4CYMA

Complex of human varp-ankrd1 with rab32-gppcp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
REHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGLERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords RAS-RELATED PROTEIN RAB-32
total genus 59
structure length 177
sequence length 177
chains with identical sequence B, C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4cymA00
5FBVB 3K70B 2IBMA 3O8DA 3TE6A 2IYQA 4TYYA 2QEQA 2A5GA 2NPIA 3RAPR 4NCIA 3SJZA 2ZVQX 4C0AC 1L2TA 1Z2AA 1UBEA 2ZSFA 2HLDD 5GVRA 2NGRA 2QG6A 4N0DA 2F1RA 2N1BA 2OCAA 4D0LB 5F2EA 3LVRE 3VKWA 3RS5A 1NMXA 4AYXA 1JJ7A 1T91A 2BMDA 3RHFA 2PZGA 2RMKA 3FMOB 2GXQA 2IWRA 1OH8A 2CLSA 3VKGA 3LWNA 3RWOA 4DUGA 2XXAB 2IUSA 4CEJB 4GP7A 3CWQA 3KXIA 5KTYA 4OQXA 4PQFA 4NYJQ 4RD1A 3TQFA 5JRJA 3TMKA 5CJ2A 3TAUA 1QHHA 2JLWA 4IEIA 1YVDA 4HSEA 1PUIA 2W0SA 3VFDA 1FP6A 3D6TB 3GLHB 1NVXQ 4TYWA 1A1VA 2P6NA 1FW6A 4XWKA 2GHIA 3FTQA 1EWQA 1AK2A 2VO1A 3CONA 2QM7A 4FMDB 1GL6A 4QHYA 5ELXA 2B6HA 1D2MA 4TQUS 2UVQA 2C78A 3UATA 2HV8A 1SHZA 4KLZA 3A1WA 1KI6B 4D4KA 1AJEA 1QBKC 1J99A 1N6OA 1Z29A 1GRNA 1DG1G 1LB1B 1H8HA 1Z2CA 1IM2A 3BWDD 3W6NA 3B13B 1D9XA 1WCV1 1ZC3A 3EIEA 4HB4A 4TL9A 4UNRA 2QORA 1W4BA 1US8B 2CMKA 3CR7A 3HU2A 4PPGA 4TMKA 3BD9A 3Q7QA 4URVR 1QHSA 3THYB 4JSTA 3WP1B 4HUQA 1KSGA 4DCNA 4IW3B 3DHWC 4L9SA 5BYJA 5EP3A 2AX4A 2FSGA 4MYHA 3A1UA 5DHFA 4H1VA 4IXMA 4PC3A 2L0XA 2YHSA 3TGPA 4C0LA 1S4QA 3B9PA 1L8QA 2OCPA 4DCSA 3Q5EA 4JBYA 4NTZA 5GVSA 5IK2D 1KJYA 1RRFA 1Z6AA 3IHLA 1E1QD 5KPDA 5CB8A 2NO0A 1QHHB 1EFRA 3EPHA 1Z63A 4JL6A 3GLHA 4D4MA 4DIDA 3AVYA 1U9IA 5LD2C 2FGJA 3IEUA 3CLVA 1R5BA 5KSZA 5JHHB 2QMEA 1YZLA 3AUXA 5LDDC 2RGEA 1R7RA 4KCGA 2EFDB 4Z8YA 3H2YA 2AL7A 2ZRNA 1W4CA 1AS2A 4TLAA 2BBTA 3SQXA 2QTHA 1LTQA 1XF9A 2VSXA 2EFHB 1I4DD 2J0UB 1EXMA 1Z06A 4QJ3A 3HR7A 4KFTA 3HWSA 4H1UA 3HU3A 4JL5A 2FE4A 1N6KA 2JIZA 5ANRB 4PQYA 1TU4A 3DKVA 4ZKDA 2IX3A 1EFUA 1NG1A 2ZU6A 3BH7A 2YJTD 4W5WA 1NN5A 1VYTA 4EDHA 4KFUA 4HLQB 4FN5A 3U3KA 4WVFA 1ZJ6A 1Z28A 1JNYA 1JPJA 3ZGXA 5K8TA 2BCJQ 2QI9C 3AKCA 1XCMA 3FE2A 2QBYA 1LF0A 2Z4RA 2OBMA 1ONBA 4OI4A 4JYBA 1CRPA 3LFUA 4CYMA 4RFSB 4G5SA 1QRAA 3NBXX 5L3RA 1EGAA 4LUCA 3QEJA 4KU4A 2FGKA 3FMPB 4AG5A 4Q5IA 2FJUA 4LX0A 3HU1A 221PA 3HPQA 2BCGY 3QENA 2G1KA 2FPLA 1NLFA 2GKSA 1KDPA 2IS4A 4DC9A 3HJNA 1JEDA 2ZEJA 2O8EB 3BGWA 4GFDA 3QOFA 1W36D 1TTTA 1LW7A 2ZE7A 2RGGA 1XDBA 1ESMA 4IDPA 1OXSC 2FPKA 1T8UA 4GBMA 2XGJA 1MKYA 4JVNA 1KMHA 1QVRA 4BLSA 4B71A 3P27A 2RHDA 3P26A 2YWFA 2ZE5A 3NC1C 3AM1A 4URYR 2ZUBA 1LNZA 1YE8A 3TAHA 1Z6TA 1U98A 3C14C 1SZPA 3GEHA 1MRNA 1ZBDA 4EPWA 3SYKA 4IOKA 4RFSA 1G7CA 4HB2A 4JT4A 4UNPA 1KTVA 1Z3IX 4HATA 3DZDA 4POAA 1ZCAA 5FOXA 1PVOA 1U0LA 1TF2A 2GJAA 5FBWB 5BQ5A 4ESHA 1RRPA 2QPOA 4FWIB 3ADDA 1RFLA 1U8ZA 2ZJ8A 1KHTA 1DVRA 3BB4A 2QAJA 4B32A 4CRWB 5FFMA 1NN3A 3IO3A 2KBFA 2QROA 2XTMA 4HLUA 2E9SA 4P4TA 1G21E 4NYJR 2ZJAA 5EXSA 1UKYA 5CITA 2R8RA 2JLVA 3IIKA 1UFQA 3SDZA 1GIAA 2GF9A 3PUZA 3KKMA 2Q0HA 3U7HB 4OJKA 4GMXA 4US1R 1ANKA 1DE0A 2P65A 3KKQA 3LQRA 2V7QA 2IHYA 2FH5B 3GJ4A 1WMSA 3BC1A 5FL3A 4EJSC 2CE2X 2GETA 1XD9A 4LHXA 1VG8A 1IHUA 3QJYA 5CDFA 2FU5C 2YC2C 4DSOA 4HZUA 4QGAA 2DY1A 3K70D 1S9DA 3IEVA 2VHCA 2QP3A 2IXEA 2O5VA 2VQSA 1T4GA 2X2FA 4B3FX 1GRQA 1D9ZA 5AJZA 5JSZA 1FNMA 2JLQA 5B57C 4NU0A 2ZYVX 1KY2A 4FINA 2D74A 3THWB 2YV5A 1IN4A 3TW4A 2ZS9A 2QBYB 1W44A 2IUUA 1OHHA 1VIAA 2O0KA 1KO8A 1Z0DA 1I4TD 3NWJA 3I5XA 5AK0A 1FFHA 1EX7A 4B73A 2WV9A 2V8OA 1AGPA 4LHVA 5JBQA 3ZVRA 1OIVA 5D3QA 3PIRA 3WNBA 4QL3A 5C4GB 1ZCBA 1BYIA 2Z43A 1YR8A 2CCJA 3QEOA 3I5YA 1XEWX 4Q7LA 1ZNZA 1QHNA 4HB0A 4OK5A 1ZYUA 1FP7A 2CCGA 3I4LA 4IOJA 2RGDA 1Z47A 3QVUA 3W6OA 3B1ZA 2DYKA 3THXA 1XJ0A 4JS0A 4LJ9A 1P9WA 1GL9B 3B78A 4PZLA 3V00A 3C5CA 1ZINA 2JJ8A 1WE2A 2REXB 2CJWA 2QPAA 5JEEA 3OHMA 4AD8A 5B58C 2BC9A 1OH5A 5G41A 1G3QA 2AD5A 2G0TA 2ZRPA 5LB2A 4FMBB 3PV0A 5IRCD 3RWMB 1H8EA 2NG1A 1PLLA 2B8WA 1JR6A 3TUZC 1YZGA 2ORIA 3THWA 1G3UA 1CF4A 5GADl 1E9EA 3HYRA 2FOLA 1N0VC 3NTUA 4V0LA 3R9WA 1G8FA 4IVQA 5E4FA 3L0IB 1OF1A 2ZQ5A 3KJHA 3MWKA 4TTRA 1AIPA 4LPSA 2QL6A 4CDGA 2YZ2A 4URWR 2F1JA 4HAVA 1KMQA 1AS0A 5FPKA 2XSZD 4NYMR 4DLVA 2ZYWX 1W2GA 3AUYA 1BS1A 1F6BA 2C98A 3TUJC 1DARA 2XTZA 1YZQA 5JJIA 1CEEA 1AN0A 4JLJA 1DAMA 1D8TA 2OE2A 2A7QA 1D2EA 2WWGA 1E9BA 1RYHA 4B6EA 2C04A 4DCTA 5TDHA 3RANA 1XRJA 1CJUC 5EQTA 1AKYA 2YOHA 5SZHB 4M1SA 4ZIRA 4MDEA 5BN4A 5G3YA 3QF7A 4KXFB 2GNOA 2XTNA 1TMKA 2ZS8A 3SQWA 4JJZA 3GJXC 4TL6A 2PX0A 3BFXA 3OIVA 2IEYA 3LBHA 1Q0UA 1U90A 2W2VA 1OB2A 5G53C 2C9YA 4KSCA 4K46A 4GZMA 1N0UA 4OQLA 4F7WA 1N6LA 3TH5A 3A4LA 3WYFA 4Q1EA 4HYYA 2H16A 1G4AE 2IYSA 4LJ4A 2AKYA 3KQHA 1XTRA 2QSZA 1VPLA 1YRBA 1S1MA 1COWA 2HCJB 2RH5A 3I92A 3ND9A 1G8PA 4Q4AB 3ZZUA 4DLTA 4WZBE 4WZ6A 3OIWA 3TK1A 4RKEA 5KHOC 1R5NA 5FPSA 4GDFA 3A37A 2Q9CA 2HJGA 1U8AA 1U9IC 2W83A 1RW4A 3TIFA 3B82A 5IDVA 1T3HA 1OFIA 3N70A 5TB5A 2BM1A 3CW2A 3FFAA 3WMGA 4QGHA 2ZRHA 2QE7D 3BBPA 1OFUX 1E98A 2O52A 2A30A 5J4KA 3U3MA 2IEZA 4A6PA 1XEXA 1NY5A 2DFNA 2NQ2C 4M9ZA 4O25A 3T5DA 3A58B 4C0BA 4FI3C 3B5JA 1FQJA 4JKYA 4NCNA 