4CYNA

Leishmania major n-myristoyltransferase in complex with an aminoacylpyrrolidine inhibitor (2b)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 125
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cynA00
4A30A 4B10A 2WUUA 3JTKA 4UFWA 5AG5A 4C2ZA 2YNCA 4BBHA 4C7HA 5G22A 4UCMA 2WSAA 4UFXA 5AGEA 4A32A 3IWEA 4A33A 4C7IA 5AG6A 2YNEA 4C2YA 4UFVA 4UCPA 4CAEA 4CGPA 4B12A 4A95A 3IU2A 3IU1A 5G20A 4B14A 4CYPA 4A2ZA 4CGMA 4C2XA 4CGOA 4CYOA 5G1ZA 4CYQA 4B11A 2YNCC 5A28A 2YNDA 4C68A 4UCNA 4CGNA 5AG7A 4CGLA 5A27A 5AG4A 4B13A 5G21A 3H5ZA 4CAFA 4A31A 4CYNA
chains in the Genus database with same CATH superfamily
1WWZA 4J3GA 3K9TA 3KASA 2JDDA 2V77A 4A39A 4MHNA 8CPAA 2Q4VA 3SI2A 4C7HA 4RI1A 3NH8A 1Q7LA 4QUSA 5F49A 3S9LA 1VGYA 2PR8A 2REFA 3LD2A 4NFRA 1CP6A 1B6BA 1A2ZA 1XBUA 3T8WA 4MCRA 4B14A 4LQGA 3FB3A 2AE6A 1KUVA 2RFHA 2Q0YA 3FX6A 2B5GA 3D4UA 1VIXA 4Y49C 4MBUA 3S6HA 1BAVA 4OC0A 1DTDA 5A27A 4B13A 2ANPA 4MCSA 3LODA 4NF1A 5DS0A 4HNXB 3V7ZA 3DNSA 3IFEA 2PRBA 3TO6A 3S9NA 2EVNA 3DSBA 3KKWA 3PB4X 1PUAA 1XF8A 2ODFA 4MCQA 3HLPA 1WK4A 3B3TA 1TIQA 3JUWA 2D4OA 4DJLA 4X5KA 1M4LA 2ABZA 4MHZA 4A33A 4UFVA 3FJUA 2BEIA 4HKFA 2V8GA 1BPMA 3P2FA 5CNPA 3F5BA 4OMEA 3SJGA 1MJ9A 2R1IA 4M85A 4ONUA 4X2TA 5D8NA 4ZX8A 1ON0A 2DPTA 1TKFA 2BL1A 4K30A 4OC4A 3G3SA 3IC1A 3WABA 1FY7A 4WWVA 3DR8A 2QIRA 3PFEA 1Z8XA 3KQZA 5ISVA 2ZEPA 4EFDA 2CF4A 2FT0A 1B87A 1VHOA 4MY3A 3D7DA 4KOSA 4MFPA 2ZEFA 1JWQA 1R43A 1CBXA 2VBQA 2ZW6A 4KUBA 4UFXA 5G22A 2WPWA 1V0CA 5AG6A 1ZLIA 2JLMA 3IGRA 2AFXA 1BO4A 2CXAA 2PJ6A 3GLJA 3D67A 4BD9A 2XEFA 4JLYA 4JYWA 2GIVA 3QAHA 5HVGA 1S7NA 3DGVA 4XPLA 5EBVA 4A37A 4A94A 5A28A 1AMPA 3FMCA 3EXNA 4ZI6A 3NH5A 4R6TA 2C1CA 3IEHA 5K8PA 2P6EA 1Z8TA 1YX0A 2O53A 4R3LA 3FH4A 4R87A 2PVWA 3S6FA 2AFMA 2REEA 3EO4A 3RAMA 3VATA 2FL4A 2OR4A 4NGNA 4P4DA 4P45A 1IOIA 5C82A 2PR1A 1RXTA 4HNYB 4CAEA 4H89A 1JQGA 3KR4A 4OC2A 4P10A 4UIAA 4YGOA 2Q4ZA 3H8EA 1Z4EA 1YVOA 2PDOA 3R1KA 4GM5A 3W6XA 3NH4A 3FECA 4A2ZA 2KCWA 4C2XA 4LUAA 2Y0MA 4UWJA 4EVYA 2AFSA 4C68A 2HUZA 2F8HA 4KOTA 3EY5A 5KTAA 5IX3A 4KVME 4F8ZA 2Q7SA 5AG4A 1Q2YA 3I9SA 3V8IA 4P4EA 4QBJA 3RNZA 4P4BA 1OZPA 1F2PA 