2XA 4Y15A 3EDPA 2Q0OA 2A61A 5LGTA 1HSJA 4ETSA 3MZHA 4L5JA 4Y17A 2VODA 4ESJA 2A68F 1ONPA 2P6SA 4M72A 1ZLJA 2NS0A 3DQVC 4QLCU 1XGSA 4G8XA 2HOEA 3GZ6A 2QLZA 1P92A 1ON2A 2X4HA 1U6GA 2Z5UA 3KP3A 2QQAA 4CICA 3ZI0A 1D5VA 2EWNA 3WTXC 1RIOH 5IT9Z 4I0BA 3SXYA 3TO6A 3L9FA 3QPTA 2DAOA 2HGCA 4CGZA 4RS8A 1ZG5A 1LB2A 5ILSA 4LMYA 5ICGA 4HV5A 4GAEA 1HKTA 2A3SA 2PLYA 4EV0A 2JZYA 2D45A 4FLOA 3I58A 4B09A 2KJCA 3E5UA 1ZYRF 1UFMA 3E6DA 3MZYA 1GHCA 1QZYA 4RGSA 1FYMA 2Y75A 5J8CA 3GFJA 1JGSA 5JC1A 5JFRA 1TTYA 4CHUA 1U2WA 5J6XA 2IVMA 4H0EA 1B4AA 1IXRC 4MQ9F 2QENA 2HTJA 2QVOA 1BN5A 3V7RA 5DDGA 4HX4A 3RKXA 2L4AA 3HHGA 3NQOA 3K1NA 4KICA 1FLIA 3EYIA 2FEZA 4M74A 3IL2A 3IKTA 4OOIA 4AD9A 1X3UA 5LBQA 4AWXB 4I7HA 2V1DA 5LHIA 4RB3C 4OIRF 2VONA 1XGMA 3F72A 3RPUA 4L18B 5JR3A 2LDUA 4P55A 2OD5A 4BHBA 4LJZF 2RC4A 3DEUA 3NRVA 3VB2A 4LFUA 4IPAA 3ROUA 3GFMA 4RB0A 4YFNF 4HDUA 3HTSB 4I01A 5JO0A 4IVNA 5FFZA 3F6VA 2IA0A 3ZHYA 2M87A 2R3SA 1REPC 5HVQC 2ISZA 2BEOA 1S8NA 5AIQA 3J7AO 5ERIA 1IW7F 5E1WA 3P7NA 1PP8F 3V7CA 2XROA 1B59A 5TJJA 4KIGA 2RGVA 2VBXA 1MJBA 4EJOA 1B9NA 4NHJA 3WE3A 1Z91A 2M30A 3BWGA 3Q9VA 4IRHA 1YW7A 5HS8A 4OOFA 4HQMA 1QPMA 1RP3A 1P2FA 1MDMB 2F2EA 3R6SA 4UV9A 2DU9A 5L3EA 5F64A 4G7ZF 3GWZA 3MQ0A 4P9FA 2H27A 4D0PA 2E7XA 3WU0A 4WK8F 1XCVA 2EFWA 1GXPA 6PAXA 1W7PD 3QAHA 3IRRA 4I2OA 2COMA 3DV8A 1FT9A 4WXCA 3LAPA 2L02A 2FRHA 2FA5A 2HEOA 3BZ6A 5AIPA 3REOA 4A5MA 2OZUA 3KE2A 4HF2A 4EGZA 3FXUA 3ANLA 2V1XA 4HX8A 4FLRA 3B02A 1STZA 4KNYA 3ZN1A 2F5CA 1ZAOA 1RNLA 4LK0F 5HS9A 1XB4A 3CJNA 2QQBA 3JTGA 4JQFA 2YX7A 3BOQA 4LGWA 1F1ZA 4CYDA 1O3TA 2L54A 2W85A 2WC2A 4G6DA 2QM3A 4G7OF 1HW5A 3WE2A 4PDKA 4M6YA 3TDZC 1K78B 1FP2A 4K2EA 5FLXK 5H6RA 1G3TA 1WKMA 2KIFA 1SFEA 2P6TA 1WWXA 2H6CA 2M8EA 1O3QA 4XLNF 2G7HA 4QWQA 2MC3A 4G9YA 2H6BA 3VEPA 2F5DA 1O3SA 4GCVA 2NAZA 4EJUA 3W6KB 5D4SA 3J80Z 3HOSA 2UXNA 5L3GA 1DP7P 3HUGA 4YFXF 3ZHXA 3CZLA 4MGRA 1YS6A 3L09A 1R5HA 5BOXA 2HQRA 1UB9A 2EFNA 1J75A 4KDPA 3HOTA 4LB5A 3P9IA 1KGSA 3ULQB 3V8LA 2CO5A 1L0OC 1FSHA 1MZBA 2UXXA 2ZCWA 2AS5F 3R61A 5DD4A 3L2CA 1IRFA 5D5UB 1YLFA 4ZQHA 4L0ZB 3GX4X 1PUEE 3JAMK 1ONVA 2FNAA 3O3KA 4KMFA 3I59A 2E7WA 4B8XA 3CO6C 3HRUA 3N97A 3LAJA 2Y0MA 3WTTC 3QOPA 5LEKA 4HBLA 4KYWA 2UWMA 5D5VB 1KU3A 1W5TA 4UVAA 2Y1FA 3DFGA 2PMHA 2DK5A 1YS7A 4XBFA 2XAQA 2ZXJA 4KIFA 2JD0A 1A04A 2PJPA 1JXSA 2WPGA 2ZO4A 4KP7A 1XSDA 2ZNYA 1Y0UA 2DPDA 1G5AA 1KA8A 3PQJA 1BC8C 4YIFA 3HTUA 2WV0A 2M5WA 3E97A 5L3CA 3JSOA 4UHTA 3F23A 2XVCA 1XGOA 3M9AA 1MVYA 3E6BA 3JW4A 1IXSB 1R58A 2KIMA 5A2QZ 2JCVA 5L3FA 4UUVA 1YO5C 1P4WA 1QNTA 2LF7A 5ICFA 2LKPA 2MLGA 3K0LA 2QZ8A 1FNNA 1LNWA 3F3XA 2P5LC 4MEXF 2ESNA 1VTNC 2FMLA 1V4RA 3F8FA 4WXHA 4IHTA 3F8CA 3SQNA 4OIPF 1O3RA 4LK1F 4WF2A 3GEZA 3BDDA 2ZMEB 4P5OA 2HKXA 3QRFF 4ZYDA 3HHHA 4EQQA 1W4MA 4HZFA 1BI3A 4KN4X 4U88A 4UVBA 2G9WA 3FMQA 2GA2A 5E18F 1XD7A 3WU1B 4HLYA 3QP5A 2D2WA 3U1DA 4FHTA 4RCVA 3FF5A 2EK5A 1E17A 3RYRA 1USSA 1WRJA 2ETHA 4HLXA 3SZPA 2MBFA 4ZYEA 1MDMA 4ZH4F 2IPQX 4EGYA 1PP7U 3LFKA 1KU9A 4NQWA 5ICEA 3CUQC 1IXCA 2CYYA 4FX4A 1Q0HA 3LA3A 2NRAC 5HDKA 2LF8A 3A14A 3GW2A 4S04A 1J59A 4M9ZA 2J5OA 3GO5A 2IT0A 2KKOA 1K7AA 4LB6B 5DULA 3IRQA 1Z7UA 3E6CC 3CUQB 2YR2A 1LEAA 3N4MA 2CFXA 4O5VA 2OBPA 3G73A 4AIJA 1K6OA 1J7KA 2NYXA 4M73A 5JVTA 3LWFA 3BJ6A 5LHGA 2EFQA 1OMIA 4WXDA 1BI2A 2HR3A 2HYGD 3WTUC 2JSCA 2VOOA 2E1CA 1BI1A 1F4KA 1IF1A 2IRFG 2NNNA 4YFKF 2PN6A 3PQKA 1MW0A 3I59B 4ENMA 1DPUA 3DP7A 5FO5A 4TV7A 1JHFA 1IRGA 5KVRA 1K78A 2IA2A 3DPTA 2OQGA 3V8JA 1SC5A 5DV5A 1T1SA 3TQNA 3RDIA 4FLSA 2CW0F 4O6JA 4EJVA 2XRNA 3TGNA 3Q5FA 4BHPA 3FXQA 4L9VA 4JK1X 1XN7A 3GFLA 2P5VA 3GLXA 2P5KA 4Q48A 3WTYC 3KFWX 2RNJA 2RDPA 3ZP5A 4ESBA 1XDUA 2EV0A 2EFPA 1BBYA 3RTRA 4EJWA 1RUOA 3R60A 3I4PA 1RZ4A 1D3YA 3EYYA 5K5QA 2MA3A 3T8TA 3AU8A 2C82A 2XAGA 5BQTA 2RV8A 4GO1A 2DQLA 1D8KA 2MLKA 5E17F 1Z1DA 2Z99A 1IUYA 1ON1A 1EH7A 4PCQA 5KK1A 1C0WA 1SAXA 5FD5A 5EEHA 1ZRFA 3ABUA 3K69A 1TNTA 1Z6RA 4OIOF 4A6EA 4CO8A 2GXGA 1O7LA 3EQLF 1UCRA 2GA1A 2DT5A 2DLLA 1LJ9A 3QU6A 1U8RA 1P4XA 2YPRA 1Q0QA 4Q47A 1T39A 2XKOA 5L3BA 4N9IA 2FOKA 3UCQA 1QQIA 3FHZA 2XUBA 2L01A 1O7FA 3KP6A 2A5YB 1W7PB 3HRTA 3L7WA 4L5IA 1RUNA 1K5HA 1CGPA 2BE5F 5K5OA 5DCMB 1QO0D 1SFXA 2LNBA 3ANMA 2IW5A 1HBXG 3TDUC 2GAUA 3AAFA 4I02A 2OQRA 5ILVA 2KIUA 5CLSA 3ZMZA 3H3UA 3SZTA 2XKPA 2VT2A 1CF7A 5DD8A 2JD2A 4HYEA 4ZQGA 4ENKA 4KT5C 3VFZA 5DUKA 3DKWA 2ESHA 2FF4A 2ZNZA 4RGRA 4WX9A 4MEYF 1SD6A 4P9UA 5FLXZ 3WODF 2ZMEA 2A07F 2JPCA 1FP1D 3KZZA 1SMTA 5H20A 1IN7A 1XDSA 3K1MA 1QBJA 3WQSB 4M9SA 4LG0B 3DF8A 3FXRA 4RB1A 5BPDA 1MKMA 4AIKA 1LDKB 1S6LA 3ISPA 3D0SA 2HTSA 4OMYA 3G3ZA 4LLGF 3KCCA 4G6QA 2B0LA 3E6MA 4EM0B 1ZN2A 3WGHA 1BC7C 3R0JA 3F21A 4AICA 2E1NA 3H92A 4PZJA 2H94A 2VC1A 3UEQA 3HIFA 2JCYA 5LGNA 1TW2A 2GZWA 2EB7A 3V7SA 5CVVA 3WQQA 2VC0A 3JAMZ 2A69F 1XCBA 2HS5A 2WWYA 1KU7A 3RASA 2DI3A 4A0YA 2EGHA 3DPLC 1R0KA 1I5ZA 4YIIA 5HLIA 1T2KA 3CUQA 4ESFA 2YU3A 