4CEIA 1S8FA 4ZIRB 3LY5A 5LPNA 1ZD8A 1OYYA 1X1SA 1KIMA 1ZU5A 3LNCA 5H68A 2ZXUA 1NBMD 1MO4A 1S3GA 1XJQA 3F5FA 3EPKA 2ZRBA 2FSIA 3CH5A 4DDWA 1ZD9A 1JXOA 1Z22A 1Z8FA 1CJVC 1P2VA 4UJ3A 1R4AA 2GF0A 2ODNA 3OFND 5F9FA 3IBGA 2VTKA 4B6FA 1IJFA 2ODBA 4JLKA 621PA 4C9BA 1N6HA 1QHIA 1XTIA 1FX0B 2SHKA 4BECA 3A4NA 3SYLA 3VR5A 1Q3HA 2D62A 2EFCB 2VL7A 3B1XA 3B1YA 5CYPA 4A1FA 1J8MF 3QVVA 2H8KA 2V6IA 4E09A 1U94A 5HCNA 2JCSA 4HAYA 2BBOA 3WP0A 4PXAA 4BLPA 2XSZA 4CEJA 3DMNA 1JAIA 2N42A 3T35A 1WDTA 3U6KA 3X1YA 2WJVA 4EPRA 4QKQA 1WRBA 4PR0A 2ZR7A 5DI3B 3RSLA 5KO2A 3CNNA 4NYIR 1Q1EA 1UM8A 4QGFA 1TU3A 2CVHA 2J7PA 4OL0A 3D8BA 5K8LA 1P2UA 3IKJA 1I2MA 3DZ8A 1SVKA 3K9HA 4NYIQ 4A2PA 3RS2A 3PEWA 1RJ9A 1NVVQ 2D06A 3ETLA 5FOVA 2D2FA 2WWWA 1E2IA 4OYHA 5FUWA 2ZYTX 1C1YA 4F91B 4TZ6A 4PO1A 5KNCA 4BEBA 4C7OA 5GJCA 4CW7A 1DTSA 1KI6A 3CPJB 4F4CA 3CKLA 2KSQA 4DB2A 3AVVA 1G4UR 3CR8A 3QF4A 1E0SA 1GSIA 1DOAA 3OEHD 3ADCA 3LBIA 4XWOA 1XPRA 4FMCB 4IHQA 3T1VA 4DLUA 1US8A 4D81A 5JWOA 2GRJA 1GTVA 1W5SA 1XCGB 2VRWA 4BASA 3CM0A 4LI0A 2QP9X 2KWIA 3THYA 3U61B 2KI5A 2QAGB 4MKIA 1B23P 4B47A 4HUQB 1G17A 2ODWA 4RZ3A 4A2QA 4JLBA 4TMXA 1GKIA 3TNFA 4DSUA 1NKTA 3GJ7A 3EWAA 3CNOA 3QBVA 3GQBA 4URZR 1CR1A 1C9KA 4DCUA 5H1YA 5DIFA 1CR0A 1Z0JA 3MGCA 1P5ZB 4JSYA 1RPZA 3B1WA 2BJVA 3ASZA 3KUCA 1KI1A 2PJZA 3W9YA 5FTLA 4M22A 1E2JA 3VHLB 5FPHA 1RJ9B 3K0EA 2C8VA 2R44A 1X3SA 3BS4A 2QQ0A 4LJ6A 4DVGA 1GOTA 2BM0A 1HURA 4RZ2A 3CF2A 3DMDA 3QXJA 3F8TA 2OM2A 1MV5A 2F6RA 1II0A 4V02A 1SXJB 4CEIB 3SBDA 1OB5A 4B3DA 3T06B 4P31A 1LS1A 1KAOA 3C4JA 4CT4B 2BKEA 3RSOA 4NCHA 1NKSA 1VYVA 3KB2A 4PPQA 3AVXA 5SZKB 2C9CA 1G6OA 4NHOA 4AKHA 1DAGA 4KJZA 5AJXA 4CIDA 2YOGA 4KFRA 1W36B 2ZETA 4I81A 3IO5A 2CHQA 4HAWA 3W5IA 2NO9A 1H65A 4BZXA 1YR6A 3FVQA 2F3TA 3EPJA 1HTWA 1ZRHA 4V0NA 1A82A 1G19A 2JJ2D 3B9QA 4B44A 1ZVQA 1KK0A 3WRYC 3RYTC 1ESNA 4DHEA 1NVVR 4QHTA 2JATA 3V9PA 4MA4A 2NOAA 1VIYA 1VKJA 3QG5A 4KO8A 4Q1AA 1N5LA 2FEOA 3U7FB 1N25A 3SS8A 4LY6A 4LYAA 5FL7D 1JEEA 4KSBA 4QJ4A 4BUJA 2IYYA 1S1CA 2RGXA 2UZIR 2V54A 1EESA 1A2KC 1CKEA 4KBGA 2OUKA 3U3RA 1PV4A 2A78A 3LH5A 4M9QA 2WWYA 3AVQA 2YNMA 1VMAA 4Z54A 4XJXA 1IY0A 1XZQA 1XP8A 3BJIC 4GNKA 2WOJA 4TLBA 5SZJA 2O8DA 3CUEF 1DAKA 4RY2A 5UKDA 4ZV4A 5FPYA 1XMSA 5HR5A 2HT1A 3W3ZB 4ACAA 1I4LD 1Q1BA 2I3BA 3RDPA 1E69A 1FNNA 2FPMA 2XEXA 3R7WB 3K1JA 4JLOA 1IN5A 5EXTA 1QF9A 3H84A 5KYKA 4WW0A 1KMHB 1XXHE 1E3MA 3MAAC 3P32A 3REFA 2D7DA 3AKYA 4LJYA 3OZXA 5JFGA 4YQFA 1Z08A 4M1MA 2IYUA 2H5EA 4NE2A 1OH7A 5FTKA 4X8HA 3SOPA 4QBFA 2PT7A 3ZVMA 4MRNA 2X2EA 3KXLA 4KYUA 2WJYA 1KDRA 3ZZTA 1Q20A 3AB3A 2IYLD 4XVQA 5CM9C 4AC9A 1DPFA 3I61A 5HTKA 1Q21A 4WXPA 4TTQA 2QGNA 2DR3A 4BFUA 5AUOB 2D7CA 4ZPXA 3WHKA 2QPTA 4DWJA 4TQAA 1W0JA 1ZAKA 2QT1A 1ZMXA 1S96A 2P6RA 4I99A 5JMTA 3X1DA 1KSHA 2ERXA 3AGQA 2YOFA 4WAUA 2VP2A 1YHNA 2ZI5A 1P9RA 1HQCA 2AFHE 2VP4A 5HZKA 3TR0A 4QBGB 4NCKA 3S1AA 4B76A 4PPNA 5BN5A 1TX4B 2GEDA 5KU1A 3O8RA 1TF7A 3ZH9B 2X19A 3MD0A 3JZAA 2ZTSA 1ETUA 4LHWA 3KQNA 3R8FA 2WM9B 2CVFA 1HEIA 4OQFA 1CU1A 3AVTA 5EJEA 5HE8A 3Q85A 4A0GA 2FDCA 1GNPA 1DADA 1BKDR 1W49A 3FHOA 2W2XA 3NIBA 5JSZB 4JVMA 1Z5ZA 5L3QB 2WTUA 3UMRA 1WA5A 2OFOA 3BOSA 3I1FA 1XTSA 2X8AA 3B85A 3UIEA 5CJPA 3LLUA 4NL4H 2GXSA 2ZI3A 5E7IA 3FKSA 1FOEB 1T0JB 1T5LA 4PC2A 1P75A 4OQNA 1UDXA 2IK8A 2ZJ5A 4AY2A 1OJLA 2WWXA 4P33A 3QI2A 1E1QA 1OXTA 4EFLA 2ANCA 4MGKR 5E3HA 3ZD7A 2IS1A 3NDBB 3AKEA 1PZNA 4XWAA 2JLUA 1OFTA 4K81B 3DPUA 5E7JA 5KPJA 4LHZA 3PCRB 1Z6YA 3S1AB 3W8RA 4DB4A 3ICEA 1P62B 3ZYCA 4F38A 1R6BX 2AKAB 2NZ8A 4C0QC 4E03A 3BRWD 3UG6A 1E32A 4ZCMA 4MRPA 2DWOA 4II7A 5EUMA 4F4JA 4XIGS 1N2CE 1E9AA 4HDOB 5CM8B 4D25A 4IDOA 2CJWB 3H4MA 1OV4A 4V0KA 2VF7A 1M8PA 1ZD1A 3FMFA 2WIBA 1F2UA 4YMVA 4D4LA 4TZ0A 4LPKA 4PAQA 1KDOA 5FTJA 2JLXA 4O2LA 1WBBA 5JJLA 3REGA 2JLRA 5J4YA 4C3ZA 3C41J 1JECA 2F55A 4PHFA 1G8YA 5DN6D 5GJBA 2H7VA 4G0NA 2CNWD 4RD0A 2F9LA 4QOSA 2J41A 1AA9A 2A2ZA 1JPNA 2CLDX 4Q1DA 4PSAA 2WKQA 3ND8A 1D2NA 5FI1B 1GITA 1KJZA 1FZQA 4L4UA 4Q00A 3SJBA 1K5DA 2CXXA 1DO2A 2OILA 3GJ0A 4HB3A 1D5CA 4TMVA 3GP8A 2A5DA 2BHRA 2QT0A 3KDSE 3GLIE 3U7GA 3IILA 1VG9B 3Q9LA 2HDNB 1CR2A 3W34A 4DXAA 4DZZA 1NL3A 3QXSA 4ZKEA 4B74A 3K0CA 4AURA 4P4UA 3LVQE 1UJ2A 1KK2A 3GEIA 3NXSA 1J8YF 1MR3F 5KUTA 2RGCA 1R8QA 2EVWX 5AUNB 3SJCA 1UEJA 4DJTA 2WICA 3GPLA 3H0KA 1N0WA 1E2PA 2WJIA 5KDLA 2O8EA 4Y0AA 4N3NA 4KODA 1KAGA 1N5IA 1E9RA 2EFGA 1FL9A 2C96A 1CS4C 4YLGA 1E2KA 1N6RA 3WBJA 3QPVA 1MO3A 4PX9A 4PANA 3X1XA 2V1XA 4YXWD 1S9HA 4GRAA 3IIJA 2BMFA 2W6ID 3WRXC 2JJ1D 4Q7MB 2UZ3A 1LFDB 1HY3A 4NZYA 5JECA 4C0KA 3LO5A 4FIDA 1G8GA 2FFQA 3LV8A 1WB9A 4TYQA 2IYRA 5KOYA 3VNUA 2GEUA 1L7VC 4YDSA 4LWZA 4TYPA 2IHBA 3BH6A 3KQKA 2V9PA 5LD2B 2G6BA 2PLFA 1VG0B 1TPZA 2QA5A 2R6GA 4I1UA 3TKLA 1N6IA 4DEYA 5L3SA 3X1WA 1M6NA 2CHVA 2JASA 3BH0A 2B7CA 1E96A 2QTFA 5J4HA 1GAJA 1OIWA 1MOZA 4HAUA 4JLPA 2J0VA 4NP6A 3VNVA 2AXNA 5EP2A 4U00A 2EWWA 3BORA 4LDJA 4FXPA 5P21A 4AKGA 4JYCA 1JI0A 1W47A 4LCBA 4DIEA 4D6PA 3ZQ6A 3ZDQA 3CX8A 3EZFA 3FDIA 4OI2A 4TLEA 1XEXB 4IVRA 4DSTA 5JRZA 5EXPA 3VTKA 4B2IA 2C77A 4XD7A 3QSYA 2C03A 5HKKD 