5KTDA 3JTKA 4CRZB 5AG5A 3WT4A 1ZG7A 2VL1A 5H86A 2IMOA 2JBJA 2ZENA 3HUVA 4OIDA 2YNEA 2IQ6A 3D2MA 2G9DA 1S7LA 1TF9A 2Z3OA 4OP4A 4CAVA 3PGPA 4A95A 1S7FA 1IYLA 1UWYA 4KSIA 2C6CA 4RUHA 3EFAA 2F5IA 4R7MA 1P0HA 2V8HA 3B3CA 4H2KA 3D7GA 3FXTA 4O23A 3ISZA 4X8IA 4CGLA 2OZHA 3H8GA 4JJXA 4B6ZA 4DUKA 2FXFA 5JPHA 3DR6A 4BMHA 5LYLA 5I0CA 3H8FA 2VEZA 3P2HA 3LWUA 3BJ7A 3C26A 3MGDA 4R3KA 3TOBA 2ZOFA 1ARLA 4FD4A 2AFZA 2IJZA 4U9YA 5F46A 3CXSA 5J8FA 3VWEA 1CM0A 5HVFA 2BOAA 3CZXA 1M44A 3D7FA 4EWTA 2XEGA 1XRYA 3KQXA 1KWMA 2HV2A 3FBUA 2FSRA 3IU2A 5ELYA 1SQHA 2ZEMA 4CYPA 4IF5A 2B4DB 2P6GA 3TO9A 2PJBA 2O4HA 3IO1A 4KZTA 2YNDA 4UIBA 4NJRA 3SJFA 2V8DA 2VXKA 4MHYA 1GHEA 1XIXA 2EK9A 2ZEDA 3WC5A 1MK4A 2C27A 1IOFA 3MRUA 4KS9A 1VKCA 3SI1A 2VI7A 1N71A 1I21A 5DWMA 4NCZA 3R9EA 2Z3PA 4YU9A 2OB0A 4B10A 4AVCA 4TWEA 3ISXA 3L2NA 4Q7AA 2AFWA 1X12A 3TE4A 4ONWA 5LYDA 1ELLP 3KHZA 2ZEHA 4LQ6A 4E8OA 4AVBA 5CPAA 3NE8A 4P6YA 4MRIA 5G20A 5JM6A 2F7VA 3W6SA 4KSAA 5HH1A 2GANA 2ARHA 1QQ9A 3SJEA 4CGOA 1F2OA 4MFQA 4KORA 4B11A 2O28A 4CPAA 5BWAB 4L89A 2HB6A 3QNVA 1S60A 2GU2A 4KVOE 2DEAA 2J9AA 2FIWA 1YLEA 1CP7A 1LRZA 4NJQA 2ZW5A 3BLNA 4ZX9A 3TX8A 2XEIA 1OBRA 1S3ZA 4FD7A 4XPDB 1YREA 1Y9KA 4ZY1A 4XPKA 4FBEA 2WSAA 4PSXA 3IWEA 4NXYA 3CT9A 3GY9A 1U6MA 2R7HA 2FVGA 2PJ5A 1Y0YA 2D4PA 2X7BA 4KVXA 4ZY0A 1IGBA 4OC3A 2CTCA 2Z3LA 1LCPA 3NFZA 4NGTA 2GLJA 5G1ZA 3FNCA 2DPSA 4NSQA 2AJ6A 2CY2A 1K4JA 2RB7A 4FD6A 4GS4A 4CGNA 5F09A 5AG7A 2NYQA 4AVAA 3KL9A 2FCKA 4PK2A 3UY5A 1NSAA 2Q04A 3BI0A 3WC6A 4LX9A 4UEEA 1YW6A 3PB8X 4M6HA 3ZJ0A 5J1QA 5C88A 2FS5A 3N5FA 4Q38A 4K3NA 1FNOA 1XJOA 4NGSA 1S7KA 2EO8A 2CNTA 1YLOA 3IWWA 4OKOA 4Y49B 3T9YA 1PU9A 4A32A 3KI9A 4QVTA 4FWUA 4U9ZA 4MHDA 4OC1A 3TO7A 5IV0A 4PK3A 4IAVA 2BUEA 2OU2A 3S6GA 4OLLA 3K2KA 3B7IA 4UBRA 2I79A 5K8MA 2Q7BA 4R9MA 2EUIA 1I1DA 5F47A 1YVKA 4M6IA 4PXDA 3GB0A 1YMEA 1Q2DA 2A4NA 3PB7X 4B5PB 3PBEA 5K8NA 1I12A 2OZGA 1MJBA 3SXNA 4ZBGA 4P4IA 2JEVA 1Y7RA 4PV6A 1ZO0A 6CPAA 2HQYA 2GFQA 4HPSA 4R57A 4E2AA 2JDCA 1NSLA 3R96A 2EBJA 1QSRA 3DLJA 2G3AA 2EK8A 2VZZA 3PB9X 4M6GA 2NMTA 4MFJA 5EC4A 3WR7A 4B12A 7CPAA 3NE7A 1KZFA 1IICA 1CPXA 3IU1A 3VWDA 4AB7A 3D3SA 