1YW8A 5E20A 4P96A 1F5TA 2Z9OA 3IWFA 1TLHB 3RIRA 2BV6A 3R0AA 2K4JA 4KIBA 3HSEA 3R4KA 4IJAA 1BJAA 2VE8A 4HX7A 3IWZA 5IT3A 1WI9A 5BS6A 3GVAA 1G3YA 1ULYA 4N0BA 3ZMDA 1G3SA 1G6NA 3M8EA 2ISYA 1H0MA 2P8TA 2IP2A 3GF2A 5JAZA 1GXQA 4Y6RA 3TOBA 2EV6A 3MEXA 4GGGA 4ZZLA 4UVCA 4XRFA 1K79A 1EH8A 1GVJA 1MGTA 3KZYA 1EV7A 4ZYHA 1MJAA 1MW3A 1KQ9A 2HWVA 3ZPLA 5ED4A 1MD0A 2QWWA 1J2XA 1S7OA 4M71A 2KRFA 1U5TC 3W6JB 1FSEA 2MAPA 3MAJA 5LEJA 4IRGA 2AXLA 3TO9A 1W5SA 5ILUA 3I54A 2QUFA 1IN4A 2PI0A 5D6FA 4CDGA 2XHKA 3IIEA 3MCZA 1U5TB 1ONNA 4HF0A 2QYOA 1HW2A 2G7UA 4R1HA 4CZZA 3BROA 5F1RA 4LLLA 1G4DA 3ZN0A 1G3WA 1XSVA 5JMWA 3HRMA 4R79A 4CXFA 2CSOA 4UV8A 3I64A 2PBIA 4L9NA 5E8GA 3QP6A 2VBWA 1CF7B 3BPVA 1UHMA 2FQ3A 2BYVE 1QZZA 4KUMA 5LLQA 2DQRA 3C18A 1RI7A 1SD7A 1OYYA 4OOEA 2ACJA 4GYIA 2P7CB 4Y13A 1ZGAA 2VBYA 3E5QA 2O6GE 4U0WA 5LRSA 1JHHA 3GXOA 3P9KA 1ZLKA 1AOYA 4G7HF 3ZMTA 1ZRDA 1XMKA 2ZKZA 2Y1GA 2ZJ2A 3KLOA 1XGNA 5CVRA 3LA7A 2ELHA 3ZMVA 1W7PA 4HAMA 1FBUA 2O61A 1FY7A 3U2RA 3OV8A 1SFUA 2F5EA 4EJTA 4PGHA 1R1TA 2PEXA 1YG2A 1R1VA 5D8LB 3OOPA 1LEBA 3RYPA 5DCMA 2ADUA 2FBKA 2DTRA 4GYGA 4EMSA 4KA4A 3AU9A 1IN8A 2VN2A 2EA4A 5JMPA 3EETA 5D5XB 4Y6PA 2EJRA 3HYIA 4S05A 3CZGA 1TNSA 3WTWC 1YQAA 3SFZA 3FWEA 3A06A 3J81K 1T98A 1YFHA 2FE3A 3JTHA 1KYZA 5HLGA 4KMUX 1BIBA 4A03A 3ERED 1T6SA 1HSTA 3CTAA 1PDNC 2R7FA 3F8BA 2GXBA 1TQPA 5FFXA 1MW1A 2JPBA 4U0VA 2XAHA 1OYIA 1JG9A 4PGGA 1P6RA 1BM9A 4WWCA 2O03A 3V4GA 4Q5SF 1V3FA 4F7ZA 5BPIA 4LLNA 2V9VA 4LG0A 1BIAA 3I0TA 2HYFA 2CG4A 2H09A 1S29A 1OPCA 4XLPF 3S2WA 2EV5A 5D6EA 2HDCA 1FBQA 1LQ1A 4ENJA 4A5NA 2Q8KA 4R8HA 1R00A 3WQRA 1TQIA 5D8KB 4HA8A 3BY6A 2XV4S 2RVCA 4HOBA 3GZ5A 1AWCA 5LHHA 5H6QA 3MWMA 2FNPA 1LVAA 4MNUA 4DQ2A 3EUHA 3RKWA 2RN7A 1MW2A 1T1RA 1HQCA 2OU2A 3RPQA 4OMZA 1HKSA 1I27A 2QQ9A 3M1EA 2K7LA 1WSUA 3F6OA 1U78A 4XSXF 5BMZA 4RB2C 1R7JA 3COAC 3CZEA 2IA1A 4EM2A 2GWRA 2K02A 3O2PE 3KLNA 5DUIA 3WTSC 4XSZF 1R5GA 3DXJF 4HW0A 1S46A 4RAZA 4LUPA 2O8XA 2JTVA 5HOOA 4E70A 3T1BA 3ML6A 2O7GA 5IT9K 1UHWA 2OZ6A 4BH9A 3R0IA 3WGIA 3ECOA 1IN5A 4ZYGA 5AONA 5F6FA 4EM1A 3FZVA 1KQ8A 3IHUA 3HSRA 3P9CA 5EEGA 2W57A 3BJAA 4I98B 3LQRA 1HXDA 2FBHA 3ZHZA 4FLQA 2BBYA 1DUXC 3F8MA 4I0AA 4ZQFA 3BPXA 3CDHA 1I1SA 4IHSA 3GFIA 3TOAA 4U7BA 1ZG1A 5TRDA 5CVJA 3UERA 3TKYA 2J5PA 2EA2A 4HDVA 1IAWA 5E1ZB 1U5TA 1BI0A 5HS7A 3KETA 1DPRA 4BXUA 5HDGA 2A6HF 4O3MA 4MTDA 4FX0A 1Z9CA 4MHGA 3F22A 3WGGA 1J9IA 3B73A 5J8FA 1ONOA 4FT8A 2CWEA 2XGXA 1FYKA 4U7DA 3ZMSA 5ICCA 1R1UA 2MH2A 1J0RA 1H9TA 5JNLA 5HDNA 2Z3YA 2BGCA 2Y1CA 4BAYA 1P4AA 1JVSA 5CJ9A 3C3WA 2FMYA 2DO7A 3I53A 4IF4A 1Q1HA 4LD5A 3T5XA 2D1HA 2QBYA 2VOPA 2RQPA 1IN6A 3KP5A 5FD6A 4UXNA 3Q9SA 3KP7A 1F9NA 1TW3A 2NNYA 1B9MA 5LGUA 2K27A 3ELKA 2HZTA 2HFHA 2XIGA 2LSOA 4MTEA 2Y48A 1TQMA 3QU3A 3C1DA 2F5FA 4A6DA 3AUAA 2DW4A 3ZMUA 4NB5A 2K4BA 3FX3A 3CO7C 4DNCA 4L0YB 1FOKA 1FZPB 2FBIA 2PQ8A 2XAJA 4Z2YA 2WTEA 3HRSA 1R0LA 3M7GA 1KU2A 5DYMA 2DBBA 3H3ZA 4G94A 1ZGJA 2FSWA 3E5XA 4BYYA 1S3JA 3LA2A 4IRIA 2X0LA 5FGMA 2Y1DA 2OAZA 2MD5A 4GXOA 1JGIA 3BP8A 1O57A 3CUOA 1ZARA 5D5WB 4EVIA 2Q2EA 3K1PA 1H9GA 2XASA 2PG4A 3TO7A 5JBIA 3KP2A 1USTA 3M8FA 3FM5A 3SHFA 2VXZA 1FPQA 2R7DA 1YYVA 1HW1A 1R22A 2STWA 1XSXA 1R36A 3CZKA 2HKOA 4AVPA 1FX7A 1WQ2A 1ZG3A 4UNOA 1I6XA 3O6BB 1OKRA 3IC7A 5HLHA 1FC3A 3KEQA 2VT3A 5CVIA 4L9TA 2DK8A 2Y1EA 3T0YA 3J80K 1NHAA 3NEUA 2W25A 3I71A 4HF1A 1ZS2A 1YTYA 2K86A 3IKVA 4ASNA 4HV6A 1EH6A 3K9TA 3C7JA 4A0XA 1BOAA 5D4RA 1OR7A 1D8JA 3FMRA 1J5YA 2V79A 4OU0A 3WTZA 1QGPA 5E1XA 5JHUA 4M6XA 5DEQA 2YX4A 4A2UA 1ZREA 2UZKA 3K2ZA 4Y67A 1IZ1A 3JSPA 1ZRCA 1SD5A 5LRRA 2XAFA 2O0YA 4MQVA 2MAOA
chains in the Genus database with same CATH superfamily
3S32A 2VBZA 3D5LA 3J7YJ 5K1YA 3FUEA 3AKZA 2P7VB 5DCFA 3VSLA 1S9HA 2DA3A 2I8DA 5E3NA 1SD4A 4OAZA 1FWZA 3ABTA 2MH9A 3FH5A 1TBXA 2V1UA 3BJOA 2HDDA 1B1BA 2L4MA 1ZH5A 3GTKJ 2EFOA 2BVMA 3RKYA 2X6XA 2ZSHB 2NVYJ 1VFCA 3FH8A 3PSFA 4JBAA 4Y6SA 1Q0LA 2D1VA 3FM3A 2DJIA 4Q4ZF 2Z33A 2L3DA 5J1UA 2HQNA 2V6CA 2OA4A 3DPUA 3TW6A 2HVSA 2GIVA 5FB2A 4M9XA 3RJPA 2DPUA 2C6YA 4WCGA 2PMUA 3I3LA 4ENNA 1T0FA 4BHCA 2QBYB 3V8KA 4F55A 1IGNA 4AU7A 1YIOA 3J7AY 2E2IJ 4KN7X 2YU9J 3GTOJ 2X6WA 3CCEI 4C9YA 3HPHA 5JI6A 3CCUI 2B61A 2JT1A 2TCTA 1I50J 2JD1A 4AIHA 3GYHX 1OYWA 3FU3A 1MMGA 3F8NA 1FBSA 3LSTA 2CMPA 2FU4A 1OQYA 1Z6TA 1MNDA 3FIWA 1SFOJ 3A03A 4RGXA 1WPKA 2M1BA 1W1WE 1I1GA 3DKXA 1ZKGA 2ID3A 3FMSA 4R5XA 3KEOA 4A12A 3CLOA 3QYFA 3VOEA 3GUDA 1DGRM 5C44J 1RR7A 2VXDA 4U0YA 3B37A 1TT0A 3KP4A 2PL5A 2FXAA 3I5UA 3J81Z 1T38A 4IHXA 2R5YB 1ODDA 3UKGA 4HQEA 5A2QK 1WH7A 3FXMA 1U3EM 2HNHA 4FE4A 1Z05A 2KRCA 4YG2F 3TMOA 1JE8A 4I09A 3E3VA 1KQ0A 2ZBKA 4BQAA 1YIJI 1FJLA 1A6QA 2YSRA 4FETA 2OCEA 2LBFB 3JRAA 4KFCA 3A0BC 4A0ZA 1DDNA 1R4MB 3RI4A 2N8GA 2PFBA 3H5RA 1S7AA 2IJLA 2L5QA 2RKHA 4HSTA 3ANNA 2CGPA 5K5RA 1H8AC 3FULA 4ZZDA 1R23A 2DA2A 2CQKA 2ELKA 2VE9A 3G1LA 3SEQA 5CPRB 1FYLA 4Q4IA 2KT0A 2W84A 4ON0A 