3P1JA 1ZU4A 2J87A 2QENA 4R9UC 2ZM5A 5HCIA 3GLFA 1L4YA 2BMJA 3C5HA 3MLEA 5BYKA 3U44B 1R0YA 2REBA 4IDHA 5CIQA 4A82A 1HV8A 1GDDA 1UAAA 2CDNA 1LS6A 4H9GA 4CEHA 3EG5A 3TLXA 2CLCX 3AF0A 3MSXA 4IOMA 2Q9BA 1N5KA 3IGFA 4Z51A 4M2LA 4YC7A 2RGNC 3DO6A 3M4YA 3QXXA 4JKIA 2IUTA 3C16C 1R0WA 4MDFA 4WXRA 1GKUB 1IY2A 1RIFA 2WVJA 5FI0B 4U5XA 1KDTA 1KI8A 3KFVA 2VP6A 5JHGB 2OHFA 4OHYA 3CRRA 4A0FA 1XD2A 1CULC 3MRSA 2C2HA 3QKRB 3U5ZB 4NONA 4RZUA 4LV8B 3WNCA 2RGAA 5IHPA 3GLGB 1FUUA 4U02A 2VPPA 4Q21A 3J81k 3TVDA 1AZTA 1KNXA 4Q7KA 3SE0A 2IYVA 2GK6A 2ZRDA 3MG9A 3SC3A 2OBLA 2IWHA 3TVTA 1P61B 2J46A 4AYWA 4WA7A 1XBTA 4IRUB 2A9KA 4Z1MD 2NO7A 1BMFD 5C1BA 3RVBA 2QRNA 421PA 2ANBA 4BFVA 4MRVA 4ITRC 3OEEA 3KKPA 3OAAD 4B75A 5FUYA 3U44A 5CK4A 3AVWA 1IOZA 3RC3A 1CJTC 2OCYC 1R5OA 3FFBA 1UPTA 1G16A 4CEHB 4C7OB 1TQ2A 1YZTA 2GK7A 4PHGA 4Q66C 1H8HD 2IYWA 1E9SA 5KDOA 2VF8A 1E2QA 5H8WA 5CB6A 1AKEA 3U3OA 1G5TA 3VR1A 2GJ8A 3K09A 1N5JA 2J59A 2I4IA 5DNYB 1NVUQ 5IF9A 1OE0A 4RZXA 1E2GA 3A1VA 4HI0E 2Q21A 4BFTA 1IXSB 3PVSA 3ZD6A 2J0SA 4B48A 1E99A 5EE5B 5H70A 1P4SA 2GDJA 1BO6A 2PMKA 3BK7A 2OFXA 3IUYA 3SEAA 1MRSA 4TYNA 2Q3HA 4PTLA 1OXVA 3KTAB 3VHXA 5L3SB 2EU8A 1KY3A 3Q3JB 1E2MA 2R6DA 1PUJA 1E6CA 1RRCA 1BH2A 5C4MA 3TRFA 4TQ9A 1W5TA 2YWEA 3M6AA 2QMUA 2PX3A 2E87A 4DLWA 3OAAA 1R0XA 3K0SA 5FTMA 2XZOA 3JVVA 1KJWA 4ZDJA 4DDTA 1DO0A 2ATXA 3GLHE 1DBSA 5JWRA 3VR4A 3QQ5A 4R98A 1P3JA 3NBFA 4BLOA 1XEWY 4PSKA 1SXJA 4JLAA 2GVDC 4FW9A 2BJWA 2PMDA 3PR1A 4E07A 3B2EA 2ZI4A 3FWYA 2ONJA 4ERNA 2HYDA 3NKVA 3MWLA 4B2LA 1E2FA 2V55B 4ZCIA 5DISB 5TMPA 4G3XA 1W4AA 4I1OA 1PJRA 1E0AA 1G20E 1VYUA 3K53A 2HCBA 2OFWA 4C0HA 4ZDWA 1Z83A 1DAFA 1XU4A 1SKYB 1AQYA 5B30A 1IBRA 4NDZA 4YONB 4LYFA 3A1TA 1RE0A 5FR1A 2JLYA 5DN6A 2J0QA 2O8BB 2Q3MA 1CBUA 2RAPA 5FR2A 2QMOA 4AK9A 3K09C 1II8B 3L0OA 5AUPB 5EE9A 1KZ7B 5CDFE 1XFAA 1SXJD 2HT6A 3QKRA 2XJ9A 821PA 1OH6A 3GLGA 2HXYA 3AVOA 5EE0A 4XD7D 1G41A 1G64A 3MCAA 5J4LA 4JIMA 5HKKA 2Y8EA 1W2HA 2QAGC 1D6JA 2YWHA 3UANA 2ORWA 1L4UA 721PA 2O8FA 3K9GA 4Q4JB 2H57A 4RD4A 1Z6XA 2LCFA 3E1SA 3SHWA 2DFTA 1P73A 4ESVA 4NYMQ 1NIJA 4RD6A 2KBEA 4W5JA 4DSNA 4PAMA 4YMWA 4ZO4A 4Q1BA 1R2QA 3EX7C 2IS6A 4W5HA 1ZUIA 2E1RA 3EC1A 2MSDB 4EIWA 5F3WB 2GVZC 121PA 4BWYA 2FX3A 2QUZA 2F3RA 4B33A 2WWFA 3AP2A 1E1RD 4LRWA 3B8HA 3CX6A 1OKKD 4ON9A 5FPTA 5F9HA 1OXXK 4DLZA 1M1YE 1TQ6A 5E95A 4RVCA 5DSZA 1TNDA 1VHTA 2GJSA 2EW1A 3F0TA 3SFVA 2HF8A 1P7CA 4DT1B 4GI7A 2NO1A 2J5XA 2VBCA 5JI2E 4LV6A 1XMJA 4WZAE 5TARA 3MFYA 3VR3A 1OPXA 4LZZA 4RD3A 1H8ED 5DI3A 2HJVA 1IN7A 3LDAA 2ZIAA 1JR3D 1E4VA 3ZIAA 4B35A 2ZJOA 3CWZA 4IDQA 1QVAA 2WHXA 5SZIA 2O8FB 2R6CA 4Q4JA 1Z0AA 3WYAA 2Q6TA 1G7SA 2ZUDA 4UJ5A 4DCVA 2KE5A 2WBLC 4D80A 3TR5A 4X8OA 4PFSA 5C18A 1ZW6A 1KK1A 4A15A 2WAXA 1M2OB 5J4VA 1Z0FA 4QNMA 2RCNA 4O3MA 4GOXA 1DG3A 1SVWA 3H86A 1U99A 1KI2A 4KYIB 3ADBA 5FL7A 3K0FB 1ZIOA 4XSGA 4Q4HA 1YQTA 1A2BA 4LJ8A 4E22A 2H18A 3QKUA 1R10A 3PQCA 2IC5A 4AWXA 5IT5A 3I8SA 1ELOA 1M7BA 3RRYA 2DBYA 4WOPA 3U60B 4Q01A 5EXXA 1G3MA 2QAGA 3I32A 1G291 3O8BA 1U2RA 4TSFD 4KAXA 2HUPA 1I2DA 4QFMA 1OYWA 1PLKA 3DM5A 2C5LA 3QNUA 4C2UA 1ZM2A 3IPYA 2OLJA 2PEYA 1NBME 2WKPA 4HDCA 1J2JA 3IQXA 3VKHA 3P4YA 1YU9A 2TMKA 4QNRA 5FBQB 4CT5A 2R62A 3GJ6A 3K0CC 4BFXA 5L3VA 4XTRA 4D0NA 4I1VA 2G3YA 2G83A 1CR4A 3EZ2A 3Q5DA 1JQLB 1GP2A 3ZS8A 4TMZA 2GWHA 2GAAA 2Z4SA 1BOFA 3F3YA 4FCVA 1W1WA 1FPMA 2QQEA 2ZJ2A 2PH1A 2J7KA 2R65A 2GXUA 4B3CA 4TWZA 3GLGE 2WKRA 1NIPA 3AP1A 5DI9A 5CIWA 2IYZA 2ZUCA 4UNSA 3GFOA 4LYHA 3LW8A 5FOUA 4BRUA 4JLDA 2GZAA 3GD7A 1QHYA 2VHQA 4D26A 2P5TB 1EFHA 1G1MA 1MABB 1T9HA 2RGNA 2W6IA 4MRSA 4M4SA 1CLUA 3PEYA 4PPFA 1JQJC 2NIPA 1JBKA 5KNBA 4Q9JA 3FKQA 1RVDA 2AXPA 2ZR9A 1EK0A 4HAZA 3X2SA 1FTSA 5DH9A 3KQLA 4BFYA 3IPXA 4CF7A 1T5IA 3QUSA 521PA 4F92B 1KKLA 4DRZA 2Z6VA 5KSPA 2GCPA 4V03A 4EQ6A 2DWQA 1KNQA 1Q12A 4MYCA 2JEOA 3U2QA 2MMGA 2WJHA 2QU8A 4MITA 1TUEA 5EP4A 4Q03A 2PZEA 4QM7A 4DT1A 2K5UA 2FV8A 3D7MA 4RCYA 3R8CA 3Q8XB 4OI1A 1E1RA 2FZLA 3QKTA 2BBSA 1VDZA 4R71A 4GL2A 3LXXA 1WP9A 2PT5A 3VU9A 2WWHA 3SR0A 4GT1A 2FG5A 1EG7A 4AYTA 2W0MA 3QPUA 2XNDD 1GKYA 4EAQA 1KI7A 2LKCA 4QG7A 2IYXA 4D4JA 3T15A 4IEEA 4PO9A 3ICQB 3O47A 2ODEA 2AWNA 3CH4B 3HYTA 2OAQ1 3R7WA 3DDCA 4PO8A 1II9A 1P9NA 2YKGA 1ZM3A 3NHBA 2CE7A 4TLCA 1DS6A 1OW3B 3ZLJA 3QIAA 2NMVA 2EYQA 1ZUHA 3AF2A 4A0RA 1XX6A 5JLJA 3CX7A 2ONKA 2XNDA 2G77B 1U81A 4RJLA 3AP3A 4IFBA 5KSOA 3U4QB 1OHHD 4G5RA 4JLVA 3RRMA 5EE3A 2GBLC 4Q4HB 5C46F 4EQ6B 1ZNWA 1IN8A 4B34A 4P3YA 4JLMA 1TEXA 4MQBA 2OV2A 1JAHA 3NBZC 3P20A 2DFLA 4Q1CA 1W4RA 1SVOA 4UXJA 1Q3TA 4KVGA 5EZ5A 4HLUC 4CVNA 2P5SA 3NEYA 3EZ9A 4MUAA 2FFAA 4KLNA 2IF0A 4DBLC 4X8MA 4A6XA 5KNDA 4U7DA 1NMZA 4GPTA 2JJ1A 4ZI2A 4Q9LA 4B3BA 5C2JB 2HEIA 1A7JA 2AR7A 2J45A 2JGNA 2XITA 4OBEA 3OEED 2JIZD 4HLDA 4LBVA 4Q7JB 5CYOA 5JWHA 3LX8A 4OJQA 1O3YA 3KUDA 1X86B 4A8JC 4JVLA 4ABYA 1NI3A 1Q1ZA 4XOIA 4HUTA 1NLZA 2PLRA 4V0MA 1M34E 1LV7A 2AFIE 4IFEA 1OIXA 1GILA 2FEMA 1KYIA 1NN1A 3BE4A 4JJKA 4TT3A 3UPUA 3FPAA 3GLFB 2QZ4A 3QE0A 2ZAMA 4FWTA 2MMCA 1QHXA 5K8IA 3ASYA 3IDQA 1ZNXA 5AWFC 3UXMA 2GZHA 3NHAA 4PC7A 4PAOA 