2ZEGA 3CDXA 3IWGA 3KZWA 5CBMA 2CNSA 3IIBA 4YFJA 4MJ8A 3SI0A 4CRYB 5LYFA 4CAXA 1Z5RA 2GREA 3SXOA 3B3VA 1EE3P 4M3SA 4CAWA 4DNCA 1IYKA 3NA6A 3R95A 2P6FA 3B3WA 1XFOA 2BO9A 1R57A 3F8KA 4YWYA 4B5OA 4KLWA 5LRKA 4DYOA 1QSTA 4GXHA 2Z3MA 2GE3A 2NSMA 1NE9A 3GUXA 4MFZA 3BI1A 4XNHC 1Y9WA 4F0XA 1X10A 4W9YA 4IK2A 2Q4YA 4RS2A 1YSJA 1J4JA 4UCPA 3BHXA 3PP9A 4PQAA 2Q43A 1NMTA 1QSOA 2ZEEA 3FIXA 2CNMA 2Q44A 2PVVA 1RTQA 2PCUA 3I1UA 3D8PA 1UFHA 3TTHA 2B5GB 1M4GA 1QSMA 1XEBA 1PYTB 1QSNA 2XEJA 2I00A 4MFLA 1CJWA 2FIAA 2PJ4A 4MFKA 4UA3A 3D66A 1YK3A 3H5ZA 1ELMP 2QVPA 3KGQA 2H5MA 2OZUA 3BXMA 3R9GA 5F48A 3TOAA 3FYNA 3SHPA 2VZYA 4ZGYB 4UEFA 2YNCA 1TKHA 1XMBA 2PJ7A 5HVHA 2QMLA 3ZZIA 5LRGA 4Z65A 3LACA 4C2YA 4MMOA 1Y0RA 1RO5A 3MN8A 1CG2A 4Q36A 2R98A 3WC7A 2B4DA 2QECA 2YGWA 3VH9A 4WJBA 3QB8A 2ZOGA 3A9LA 4QB9A 1XE4A 4P44A 1HEEA 2J8RA 5E96A 5JH9A 5IB9A 3B8GA 4KOVA 5IB0A 3BJ8A 1YW4A 4OAEA 5LYIA 4MY0A 1Z8LA 4CAFA 3D7HA 5HMNA 4CYNA 2Z10A 3CPXA 3DDDA 4PXEA 1XMTA 3FEEA 1GYTA 4I49A 2P0WA 3PEIA 4H6ZA 4MI4A 4P4JA 5FVJA 3V38A 2B58A 4NGMA 3I3GA 3R9FA 2ZW4A 3G8WA 3KR5A 2WZNA 3PFOA 3FEDA 5THWA 4F0YA 4IUSA 2J8NA 3T90A 1BOBA 5GCNA 2AFOA 2ZELA 3B2YA 2B4BA 3LMSA 4NEXA 1AYEA 5JQ4A 4PSWA 1QMUA 4XNHB 1F57A 4OC5A 1HDUA 1IU8A 1VHSA 2PQ8A 4F6AA 4R8FA 4JZ0A 5JGFA 1S5KA 2BCOA 1KUXA 5G21A 1MJAA 1YQEA 2Z3KA 2PJCA 1Z2LA 1M1DA 2WUUA 3FF3A 2CTBA 4UFWA 3FVLA 1LOKA 3E0KA 4U5YA 2OH1A 3IJ3A 3RZAA 4ZY2A 2PJ0A 5I4MA 1YR0A 2QYVA 2GLFA 4UCMA 2C6PA 2IL4A 4CS0B 4F9UA 1FT7A 4YRHA 3B3SA 1LFWA 4PXCA 4CGPA 2Q51A 2ZEOA 4L8AA 4QC6A 2J8MA 1AUGA 2PJ9A 1BLLE 1TKJA 3D2PA 4HNWB 3TC8A 5K8OA 4II9A 1LANA 1Q2CA 3OWCA 1IB1E 3QAYA 4JXQA 4RN7A 4CGMA 2QJ8A 2B3UA 2G0BA 2YNCC 3F0AA 4JD6A 5J8CA 3PRTA 1IIDA 1M4DA 4KLVA 1Z4RA 3CPAA 4FUUA 3TFYA 5EMIA 1HDQA 3FRMA 4KSFA 1DE4C 2DXQA 4H6UA 2PRQA 2V8VA 4MHPA 2VQYA 3GIUA 2DF5A 4A30A 3VARA 1M4IA 5LRJA 4R76A 4F9VA 3CXPA 4C2ZA 4NGPA 4P4FA 3TT2A 5AGEA 4AG9A 3W91A 4NGRA 2PSWA 2OOTA 2PIZA 3CXQA 1L0CA 2PJ8A 4JWPA 4KOUA 4KUAA 5D29A 2EWBA 4FD5A 1ZG8A 4KOXA 2PC1A 5H84A 3RBUA 4BINA 4E0AA 2ZXVA 4X3RA 1IY7A 1KUYA 4CYOA 3SJXA 4UF4A 2CIJA 2G3TA 2JBKA 3KHXA 3N7ZA 3PBBA 3EC4A 3GYAA 