3SJMA 3PFIA 5CYVA 3ECHA 3WG9A 4ZQEA 1SMYF 2KJBA 3QPHA 2O3FA 3U9GA 2P4WA 3TBIA 3ZQ7A 5CVUA 3ERMA 2JRMA 3L00A 4IXAA 4OIQF 2LFBA 1PUFB 2TDXA 2JCXA 4ZN6A 1XMAA 5E8IA 4AYSA 3TP0A 3HL2A 3FUDA 1OCPA 3T8RA 2JA7J 4RMNA 4DBQA 1X4PA 3H35A 4RGUA 2NXNB 4BNCA 2Y0SA 4K5MA 3VODA 1UZCA 4NC6A 4DZJA 2STTA 4DYRA 2ZC2A 3WTVC 2CFOA 1N77A 2ZXHA 2DFIA 4OAYA 3LQQA 2EPFA 4RAYA 1YW9A 2Z16A 4CH7A 2HQ5A 3GTJJ 1UG0A 3HUGB 5L3DA 1H3LA 3LL7A 2V9PA 1MJ9A 3M4OJ 1KYWA 3HSFA 4N9HA 5F1JA 3FDYA 1X1BA 2QGUA 2RQQA 3MFKA 4XMZA 1HKQA 2W24A 2GQQA 2JRTA 2ZFWA 4C3IJ 2EH3A 4KITB 1LPQA 1ZHFA 1D1CA 1LDJA 1LDDA 2KPMA 5IY5H 2M45A 4IQJA 4L9JA 1MH3A 2A6EF 4C30A 1L3LA 3S14J 1BA5A 1B6AA 3F0CA 2HDWA 4OINF 3CC7I 2VI6A 3FUFA 1E2XA 1NTCA 4Y15A 4AYBN 1H19A 3EDPA 4DJAA 2Q0OA 3G71I 3CC4I 3B7TA 2A61A 5LGTA 1HSJA 4ETSA 3MZHA 4L5JA 4Y17A 2E2HJ 4ESJA 2VODA 2A68F 4BKXA 2GTQA 2V4JC 1ONPA 4JYKA 1ZR2A 3Q0UA 1V55H 2P6SA 4CCMA 4BU2A 4M72A 1ZLJA 4HSRA 1GW6A 4PU2A 2NS0A 5K7FA 4JX4A 3DQVC 1A5JA 4QLCU 1XGSA 4G8XA 1WGXA 5FWQA 2HOEA 3PL8A 1VQ7I 3GZ6A 4K5PA 2QLZA 1P92A 1ON2A 2X4HA 1U6GA 2Z5UA 3KP3A 2HVQA 2BY3A 2QQAA 1R49A 2VL8A 3H0DA 3PSIA 2M3AA 4CICA 4F3QA 3ZI0A 1TZLA 5B5EC 1D5VA 3BR0A 2EWNA 1VQ4I 2R7QA 3WTXC 1RIOH 5IT9Z 4I0BA 3SXYA 3TO6A 4D7MA 3L9FA 3QPTA 2DAOA 3N05A 2HGCA 4CGZA 4RS8A 1ZG5A 1LB2A 3KEYA 2IGMA 5ILSA 1ETKA 4LMYA 4XKCA 5ICGA 4HV5A 4GAEA 1HKTA 2A3SA 3QPSA 3FHNA 2PLYA 1I3QJ 4EV0A 5GTHC 5KAFC 3HOYJ 2JZYA 4CCOA 3DTEA 2D45A 4FLOA 4BGDA 3I58A 4B09A 3AG1H 3GTMJ 2V6EA 2BXZA 3KIOA 5EG0A 5IYDJ 2KJCA 3OYMA 3E5UA 1ZYRF 1UFMA 2DDBA 2EINH 3E6DA 3FKIJ 3MZYA 1GHCA 3DBHB 1QZYA 2OV7A 4RGSA 1FYMA 2Y75A 5J8CA 3GFJA 1JGSA 5JC1A 5JFRA 4D5CA 1TTYA 2WB1N 4CHUA 2XPYA 1U2WA 1DQUA 3M8JA 2IVMA 5J6XA 4H0EA 2KQRA 4YRVA 2RJIA 1B4AA 3X2QH 5KAIC 1IXRC 5AENA 3CHSA 4MQ9F 1V5EA 2QENA 3HDDA 2HTJA 2QVOA 4A3GJ 1BN5A 1WJEA 3V7RA 5DDGA 1R71A 4HX4A 3RKXA 2CW7A 2L4AA 3HHGA 3K7AJ 3NQOA 3OR2C 3K1NA 4KICA 1I6HJ 3EYIA 1FLIA 2PUSA 2FEZA 4M74A 4AIDA 1G59A 3TEDA 1M1EB 2BXYA 3IL2A 3K4JA 3IKTA 4OOIA 2GOMA 4AD9A 1X3UA 1FMWA 5LBQA 3K70C 3H36A 4AWXB 3D5SC 2HVRA 1DGWY 4I7HA 2V1DA 5LHIA 4RB3C 4OIRF 2VONA 1XGMA 4V2FA 1HA8A 2VPLA 1T08B 3F72A 1ETWA 3RPUA 3ESWB 3JRIA 4L18B 1IG7A 4AYBA 5JR3A 2LDUA 4YEJA 3GMEA 2M7AA 4P55A 3NWTA 1JI8A 4NC7A 4XNAA 2OD5A 4BHBA 5DM6F 2QSGX 1I39A 1XC5A 4LJZF 2RC4A 2JJ7A 3DEUA 2EIKH 3NRVA 5FKLA 1YX3A 4LFUA 3VB2A 4IPAA 3ROUA 4UUSB 4ZX4A 3GFMA 4RB0A 4YFNF 2BOLA 2DQ6A 4HDUA 2E36A 3HTSB 4I01A 1B72A 5JO0A 3SEZA 4IVNA 5FFZA 3F6VA 2IA0A 3Q0VA 3ZHYA 2M87A 4M3FA 2R3SA 1REPC 5HVQC 3WG7H 2DA5A 3FK7A 1G8XA 5DTDA 2ISZA 3JRBA 2BEOA 1S8NA 1MIJA 5AIQA 5IYBJ 4ANJA 3J7AO 5ERIA 1IW7F 5E1WA 4UB6C 2XGCA 3P7NA 2HOSA 1PP8F 3V7CA 2XROA 4D1QA 1XX5A 1B59A 1ETYA 1OCRH 3CHQA 2ZJQF 5TJJA 4KIGA 3HOZJ 3BTCA 1SANA 1T56A 1TWGJ 3OYBA 2RGVA 2VBXA 1MJBA 1H88C 1FTTA 2HPIA 4EJOA 1B9NA 1MBGA 3WE3A 4NHJA 3VVMA 1Z91A 2M7BA 2M30A 1YI2I 4JNDA 1UHSA 5GPAA 2DQMA 3BWGA 3Q9VA 4IRHA 1TC3C 1YW7A 5HS8A 4OOFA 3QPLA 3C2GA 3FBIB 4HQMA 1QPMA 2QKMB 4A3KJ 1RP3A 1P2FA 1MDMB 2F2EA 3R6SA 3OYFA 3FUHA 3FTXA 4UV9A 1QU3A 2DOEA 2X85A 2ME6A 1D1AA 2DU9A 5L3EA 5F64A 4G7ZF 3RKQA 4NQWB 4BY1J 2X51A 3GWZA 3MQ0A 4P9FA 2CUEA 2H27A 4D0PA 2E7XA 3WU0A 3A01A 4XR6A 1XG1A 4WK8F 1XCVA 2EFWA 4F92B 2K9NA 2VLAA 4FISA 1GXPA 2AQFA 1W36D 6PAXA 4CSWA 1VQPI 1W7PD 3QAHA 3IRRA 4I2OA 2COMA 3DV8A 3BQZA 1BW6A 1FT9A 4WXCA 3L2QA 4IQ4A 3PJRA 3LAPA 2L02A 2FRHA 4C2TA 2FA5A 4RDUA 3BZ6A 5AIPA 1RKWA 3REOA 2XRLA 3I56I 2HEOA 3FTYA 4EATA 4A5MA 3MKZA 3S1RJ 3FTSA 2OZUA 3FXJA 5J4VA 3SZGA 3LMMA 3HKZA 4M3BA 3L2WA 3KE2A 2DYSH 4HF2A 4EGZA 3FXUA 4G12A 3ANLA 2X1EA 3C2BA 1FOXA 2V1XA 4HX8A 4FLRA 2EZKA 2R5YA 2CU7A 3B02A 4N4OB 4ZTFA 1JTYA 1STZA 3BT9A 4RLQA 4KNYA 3FTVA 1YJNI 4ZW7A 1D0XA 3FHEA 3ZN1A 2F5CA 2LMDA 4B44A 2W7NA 1ZAOA 1NH3A 1RNLA 2W48A 4XN9A 4BE2A 4LK0F 1X58A 5HS9A 1BL0A 1XB4A 3CJNA 2QQBA 2DT6A 3RQ4A 3JTGA 4JQFA 4U87A 2YX7A 3BOQA 4LGWA 1OISA 1F1ZA 2IS6A 5E79C 4CYDA 1O3TA 3AFHA 2L54A 2W85A 1U9OA 1YX5A 2WC2A 4G6DA 3QQAA 2QM3A 4G7OF 1HW5A 1W0UA 3WE2A 3AL0C 4PDKA 4MKTA 2ZJPF 1E3PA 3JRGA 1NK3P 4M6YA 3TDZC 1K78B 2BY1A 3S3MA 1FP2A 4K2EA 5FLXK 2W4SA 5H6RA 1U0JA 1G3TA 1FMVA 4BQQA 1Y0NA 1WKMA 2KIFA 4BXFA 5GP9A 2LC2A 1SFEA 2P6TA 1BR1A 1PUFA 4A3LJ 1HDPA 1WWXA 2H6CA 1LKXA 2EILH 2M8EA 2DA4A 1O3QA 1MNMC 4XLNF 5EGOB 3P5JA 2G7HA 4QWQA 4XLAA 3HOVJ 2MC3A 4YELA 3H9GA 4G9YA 3B7UX 3AL0B 2H6BA 3VEPA 1NG7A 4CZCA 3S2HJ 2F5DA 1O3SA 1YHQI 4GCVA 2NAZA 4EJUA 3W6KB 5D4SA 1QA6A 2PX9A 3PUBA 2L9VA 3J80Z 3OYIA 3HOSA 2UXNA 5L3GA 2IS1A 1DP7P 3HUGA 4B1RA 4YFXF 3ZHXA 3CZLA 4MGRA 3RZOJ 2FOWA 1YS6A 3L09A 5FKOA 1R5HA 3OYGA 5BOXA 2HQRA 5E3OA 1YE9A 1UB9A 2EFNA 1J75A 4KDPA 3G6EI 5FLVA 5EG0B 3HOTA 4LB5A 5TGTA 2XPUA 5F08A 3P9IA 4PUSA 2P0WA 2BW3B 1KGSA 3ULQB 3V8LA 2CO5A 2F4OB 1L0OC 1FSHA 4A93J 3U21A 2LOOA 1MZBA 2UXXA 2ZCWA 2QSHX 1MW7A 2AS5F 3R61A 5DD4A 2HOTA 3KZIC 4MFDA 3L2CA 3I4MJ 1IRFA 5D5UB 2K40A 