1GRRA 3B6EA 3D31A 4N1AA 2O8CB 4LV5B 3ECCA 3CRMA 3GJ5A 1MO6A 1Q57A 4NPHA 1NY6A 4PC6A 1WXQA 2ATVA 4QRHA 2BIFA 1XNJA 3MJHA 5FBLB 3VR6A 5L3QA 1E2LA 4D82A 3AH8A 3RNLA 1G3RA 4Q18A 4L8GA 1JXMA 2FSHA 3LLMA 5GJWC 3THOA 1XTJA 4JBXA 3T1QA 1XXHA 1P60A 1S3SA 3PEVA 3T5GA 1XD2B 5TXGA 4ARZA 2VHUA 3Q7PA 1NNEA 3BB3A 4LHYA 4L16A 3A1SA 5AUQA 1E9CA 2F1HA 2AHOA 3TBKA 5CLQA 3EC2A 5BW8A 1RRGA 4LC0A 4X8LA 2V7QD 3L82B 4NCJA 4S2EA 1FMJA 2ZSEA 1E2DA 2FFHA 3BIFA 4HZIA 5EZ6B 1T6NA 1GUAA 2QNRA 3R9XA 4UXIA 4C4PA 4BFWA 1Q22A 5JZVA 1DELA 4KFSA 2VLIA 2AD1A 2GJKA 1ZM7A 2RKOA 5J40A 5JS7A 2YWGA 1NJGA 4JL8A 2DPXA 1F2UB 1K5GA 3A6PC 1BMFA 1E2EA 1K6MA 2J9RA 3DKPA 1CTQA 3GJ8A 2XXAA 3UG7A 1E0KA 4M8NE 1IXRC 1E9FA 3NG1A 4OI0A 5FTNA 4TTPA 1HH4A 4HAXA 2ZS7A 4OKSA 3EPLA 3U4QA 3A4MA 2B21A 1VG1A 8OHMA 2V3CC 5LBIA 3WY9A 1YZUA 4QBIA 2A3RA 1SQ5A 1XEFA 1KO1A 3LRPA 1OSNA 2C95A 3G5UA 2ZRMA 5A0FA 4L15A 2IXFA 1SVLA 2JDID 3FGNA 1XMIA 4MKGA 1HA3A 1ZM4A 3HP1A 1OKKA 1SGWA 2GCOB 3N2EA 3KKNA 3QBTA 4US0R 5DE3A 3UMSA 4OK6A 4DLYA 1CP2A 4MKFA 1TAGA 5EE1A 6Q21A 4MGYR 4LOAA 4MRRA 2LKDA 1HQYE 2C9OA 2NZJA 1NF3A 3EAQA 2IA5A 2WSSD 3EXAA 4OHVA 2WAYA 4UXHA 4C2TA 2V6JA 2WJGA 2VP0A 4PZZA 1WQ1R 4Q9KA 5G40A 4KITB 2CK3A 4KI0A 4ACBA 1NJFA 3TSOA 4UNQA 1IONA 5BWMA 3JVUA 2JLZA 4BE7B 2ZRLA 1V5WA 1OLOA 3P4XA 5JI3E 1EX6A 3QXHA 1V43A 3AQ4A 2ZANA 3I8XA 2RB4A 2XX3A 4P4SB 4KVAA 4Q9IA 5FBRB 1X1RA 4GP6A 3VX4A 4YMTA 1Y3AA 3BB1A 1JB1A 3KB1A 2F43A 3LW7A 4I4LA 4LC1A 4A92A 1G7RA 1QG4A 2EFEB 3CZQA 1HYQA 1VCOA 5KDDA 2ZRCA 3PEUA 2OEPA 3DL0A 3GJ3A 2WWIA 2ZJZA 4RSGA 4Q19A 1SVIA 2ZE6A 4KV9A 4FMDF 4LYJA 1J90A 5B2ZA 4EPYA 3NVAA 1UBCA 4M21A 2HYIC 3BXZA 4BLRA 2CHGA 1HUQA 3KJEA 1SKQA 1YR9A 2ZPTX 1YRAA 1Q1QA 3KL4A 1XPUA 1NN0A 2O8BA 1II8A 1R8SA 4EPTA 3CNLA 3NBYC 2J0UA 2OBNA 5TVKA 2R6FA 1AS3A 4E5UA 5DHAA 4ASUA 3D3QA 3AV0B 2ERYA 2AWOA 1X8KA 1X8LA 5DGXA 4W7SA 5A5GA 2ZR0A 1G3IA 3K8YA 1W36C 2DWPA 1NVWQ 3C7KA 1X8JA 4XH9B 2KB0A 2YC4C 5AJWA 4QXAA 4TT3D 4QJ5A 2YYZA 2BWJA 3WXMA 2FNAA 1TUIA 2FWRA 1NSFA 1NLYA 2BVNA 2B7BA 4FMCF 5HZHA 1XWIA 1YZKA 1VECA 3AF4A 3FKSD 3KXKA 3L8YA 1CRQA 2JA1A 3GMTA 1TEVA 2VHJA 1EFCA 2J3EA 4MGZR 1VCNA 4GOKA 4GZLA 4BQSA 2GCNA 1GFIA 3EZ6A 1SHKA 1EFRD 2Z5FA 2F9MA 3OE7D 1AQUA 2VEDA 4G5OA 2FN4A 4QHSA 1UDWA 4EFNA 2ZAOA 5L8VA 4A0HA 3V4FA 2QRZA 1C4OA 2NPFA 4PQRA 1Y63A 1HT1E 2WMNB 3E5HA 2BBWA 3QKSA 4O2RA 2IL1A 4RKFA 1G9XA 1NSTA 1E79A 3ONWA 4LBWA 4LGMA 3W5JA 5A4JA 1VHLA 2VSFA 3SN6A 4YDHB 1E79D 3AF3A 4PC1A 4KHZA 1VTKA 1KO7A 1SVSA 1HE8B 3DEFA 3I3SR 4ZDIA 2PEZA 1SULA 3GFPA 3RS4A 3EA5A 1N6PA 3L43A 1KI4A 3LAWA 3BERA 1E2HA 1NP6A 2BV3A 1CJKC 1LVGA 2A5FA 2HF9A 4ZI3A 3IIMA 3KZ1E 4LJ7A 1G7TA 1JALA 2VSOA 5K8UA 3SI7A 4EKDA 2W58A 3TUIC 5AR1A 1IQPA 3PUXA 5D3MA 4EPXA 4NMMA 4G01B 4TN1A 1GL7A 1UF9A 5J5CA 1E4YA 4YMUA 1F2TA 2EWVA 3CBQA 1JJVA 3SJAA 2ZI9A 4BFSA 3NC0C 3T1TA 5AJYA 2QN6A 2ZRFA 3GEEA 1G18A 3W8NA 2IYTA 4B3GA 4JLNA 3PENA 4DDVA 2OLKA 2MSCB 4QBHA 2Z83A 1FMLA 2XJ4A 4P4SA 1P2SA 5CLLA 1ODFA 2CCKA 3QKSB 1NG9A 4Y0VA 1RC8A 2F43B 3I62A 4FCWA 1Z6GA 1TQ4A 4AI6A 4JZKA 2MSEB 2W00A 2REOA 1TL7C 4AKEA 4AG6A 2QE7A 1DAIA 4MYTA 2XB2A 2GAOA 1DAHA 2G9NA 1TF5A 4JBWA 1GM5A 4A36A 1NMYA 4HEJA 1J70A 1F5NA 3KTAA 4LK2A 2WIAA 4I1SA 4M1WA 2FF7A 4OHWA 1SKYE 3H1TA 3WMFA 4XVUA 2B8TA 3KJIA 4D2IA 2A5YB 2ZJBA 3SZRA 2JJ2A 3L8ZA 1COWD 4LJ5A 2DFKB 4Z8XA 3TQCA 1E94E 4A8JA 3U6BA 2QMHA 1J7KA 1Z07A 1FTNA 2LWIA 3MWJA 4UQOA 1G8HA 5FOSA 1ZNYA 4P32A 3VMFA 3PFIA 2QGZA 3CRVA 3NDPA 1N3BA 3IQWA 4HZUB 4AKIA 3MUFA 1A4RA 4PZYA 1F2TB 3SYNA 4DLXA 2EQBA 3VQTA 1P2TA 4GOJA 3AGPA 3R20A 2YVUA 3HDTA 4R2HA 3ZVNA 2Q9AA 3PJRA 2RGBA 2ZRGA 2ZVPX 4LJAA 1KKMA 1MABA 3AKDA 1FUKA 1S2MA 4A9AA 1AM4D 2ZRIA 1WBDA 2PCLA 3TSZA 5FH9A 4PHHA 4LBYA 3T1OA 2FFBA 3RLFA 4W9MC 1M7HA 1EWRA 5AJVB 4UKDA 1OXUA 3EWSA 3LA6A 1T3LA 2D4HA 1KI3A 2OZEA 4YMSA 3C8UA 4M1KA 3DOEA 2OT3B 1IJEA 2GTPA 3PXGA 3ZJYA 4HLCA 2ZRKA 4N0EA 3WBKA 2B92A 2G1JA 4D0GA 3R9IA 2XAUA 3VR2A 2WJJA 2O0JA 2CL0X 2ZROA 3OIUA 1UEIA 3JZMA 4B3XA 1UKZA 2P6UA 3THXB 3SFZA 1K8RA 2BDTA 5DO9A 4A8JB 2H17A 4BEJA 5M04A 3I73A 3DVLA 4ZCLA 5DYIA 3W3AA 3SHFA 2OO7A 3IBYA 3UMFA 1HE1C 4GSYA 3Q72A 1XJCA 2N46A 4IVPA 4DDUA 2P2LA 4BLQA 4TMWA 1U0HC 3X1ZA 1NBMA 1KSFX 4Z1MA 4C30A 2PCJA 1GVNB 5KSYA 1X6VA 2J1LA 3CRW1 2WZQA 1KSJA 4Q4LA 5EUQB 3B7GA 3GLIA 5D3MB 3L2OB 2RHMA 1GZSA 3BFVA 2VP5A 3L0SA 1W48A 3FOZA 3KJGA 5JS8A 5GJVC 4ASUD 3E70C 4R7ZA 4V0OA 4BRWA 1YJ5A 3VX3A 2F1IA 2OSBA 1SVMA 1HT2E 3CIOA 3DM9B 4QGGA 3TSWA 2X1VA 1ZP6A 5HE9A 2JLSA 3NH9A 2BMEA 4TL7A 3CPEA 5FOWA 4QM6A 3K9LA 4OHXA 1OFHA 1GWNA 1CJMA 2CL7X 5JCPA 1KZGB 4A2WA 4CZ2A 4G1UC 2ECKA 1T0HB 2ZRJA 4BGDA 3ADKA 4MKHA 4M1OA 2P3SA 3T34A 1R0ZA 4Q48A 3VAAA 4NBSA 3K0AB 2WOOA 2XB4A 3LQQA 1U0JA 5JJKA 2WMOB 3N5CA 2CBZA 4S35A 4EFMA 1ZUNB 1IN6A 3NH6A 2CNWA 2IT1A 3OIYA 2R6AA 1AGRA 2QP4A 3WYGA 1W0KA 2XOKA 1MO5A 4XSHA 2P67A 5BXQC 3QXCA 3AVUA 1XTQA 3GFTA 4MGIR 3KQUA 2J7PD 4BLTA 1WF3A 4EJSA 3EASA 3NEJA 2D2EA 1NRJB 3V4RA 2QY9A 1RYFA 3OF5A 4M0LA 2WPDD 1KK3A 1IXZA 2WSMA 2AK3A 2I1QA 1W7AA 1KO4A 1B0UA 3A8TA 3RRZA 4DLRA 2QTVB 3AVPA 4Q4AA 1QZXA 2PL3A 