1LAMA 2PJ3A 4B5PA 3JRUA 2WPXA 3TCVA 2PJAA 3PZJA 3S9MA 3GKRA 4KOYA 1CPSA 1Y7EA 3RO0A 1TXRA 2RC4A 1ZG9A 3JVNA 4MCPA 4A31A 4TNUA 1LAPA 1CX8A 2ATRA 2Z0ZA 1BPNA 2WYRA 4OADA 4ORFA 4PXBA 3D68A 2BSWA 2B3VA 4IHMA 2PJ2A 2ZW7A 3H4QA 4KOWA 2R8VA 4AXVA 4BBHA 1TF8A 4FAIA 3S6KA 2AFUA 4JXRA 5KTCA 2JEWA 4C7IA 1XOVA 2HC9A 2FE7A 2PJ1A 3PB6X 4UEZA 1ARMA 4MXUA 5DWNA 3B35A 1YGHA 1R3NA 1PCAA 1Z8WA 2Z11A 4A38A 2POKA 2Z3NA 4XPDC 1ZLHA 4CYQA 1VHEA 4NGQA 4AG7A 2ZPAA 4UCNA 4EMEA 4PPZA 4ZYQA 2PIYA 1H8LA 3K9UA 1Z9UA 4G1PA 3RYOA 1P4NA 2I3CA 4UWIA 5HXDA 4OIWA 2C6GA 2PE3A 2K5TA
chains in the Genus database with same CATH topology
1WWZA 4J3GA 2JDDA 2Q4VA 4C7HA 4RI1A 4QUSA 5F49A 2PR8A 2REFA 3LD2A 4B14A 1B6BA 3FB3A 2AE6A 1KUVA 2Q0YA 2B5GA 4Y49C 4MBUA 3S6HA 5A27A 4B13A 3LODA 4NF1A 4HNXB 3DNSA 2PRBA 3TO6A 2EVNA 3DSBA 3KKWA 1PUAA 1XF8A 1WK4A 3JUWA 1TIQA 2D4OA 4X5KA 4A33A 4UFVA 2BEIA 4HKFA 3P2FA 5CNPA 3F5BA 1MJ9A 2R1IA 4M85A 4ONUA 1ON0A 2DPTA 2BL1A 4K30A 3G3SA 1FY7A 3DR8A 2QIRA 5ISVA 2FT0A 1B87A 4MY3A 4KOSA 4MFPA 2ZW6A 5G22A 2VBQA 4UFXA 4KUBA 2WPWA 1V0CA 5AG6A 2JLMA 3IGRA 1BO4A 2CXAA 4JLYA 2GIVA 3QAHA 1S7NA 5EBVA 4XPLA 5A28A 3EXNA 2P6EA 4R3LA 1YX0A 4R87A 3S6FA 2REEA 3EO4A 2FL4A 5C82A 2PR1A 1RXTA 4HNYB 4CAEA 4H89A 4YGOA 3R1KA 1Z4EA 1YVOA 2PDOA 3W6XA 4A2ZA 2KCWA 4C2XA 4LUAA 2Y0MA 4UWJA 4EVYA 4C68A 2HUZA 4KOTA 3EY5A 5KTAA 5IX3A 4KVME 5AG4A 1Q2YA 3I9SA 3V8IA 4QBJA 1OZPA 5KTDA 3JTKA 4CRZB 5AG5A 5H86A 2YNEA 3D2MA 1S7LA 2Z3OA 4CAVA 3PGPA 4A95A 1S7FA 1IYLA 3EFAA 2F5IA 1P0HA 3FXTA 4CGLA 2OZHA 4JJXA 2FXFA 5JPHA 3DR6A 4BMHA 5I0CA 2VEZA 3P2HA 3MGDA 3BJ7A 3C26A 4R3KA 3TOBA 4FD4A 4U9YA 5F46A 3CXSA 5J8FA 3VWEA 1CM0A 1M44A 2HV2A 3FBUA 2FSRA 3IU2A 4CYPA 1SQHA 4IF5A 2B4DB 2P6GA 3TO9A 4KZTA 2YNDA 2VXKA 1GHEA 1XIXA 1MK4A 2C27A 4KS9A 1VKCA 2VI7A 1N71A 1I21A 5DWMA 4NCZA 3R9EA 2Z3PA 2OB0A 4B10A 4AVCA 3TE4A 4E8OA 4AVBA 5G20A 3W6SA 4KSAA 5HH1A 2GANA 2ARHA 4CGOA 4MFQA 4KORA 4B11A 2O28A 5BWAB 4L89A 1S60A 4KVOE 2FIWA 1YLEA 1LRZA 2ZW5A 3BLNA 1S3ZA 4FD7A 4XPDB 1YREA 1Y9KA 4XPKA 2WSAA 4PSXA 3IWEA 4NXYA 3GY9A 1U6MA 2R7HA 2D4PA 2X7BA 4KVXA 2Z3LA 5G1ZA 3FNCA 2DPSA 4NSQA 2AJ6A 2CY2A 1K4JA 