1YLFA 1ETXA 4BE0A 3DEEA 2LRDA 4L0ZB 4ZQHA 1UMQA 2ID6A 3GX4X 1AU7A 1PUEE 3J7ZI 2A05A 2L9NA 4XN3A 3JAMK 3BG7A 3CCQI 2BY2A 1ONVA 1JJ6C 2CW8A 2FNAA 3O3KA 4KMFA 1WJAA 1VQ8I 4A3BJ 1HS6A 3I59A 4RAFA 2E7WA 3IAM2 3I55I 2LH9A 4B8XA 5BPPA 3CO6C 5IP7J 1H89C 2LY9A 3HRUA 3N97A 1IJWC 3CZ6A 5EZGA 3M3YJ 2HYJA 1X1AA 3LAJA 4QTRA 1APLC 4XN7A 2Y0MA 3OYCA 3S8PA 3DTIA 3WTTC 3OL3A 3QOPA 5LEKA 4HBLA 5FRNA 1IV8A 5IOYA 2K9QA 4KYWA 2A7OA 2UWMA 5D5VB 2FFLA 2LREA 3ABMH 1KU3A 1W5TA 4B4CA 4UVAA 3RC3A 2Y1FA 1E0EA 3DFGA 2PMHA 2DK5A 2EBIA 1HOMA 1YS7A 3U9WA 2CQXA 3D5RC 2V26A 4XBFA 3HGGA 2XAQA 2DA7A 2ZXJA 3CF5F 4KIFA 2JD0A 2DJNA 1A04A 2PJPA 1QZEA 1JXSA 3OIPA 1MMNA 2WPGA 1HCRA 2ZO4A 4KP7A 1XSDA 3VSKA 2ZNYA 2K9LA 4RLFA 4XLCA 4QIWN 1Y0UA 4I76A 2DPDA 3CIAA 2FQ4A 2EIJH 3AG4H 1IRZA 1G5AA 1KA8A 2W00A 3PQJA 1BC8C 3DLAA 4YIFA 5CKTA 3OIOA 2CV1A 5BNGA 3H0GJ 3HTUA 2WV0A 1JUMA 1BOBA 2DT7B 4AVZA 3L2VA 1WCMJ 2XGEA 4AR1A 2M5WA 2OTLI 2X9DA 3E97A 2VKVA 5L3CA 2V7FA 3DKYA 1R6RA 3JSOA 2XAUA 4UHTA 3F23A 2XVCA 1XGOA 3M9AA 1MVYA 3E6BA 3JW4A 4HEA2 1IXSB 1R58A 2KIMA 5A2QZ 2JCVA 5L3FA 4UUVA 1YO5C 1P4WA 1QNTA 2LF7A 5ICFA 4PSWA 2LKPA 5M5WJ 2LR8A 2MLGA 3A01B 5DS9A 5CQGA 2VJIA 1DU0A 2KL4A 2ZMEC 3K0LA 2QZ8A 1FNNA 1LNWA 1X3ZB 3F3XA 4XNBA 3AG2H 3G4SI 3D1NI 2M9HA 2MYSA 2HI3A 4X0GA 2P5LC 3PO2J 4MEXF 2ESNA 2FMLA 1V4RA 5HLTA 1VTNC 3F8FA 4PJMA 4WXHA 2HQAA 5M5XJ 3FU0A 4IHTA 4BXXJ 3F8CA 2EIMH 3SQNA 4OIPF 4UUSA 1O3RA 3IUOA 5F27A 4LK1F 2BVLA 4WF2A 3Q44A 1MH4A 3GEZA 2C5ZA 4BQNA 2DTZA 2ZMEB 3BDDA 5IP6A 4P5OA 4MO7A 2QVWA 2HKXA 2M4GA 3QRFF 4ZYDA 4X2UA 3DBLB 1SVLA 2CUZA 3HHHA 3RSNA 1JKOC 4EQQA 1Y1WJ 1W4MA 4HZFA 2V9KA 4QSHA 1BI3A 3FKJA 4KN4X 4U88A 4ZDLA 4UVBA 4BS9A 1A35A 2G9WA 3FMQA 2DXIA 3VPRA 2GA2A 5E18F 3QJXA 1XD7A 1X1DA 1ITYA 3HPGA 3WU1B 4HLYA 1YJWI 1MBHA 3TP3A 2JV7A 1PVEA 3QP5A 2D2WA 3U1DA 1ETQA 2IGOA 3BCBA 2QJ1A 4GDFA 5M5YJ 2JN6A 3OSFA 2ICWG 4FHTA 2K5CA 3B7SA 2M8GX 2ZFUA 2CS3A 2X1DA 4RCVA 3FF5A 2EK5A 1E17A 3RYRA 3FU5A 1USSA 1WRJA 2X1CA 2ETHA 4ZW8A 1VF9A 2ME0A 2AXTC 5GAHJ 1R4NB 4HLXA 3SZPA 2MBFA 4ZYEA 1MDMA 4II2A 4ZH4F 2IPQX 1V5FA 1OLTA 1D5YA 4K5LA 3CP2A 3FXKA 1GT0C 4EGYA 1PP7U 1D0YA 3LFKA 1KU9A 4NQWA 3S3NA 5ICEA 3CUQC 3VWBA 1IXCA 2CYYA 4XLEA 3PUUA 2EZLA 4FX4A 3H9QA 1YOVB 1HC8A 1Q0HA 3LA3A 2NRAC 3VYUB 2DA6A 5HDKA 2M0MA 2LF8A 3A14A 2XPVA 4E4HA 3GW2A 1B8IA 4S04A 1J59A 2DMUA 4M9ZA 2J5OA 2M0CA 3GO5A 2ZSIB 1TWFJ 2IT0A 2KKOA 1RR8C 1S5LC 1K7AA 1BW5A 5LD2C 2ZXWH 5GTIC 4LB6B 4CYCA 3ZQLA 3CLQA 4BJ5C 5IOZA 5DULA 3IRQA 1Z7UA 2X6YA 2R7RA 3E6CC 3CUQB 2YR2A 1LEAA 3N4MA 2CFXA 2FUG2 4O5VA 2OBPA 3OYLA 1CQTA 2DMTA 3G73A 2ZXIA 3Q0WA 4AIJA 1RPWA 2Y69H 1K6OA 4E7ZA 1J7KA 2NYXA 4M73A 5JVTA 2GBYA 3LWFA 3BJ6A 5LHGA 2EFQA 1OMIA 3H1CA 4WXDA 1BI2A 4F93B 2HR3A 2HYGD 1VQNI 2R59A 4Y33A 3F9KA 3WTUC 1DP3A 3CDIA 3BR5A 2JSCA 4L2LA 2VOOA 3W2VA 1BI1A 4E7SA 2E1CA 2DFEA 2MW8A 1F4KA 1IF1A 2IRFG 2NNNA 2DFHA 3BR6A 4YFKF 2PN6A 3PQKA 2KZVA 1MW0A 3I59B 4ENMA 1DPUA 1WVRA 3DP7A 3CCSI 3BR2A 4M6VA 4XKBA 2M4KA 4Y52J 2X6OA 1R5ID 4E7JA 5FO5A 4TV7A 3FISA 1JHFA 2NVQJ 4XORA 4Y7NJ 1IRGA 2MABA 5KVRA 1K78A 3JRFA 3KPHA 2IA2A 1GV5A 3DPTA 5EZHA 3PNYA 4XN4A 2BY0A 2OQGA 4R7LA 3V8JA 1SC5A 3OYDA 5C4JJ 5DV5A 5EGOA 1T1SA 1MBJA 3TQNA 2LYCA 3RDIA 1HLVA 4FLSA 2CW0F 4O6JA 3O8GA 4EJVA 2DMQA 3FK6A 2DDAA 2XRNA 3TGNA 1OCTC 5F04A 3Q5FA 4BHPA 1JGGA 4BBSJ 3FXQA 4L9VA 2IGKA 2MFZA 4JK1X 1XN7A 3GFLA 2P5VA 3H5AA 3GLXA 2P5KA 4Q48A 3CHRA 4NBQA 3WTYC 3KFWX 4PK4A 1WJ5A 2BW3A 2VQLA 2L7MP 3O8HA 4E7LA 1T8IA 1FEXA 2RNJA 2RDPA 3ZP5A 4ESBA 1XDUA 3PM1A 2R7XA 2EV0A 2EFPA 1BBYA 4PJLA 3RTRA 4EJWA 4HNVA 4RM3A 4CCKA 3K4KA 3G2BA 1RUOA 3R60A 3I4PA 3A0HC 3B2XA 2OPTA 2WY7Q 3S16J 1RZ4A 1D3YA 1RETA 5FKNA 4BBRJ 3CHOA 4XRSA 3BG6A 4GAAA 1MNEA 3KYCB 3HM5A 3EYYA 1YITI 5K5QA 2MA3A 1VNDA 1MMSA 3T8TA 4CCLA 3AU8A 4PVBA 3L2RA 2C82A 2XAGA 4BQOA 1ENHA 5C4XJ 5EYRA 2L0KA 5BQTA 4Q4EA 2RV8A 4GO1A 2DQLA 3A4CA 1D8KA 2MLKA 5FRMA 1Z1DA 2Z99A 5E17F 2PMZN 1IUYA 3B34A 3Q43A 2RREA 3QYBA 1ON1A 1EH7A 3LSKA 4PCQA 1BJZA 5KK1A 1IV6A 3NARA 1C0WA 4ARFA 1SAXA 5FD5A 5EJCA 5DLLA 1AKHB 2JQ7A 3BR3A 5EEHA 1ZRFA 3ABUA 3PFYA 3K69A 1TNTA 2PGGA 1SVOA 1Y1VJ 3HBLA 1Z6RA 4OIOF 4A6EA 5J47A 1HF0A 4DBRA 1XPXA 4XKWA 4CO8A 4JP0A 2GXGA 1EJ9A 4PFOA 2Y9ZA 1O7LA 3EQLF 4BDYA 3IH2A 1D1BA 1UCRA 4C3JJ 2GA1A 2DT5A 5M3FJ 2XB0X 2DLLA 3K4NA 2QCOA 2XGDA 2CQ7A 1W36C 1LJ9A 4HG2A 5HNFA 2QA4I 3SDGA 3ABLH 4QIRA 3QU6A 1U8RA 1P4XA 2YPRA 1Q0QA 4Q47A 1T39A 5EF6A 1MMDA 2VQGA 3JREA 3FTWA 3GLLA 3FXLA 4XICA 2XKOA 5L3BA 4N9IA 1T95A 2FOKA 3UCQA 2JVHA 3S1NJ 1SAUA 1QQIA 1P7IA 3FHZA 4LIVA 2VIXA 2XUBA 2L01A 1A36A 1O7FA 1SFKA 2ECCA 3KP6A 2A5YB 1TWAJ 1W7PB 2WAQN 3HRTA 1OCZH 3L7WA 1WJDA 2F6CA 3BTLA 1Y39A 3OYAA 3GTQJ 4L5IA 3DCFA 4KISA 4DW6A 1V54H 1RUNA 3DLLF 1K5HA 1CGPA 2BE5F 5K5OA 4S0HB 5DCMB 2K3FA 1QO0D 1SFXA 4DOZA 5JVGF 5CQEA 2LNBA 3ANMA 2IW5A 4ZC3A 1Z3YA 2K9MA 1TL8A 3W6VA 1XTAA 1HBXG 3TDUC 1IC8A 2GAUA 3AAFA 1X4OA 