3IHWA 1E9DA 1JR3A 3ZIAD 3K0FA 2BEKA 1A5TA 3WHLA 2O8CA 1Z0KA 4LBZA 4M53A 4F93B 1DAEA 3KX2A 4M9SA 4MYUA 3RS0A 4JVSB 2OESA 4P0TA 4DUGD 4F4IA 2ZRAA 5G3ZA 2JDIA 4ILEA 1GNQA 4K8OA 3B1VA 3OFNA 2FMXA 3BAFA 4DKXA 3K9NA 3PUWA 1G6HA 1KI9A 3CZPA 3MMPA 3WNDA 1AZSC 1UBFA 3N2IA 1GG2A 1XB2A 2HXSA 3ZVLA 2HLDA 1TQDA 2EYUA 4O0MA 4PHTA 3RC8A 2CK3D 3PUYA 4KBFA 5LB4A 3TJZA 1Q44A 4FD2A 3RRNA 3CRQA 2V1UA 3DOFA 3MJRA 2ZU0C 2GJ9A 4R2IA 1TADA 2PBRA 2BOVA 2IF2A 2VHTA 2BKUA 4AIIA 1XMVA 5DYGA 2D3WA 3C15C 3U7EB 3PUVA 5HPYB 5B64A 1T3SA 4IXNA 1P72A 4C0JA 1FX0A 4US2R 3QPWA 2FZ4A 3UK6A 3HR8A 3GLIB 4WIAA 2ZYUX 1N6NA 1QDEA 2IXGA 2DCUA 3CPHA 3MWYW 3LX5A 3SNHA 3QY0A 1G5RA 1F48A 2NO6A 3I72A 3T61A 4IKEA 1ZM9A 3OESA 4GMDA 4M1YA 4XVRA 4URXR 5IK2A 3G0HA 1YZNA 2ZREA 2R2AA 1MH1A 2ZE8A 2YINC 2GEVA 2OAP1 1IAQA 1BYUA 2OXRA 3EW9A 2P0EA 3W90A 4TSFA 2WPDA 4XTCS 1VCMA 2W2TA 1CIPA 1KO5A 1QG2A 1XTKA 3TW8B 2JAQA 5JCZA 3RS7A 4RD2A 1LY1A 1KOFA 2Z0MA 3OE7A 2VA8A 1KGDA 2GILA 2R9VA 2GESA 2GCOA 3PG5A 3ZS9A 1W0KD 2XOKD 1M74A 4RCZA 2CL6X 3K0AA 4B2PA 4PSVA 3UWKA 3VU9B 2Q3FA 2I1VB 1SXJC 3QF4B 2OXCA 4L5BA 4CGZA 2AK2A 4G5QA 2QM8A 3FMIA 4QC2A 1RKBA 1U8YA 3OEHA 2H92A 4OHZA 3RS3A 3U3JA 4BPBA 4BZQA 1O87A 4DEXA 4EPVA 1EFTA 4YXWA 3O8CA 3W6PA 5FOTA 1UADA 3EIQA 2VH5R 4JT2A 3ZZ0A 2V4ZA 4OK3A 4EJSB 1UBGA 1F3OA 5EP1A 4URUR 1YKSA 3T12A 1RZ3A 4BFZA 2C99A 4M1TA 2ORVA 2OG2A 3EARA 2ZI6A 4HDQB 3GLFE 3LD9A 2CEAA 4RFVA 1LF5A 3EZ7A 3FYHA 2OCBA 2ZSAA 3L0PA 5FUVA 1ZC4A 4DLSA 3AF1A 1BIFA 1T8TA 3HPRA 4TMTA 1M7GA 1W0JD 1PLJA 1JR3E 4WBSA 1ZIPA 5TV2A 4C0SA 4J0QA 3KFXA 4MUBA 4V0ME 3A36A 2G0NA 4Q02A 1XD8A 4G5GA 3KKOA 2F7SA 2PZFA 4BZPA 2IW3A 4TL8A 2ZI7A 3WMEA 1F60A 1FQKA 4TLDA 3QG1A 1CXZA 2VP9A 2VIIA 1DEKA 4ZDKA 3LXRA 4IJMA 2BEJA 2AN9A 2FA9A 4NH0A 2XZPA 3PITA 1P6XA 5F98A 3SU8A 2IS2A 1Z0IA 2DB3A 2KJQA 1QHGA 1MT0A 2O0HA 3CO5A 5J47A 3M1IA 4Q1FA 2GA8A 3FHCB 3FB4A 2X77A 1OT3A 2GZDA 3AEZA 1VCIA 3G82C 1UKVY 3UWOA 5TY0A 1UKEA 2XZLA 4L9WA 3K70C 2ZJYA 2W6JD 3M0EA 1XZPA 3RABA 2GXAA 4EUNA 2ASEA 2WSSA 3SBEA 1W46A 2GBLA 1E2NA 3CF6R 1IY1A 4IDNA 5CK5A 2A5JA 2NTYC 5FUXA 1XPOA 2ZSBA 2G88A 1S0UA 1YR7A 3EA0A 4OQMA 5E7MA 3GCGA 3CF0A 5BN3A 3EIHA 3B60A 4B43A 2VYFA 4MH0R 4Q9HA 3BFKA 5DLQC 2QSYA 4M9XA 3UKDA 1GNRA 2UKDA 1E0JA 3CB4A 3LBNA 2DHRA 4NKRA 3FHTA 4LSGA 2W6JA 2XNSA 2H1LA 1G5PA 4UNNA 2PJRA 2FSFA 3E2IA 1SXJE 1XCPA 2ZSDA 4FCTA 4A4DA 4IOLA 4Q47A 2O8DB 1XXHB 3ZQJA 4JMPA 2ZITA 4ARZB 5JEDA
chains in the Genus database with same CATH superfamily
1BN7A 1AUPA 5AHKA 1D1PA 4ZOLB 3HB5X 2A5GA 2NPIA 5JMPA 4OJNA 4DJFC 2JZOA 4XDHA 3OZCA 4XJTA 4ZYVA 3DWGA 3OQ1A 4JI8B 1KEUA 1EXWA 1L2TA 4YAEA 3A6HA 5IXSA 1TW2A 1T0UA 2Y27A 3P19A 1B8NA 4N0DA 1QFMA 2OCAA 4EB6A 2Z5VA 1SIWA 4RTLA 3OHSX 5JUWA 1M33A 4HBGA 3RS5A 1SA0A 3DUFA 4EBBA 1T91A 5GM1A 2A0YA 1FYWA 4DPKA 4EGSA 3DE7X 3ROEA 2D2XA 1YFLA 3RHFA 3ENKA 4IRXA 4MS1A 5ITVA 1YB5A 3AUSA 1OLSB 3T7CA 1YB4A 2IWRA 5HS6A 5KX5A 1GNTA 1OH8A 3VKGA 2LV8A 4RDIA 1HZZA 3UWMA 3LUDA 3RWOA 4FSXA 4HHEA 4X60A 5ESXA 2XUOA 1UC9A 2XXAB 4EUEA 4RUKA 4CEJB 3F6YA 3ONNA 3K5HA 1V7QA 2R11A 4TM8A 4IGAA 1C3OA 4EA9A 5IULC 2Z6UA 1N2CA 1MQ8B 1LPNA 1N7IA 5KTYA 1PNOA 3AY3A 1MDBA 3MZ0A 4OXNA 3KEQA 4PQFA 2O7QA 4RD1A 4GR9A 3X0DA 1NXSA 1FTQA 4MQMA 2P3QA 1U7DA 3IUPA 4XB1A 3TMKA 5JRJA 5CJ2A 1BTOA 1KFBB 2DKNA 2OXFA 2PL5A 4IEIA 5ES3A 5I6DA 1PUIA 2W0SA 5C5EA 3VFDA 2AFVA 2J6BA 1FP6A 1S2LA 3D6TB 2ZLBA 3GLHB 5EJFA 4XKJA 2FWPA 1A8QA 2E4UA 5IC4A 3HCRA 3VOSA 3B5EA 4XWKA 2Y0BA 1HNZB 5C32A 4Z7JA 5A9SA 1JA9A 1GL6A 4FMDB 5ELXA 2B6HA 4MW4A 4QPNA 3VM6A 3LBAA 3NAMA 3UATA 4Z9XA 5E3JA 4QTXA 3A1WA 4G41A 4D4KA 4ZZIA 1QBKC 2PV7A 5I7EA 2XXBA 4RY0A 3VAZA 3ZGYA 1QYDA 5AHXA 1J99A 1M5RA 4X65B 1H8HA 1I9GA 1P5RA 1IM2A 4NATA 1VLJA 1JHDA 4M89A 1U0NA 2ICAA 4MHSA 1PWXA 3EVZA 1Q0RA 1JEQB 2FQYA 1PQYA 1FUEA 4FK8A 5BSWA 4HDNB 2HJ9A 4UVEA 2CXSA 4ONEA 3WQRA 4JSTA 2D1YA 4WRRA 3TZKA 2WUDA 3LT0A 4DCNA 1N0HA 5I9BA 1LPBB 4L9SA 5EP3A 1FSSA 1DUVG 1LQ2A 2AX4A 2X0JA 2ZFUA 3HLTA 1X92A 3LP6A 4H1VA 1RADA 4MYHA 1F51E 4I0WB 2XTJA 2YHSA 4C0LA 4IDDA 3B9PA 5LQMA 4NTZA 3SZUA 1A9XA 1XMOB 1A4IA 3GDGA 5BO5A 2WSIA 1TTHA 1XZNA 1QGAA 1QHHB 3EPHA 1Z63A 1G21A 4JL6A 3PC4A 3V1NA 3U19A 5HMLA 4LG1A 2ZW9A 4CM9D 4DIDA 2PO7A 3P2JA 1IZ0A 5JHHB 4PG7A 4XQCA 4PXYA 2AG1A 1YZLA 2WB2A 1IHOA 5H9VA 4KHPB 1TYZA 4IPTA 2NV6A 3DEIA 3NS7A 2HIHA 4LGYA 2WABA 4U7PB 2JRLA 4X1IB 4J0EA 4Z3DA 4R8SA 2CHUA 2VSXA 4YJ2F 1GTL1 1I4DD 5K6TA 3GUVA 1Z06A 3RIYA 4KQKA 3DOCA 4RF4A 3HWSA 2VP3A 4LGCA 2FE4A 5A4DA 5ANRB 2R3SA 1MUUA 2J3KA 3DKVA 2IX3A 1EFUA 1Y3CE 1CETA 2HA6A 4FNOA 5ALOA 3HKEB 1ENZA 1SUBA 2YJTD 4D43A 4W5WA 4D8XA 5F5XA 3GWGA 3P8ZA 5KI6A 5H80A 5FBKA 4PO3X 1P6QA 4EDHA 1JR2A 5LYJA 2X7HA 3IAFA 1KPHA 3ODGA 4FN5A 4HLQB 1EU1A 3ZJ4A 1E1MA 3IRVA 3HFRA 1Z28A 1JNYA 1KP9A 2TMGA 3IXQA 4UTZA 5K8TA 2WD8A 3INGA 1FJ2A 1LF0A 1BMTA 5CB4F 2AMLA 4X1YB 3L8FA 4YJ3F 1V2GA 3BMNB 4OGFA 1CRPA 1WB4A 2Y1GA 3VVBA 3WQBA 4JU9A 4FB4A 3QX3A 1N3IA 2EBWA 1EM8A 3NBXX 1AQIA 3WDKA 1EGAA 4LUCA 4KU4A 1RYEA 2C54A 2WFLA 3KDPA 3OMWA 3FMPB 4Y6OA 4AG5A 5JH7F 4PGFA 2FX5A 3D02A 1ZOPA 