4FD6A 4GS4A 4CGNA 5AG7A 4AVAA 2FCKA 4PK2A 3UY5A 2Q04A 4LX9A 3ZJ0A 5C88A 2FS5A 4Q38A 1S7KA 4A32A 2CNTA 4Y49B 3T9YA 1PU9A 4QVTA 4U9ZA 4MHDA 3TO7A 5IV0A 4PK3A 2BUEA 2OU2A 3S6GA 4OLLA 4UBRA 2I79A 2Q7BA 4R9MA 2EUIA 1I1DA 5F47A 1YVKA 1Q2DA 2A4NA 4B5PB 1I12A 2OZGA 1MJBA 3SXNA 4ZBGA 2JEVA 1Y7RA 4PV6A 1ZO0A 2HQYA 4R57A 4E2AA 2JDCA 1NSLA 3R96A 1QSRA 3ZZIA 2G3AA 3WR7A 2NMTA 4MFJA 5EC4A 4B12A 3NE7A 1KZFA 1IICA 3VWDA 3IU1A 4AB7A 3D3SA 3IWGA 2CNSA 4YFJA 4MJ8A 4CRYB 4CAXA 3SXOA 4M3SA 4CAWA 4DNCA 1IYKA 3R95A 2P6FA 4B5OA 1R57A 3F8KA 4KLWA 1QSTA 2Z3MA 2GE3A 1NE9A 4MFZA 4XNHC 1Y9WA 4F0XA 2Q4YA 4RS2A 1J4JA 4UCPA 3PP9A 1NMTA 1QSOA 3FIXA 2CNMA 2Q44A 3D8PA 1UFHA 3TTHA 2B5GB 1M4GA 1QSMA 1XEBA 1QSNA 2I00A 4MFLA 1CJWA 2FIAA 4MFKA 4UA3A 1YK3A 3H5ZA 3R9GA 2H5MA 2OZUA 3TOAA 5F48A 3FYNA 3SHPA 2VZYA 4ZGYB 2YNCA 2QMLA 4C2YA 1RO5A 4Q36A 2R98A 2B4DA 2QECA 2YGWA 3QB8A 3A9LA 4QB9A 1XE4A 2J8RA 5E96A 3B8GA 4KOVA 5IB0A 3BJ8A 4OAEA 4MY0A 4CAFA 5HMNA 4CYNA 2Z10A 3DDDA 1XMTA 4I49A 2P0WA 4H6ZA 4MI4A 5FVJA 2B58A 3I3GA 3R9FA 2ZW4A 3G8WA 4F0YA 4IUSA 2J8NA 3T90A 1BOBA 5GCNA 2B4BA 4NEXA 5JQ4A 4PSWA 4XNHB 4F6AA 1VHSA 2PQ8A 1S5KA 1KUXA 5G21A 1MJAA 2Z3KA 1M1DA 2WUUA 4UFWA 4U5YA 3E0KA 2OH1A 1YR0A 4UCMA 2IL4A 4CS0B 4YRHA 4CGPA 4L8AA 4QC6A 2J8MA 4II9A 4HNWB 3D2PA 1Q2CA 3OWCA 4JXQA 1IB1E 4CGMA 2B3UA 2G0BA 2YNCC 3F0AA 4JD6A 5J8CA 1IIDA 1M4DA 4KLVA 1Z4RA 3TFYA 3FRMA 4KSFA 2DXQA 4H6UA 2VQYA 4A30A 1M4IA 3CXPA 4C2ZA 3TT2A 5AGEA 4AG9A 3W91A 2PSWA 3CXQA 1L0CA 4JWPA 4KOUA 4KUAA 4FD5A 4KOXA 2PC1A 5H84A 4E0AA 2ZXVA 1KUYA 4CYOA 2G3TA 3N7ZA 3EC4A 3GYAA 4B5PA 2WPXA 3TCVA 3PZJA 3GKRA 4KOYA 4A31A 3JVNA 2RC4A 2ATRA 2Z0ZA 4OADA 4ORFA 2BSWA 2B3VA 4KOWA 2ZW7A 3H4QA 4BBHA 5KTCA 2R8VA 3S6KA 4JXRA 4C7IA 2FE7A 5DWNA 1YGHA 2Z11A 2Z3NA 4XPDC 4CYQA 4AG7A 2ZPAA 4UCNA 3K9UA 1Z9UA 3RYOA 1P4NA 4UWIA 2VZZA 2K5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A30 A;  4B10 A;  2WUU A;  3JTK A;  4UFW A;  5AG5 A;  4C2Z A;  2YNC A;  4BBH A;  4C7H A;  5G22 A;  4UCM A;  2WSA A;  4UFX A;  5AGE A;  4A32 A;  3IWE A;  4A33 A;  4C7I A;  5AG6 A;  2YNE A;  4C2Y A;  4UFV A;  4UCP A;  4CAE A;  4CGP A;  4B12 A;  4A95 A;  3IU2 A;  3IU1 A;  5G20 A;  4B14 A;  4CYP A;  4A2Z A;  4CGM A;  4C2X A;  4CGO A;  4CYO A;  5G1Z A;  4CYQ A;  4B11 A;  2YNC C;  5A28 A;  2YND A;  4C68 A;  4UCN A;  4CGN A;  5AG7 A;  4CGL A;  5A27 A;  5AG4 A;  4B13 A;  5G21 A;  3H5Z A;  4CAF A;  4A31 A;  4CYN A; 