4I02A 2OQRA 5ILVA 2KIUA 5CLSA 3ZMZA 3K70D 3H3UA 3SZTA 2XKPA 2VT2A 3ZQHA 1XS9A 3CJQB 1CF7A 4XO3A 1B8IB 5DD8A 1X3ZA 4KT6A 3CCMI 4IX7A 2JD2A 2XF5A 4HYEA 2OUMA 2WB1A 4ENKA 4CYCB 4KT5C 5FKKA 4ZQGA 3VFZA 5DUKA 1RC9A 2LTPA 3DKWA 4QUOA 2HZDA 1LE8B 2ESHA 4JX5A 2FF4A 2ZNZA 3BQYA 4RGRA 4WX9A 4MEYF 2O7OA 1SD6A 3S3OA 4P9UA 3K2AA 5FLXZ 3I4NJ 4IOAF 3OIQA 4PJJA 3WODF 2ZMEA 2A07F 3OYEA 2JPCA 1RESA 4FASD 3ZQIA 1FP1D 4AR8A 3KZZA 2VB6A 1SMTA 1OCOH 5H20A 2VJ8A 1IN7A 4RSYA 1XDSA 3FUKA 1VQKI 3K1MA 3K10A 1QBJA 3WQSB 3MKLA 4M9SA 4M3GA 3DF8A 3FXRA 4RB1A 5BPDA 4LG0B 3H3VK 1I3AA 3CMEI 1MKMA 2KIQA 2E5NA 4AIKA 1LDKB 1S6LA 3ISPA 2AQEA 3D0SA 2HTSA 3K4MA 4OMYA 3G3ZA 2M2EA 4XIDA 2CRGA 2LK2A 1Z77A 4LLGF 1ZTRA 3KCCA 1WFXA 4R5TA 4G6QA 2B0LA 3E6MA 5GADJ 2LVSA 4Y4RA 4EM0B 4XQFA 1ZN2A 3IP4B 2LY2A 4NNJA 1ACIA 3WGHA 1BC7C 3R0JA 3TL4X 3OY9A 3MVPA 3F21A 4XK4A 1LVKA 3EUHC 4AICA 2E1NA 3VYTB 1IDZA 2HPTA 3H92A 2K3PA 2H94A 2VC1A 4PZJA 4QPOA 5KHDA 3UEQA 1SQMA 4II3A 3HIFA 2JCYA 4C3HJ 5LGNA 1TW2A 2GZWA 4JOMA 2EB7A 3LFUA 5CVVA 3V7SA 4FCYA 3OWTA 1FIPA 4XN2A 2VC0A 5F0CA 3JAMZ 3WQQA 2A69F 1XCBA 2HS5A 3S93A 2WWYA 1KU7A 3RASA 2DI3A 2Q1ZB 3M07A 4A0YA 3HJEA 3A02A 4BEHA 4D5FA 2EGHA 3DPLC 1VQLI 1R0KA 3B6CA 3EBIA 1I5ZA 4YIIA 5J40A 5HLIA 3OS0A 4IZZA 5IP9J 1T2KA 5J4YA 4M3DA 4XN0A 4ZX5A 3CUQA 1JT6A 4ESFA 1SVMA 2OCCH 3CMAI 1X1CA 2YU3A 1YW8A 2COBA 5E20A 3BR1A 4P96A 1Q1VA 3OYKA 3KEDA 4BY7J 1F5TA 2Z9OA 3IWFA 1TLHB 4IOCF 1V5GA 1G2HA 3RIRA 3FTZA 3OYJA 2BV6A 2P81A 2LY1A 1QHGA 3IH3A 2K4JA 3R0AA 4KIBA 4CCNA 3HSEA 4D7NA 3R4KA 3CCLI 3HXLA 4IJAA 4PJNA 1BJAA 2VE8A 4ZTJA 1GDTA 4XNDA 4HX7A 3IWZA 5IT3A 1WI9A 3S1MJ 2GOXB 3CHPA 5BS6A 3GVAA 1G3YA 1ULYA 2V1NA 4N0BA 3ZMDA 4C2MJ 1G3SA 2WBMA 1G6NA 3M8EA 2ISYA 2WADA 1H0MA 2R70A 1Z67A 2P8TA 2IP2A 3GF2A 4BJTA 2O5RA 4A3CJ 5JAZA 1GXQA 4Y6RA 2VPRA 3TOBA 2EV6A 4DGWB 3MEXA 3ZOBA 1R9TJ 4GGGA 4ZZLA 4UVCA 4XRFA 1K79A 2ZXGA 1K4TA 3KYLA 2R7VA 1EH8A 1GVJA 1MGTA 1OCCH 1WJBA 3BCAA 3KZYA 4D9JA 1UAAA 1EV7A 5M3MJ 4ZYHA 1MJAA 1TWHJ 3RZDJ 1MW3A 1KQ9A 2HWVA 3ZPLA 2QQ8A 5ED4A 2QWWA 1MD0A 1RRJA 1J2XA 2JA5J 3FH7A 1S7OA 4M71A 2CH0A 4E7KA 2KRFA 1MSFC 3U1KA 4V19K 1U5TC 3CC2I 2AHQA 3W6JB 1FSEA 1QPIA 1OJLA 5K7ZA 2ZJRF 2IS2A 2MAPA 3MAJA 3ZGKA 2D5VA 1MBKA 5LEJA 4MS6A 2VKEA 2AXLA 4IRGA 4B3XA 3TO9A 4NC8A 2NVXJ 1W5SA 3ZQQA 5ILUA 3I54A 4IL6C 2QUFA 1IN4A 2PI0A 5D6FA 4CDGA 2XHKA 1W5CC 3IIEA 1T33A 3CCVI 2IEKA 1WJFA 3MCZA 1U5TB 1ONNA 3BLYA 4FE7A 4HF0A 4PSXA 1U9NA 2KISA 1UELB 2QYOA 4X1EA 1WZ2A 3CESA 1HW2A 2G7UA 2OJED 4R1HA 3W3CA 1GLNA 4CZZA 1YRNB 3BROA 5J1RA 1ZQ3P 3MN2A 5F1RA 2Y0SN 2DMPA 2LKSA 3HC7A 4LLLA 1AHDP 1G4DA 3W2AA 3ZN0A 1JUSA 1G3WA 5EDNA 2IBDA 1XSVA 5JMWA 3IV5A 1QVTA 1GV2A 1ZR4A 2O9LA 3RPUD 3HRMA 3KX2A 4R79A 3ZRGA 1Y8RB 2KFDA 4CXFA 1A31A 2CSOA 2TRTA 3I9V2 3I64A 4UV8A 2LLKA 4IEJA 3WHCA 2PBIA 1O4XA 1YJ9I 4XRMA 4L9NA 1X3WA 1JKPC 1QRYA 5E8GA 3QP6A 3EBGA 2VBWA 3CQZJ 1CF7B 2VUMJ 3BPVA 1UHMA 1AKHA 4XLHA 2FQ3A 4QPQA 3VYRB 2BYVE 1QZZA 2DN0A 2E60A 4AC0A 5B3SH 2IGNA 2DA1A 3HB9A 4KUMA 4C2UA 1JTXA 5LLQA 2DQRA 3C18A 1RI7A 1J09A 1SD7A 3PIOF 1OYYA 2JA8J 2DOAA 4OOEA 2VJ5A 2B7EA 4KJZA 2UV1A 2ACJA 2KP6A 4GYIA 3ZCOA 2P7CB 3KYDB 4Y13A 1ZGAA 2VBYA 1N78A 1OFCX 3E5QA 2O6GE 4U0WA 1IUFA 5LRSA 4XKVA 2XPZA 1JHHA 3GXOA 3ASOH 3K4CA 3P9KA 1NK2P 1ZLKA 5TISC 2LKXA 1AOYA 4G7HF 4M3EA 3OOUA 2WA0A 3ZMTA 1ZRDA 1XMKA 5JLWA 2ZKZA 2Y1GA 1POGA 2ZJ2A 3FBNB 1KONA 2R7UA 2QKLB 3KLOA 1XGNA 5CVRA 5GPCA 3OS1A 2QSFX 2PJRA 3LA7A 4V2GA 1S72I 4DPRA 2ELHA 3ZMVA 1W7PA 4HAMA 3LSGA 1FBUA 2O61A 1FY7A 1UG2A 3U2RA 3OV8A 1FIAA 4I6ZA 1SFUA 3GBGA 4XO5A 2F5EA 1S7EA 2OC6A 5DM7F 5FKMA 4DIQA 4OWRB 4PGHA 3OYNA 4EJTA 2MSYA 2GXAA 1R1TA 4RVBA 2PEXA 1YG2A 1R1VA 1X1PA 3ZXSA 3OOPA 5D8LB 4EEFG 2E2JJ 5GAEJ 1LEBA 3RYPA 2I5UA 1Z21A 2DYRH 5DCMA 2ADUA 4A3EJ 4P1WA 2WZFA 2FBKA 4FCAA 2DTRA 4GYGA 4EMSA 4KA4A 4XM3A 4L5EA 3AU9A 4A3MJ 1IN8A 3UNGC 2VN2A 2E1MC 2EA4A 4NUBA 2M34A 3NAUA 5JLXA 5JMPA 3EETA 4ABZA 1MSEC 1WH5A 1IRXA 2H1LA 5D5XB 4Y6PA 2EJRA 2Y31A 3HYIA 4S05A 3CZGA 2E34A 1TNSA 1WHUA 3IH4A 5F0FA 4NDLA 4XMYA 3DTKA 3WTWC 1QHHD 1YQAA 3SFZA 4QMEA 3FWEA 1MBEA 3A06A 4ZYAA 3J81K 1AA7A 1T98A 1JJ8C 4QHPA 1YFHA 2FE3A 2JUGA 3JTHA 1KYZA 3QOEA 5B66C 3FUNA 5HLGA 3HOXJ 4KMUX 4BEHB 1BIBA 4H4KC 2E1MB 4A03A 1D0ZA 2NVTJ 2WAEA 3ERED 5JHFA 1T6SA 2Q2EB 3H5NA 4UY8I 1HSTA 5E3LA 3CTAA 3CDLA 2R7FA 3LSHA 1PDNC 3F8BA 4XOTA 2GXBA 2R7SA 1LE8A 2LD5A 1TQPA 5FFXA 2HXOA 1ZELA 2JA2A 4HPQA 2JPBA 1MW1A 1BR4A 4MFEA 2RAEA 4U0VA 1Y6IA 2XAHA 1OYIA 1JG9A 1K83J 4PGGA 1P6RA 1BM9A 4WWCA 3S1QJ 2H1KA 4XMVA 2O03A 3V4GA 4CA0A 2OTJI 4F91B 4Q5SF 3G1OA 3W2WA 1VQMI 3GCMA 1V3FA 2CUFA 2KMUA 4F7ZA 9ANTA 5BPIA 3SYTA 2Y9YA 3JRCA 3Q3SA 4LLNA 2V9VA 3CCJI 4LG0A 1BIAA 3EUKL 3I0TA 1TT5B 3CMYA 1A6IA 2HYFA 2OF7A 2CG4A 1ZGWA 2H09A 1S29A 3H9JA 1OPCA 3RCOA 3LSJA 4XLPF 4AR9A 4LITA 1X2MA 3S2WA 4ZW6A 2HOAA 3QODA 4UUTA 2EV5A 2BZTA 5D6EA 4BDZA 2HDCA 1LFPA 4X6AJ 1JKRC 3RC8A 