1UKCA 3QVLA 3HU1A 1EB9A 1W5AA 4UMVA 3UK0A 5B4VA 1T10A 2Q5FA 3GIWA 4CG3A 4XDGA 2GZ2A 3HSKA 3DJYA 3SQMA 2IS4A 3U49A 4L8VA 1WDMA 1Z45A 2O8EB 1PFGA 1FXWF 2N1MA 4GFDA 3UCEA 2O8NA 2RBGA 4GBJA 1GSHA 4BNWA 4BLUA 2CKMA 1GXSB 2ZJ1A 1ESMA 2BGJA 1NNI1 5J1SB 3AUFA 4DDKA 5LOVF 2XGJA 1Y6FA 3GGSA 3NDRA 4JVNA 1D6SA 3LUPA 4BVLA 2Q2VA 4PAGA 4XFJA 4L5CA 1T4CB 2PTGA 4FQ5A 2DETA 4HXEB 2WTEA 4ZAFA 4RX1A 1GAQA 4NULA 1EGHA 1YE8A 3D2LA 5GAJA 4MZDA 3TAHA 2WHEA 1U98A 4XUEA 3C14C 1F0YA 1SZPA 1I0LA 1MRNA 3DULA 2CLKB 3BTSA 4WJZA 3VHQA 4BMYA 4E46A 3MGKA 3F67A 2QZSA 2OWDA 1CJCA 3SYKA 2D1QA 1G7CA 5K0NA 3T0FA 4JT4A 1Z3IX 3MYYA 4POAA 5FOXA 2FETA 2D7JA 1ZDMA 2BKVA 3N6XA 1TF2A 2GJAA 3V1YA 5BQ5A 2M2IA 2XGMA 3VUFA 4ESHA 3OX3A 3P9QA 4H08A 1J25A 4FWIB 1TT5A 2V96A 3L4SO 4C7VA 3ADDA 1RFLA 1PGJA 1U8ZA 1KHTA 3IMKA 5CJJA 3RGWS 3ER9A 1DVRA 3BB4A 2FEXA 4O5OA 4CRWB 5FFMA 2XWSA 5BRAA 1RD4A 3MUNA 3R6TA 4FTWA 4RXTA 5JATA 2QROA 3TL3A 8MHTA 4HLUA 1Z4QA 2AFIA 4IIEA 1ZICA 1U7TA 3KU4A 2YYYA 4QYSA 5LDGA 4R3UC 2KQUA 5KTPA 3H11A 3CYFA 1IE3A 1CHDA 2BN4A 5L3ZA 3WE7A 3KSRA 5DPMA 5EJ4A 3Q3CA 4LK3A 3IP6A 4M9CA 3B3AA 3SC4A 2JHFA 4YS6A 2IHYA 4DV4B 1V8FA 1HYEA 2GYVA 4QPDA 4RV9A 1C81A 1T4MA 2GSDA 2YV2A 4ZT3A 2VPWA 5JD5A 3F3KA 3QJYA 2FU5C 2YJGA 4Y18A 3KQVA 2D4AA 1JNXX 1U5BA 3B12A 2G06A 4IIXA 4L0DA 2CSUA 3RVMA 1S9DA 5CYGA 1FS4A 2G9QA 2IXEA 3AT1A 1GRQA 5AJZA 2JLQA 2QDKA 2ID4A 3WA6A 4CU2A 5B57C 5BSUA 4NU0A 4KV7A 1BXKA 4KXLA 1UK8A 2QD5A 2H2GA 4KMMA 5JALA 3WJ2A 1BWRA 4YJHA 4JLSA 1ADFA 3DMRA 3JRNA 1Q2XA 4MV4A 1IN4A 1N4AA 4W5OA 3D5EA 5ALSA 2HMSA 4Y1FA 2EGHA 5CFMA 4TROA 2C2ZA 1KF0A 2JFZA 3GP5A 3WLIA 1PNRA 4KPUB 1RAFA 3H3XA 1YXMA 2HAEA 1IVNA 3OCXA 4E5MA 2YTZA 2MYPA 1V3QE 3QVGA 4RLFA 2V8OA 3RC1A 3U4GA 4JK3A 1U3FA 4L74A 4JJAA 1PR3A 3FTNA 3PDJA 4FFBB 4NH4A 5SYAA 4LTNA 4MQUA 3VPCA 3PE4A 4P81A 1YR8A 2CB0A 1WXIA 1XEWX 4AJHA 5CXXA 5DCYA 2IYFA 3MQ4A 1N1MA 4WXEA 2RGDA 4Z0HO 2PSJA 2XGGA 3WLEA 3MMSA 4UAJA 3QFTA 2QTGA 3LKBA 5JVDF 1P9WA 3M8KA 4U9HS 5JNVA 1MDFA 1QWOA 1ZINA 2JJ8A 3DT6A 1WE2A 2EJWA 2REXB 1U3CA 2G5TA 2FPGB 4EB0A 3P9ZA 3TVYA 5GZ1A 5B58C 5P8WA 1ODLA 5ERXA 3ZQ4A 3TKAA 5KNBH 1OH5A 1YVEI 3SF8B 5G41A 1G3QA 16PKA 2ZRPA 2AN4A 1LWOA 1I14A 1QM5A 1YQDA 2C97A 1S2IA 2WMYA 3PV0A 4RXMA 3SAJA 4S05A 4KAFA 3RWMB 4GHWA 1KQOA 3PFHA 4TUYA 3WOHA 3FCYA 4JC8A 4FZ3A 3KB8A 2FPWA 3WLLA 1TIBA 2ZIVB 5AI4A 5DT2A 3QHQA 4NECA 1G3UA 5CB0A 1CZRA 1P9LA 1T0PA 3K20A 3QW4B 4Q16A 5DNWA 4H3VA 3HYRA 3UK2A 5BT8A 1OI4A 1D4FA 3VPXA 1IFXA 4KPUA 1LPMA 3COJA 1UJBA 3BA1A 5GWXA 4EEXA 1NBAA 4J7CA 3KUUA 4XJVA 4HDAA 5D5HA 3AWIA 1MF7A 1U2QA 2A59A 2IP1A 2ZATA 2A92A 3A32A 3LFTA 3NCHA 4J0DA 2C94A 5E4FA 4YPFA 5T3YA 4XYEA 2ZQ5A 3KJHA 3MWKA 4G0QA 1DV1A 4EAAA 3RARA 1ZOLA 2FQQA 3GRRA 3INTA 4URWR 5DHPA 3VJLA 2F1JA 2CXNA 5F51A 1V1MA 1KMQA 3IH5A 2I4RA 1AS0A 1JJIA 1MAWA 2P2DA 3GPDG 4HH4A 4OGKA 1FXWA 3AUYA 1W2GA 4UU1A 3TUJC 1F6BA 4IX1A 4DLVA 1DARA 2FP4A 4PCUA 2C82A 3AETA 5SYMA 2QUKA 1EWKA 2G28A 4ZYUA 1AN0A 1PD1A 4FPXA 5DLDA 1J2UA 1AE1A 1Z5OA 3G3EA 2A7QA 4IIBA 5A04A 3THSA 2WWGA 2Q3LA 5IVHA 4FDLA 5DZSA 5TVGA 1LH0A 4DTCA 4G97A 1TM5E 1WUHS 2JPDA 5TDHA 3IOCA 3WB2A 2ZT5A 3T5BA 3FTEA 3RANA 3KSZO 3MAJA 4FBLA 5I5EA 1XF1A 4YRCA 3F7OA 1UOEA 3QHPA 4DCJA 5J43A 4MDEA 5BN4A 2UUBB 2KLHA 3QF7A 3AUUA 4KXFB 5KQSA 2OQ2A 1CVIA 2VXOA 3ZLUA 4QUJA 1LVUA 4CQNA 2YZKA 1VIMA 2IE8A 4KMSA 2IEYA 1S3IA 3BBLA 3LBHA 5AKJA 1FU8A 4QU8A 5CPFA 3UA4A 4Z49A 1Q0UA 2W2NA 2WNSA 1C2YA 3NVMB 4B7XA 2C9YA 3SR3A 1F6DA 2PHZA 3H99A 3OZSA 2YS7A 4RH1A 3DDHA 4GZMA 1PJ4A 4MWOA 2K4MA 4OQLA 1N6LA 4REOA 1I3NA 3A4LA 4ZC8A 1KHHA 4ZP1A 2H16A 3WYFA 3TG8A 2K7FA 2I4OA 1D6MA 2JFPA 3RKUA 3LKZA 1YRBA 3WRWA 4KE9A 2HCJB 3ND9A 3GELA 2I7CA 4DG5A 4WZBE 4D9IA 4DJ5X 5D84A 1XCLA 3AI3A 2I0FA 2RGRA 1NBHA 1CY7A 3IELA 4MPDA 2NQ8A 2EP5A 3VZPA 4E6PA 2A33A 1WPRA 3BTUA 3KOWA 2HHLA 4H3SA 3S2IA 3EGCA 3DAHA 4M0EA 4NG5A 5IDVA 1T3HA 5TGZA 5BMVB 1KWKA 1IXYA 4OX9B 5TB5A 4OBXA 3JR3A 3WKEA 4EELA 4C0WA 2HZBA 2QE7D 4OKIA 5JMOA 4O4HA 1E98A 2GPAA 2A30A 1UFVA 2O48X 3U3MA 4QYMA 4EUHA 3K15A 4CI9A 4S3MA 4EVIA 5BWLA 3PDCA 2R1ZA 1E3LA 3A58B 4CM5A 4EHFA 1XZLA 5JZ9A 2C5HA 3BILA 1FQJA 5AI6A 1ZIYA 1JEYA 4NCNA 3F71A 2JAHA 5DT9A 4RULA 1S8FA 2HB6A 3LY5A 5LPNA 4DNFA 4RE5A 1Q0QA 1ZD8A 4BO8A 4S1OA 4FJ2A 1JKJA 2AQ8A 2HQSA 1JWBB 2EWMA 2ZRBA 1I1OA 4IHKA 3CH5A 5A4IS 5JXHA 1ZD9A 1P2VA 4AUKA 1ZL0A 4XRGA 2G9ZA 3ONVA 1LGYA 1K2VN 3OFND 2DWCA 5F9FA 2Q2OA 2AZMA 4QICA 1P31A 3MTJA 4HN2A 1VRWA 4JLKA 5A71A 3GAAA 5EHXA 2Q1TA 1QHIA 4AO8A 3L7JA 1XTIA 4UM9B 3SHOA 3A4NA 3SYLA 1PDVA 2WTAA 4ODIA 1Q3HA 4D6XA 3N75A 4Z7NB 1XZEA 1B00A 2H8KA 4JV5B 3SXUA 1U94A 4C3OB 5TEVA 2TMDA 2JCSA 2D0DA 1VZ3A 1ODKA 1USIA 2BBOA 4BLPA 2XSZA 3MBKA 3QFSA 3RSCA 2ETXA 1U4NA 2N42A 1UP7A 3I9NA 4DA9A 1Y5IA 3X1YA 2W2OA 2WJVA 4LNUB 5DTIA 3TGWA 4CF4A 1J4AA 2XKJE 5ALTA 3ZDYB 3QPAA 2A5LA 4DYHA 1JG7A 1Q1EA 1Z7YA 3PSHA 3PUIA 4QGFA 2PRKA 5IC6A 4BVAA 2J7PA 4OL0A 4BN4A 4IXWA 4RBNA 3RM3A 1IZ7A 3RAEC 3RU9A 3RT7A 2QMQA 3FF4A 3DTVA 5C8YA 4RZSA 1DG9A 1YCDA 2XVZA 3AM5A 1LU9A 4ZU6X 3HJBA 1FFCA 3WKDA 2WWWA 4PU0A 5AVWA 4PQEA 3KYCA 