#chains in the Genus database with same CATH topology
 1WWZ A;  4J3G A;  3K9T A;  3KAS A;  2JDD A;  2V77 A;  4A39 A;  4MHN A;  8CPA A;  2Q4V A;  3SI2 A;  4C7H A;  4RI1 A;  3NH8 A;  1Q7L A;  4QUS A;  5F49 A;  3S9L A;  1VGY A;  2PR8 A;  2REF A;  3LD2 A;  4NFR A;  1CP6 A;  1B6B A;  1A2Z A;  1XBU A;  3T8W A;  4MCR A;  4B14 A;  4LQG A;  3FB3 A;  2AE6 A;  1KUV A;  2RFH A;  2Q0Y A;  3FX6 A;  2B5G A;  3D4U A;  1VIX A;  4Y49 C;  4MBU A;  3S6H A;  1BAV A;  4OC0 A;  1DTD A;  5A27 A;  4B13 A;  2ANP A;  4MCS A;  3LOD A;  4NF1 A;  5DS0 A;  4HNX B;  3V7Z A;  3DNS A;  3IFE A;  2PRB A;  3TO6 A;  3S9N A;  2EVN A;  3DSB A;  3KKW A;  3PB4 X;  1PUA A;  1XF8 A;  2ODF A;  4MCQ A;  3HLP A;  1WK4 A;  3B3T A;  1TIQ A;  3JUW A;  2D4O A;  4DJL A;  4X5K A;  1M4L A;  2ABZ A;  4MHZ A;  4A33 A;  4UFV A;  3FJU A;  2BEI A;  4HKF A;  2V8G A;  1BPM A;  3P2F A;  5CNP A;  3F5B A;  4OME A;  3SJG A;  1MJ9 A;  2R1I A;  4M85 A;  4ONU A;  4X2T A;  5D8N A;  4ZX8 A;  1ON0 A;  2DPT A;  1TKF A;  2BL1 A;  4K30 A;  4OC4 A;  3G3S A;  3IC1 A;  3WAB A;  1FY7 A;  4WWV A;  3DR8 A;  2QIR A;  3PFE A;  1Z8X A;  3KQZ A;  5ISV A;  2ZEP A;  4EFD A;  2CF4 A;  2FT0 A;  1B87 A;  1VHO A;  4MY3 A;  3D7D A;  4KOS A;  4MFP A;  2ZEF A;  1JWQ A;  1R43 A;  1CBX A;  2VBQ A;  2ZW6 A;  4KUB A;  4UFX A;  5G22 A;  2WPW A;  1V0C A;  5AG6 A;  1ZLI A;  2JLM A;  3IGR A;  2AFX A;  1BO4 A;  2CXA A;  2PJ6 A;  3GLJ A;  3D67 A;  4BD9 A;  2XEF A;  4JLY A;  4JYW A;  2GIV A;  3QAH A;  5HVG A;  1S7N A;  3DGV A;  4XPL A;  5EBV A;  4A37 A;  4A94 A;  5A28 A;  1AMP A;  3FMC A;  3EXN A;  4ZI6 A;  3NH5 A;  4R6T A;  2C1C A;  3IEH A;  5K8P A;  2P6E A;  1Z8T A;  1YX0 A;  2O53 A;  4R3L A;  3FH4 A;  4R87 A;  2PVW A;  3S6F A;  2AFM A;  2REE A;  3EO4 A;  3RAM A;  3VAT A;  2FL4 A;  2OR4 A;  4NGN A;  4P4D A;  4P45 A;  1IOI A;  5C82 A;  2PR1 A;  