2MGQA 1FBQA 1LQ1A 1LUJB 1OR7C 2R72A 4ENJA 4A5NA 2BHZA 1Y56A 3BC8A 2Q8KA 4R8HA 1R00A 4LIUA 3WQRA 1TQIA 3TW7A 5D8KB 3PO3J 4BJ6C 4PJ0C 4HA8A 3MKYB 3BY6A 3HGYA 2XV4S 2RVCA 4HOBA 2K9SA 2XDVA 4XMUA 3GZ5A 1AWCA 5LHHA 5H6QA 3E7LA 3MWMA 3ZQCA 3BTIA 2W82A 2R92J 3HOUJ 2FNPA 1LVAA 2JWTA 4N4NB 4ZX3A 4MNUA 4DQ2A 4DZPA 3EUHA 3RKWA 2RN7A 3OL4A 3CMMA 1MW2A 4CUGA 3AG3H 1HQCA 2OU2A 1T1RA 4ZW3A 3DEWA 1FTZA 3LSRA 3RQIA 3RPQA 4OMZA 4CCJA 2R5ZA 1EA3A 1HKSA 3V42A 1I27A 3B2PA 1N25A 2QQ9A 1FOWA 2KDOA 4HNUA 3M1EA 3PUFA 2CQNA 2K7LA 2IS4A 4XMXA 1WSUA 4A3JJ 3F6OA 3GZNB 2XF6A 1U78A 4XSXF 5BMZA 2A6TA 2JUCA 2VQCA 1R7JA 4RB2C 2HPMA 3PNVA 3COAC 1UJ8A 4BL0B 3CZEA 3HZJA 2Y30A 2IA1A 4AM3A 4W1UA 4EM2A 4XN5A 5EV7A 3FXOA 2ZB9A 1MBFA 2GWRA 5KCMA 1Y8QB 2K02A 3O2PE 2X48A 3VYSB 3KLNA 4ZJZA 4UB8C 5DUIA 3CJTB 1T0FC 4MLOA 5J3LA 3WTSC 2R93J 4XSZF 1R5GA 3DXJF 4HW0A 1S46A 4RAZA 4LUPA 2XB5A 2O8XA 2JTVA 2EZIA 5HOOA 4E70A 1X3WB 3T1BA 3ML6A 3EPZA 5IT9K 1ERDA 2O7GA 3FTUA 2E35A 2L9SA 1UHWA 3ZQFA 2OZ6A 1DU6A 4BH9A 3VDXA 4YIRX 1F43A 2JK3A 3HKZN 4B48A 3CD6I 3R0IA 1FOYA 4HRIA 3WGIA 3ECOA 1X19A 4W97A 2F4MB 1SEUA 1WI3A 3DWLE 1IN5A 4I99C 4ZYGA 5AONA 5F6FA 4E6KG 4EM1A 5DYFA 3FZVA 1KQ8A 3BTJA 3IHUA 3HSRA 2NOJB 1VQ5I 2XC7A 3P9CA 5EEGA 2W57A 3CP8A 5C3EJ 3BJAA 4I98B 3B3BA 2VKDA 3LQRA 1HXDA 2FBHA 4LG3A 4XMTA 2Z2SB 3ZHZA 4FLQA 4XN1A 1K6YA 2BBYA 2VJJA 3F8MA 1DUXC 3DU6A 4F52A 4I0AA 4ZW5A 4ZQFA 2E1OA 3BPXA 3CDHA 1GUUA 2MC4A 4ZQTA 1I1SA 4IHSA 4G6TB 3JSZA 3GFIA 3TOAA 1SG7A 1JKQC 4XLFA 3BG5A 4U7BA 3WHBA 1ZG1A 5TRDA 5CVJA 2PJRB 5B1AH 3UERA 3HW2A 3TKYA 2FJ1A 2J5PA 1HDDC 1X2NA 2EA2A 2KDZA 4HDVA 1IAWA 2NOGA 5GAGJ 2JSPA 2WY8Q 2HU9A 5E1ZB 1U5TA 1BI0A 5HS7A 3KETA 4J19A 3HEFA 1DPRA 4BXUA 2HXIA 3FU6A 3OYHA 2IAIA 5HDGA 2VJ4A 2A6HF 4GRIA 1W0TA 1YRNA 4O3MA 3CCRI 4XN8A 3K4LA 4MTDA 4FX0A 3UR3C 3BG3A 2WAFA 1Z9CA 4B3AA 4MHGA 3F22A 3WGGA 1J9IA 2E71A 3B73A 3FUJA 5J8FA 3JR9A 3S15J 3NWSA 1ONOA 4B43A 2H8RA 4FT8A 2CWEA 4RM2A 2XGXA 3K6GA 1FYKA 5E3MA 1MMAA 3G1MA 3ZMSA 5ICCA 4U7DA 3CF2A 1LFUP 2B63J 4DYCA 2QEXI 3ONQA 1R1UA 1Z0XA 5B1BH 1VQOI 2MH2A 1J0RA 1H9TA 5JNLA 2F48A 5HDNA 2Z3YA 2BGCA 2MAOA 4PW4A 4R5VA 2Y1CA 3MMYB 4BAYA 2LP0A 2CQQA 1P4AA 2W1OA 1ORKA 5CJ9A 1JVSA 4K5NA 2VASA 3C3WA 2FMYA 1RKTA 3ASNH 2DO7A 3I53A 3QYEA 2FD5A 4IF4A 4IHYA 1Q1HA 4LD5A 5HNHA 2DOFA 4FQGA 3T5XA 1Z3XA 2D1HA 3CCYA 2QBYA 2VOPA 2RQPA 1IN6A 3KP5A 3T8VA 3JCUC 5FD6A 1N75A 4UXNA 3Q9SA 2VKHA 3LSPA 3KP7A 3HOWJ 3VVLA 2KZGA 1F9NA 2ELJA 1P7JA 1TW3A 2WV1A 1PYVA 4XONA 2L7ZA 2NNYA 2DCEA 3LSIA 1B9MA 5IYCJ 4A3DJ 5LGUA 3LNQA 2R7TA 2K27A 5F0HA 3ELKA 5FJ8J 2HZTA 2GM4A 1U8BA 2HFHA 4ZDOA 2PMZA 2XIGA 1TWCJ 2LSOA 2MD0A 2YS9A 3GTPJ 4MTEA 2Y48A 3DBRB 1TQMA 5H2FC 2KRHA 2K85A 3QU3A 4E7HA 3C1DA 2JVGA 3ABKH 3QWLA 2BHYA 2F5FA 1Z7LA 4BACA 4A6DA 4XO4A 3CXBA 3AUAA 2DW4A 2ECBA 3EUAA 3ZMUA 3L1PA 4NB5A 4BUPA 2K4BA 3FX3A 2DFFA 2L7KA 3SDBA 3CO7C 2Z1DA 2IXSA 4XL9A 1VZ0A 4BE1A 4DNCA 2KHMA 4L0YB 1FOKA 1VQ6I 2KLOA 5KNLA 1FZPB 2FBIA 2PQ8A 2CUJA 3EBHA 1E3HA 3BZKA 4J3BA 2XAJA 4Z2YA 3JRHA 2LBFA 2QF7A 3MZ8A 4XMWA 1PJRA 2YUSA 2XSDC 2WTEA 4J01A 1JT0A 3HRSA 4A3FJ 1R0LA 5LFAA 3FUIA 3WU2C 2NS8A 3E1SA 2RNGA 3M7GA 1KU2A 1XMXA 5K7HA 5DYMA 1WJCA 4XOPA 2DBBA 1TP4A 2XF7A 3H3ZA 4XRSG 4RAGA 2H8WA 4G94A 4K5OA 1E3OC 1ZGJA 2FSWA 3E5XA 4BYYA 1S3JA 1IDYA 3LA2A 4IRIA 2X0LA 5FGMA 2WAQA 2Y1DA 2OAZA 2JMWA 4AUXA 2R7ZJ 1JUPA 3JRDA 3B7RL 2MD5A 4GXOA 1JGIA 1BR2A 3BP8A 2Y2ZA 3ZQGA 4J00A 2XPWA 1O57A 2NVUB 3CUOA 1ZARA 3HG9A 5HODA 5D5WB 2R5ZB 2AO9A 4IKFA 4EVIA 4MIMA 4LOCA 2Q2EA 2L2OA 1EF4A 2XSJC 3E0JB 3K1PA 1H9GA 1LFBA 2XASA 4HNTA 2GLOA 3FUMA 4GFBA 2PG4A 3TO7A 1K4SA 3LOCA 5JBIA 3KP2A 1USTA 1SC7A 3C2HA 3M8FA 2GIZA 3FM5A 3JT1A 1VQ9I 3OR1C 3SHFA 5EEAA 3BZCA 3MKWB 3PIPF 2VXZA 1ETVA 2NS7A 3GTGJ 1FPQA 2R7DA 3CJRB 1YYVA 1HW1A 4PFPA 3OS2A 4A3IJ 1R22A 4RBOA 2UUZA 2FX0A 2STWA 1XSXA 2R4GA 1R36A 4FTHA 3CZKA 2HKOA 4AVPA 1FX7A 1WQ2A 1ZG3A 3K4BA 4JX6A 2E5ZA 4UNOA 2F4IA 1I6XA 3O6BB 4Y3OA 1OKRA 3L2UA 1GVDA 3IC7A 2EQRA 3M1CA 5HLHA 2CV2A 1FC3A 2L7FP 3BG9A 3KEQA 2VT3A 2R0QC 5CVIA 4L9TA 2JA6J 2DK8A 2Y1EA 3T0YA 3OSGA 3IAS2 3S17J 4XNFA 2MG4A 3J80K 1NHAA 3NEUA 2W25A 4RA2A 4A69C 5FLMJ 2CV0A 3I71A 4HF1A 3OMYA 1ZS2A 3LSMA 1YTYA 2K86A 3IKVA 4B47A 3S2DJ 4ASNA 2XQ0A 1KZHA 4HV6A 1EH6A 3MD2A 1ETOA 3K9TA 4ITVA 3C7JA 4IHWA 4A0XA 5FROA 1K61A 1P9QC 1QVUA 3A1YA 5J1YA 1BOAA 2A5WA 5D4RA 1OR7A 2O8KA 3GTLJ 2I10A 1ZK8A 1D8JA 2HPOA 2R7WA 3FMRA 2DMNA 1J5YA 2V79A 4OU0A 2WZGA 2B9SA 1VI0A 3WTZA 4Z6YA 1QGPA 3ZR8X 5E1XA 5JHUA 4M6XA 5DEQA 2F5VA 2YX4A 4A2UA 1ZREA 4E7IA 2UZKA 3SFIA 1B72B 3K2ZA 4Y67A 1F36A 2L9RA 1IZ1A 3JSPA 1ZRCA 2CJJA 1SD5A 4DYQA 2DODA 2G0EA 2VQHA 4IO9F 5LRRA 4QPEA 2XAFA 3PNTA 1EKEA 4IHVA 2E19A 4ZX6A 2R7OA 2O0YA 4ZDPA 3B6AA 1IO2A 4MQVA 1NG6A 3A2KA 2EZHA 3DU5A 5IPAA 2LG4A
chains in the Genus database with same CATH topology
2VBZA 3D5LA 3FUEA 5K1YA 2P7VB 5DCFA 1SD4A 1FWZA 3ABTA 2MH9A 3FH5A 1TBXA 2V1UA 3BJOA 1B1BA 2L4MA 1ZH5A 2EFOA 3RKYA 3FH8A 4JBAA 4Y6SA 1Q0LA 2D1VA 3FM3A 4Q4ZF 2Z33A 2L3DA 2HQNA 2V6CA 2OA4A 2GIVA 5FB2A 4M9XA 3RJPA 2DPUA 2C6YA 4WCGA 2PMUA 4ENNA 1T0FA 4BHCA 2QBYB 3V8KA 1YIOA 4KN7X 5JI6A 2B61A 2JT1A 2JD1A 4AIHA 3GYHX 1OYWA 3FU3A 3F8NA 1FBSA 3LSTA 2FU4A 1Z6TA 4RGXA 2M1BA 1I1GA 3FMSA 4R5XA 3KEOA 4A12A 3CLOA 3VOEA 3GUDA 4U0YA 3B37A 3KP4A 2PL5A 2FXAA 3I5UA 3J81Z 1T38A 1ODDA 4HQEA 5A2QK 1U3EM 1Z05A 4YG2F 1JE8A 4I09A 3E3VA 1KQ0A 2ZBKA 4BQAA 2YSRA 4KFCA 4A0ZA 1DDNA 3RI4A 2PFBA 1S7AA 2IJLA 2RKHA 3ANNA 2CGPA 5K5RA 3FULA 4ZZDA 1R23A 2CQKA 2VE9A 1FYLA 4Q4IA 2W84A 4ON0A 3PFIA 5CYVA 3ECHA 3WG9A 4ZQEA 1SMYF 2KJBA 3QPHA 2O3FA 3U9GA 2P4WA 3ZQ7A 5CVUA 3L00A 4IXAA 4OIQF 2TDXA 2JCXA 4ZN6A 1XMAA 5E8IA 4AYSA 3FUDA 3T8RA 4RGUA 4BNCA 4K5MA 3VODA 2STTA 3WTVC 2DFIA 3LQQA 4RAYA 1YW9A 5L3DA 1H3LA 1MJ9A 1KYWA 3HSFA 4N9HA 3MFKA 4XMZA 1HKQA 2W24A 2GQQA 2JRTA 2ZFWA 1ZHFA 1LDJA 1LDDA 2M45A 4L9JA 2A6EF 1L3LA 1B6AA 4OINF 3FUFA 1E2XA 4Y15A 1H19A 3EDPA 2Q0OA 3B7TA 2A61A 5LGTA 1HSJA 4ETSA 3MZHA 4L5JA 4Y17A 2VODA 4ESJA 2A68F 2GTQA 4BKXA 1ONPA 2P6SA 4M72A 1ZLJA 1GW6A 4PU2A 2NS0A 3DQVC 4QLCU 1XGSA 4G8XA 5FWQA 2HOEA 3GZ6A 4K5PA 2QLZA 1P92A 1ON2A 2X4HA 1U6GA 2Z5UA 3KP3A 2QQAA 4CICA 3ZI0A 1D5VA 2EWNA 3WTXC 1RIOH 5IT9Z 4I0BA 3SXYA 3TO6A 3L9FA 3QPTA 2DAOA 2HGCA 4CGZA 4RS8A 1ZG5A 1LB2A 5ILSA 4LMYA 5ICGA 4HV5A 4GAEA 1HKTA 2A3SA 2PLYA 4EV0A 2JZYA 2D45A 4FLOA 3I58A 4B09A 2KJCA 3E5UA 1ZYRF 1UFMA 3E6DA 3MZYA 1GHCA 1QZYA 4RGSA 1FYMA 2Y75A 5J8CA 3GFJA 1JGSA 5JC1A 5JFRA 1TTYA 4CHUA 2XPYA 1U2WA 5J6XA 2RJIA 2IVMA 4H0EA 1B4AA 1IXRC 5AENA 3CHSA 4MQ9F 2QENA 2HTJA 2QVOA 1BN5A 3V7RA 5DDGA 4HX4A 3RKXA 2L4AA 3HHGA 3NQOA 3K1NA 4KICA 1FLIA 3EYIA 2PUSA 2FEZA 4M74A 3IL2A 3IKTA 4OOIA 4AD9A 1X3UA 5LBQA 4AWXB 4I7HA 2V1DA 5LHIA 4RB3C 4OIRF 2VONA 1XGMA 3F72A 3RPUA 4L18B 5JR3A 2LDUA 4P55A 4XNAA 2OD5A 4BHBA 4LJZF 2RC4A 3DEUA 3NRVA 3VB2A 4LFUA 4ZX4A 4IPAA 3ROUA 3GFMA 4RB0A 4YFNF 2DQ6A 4HDUA 3HTSB 4I01A 5JO0A 4IVNA 5FFZA 3F6VA 2IA0A 3ZHYA 2M87A 2R3SA 1REPC 5HVQC 2ISZA 2BEOA 1S8NA 5AIQA 3J7AO 5ERIA 1IW7F 5E1WA 3P7NA 1PP8F 3V7CA 2XROA 1B59A 3CHQA 5TJJA 4KIGA 2RGVA 2VBXA 1MJBA 4EJOA 1B9NA 4NHJA 3WE3A 3VVMA 1Z91A 2M30A 2DQMA 3BWGA 3Q9VA 4IRHA 1YW7A 5HS8A 4OOFA 4HQMA 1QPMA 1RP3A 1P2FA 1MDMB 2F2EA 3R6SA 3FUHA 3FTXA 4UV9A 2DU9A 5L3EA 5F64A 4G7ZF 3GWZA 3MQ0A 4P9FA 2H27A 4D0PA 2E7XA 3WU0A 4WK8F 1XCVA 2EFWA 2VLAA 1GXPA 6PAXA 1W7PD 3QAHA 3IRRA 4I2OA 2COMA 3DV8A 1FT9A 4WXCA 3LAPA 2L02A 2FRHA 2FA5A 2HEOA 3BZ6A 5AIPA 3REOA 3FTSA 3FTYA 4A5MA 2OZUA 3KE2A 4HF2A 4EGZA 3FXUA 3ANLA 2V1XA 4HX8A 4FLRA 3B02A 1STZA 4KNYA 3FTVA 4ZW7A 3FHEA 3ZN1A 2F5CA 1ZAOA 1RNLA 4XN9A 4LK0F 5HS9A 1XB4A 3CJNA 2QQBA 3JTGA 4JQFA 2YX7A 3BOQA 4LGWA 1F1ZA 4CYDA 1O3TA 2L54A 2W85A 2WC2A 4G6DA 2QM3A 4G7OF 1HW5A 3WE2A 4PDKA 4MKTA 4M6YA 3TDZC 1K78B 1FP2A 4K2EA 5FLXK 5H6RA 1G3TA 1WKMA 2KIFA 1SFEA 2P6TA 1WWXA 2H6CA 2M8EA 1O3QA 4XLNF 2G7HA 4QWQA 2MC3A 4G9YA 3B7UX 2H6BA 3VEPA 2F5DA 1O3SA 4GCVA 2NAZA 4EJUA 3W6KB 5D4SA 3J80Z 3HOSA 2UXNA 5L3GA 1DP7P 3HUGA 4YFXF 3ZHXA 3CZLA 4MGRA 1YS6A 3L09A 1R5HA 5BOXA 2HQRA 1UB9A 2EFNA 1J75A 4KDPA 3HOTA 4LB5A 3P9IA 1KGSA 3ULQB 3V8LA 2CO5A 1L0OC 1FSHA 1MZBA 2UXXA 2ZCWA 2AS5F 3R61A 5DD4A 3L2CA 1IRFA 5D5UB 1YLFA 4ZQHA 4L0ZB 3GX4X 1PUEE 3JAMK 1ONVA 2FNAA 3O3KA 4KMFA 1HS6A 3I59A 2E7WA 4B8XA 5BPPA 3CO6C 3HRUA 3N97A 3LAJA 4XN7A 2Y0MA 3WTTC 3QOPA 5LEKA 4HBLA 4KYWA 2A7OA 2UWMA 5D5VB 2FFLA 1KU3A 1W5TA 4UVAA 3RC3A 2Y1FA 3DFGA 2PMHA 2DK5A 1YS7A 3U9WA 4XBFA 2XAQA 2ZXJA 4KIFA 2JD0A 1A04A 2PJPA 1JXSA 2WPGA 2ZO4A 4KP7A 1XSDA 2ZNYA 1Y0UA 2DPDA 3CIAA 1G5AA 1KA8A 3PQJA 1BC8C 4YIFA 3HTUA 2WV0A 4AR1A 2M5WA 3E97A 5L3CA 3JSOA 4UHTA 3F23A 2XVCA 1XGOA 3M9AA 1MVYA 3E6BA 3JW4A 1IXSB 1R58A 2KIMA 5A2QZ 2JCVA 5L3FA 4UUVA 1YO5C 1P4WA 1QNTA 2LF7A 5ICFA 2LKPA 2MLGA 3K0LA 2QZ8A 1FNNA 1LNWA 3F3XA 4XNBA 2P5LC 4MEXF 2ESNA 1VTNC 2FMLA 1V4RA 5HLTA 3F8FA 4WXHA 3FU0A 4IHTA 3F8CA 3SQNA 4OIPF 3Q44A 1O3RA 4LK1F 4WF2A 3GEZA 2C5ZA 3BDDA 2ZMEB 4P5OA 2QVWA 2HKXA 3QRFF 4ZYDA 4X2UA 3HHHA 4EQQA 1W4MA 4HZFA 1BI3A 4KN4X 4U88A 4UVBA 2G9WA 3FMQA 2GA2A 5E18F 3QJXA 1XD7A 3WU1B 4HLYA 2JV7A 3QP5A 2D2WA 3U1DA 2QJ1A 4FHTA 3B7SA 4RCVA 3FF5A 2EK5A 1E17A 3RYRA 3FU5A 1USSA 1WRJA 2ETHA 4ZW8A 4HLXA 3SZPA 2MBFA 4ZYEA 1MDMA 4ZH4F 2IPQX 4K5LA 4EGYA 1PP7U 3LFKA 1KU9A 4NQWA 5ICEA 3CUQC 1IXCA 2CYYA 3PUUA 4FX4A 1Q0HA 3LA3A 2NRAC 5HDKA 2LF8A 3A14A 3GW2A 4S04A 1J59A 4M9ZA 2J5OA 3GO5A 2IT0A 2KKOA 1K7AA 4LB6B 5DULA 3IRQA 1Z7UA 3E6CC 3CUQB 2YR2A 1LEAA 3N4MA 2CFXA 4O5VA 2OBPA 3G73A 4AIJA 1K6OA 1J7KA 2NYXA 4M73A 5JVTA 3LWFA 3BJ6A 5LHGA 2EFQA 1OMIA 4WXDA 1BI2A 2R59A 2HR3A 2HYGD 3WTUC 2JSCA 4L2LA 2VOOA 2E1CA 1BI1A 1F4KA 1IF1A 2IRFG 2NNNA 4YFKF 2PN6A 3PQKA 1MW0A 3I59B 4ENMA 1DPUA 3DP7A 5FO5A 4TV7A 1JHFA 1IRGA 5KVRA 1K78A 2IA2A 3DPTA 4XN4A 2OQGA 4R7LA 3V8JA 1SC5A 5DV5A 1T1SA 3TQNA 3RDIA 4FLSA 2CW0F 4O6JA 