2PNFA 2ZYTX 1C1YA 3BIJA 4TZ6A 4G67A 1IRIA 1H23A 1K3FA 1UBJS 1WG8A 3QMMA 5EMHA 3JYNA 1KI6A 4Y9TA 1IZYA 4MIKA 5TF4A 5ALVA 1HMPA 4F12A 3QF4A 3NBAA 3DA8A 5ENDA 3I01M 1UBLS 2TS1A 1DOAA 1XXLA 3W9UA 1D0VA 1NNSA 2YRFA 3H8VA 3NX4A 2C9ZA 3QBJA 4IHQA 1US8A 5DRYA 3V3TA 1GTVA 4ANFA 1HRDA 1NW7A 3CM0A 1OI2A 2FVYA 2BKXA 5TT1A 2QLJA 3THYA 1IJKA 2QAGB 1HT3A 1PK8A 3BFJA 4MKIA 4J3FA 2ADFA 1G17A 2IPXA 5BSKA 4GI3A 1OPRA 4JLBA 1XU9A 2O9JA 5KOJA 5KVAA 3TNFA 4DA7A 3EZYA 1JQBA 3QMVA 1D03A 3CVJA 2JHPA 4L6AA 4P80A 4EG8A 4CIWA 1CZUA 3MNFA 3D3WB 2BGTA 1WIWA 1EVYA 4HBZA 2RE8A 2BJVA 1AKMA 2HSDA 1JXAA 3C7CB 3WV5A 3TS1A 5FTLA 3AL0C 1A9TA 2O7RA 2X42A 3VHLB 1RJ9B 3K0EA 4HAOA 5I01A 2O5EA 1X3SA 4HGPA 2AQIA 3IEMA 3CE6A 1XCJA 4LE2A 4QU9A 4Z7QB 4OX9Y 1DIBA 4GZ5A 2OSVA 1WCYA 5DOZA 3CF2A 5I7UA 1D0IA 2YJ3A 1S5PA 3IAEA 3PR2B 1C3EA 1EX1A 2F6RA 4Y6PA 3HE3A 1TLFA 3HA3A 1SXJB 3ELBA 2NLOA 3HKBB 1XRPA 4UM8B 2NVUA 3OPVA 1SRQA 1RRMA 4OP2A 1LS1A 2XHZA 1QJ4A 1VBKA 2B3DA 1NV9A 1NPYA 1UZAA 2BKEA 2CLIB 2XIJA 1VYVA 1GGNA 3MJCA 4PPQA 5LQSA 1EAYA 5AKEA 4ZT5A 1LX7A 3ORSA 1CHNA 1YMUA 3BWMA 1EXVA 1A98A 1M67A 4HEHA 5AJXA 3EJ6A 4DSAA 1YQQA 4MW2A 2YOGA 3O4FA 1MU0A 3T9CA 1HDIA 2DG2A 3LK7A 4YBRA 4ZZ0A 3MXOA 1H65A 1ZGGA 4J2HA 2IZ1A 6YASA 3EPJA 1SMKA 1HC7A 1HTWA 4TPKA 1CLEA 3EOZA 1G19A 1PJ3A 5FTWA 1V0JA 3UZUA 5B2FA 1ZVQA 1KK0A 4C4SA 1I30A 1LX6A 3FB1A 1Q1GA 3RYTC 4DHEA 5EIAA 1TCAA 4XSVA 3H3JA 3TTVA 1Z12A 1B0AA 1NW5A 4AULA 4YRSA 3FTPA 3TFOA 2O6LA 2I7XA 5HJ5A 4LYAA 5ALGA 4JN6B 3W5CA 3RUIA 5LKAA 1NVKA 2P1DA 4QJ4A 4F9GA 1QP0A 2IYYA 1LJ8A 2R1VA 1EESA 4FHCA 4OHCA 1QYXA 3AU9A 2OUKA 1TAUA 1PV4A 1FXSA 1ADBA 3LH5A 4R1PA 2WWYA 2YNMA 3V6MA 3PXDA 1XNRB 2P9EA 4JYMA 1WDLA 2QVLA 4RY2A 5UKDA 4B7UA 4ZV4A 2AKEA 5HR5A 1EUYA 1MTOA 1UMKA 4E1AA 1X1DA 1I4LD 2I3BA 2BHNA 4UBNA 2GOYA 1FNNA 3V80A 2FPMA 4QQ8A 1XYGA 4HQKA 4HQRA 3IVAA 3K1JA 2IV3A 3R7WB 3UUGA 3I6MA 1J42A 3BXOA 5HW0A 2XECA 1PZFA 1GTZA 4TKUB 5KYKA 3CU5A 1XXHE 2XWBF 3PC8C 1SQ0A 3P32A 4IH1A 4KO2S 1N9GB 4E14A 2ZYSA 3PA6A 2ZPUA 4MCAA 4EHIA 4U0KA 4IIJA 2Y9PB 4WNAB 2BFCA 1XMPA 3RT9A 3DUFB 2WG0A 3SOPA 2FY8A 4QBFA 1TO2E 5E2AA 4OHUA 1ZQ1A 1N57A 5T8KC 5LKRA 1Z18A 1L7PA 1RCFA 2WJYA 1KDRA 3KXLA 4KYUA 1Q20A 4XVQA 3AEKB 1YS7A 2D5CA 1JHXA 3L8CA 3G1TA 5D7BA 1K92A 2IDJA 3H97A 1DL5A 2W7TA 4OOFA 5ICFA 1KVUA 1QBGA 3EEYA 2DR3A 3F3SA 4I4TF 5AUOB 1C9EA 2QVCA 1PK7A 4ZPXA 3X44A 4E08A 2RKWA 3KT3A 2QPTA 4DWJA 4TQAA 4FOOA 4WKNA 1XMQB 1O8CA 1U8CB 4REMA 5EY5B 3WSWA 4JJGA 1N32B 1ZMXA 1S96A 2Q3DA 3FJ1A 2ZSKA 4I99A 4WGFA 1XZFA 2IKQA 5JMTA 1NXQA 1QOZA 4F3YA 4PQGA 4HFRA 2V5VA 3FLMA 1NTRA 1FP4A 2ZI5A 1P9RA 4MYRA 2AFHE 3ZU5A 3E1KA 5CDYA 1MA0A 1P2DA 4Z4QA 2ZBUA 3I9V6 3L1HA 4XGKA 2BR3A 3ZCQA 1ISIA 1B8VA 4PRLA 3U13A 5BN5A 3R41A 1N3LA 4R51A 3PDUA 2CVOA 5KU1A 2WM2A 3BXFA 1TF7A 3O8RA 2VZEA 4ND8B 2X19A 4XGIA 3R8XA 2EX0A 2W90A 1JBQA 3ZH9B 5BNIA 5AJTA 1P5HA 3HUEA 1DQYA 4O59O 4YT8A 2C9MA 1I13A 1ZD3A 1J9ZA 4IIJB 4LHWA 4V0QA 4Y1RA 1ZVVA 2EBUA 3PGKA 5BV7A 1B7GO 1HEIA 4OQFA 1CU1A 5TPWB 3WTCA 3PWZA 3HSSA 4JJ8A 4YRAA 2FFJA 2FR1A 1DADA 2I2AA 1ZRSA 3WR5A 5KKNB 1BKDR 1W49A 3FHOA 3P9SA 2CHEA 4QRIA 3NIBA 2WTUA 4B8WA 3UMRA 4P34A 3RVKA 4JEMA 1E7SA 1SZCA 1WLSA 4UE3S 4WDRA 4BJ1A 1ODTC 3B85A 5AVZA 3UIEA 4M38A 4PLVA 5F4ZA 1JTEA 5FADA 4CR8A 3IVXA 4WD3A 1Y1QA 5FBHA 5BUZA 2W71A 3AR7A 2ZJ5A 2OXTA 3WRXA 3ZY2A 2B61A 1BOOA 4IJVA 4YO7A 1U2TA 4GD3Q 1KZ1A 4P33A 2A4KA 2WHQA 1PFWA 4NZNA 1OXTA 3I05A 3MA0A 1LDNA 3FUXA 3L5OA 5E3HA 3ZD7A 2VPXA 3AFHA 4DW8A 2DGDA 3B1KA 4MPJA 5IWCA 1U3GA 4XWAA 3N1UA 5E7JA 1OXKB 4ALIA 1T1SA 2WVGA 3C5WP 1P62B 3UG6A 3ES9A 1VLVA 3G7SA 4ZCMA 2DWOA 4II7A 3ZHXA 2HA4A 3LT5A 2ID8A 4AFNA 2JIQA 5IKEA 1N2CE 1QG0A 4Y1RB 1QUFA 1W73A 3T3PB 4DA6A 3H4MA 2PUBA 3QX9A 1OV4A 4QDXA 1U2GC 3FMFA 1J5EB 5G1OA 2QN1A 1Q7EA 3HCNA 1H9AA 4RY8A 3U0VA 1F2UA 2SKEA 3EE6A 3F6RA 4YMVA 4D4LA 2C31A 1O5IA 4WE3A 3WIUA 4UM7A 1WBBA 3GFRA 2JLRA 1VJGA 3K05A 4WUVA 1QO0A 3HL4A 1X7WB 3T0IA 3H1BA 3QEBZ 4G0NA 4WKPA 3YASA 4BS9A 2CJFA 1JYFA 5K0GA 1CG6A 2VZ9A 5I9IA 4JXXA 2J5QA 2BFNA 1AG9A 3BE5A 3GJSA 2WKQA 4Q1DA 1DXYA 1GITA 2X5XA 1YJAA 3PQEA 3VI3B 4NE7A 2CXXA 1K5DA 1DO2A 4TMVA 4BNMA 3GP8A 2J9ZB 2ZYAA 4I14A 3I5MA 4DNOA 3IILA 4Y2SA 2BELA 2HDNB 4LW8A 4YQEA 1UZNA 2BEVA 5B53A 4AURA 3O1LA 5K6AC 3OCUA 4NV1A 1VE9A 3FLBA 3VYWA 4LKOA 1J2TA 3LHKA 1GDTA 2X76A 3P9IA 2WJAA 3TD9A 3KLMX 1ECGA 1UEJA 3FPFA 3NFRA 1C7RA 4LMAA 3SJCA 1HE3A 2B4QA 3OOJA 3PYLA 4YPVA 5I7FA 3EVEA 1KAGA 2YHAA 1N5IA 1R74A 3EDRA 1CS4C 1O03A 3WBJA 2VZLA 2Y92A 2JFOA 2YL2A 4OMDA 4PX9A 2OK7A 1WCWA 2KX7A 3WKAA 3PI6A 3A7EA 3X1XA 2OYRA 4YXWD 2GN1A 3H9GA 2UUOA 3IIJA 3H5OA 4ZI7B 1J1UA 1E7MA 2I2DA 5KTSA 2ZAYA 5LZ5A 5LUAA 4Q7MB 4B31A 2DUMA 1VJ1A 4DQ0A 1GLNA 4GLFA 2WFZA 2PV0A 2R2GA 5JECA 3GVIA 3R40A 4YALA 1PJSA 1PAUA 4ZO6A 4CIYA 5BOSB 2DUNA 4TM7A 1G8GA 4BQOA 1VFNA 5K8JB 3JQCA 1TMGE 3OO0A 4TYQA 3L0CA 2PX2A 3TJMA 5I45A 1HLPA 1AMOA 2IYRA 1EGQA 5JSFA 5EL0A 1XMXA 1XVTA 4A0QA 4Z4FA 2JD1A 3THRA 1K0UA 4TYPA 1VLZA 2IHBA 3H2KA 3H5NA 3DYBA 4GKJB 3KQKA 2R66A 3R76A 1ACJA 1OBFO 2G6BA 2PLFA 5FWAA 1X7ZB 3D3NA 3VZBA 4ZJZA 