4EJVA 2XRNA 3TGNA 3Q5FA 4BHPA 3FXQA 4L9VA 4JK1X 1XN7A 3GFLA 2P5VA 3GLXA 2P5KA 4Q48A 3CHRA 3WTYC 3KFWX 2RNJA 2RDPA 3ZP5A 4ESBA 1XDUA 2EV0A 2EFPA 1BBYA 3RTRA 4EJWA 1RUOA 3R60A 3I4PA 3B2XA 1RZ4A 1D3YA 4GAAA 3CHOA 3EYYA 5K5QA 2MA3A 4PVBA 3T8TA 3AU8A 2C82A 2XAGA 5BQTA 4Q4EA 2RV8A 4GO1A 2DQLA 1D8KA 2MLKA 5E17F 1Z1DA 2Z99A 1IUYA 3B34A 3Q43A 1ON1A 1EH7A 4PCQA 5KK1A 1C0WA 4ARFA 1SAXA 5FD5A 5DLLA 5EEHA 1ZRFA 3ABUA 3K69A 1TNTA 2PGGA 1Z6RA 4OIOF 4A6EA 4CO8A 2GXGA 1O7LA 3EQLF 1UCRA 2GA1A 2DT5A 2DLLA 1LJ9A 5HNFA 4QIRA 3QU6A 1U8RA 1P4XA 2YPRA 1Q0QA 4Q47A 1T39A 3FTWA 2XKOA 5L3BA 4N9IA 2FOKA 3UCQA 1QQIA 3FHZA 2XUBA 2L01A 1O7FA 3KP6A 2A5YB 1W7PB 3HRTA 3L7WA 4L5IA 1RUNA 1K5HA 1CGPA 2BE5F 5K5OA 5DCMB 1QO0D 1SFXA 2LNBA 3ANMA 2IW5A 1HBXG 3TDUC 2GAUA 3AAFA 4I02A 2OQRA 5ILVA 2KIUA 5CLSA 3ZMZA 3H3UA 3SZTA 2XKPA 2VT2A 1CF7A 4XO3A 5DD8A 1X3ZA 2JD2A 4HYEA 4ZQGA 4ENKA 4KT5C 3VFZA 5DUKA 3DKWA 4QUOA 2ESHA 2FF4A 2ZNZA 4RGRA 4WX9A 4MEYF 1SD6A 4P9UA 5FLXZ 3WODF 2ZMEA 2A07F 2JPCA 1FP1D 4AR8A 3KZZA 1SMTA 5H20A 2VJ8A 1IN7A 4RSYA 1XDSA 3FUKA 3K1MA 1QBJA 3WQSB 4M9SA 4LG0B 3DF8A 3FXRA 4RB1A 5BPDA 1MKMA 4AIKA 1LDKB 1S6LA 3ISPA 3D0SA 2HTSA 4OMYA 3G3ZA 4LLGF 3KCCA 4R5TA 4G6QA 2B0LA 3E6MA 4EM0B 1ZN2A 3WGHA 1BC7C 3R0JA 3F21A 4AICA 2E1NA 2HPTA 3H92A 4PZJA 2H94A 2VC1A 3UEQA 1SQMA 3HIFA 2JCYA 5LGNA 1TW2A 2GZWA 2EB7A 3V7SA 5CVVA 4XN2A 3WQQA 2VC0A 3JAMZ 2A69F 1XCBA 2HS5A 2WWYA 1KU7A 3RASA 2DI3A 4A0YA 2EGHA 3DPLC 1R0KA 3EBIA 1I5ZA 4YIIA 5HLIA 1T2KA 4ZX5A 3CUQA 4ESFA 2YU3A 1YW8A 5E20A 4P96A 3KEDA 1F5TA 2Z9OA 3IWFA 1TLHB 3RIRA 3FTZA 2BV6A 3R0AA 2K4JA 4KIBA 3HSEA 3R4KA 4IJAA 1BJAA 2VE8A 4XNDA 4HX7A 3IWZA 5IT3A 1WI9A 3CHPA 5BS6A 3GVAA 1G3YA 1ULYA 4N0BA 3ZMDA 1G3SA 1G6NA 3M8EA 2ISYA 1H0MA 2R70A 2P8TA 2IP2A 3GF2A 5JAZA 1GXQA 4Y6RA 3TOBA 2EV6A 3MEXA 4GGGA 4ZZLA 4UVCA 4XRFA 1K79A 2ZXGA 1EH8A 1GVJA 1MGTA 3KZYA 1EV7A 4ZYHA 1MJAA 1MW3A 1KQ9A 2HWVA 3ZPLA 5ED4A 1MD0A 2QWWA 1J2XA 3FH7A 1S7OA 4M71A 2KRFA 1U5TC 3W6JB 1FSEA 2MAPA 3MAJA 5LEJA 4MS6A 4IRGA 2AXLA 3TO9A 1W5SA 5ILUA 3I54A 2QUFA 1IN4A 2PI0A 5D6FA 4CDGA 2XHKA 3IIEA 3MCZA 1U5TB 1ONNA 4HF0A 2QYOA 1HW2A 2G7UA 4R1HA 4CZZA 3BROA 5F1RA 4JNDA 4LLLA 1G4DA 3ZN0A 1G3WA 1XSVA 5JMWA 3HRMA 4R79A 4CXFA 2CSOA 4UV8A 3I64A 2PBIA 4L9NA 1X3WA 5E8GA 3QP6A 3EBGA 2VBWA 1CF7B 3BPVA 1UHMA 2FQ3A 2BYVE 1QZZA 4KUMA 5LLQA 2DQRA 3C18A 1RI7A 1SD7A 1OYYA 4OOEA 2ACJA 4GYIA 2P7CB 4Y13A 1ZGAA 2VBYA 3E5QA 2O6GE 4U0WA 5LRSA 2XPZA 1JHHA 3GXOA 3P9KA 1ZLKA 1AOYA 4G7HF 3ZMTA 1ZRDA 1XMKA 2ZKZA 2Y1GA 2ZJ2A 3KLOA 1XGNA 5CVRA 3LA7A 4DPRA 2ELHA 3ZMVA 1W7PA 4HAMA 1FBUA 2O61A 1FY7A 3U2RA 3OV8A 1SFUA 4XO5A 2F5EA 4EJTA 4PGHA 4RVBA 1R1TA 2PEXA 1YG2A 1R1VA 5D8LB 3OOPA 1LEBA 3RYPA 5DCMA 2ADUA 2WZFA 2FBKA 4FCAA 2DTRA 4GYGA 4EMSA 4KA4A 3AU9A 1IN8A 2VN2A 2EA4A 5JMPA 3EETA 5D5XB 4Y6PA 2EJRA 3HYIA 4S05A 3CZGA 1TNSA 3WTWC 1YQAA 3SFZA 4QMEA 3FWEA 3A06A 3J81K 4QHPA 1T98A 1YFHA 2FE3A 3JTHA 3FUNA 1KYZA 5HLGA 4KMUX 1BIBA 4A03A 3ERED 1T6SA 1HSTA 3CTAA 1PDNC 2R7FA 3F8BA 2GXBA 1TQPA 5FFXA 1MW1A 2JPBA 4U0VA 2XAHA 1OYIA 1JG9A 4PGGA 1P6RA 1BM9A 4WWCA 4XMVA 2O03A 3V4GA 4Q5SF 1V3FA 4F7ZA 5BPIA 4LLNA 2V9VA 4LG0A 1BIAA 3I0TA 2HYFA 2CG4A 2H09A 1S29A 1OPCA 4XLPF 4AR9A 3S2WA 4ZW6A 2EV5A 5D6EA 2HDCA 3RC8A 1FBQA 1LQ1A 2R72A 4ENJA 4A5NA 2Q8KA 4R8HA 1R00A 3WQRA 1TQIA 5D8KB 4HA8A 3BY6A 2XV4S 2RVCA 4HOBA 4XMUA 3GZ5A 1AWCA 5LHHA 5H6QA 3MWMA 2FNPA 1LVAA 4ZX3A 4MNUA 4DQ2A 3EUHA 3RKWA 2RN7A 1MW2A 1T1RA 1HQCA 2OU2A 4ZW3A 3RPQA 4OMZA 1HKSA 1I27A 3B2PA 2QQ9A 3M1EA 2K7LA 4XMXA 1WSUA 3F6OA 1U78A 4XSXF 5BMZA 4RB2C 1R7JA 3COAC 3CZEA 2IA1A 4EM2A 4XN5A 5EV7A 2GWRA 2K02A 3O2PE 3KLNA 5DUIA 3WTSC 4XSZF 1R5GA 3DXJF 4HW0A 1S46A 4RAZA 4LUPA 2O8XA 2JTVA 5HOOA 4E70A 3T1BA 3ML6A 2O7GA 5IT9K 3FTUA 1UHWA 2OZ6A 4BH9A 3R0IA 3WGIA 3ECOA 1IN5A 4ZYGA 5AONA 5F6FA 4EM1A 5DYFA 3FZVA 1KQ8A 3IHUA 3HSRA 3P9CA 5EEGA 2W57A 3BJAA 4I98B 3B3BA 3LQRA 1HXDA 2FBHA 4XMTA 3ZHZA 4FLQA 4XN1A 2BBYA 1DUXC 3F8MA 4I0AA 4ZW5A 4ZQFA 3BPXA 3CDHA 4ZQTA 1I1SA 4IHSA 3JSZA 3GFIA 3TOAA 1SG7A 4U7BA 1ZG1A 5TRDA 5CVJA 3UERA 3TKYA 2J5PA 2EA2A 4HDVA 1IAWA 5E1ZB 1U5TA 1BI0A 5HS7A 3KETA 1DPRA 4BXUA 3FU6A 5HDGA 2A6HF 4XN8A 4O3MA 4MTDA 4FX0A 1Z9CA 4MHGA 3F22A 3WGGA 1J9IA 3B73A 3FUJA 5J8FA 1ONOA 4FT8A 2CWEA 2XGXA 1FYKA 4U7DA 3ZMSA 5ICCA 1R1UA 2MH2A 1J0RA 1H9TA 5JNLA 4PW4A 5HDNA 2Z3YA 2BGCA 4R5VA 2Y1CA 4BAYA 1P4AA 1JVSA 4K5NA 5CJ9A 3C3WA 2FMYA 2DO7A 3I53A 4IF4A 1Q1HA 4LD5A 5HNHA 3T5XA 2D1HA 2QBYA 2VOPA 2RQPA 1IN6A 3KP5A 3T8VA 5FD6A 4UXNA 3Q9SA 3KP7A 3VVLA 1F9NA 1TW3A 2NNYA 1B9MA 5LGUA 2K27A 3ELKA 2HZTA 2HFHA 2XIGA 2LSOA 4MTEA 2Y48A 1TQMA 3QU3A 3C1DA 2F5FA 4A6DA 4XO4A 3AUAA 2DW4A 3ZMUA 4NB5A 2K4BA 3FX3A 3CO7C 4DNCA 4L0YB 1FOKA 1FZPB 2FBIA 2PQ8A 3EBHA 4J3BA 2XAJA 4Z2YA 4XMWA 2WTEA 3HRSA 1R0LA 3FUIA 3M7GA 1KU2A 5DYMA 2DBBA 3H3ZA 4G94A 4K5OA 1ZGJA 2FSWA 3E5XA 4BYYA 1S3JA 3LA2A 4IRIA 2X0LA 5FGMA 2Y1DA 2OAZA 3B7RL