1TPZA 3KZXA 2XGSA 2ODQA 4YUAA 3TKLA 3ITNA 1N6IA 2UUPA 5L3SA 4X66B 3ZDAA 1M6NA 3QJGA 3IQZA 3JU3A 2IIPA 3OX4A 3PVCA 2JASA 3WIVA 2B7CA 3P9RA 1JH8A 4YYEA 2GM5A 1XTVA 5J4HA 1Y4UA 1GAJA 1WS6A 1A04A 3UM9A 4JYZA 3ITEA 2BFDB 1T24A 3WHPA 2QW0X 4ZRMA 4AKGA 1R4NA 1I5RA 1KFKB 4Q3LA 1Y8QB 4DIEA 1FJXA 4D6PA 3G59A 4OSOA 5L7TA 3WBFA 1E1CB 2O07A 3VR6H 3ZDQA 3CX8A 4XB6B 2JKYA 1JQDA 1WSWA 3L1JA 1C4WA 4NEQA 4B2IA 4WOKA 1I8TA 5CFOA 3LUCA 5JTTA 3QEMA 2CFCA 1SBHA 4N5HX 1C2TA 5HKKD 1Y4AE 5EVJA 3AZPA 1ZU4A 2J87A 1H2EA 2YUTA 4QODA 3SDBA 2IPLA 2BMJA 4L1KA 2R00C 5CDTA 1R0YA 2AZ4A 3DVAA 4IDHA 4L5JA 2DBZA 1P0QA 1H1DA 4JD5A 4LZJA 3HBFA 3AG5A 4N01A 1KPIA 3VRHA 3UBMA 1M8FA 4XWGA 4AAYA 4CEHA 3EG5A 3TLXA 2CLCX 3AF0A 4IOMA 4MQFA 4Q1VA 2Q9BA 1N5KA 3DZBA 3IGFA 4N9QA 4YC7A 2RGNC 2RHHA 1JAXA 2IBSA 1PHRA 2IODA 4X94A 1TT7A 1R6UA 3TNYA 4YVFA 2E37A 4RKYA 2YNMC 1GSAA 4X64B 2C4WA 3BEOA 4MDFA 4HEA1 5GQSA 1DUIA 3WRYA 1IY2A 1RIFA 3AO0B 3F5MA 4AZ3A 4MVJM 3O9ZA 7MHTA 4YJHB 4IWNA 3KFVA 3F78A 2Q99A 3ND6A 3AHJA 2VP6A 3WLPA 1GTRA 3B48A 4BTEA 2OHFA 3I42A 1V8BA 3CRRA 4WFJA 1XD2A 5EIFA 5K3EA 1HF3A 3FDZA 3H1PA 4JT9A 3QKRB 6PFKA 3U5ZB 3FWHA 1BGWA 3VC3A 5IHPA 1FUUA 2OB1A 4MWEA 5FNVB 3EDYA 3HI6A 3GAZA 4G1CA 3NAGA 3E0XA 3IQIX 4UAUA 3R7AA 2NXJA 3N7AA 3MG9A 5NULA 2BGLA 1BHQ1 3TVTA 1K9SA 4GWGA 2BKLA 3NIGB 4IRUB 5AM4A 2P3LA 2CXRA 3UCXA 3K73O 5C1BA 4M83A 3DQZA 3PXEA 421PA 2CVQA 4JI3B 2AUMA 4ITRC 3OEEA 3KKPA 3OAAD 4KIUA 1DBIA 4CCSA 2ZTMA 4Y98A 3D6JA 2OC9A 1YVPA 4WFIA 1R5OA 4C5AA 2YJ4A 3FFBA 3C8HA 2GQ0A 1VLLA 3GARA 4OLFA 3VV2A 1G2PA 1YZTA 3MWGA 1HR0B 4CEHB 4C7OB 2A9VA 3SMVA 3ZVKA 3U3OA 2YFKA 3K09A 1R66A 2GDZA 2P0AA 2WNIA 2CFTA 5FPPA 2Q27A 5IF9A 2CXUA 3WYEA 3DBRB 1OE0A 3OSUA 4NVRA 5DK6A 1E2GA 3IC5A 1CB0A 3VO9A 1CEYA 1ZX1A 2XNCA 3PVSA 2I9PA 4I9GA 1E99A 1PCXA 2PMKA 5H3CA 5CB4A 5JANA 1T6ZA 1T6YA 3VPSA 4DJJA 1Z4MA 2BGNA 2RK6A 2H3EA 3A3PA 2QYSA 1SKMA 3N0XA 1DCFA 4OHBA 1ZFNA 1ECPA 2IU6A 2CD7A 2AIRA 2YW2A 2HNKA 3Q3JB 3DSRA 1E2MA 1HPLA 5C1PA 2VLBA 3EGXB 5IU6A 1E6CA 1YHZA 2Q49A 4JJEA 3V2GA 5JTUA 1XA4A 4MTLA 5LWHA 4CFSA 4G65A 4D4GA 1UJ6A 1WO8A 3M6AA 2QMUA 2FP4B 2E87A 3Q10A 3C3XA 3RIGA 4HTAA 5I48A 1IWOA 3WLKX 4HXFB 4D8TA 4N41A 1T1JA 1JGTA 4ZDJA 3ZIDA 3G0IA 4GH5A 1ZK4A 3NVKI 1G5QA 3KZKA 1DKNA 3GLHE 1RJFA 3NRCA 1CNEA 5KCZA 3NIDB 3QQ5A 2FPPA 3WGQA 4C6RA 3WIDA 3HZOA 2P1RA 4Q3EA 1FEZA 4D9CA 4JQSA 5CNIA 1AUVA 1MFPA 1YCGA 4P32A 3WQHA 2HLNA 3TBHA 5AO9A 4DMHA 1U3UA 1YRQA 4AMZA 2WA2A 1SWVA 4FBMA 3PR1A 4PSUA 4E12A 4Z0PA 3ROKA 4WWHA 5AP9A 2VDKB 3RSGA 3NKVA 1FY2A 5HBRA 4JHLA 5TMPA 1E18A 1OR8A 4ZODA 1L8XA 2GK3A 3PE6A 4CG1A 2ZYRA 4FYVA 3I2FA 4OXXA 1RXUA 3BJEA 1LPSA 1L4GA 2ZBGA 1XU4A 3HRIA 3T1HB 2D8MA 1T1EA 2P9GA 3EFEA 3GO4A 3BQNB 4KOAA 3A1TA 2H5IA 4NBNA 3H7IA 4CKZA 3JYQA 3L8DA 3I53A 1JDJA 3PK0A 4K6FA 3LUHA 2Q3MA 5FR2A 3ZX4A 4ZEVA 2PR7A 1II8B 5DP1A 5A62A 4WT7A 3KZOA 3LTEA 1XFAA 2HT6A 4ROTA 4CMEC 3LCVB 1RLJA 821PA 2AVDA 3RVLA 2HXYA 4W5RA 2CLMB 4KN5A 3TZHA 4H27A 2NTJA 1WMFA 1ISHA 1QFXA 3ZDCA 3VH2A 5CDHA 1BE8A 4ZO7A 1MQSA 4PVDA 3B9RA 4C3VA 3HM9A 5BSGA 3WWZA 3OZAA 3PNSA 1Z35A 4MW1A 1FW8A 4WL0A 3H2BA 1V45E 2NTVA 3K9GA 3A4VA 4Q4JB 3SC6A 1BXGA 5C8VA 1DCTA 1FFEA 1TZCA 4UOEA 2DFTA 2JD0A 1P73A 4ESVA 3EISA 2HJWA 4OHPA 3GEGA 4RD6A 4A8HA 1IN1A 2KBEA 3PF9A 3QOYA 4FC7A 3IXLA 3JQDA 3N8NA 3ZBPA 3SQOA 3SQLA 3L01A 4HDRB 4Q1BA 5TR9A 1U1EA 4TVKA 1Y3FE 4W5HA 4F71A 5DHUA 2IS6A 3UV3A 2ZKLA 3NMUF 1A4UA 4X6YA 2YMLA 5A03A 3WLSA 121PA 4BWYA 4L8YA 3UB3A 4BKQA 1EP3B 1OU4A 2INGX 4B33A 3AP2A 4BVBA 8ADHA 1E92A 1G42A 2ORED 4Q3KA 1OXXK 3PFFA 3SIXA 3ZXSA 1MJGA 3A11A 1S6YA 3DPSA 3F5QA 4M0CA 4GE3A 1TNDA 5U4QA 4DN6A 4EMSA 2R6JA 3F0TA 1UPCA 2HF8A 3PC8A 5AW8A 1P7CA 5K6RA 1XVIA 5F77A 3TYXA 1MRZA 2ZIXA 4MB2A 1QHEA 1A7AA 2VBCA 1AHHA 4LDZA 1EFAA 2Q50A 1YQUA 4BNTA 1XMJA 5EFZA 1L5QA 5TARA 2JFBA 2YCBA 1G8KA 1NR5A 1H5QA 1OLUB 1XHLA 2YHBA 5DI3A 3V42A 2Q3BA 1X8XA 3LDAA 1X2BA 1IMOA 2C8LA 2C3PA 4DS3A 1JR3D 3UO8B 2O0MA 3ILSA 2LR0A 3CWZA 3LDFA 1W1UA 4IDQA 1QVAA 2VTDA 1FP1D 2DH5A 4YP5A 5BORA 3D4LA 1CFJA 4Q4JA 5DYTA 5KNBD 4IV8A 4BB0A 2Q9UA 2WJWA 3QFCA 3ZYZA 4L8FA 2WBLC 5LUBA 3KVRA 4IHJA 3TZBA 2WM3A 2CF5A 4YFYA 3O90A 3K30A 3CLTD 2ACKA 3IJPA 3LXUX 3DT8A 1MG0A 1M2OB 3LOQA 4QNMA 1B1CA 5AM1A 3SIWA 1NFFA 2PT9A 1LLQA 4O3MA 1JW9B 1XWWA 2LIVA 4JLWA 4RNCA 1I7LA 4KYIB 3GUZA 2YFHA 3K0FB 4JROA 1Q11A 2V7XA 5EZYA 5IBCA 1YQTA 4KK3A 3F47A 4E22A 2GCEA 3EYAA 4H31A 4XLZA 1R10A 3PQCA 2IC5A 1EX9A 4L4SA 4GQAA 5CR9A 5IT5A 3TN7A 4BC1A 1M7BA 2H51A 3RRYA 5CLLA 2EIHA 1Q17A 4FT4A 3D1JA 4NJMB 5DGIA 4OUDB 3MGBA 3TOVA 5EXXA 4OKNA 2R68A 1G291 3A6GA 3EAGA 1ZZEA 4CN9A 3RIEA 5ADHA 2HUPA 2PBLA 4QFMA 3U0BA 4X7PA 4F97A 5HIAA 3PYMA 5TPZD 4B4VA 1CUCA 2R00A 4GMKA 2ACVA 2QE6A 4RV4A 5HTOA 1ZM2A 2OLJA 1RWVA 3T7RA 2PEYA 3IQXA 3STHA 4QXMA 4A1OA 3GRVA 4XYGA 5FBQB 4ETMA 2R62A 4KPYA 3GJ6A 4QRDA 1CJSA 3TLEA 4FEEA 3E35A 5L3VA 2VUSA 4I1VA 2V4MA 3Q5DA 4DWWA 3D8NA 1J1IA 2HPAA 3FCUB 3IJEB 1GTSA 4UZFA 1R15A 5CNMA 3FKJA 1WZNA 2QJWA 1IG0A 5ARCA 3T95A 3GNLA 3ZWBA 3F3YA 4ZQBA 4EZEA 5JC8A 4B3TB 3KOXA 2J7KA 3GR6A 5KZMB 2WKRA