1RXT A;  4HNY B;  4CAE A;  4H89 A;  1JQG A;  3KR4 A;  4OC2 A;  4P10 A;  4UIA A;  4YGO A;  2Q4Z A;  3H8E A;  1Z4E A;  1YVO A;  2PDO A;  3R1K A;  4GM5 A;  3W6X A;  3NH4 A;  3FEC A;  4A2Z A;  2KCW A;  4C2X A;  4LUA A;  2Y0M A;  4UWJ A;  4EVY A;  2AFS A;  4C68 A;  2HUZ A;  2F8H A;  4KOT A;  3EY5 A;  5KTA A;  5IX3 A;  4KVM E;  4F8Z A;  2Q7S A;  5AG4 A;  1Q2Y A;  3I9S A;  3V8I A;  4P4E A;  4QBJ A;  3RNZ A;  4P4B A;  1OZP A;  1F2P A;  5KTD A;  3JTK A;  4CRZ B;  5AG5 A;  3WT4 A;  1ZG7 A;  2VL1 A;  5H86 A;  2IMO A;  2JBJ A;  2ZEN A;  3HUV A;  4OID A;  2YNE A;  2IQ6 A;  3D2M A;  2G9D A;  1S7L A;  1TF9 A;  2Z3O A;  4OP4 A;  4CAV A;  3PGP A;  4A95 A;  1S7F A;  1IYL A;  1UWY A;  4KSI A;  2C6C A;  4RUH A;  3EFA A;  2F5I A;  4R7M A;  1P0H A;  2V8H A;  3B3C A;  4H2K A;  3D7G A;  3FXT A;  4O23 A;  3ISZ A;  4X8I A;  4CGL A;  2OZH A;  3H8G A;  4JJX A;  4B6Z A;  4DUK A;  2FXF A;  5JPH A;  3DR6 A;  4BMH A;  5LYL A;  5I0C A;  3H8F A;  2VEZ A;  3P2H A;  3LWU A;  3BJ7 A;  3C26 A;  3MGD A;  4R3K A;  3TOB A;  2ZOF A;  1ARL A;  4FD4 A;  2AFZ A;  2IJZ A;  4U9Y A;  5F46 A;  3CXS A;  5J8F A;  3VWE A;  1CM0 A;  5HVF A;  2BOA A;  3CZX A;  1M44 A;  3D7F A;  4EWT A;  2XEG A;  1XRY A;  3KQX A;  1KWM A;  2HV2 A;  3FBU A;  2FSR A;  3IU2 A;  5ELY A;  1SQH A;  2ZEM A;  4CYP A;  4IF5 A;  2B4D B;  2P6G A;  3TO9 A;  2PJB A;  2O4H A;  3IO1 A;  4KZT A;  2YND A;  4UIB A;  4NJR A;  3SJF A;  2V8D A;  2VXK A;  4MHY A;  1GHE A;  1XIX A;  2EK9 A;  2ZED A;  3WC5 A;  1MK4 A;  2C27 A;  1IOF A;  3MRU A;  4KS9 A;  1VKC A;  3SI1 A;  2VI7 A;  1N71 A;  1I21 A;  5DWM A;  4NCZ A;  3R9E A;  2Z3P A;  4YU9 A;  2OB0 A;  4B10 A;  4AVC A;  4TWE A;  3ISX A;  3L2N A;  4Q7A A;  2AFW A;  1X12 A;  3TE4 A;  4ONW A;  5LYD A;  1ELL P;  3KHZ A;  2ZEH A;  4LQ6 A;  4E8O A;  4AVB A;  5CPA A;  3NE8 A;  4P6Y A;  4MRI A;  5G20 A;  5JM6 A;  2F7V A;  3W6S A;  4KSA A;  5HH1 A;  2GAN A;  2ARH A;  1QQ9 A;  3SJE A;  4CGO A;  1F2O A;  4MFQ A;  4KOR A;  4B11 A;  2O28 A;  4CPA A;  5BWA B;  4L89 A;  2HB6 A;  3QNV A;  1S60 A;  2GU2 A;  4KVO E;  2DEA A;  2J9A A;  2FIW A;  1YLE A;  1CP7 A;  1LRZ A;  4NJQ A;  2ZW5 A;  3BLN A;  4ZX9 A;  3TX8 A;  2XEI A;  1OBR A;  1S3Z A;  4FD7 A;  4XPD B;  1YRE A;  1Y9K A;  4ZY1 A;  4XPK A;  4FBE A;  2WSA A;  4PSX A;  3IWE A;  4NXY A;  3CT9 A;  3GY9 A;  1U6M A;  2R7H A;  2FVG A;  2PJ5 A;  1Y0Y A;  2D4P A;  2X7B A;  4KVX A;  4ZY0 A;  1IGB A;  4OC3 A;  2CTC A;  2Z3L A;  1LCP A;  3NFZ A;  4NGT A;  2GLJ A;  5G1Z A;  3FNC A;  2DPS A;  4NSQ A;  2AJ6 A;  2CY2 A;  1K4J A;  2RB7 A;  4FD6 A;  4GS4 A;  4CGN A;  5F09 A;  5AG7 A;  2NYQ A;  4AVA A;  3KL9 A;  2FCK A;  4PK2 A;  3UY5 A;  1NSA A;  2Q04 A;  3BI0 A;  3WC6 A;  4LX9 A;  4UEE A;  1YW6 A;  3PB8 X;  4M6H A;  3ZJ0 A;  5J1Q A;  5C88 A;  2FS5 A;  3N5F A;  4Q38 A;  4K3N A;  1FNO A;  1XJO A;  4NGS A;  1S7K A;  2EO8 A;  2CNT A;  1YLO A;  3IWW A;  4OKO A;  4Y49 B;  3T9Y A;  1PU9 A;  4A32 A;  3KI9 A;  4QVT A;  4FWU A;  4U9Z A;  4MHD A;  4OC1 A;  3TO7 A;  5IV0 A;  4PK3 A;  4IAV A;  2BUE A;  2OU2 A;  3S6G A;  4OLL A;  3K2K A;  3B7I A;  4UBR A;  2I79 A;  5K8M A;  2Q7B A;  4R9M A;  2EUI A;  1I1D A;  5F47 A;  1YVK A;  4M6I A;  4PXD A;  3GB0 A;  1YME A;  1Q2D A;  2A4N A;  3PB7 X;  4B5P B;  3PBE A;  5K8N A;  1I12 A;  2OZG A;  1MJB A;  3SXN A;  4ZBG A;  4P4I A;  2JEV A;  1Y7R A;  4PV6 A;  1ZO0 A;  6CPA A;  2HQY A;  2GFQ A;  4HPS A;  4R57 A;  4E2A A;  2JDC A;  1NSL A;  3R96 A;  2EBJ A;  1QSR A;  3DLJ A;  2G3A A;  2EK8 A;  2VZZ A;  3PB9 X;  4M6G A;  2NMT A;  4MFJ A;  5EC4 A;  3WR7 A;  4B12 A;  7CPA A;  3NE7 A;  1KZF A;  1IIC A;  1CPX A;  3IU1 A;  3VWD A;  4AB7 A;  3D3S A;  2ZEG A;  3CDX A;  3IWG A;  3KZW A;  5CBM A;  2CNS A;  3IIB A;  4YFJ A;  4MJ8 A;  3SI0 A;  4CRY B;  5LYF A;  4CAX A;  1Z5R A;  2GRE A;  3SXO A;  3B3V A;  1EE3 P;  4M3S A;  4CAW A;  4DNC A;  1IYK A;  3NA6 A;  3R95 A;  2P6F A;  3B3W A;  1XFO A;  2BO9 A;  1R57 A;  3F8K A;  4YWY A;  4B5O A;  4KLW A;  5LRK A;  4DYO A;  1QST A;  4GXH A;  2Z3M A;  2GE3 A;  2NSM A;  1NE9 A;  3GUX A;  4MFZ A;  3BI1 A;  4XNH C;  1Y9W A;  4F0X A;  1X10 A;  4W9Y A;  4IK2 A;  2Q4Y A;  4RS2 A;  1YSJ A;  1J4J A;  4UCP A;  3BHX A;  3PP9 A;  4PQA A;  2Q43 A;  1NMT A;  1QSO A;  2ZEE A;  3FIX A;  2CNM A;  2Q44 A;  2PVV A;  1RTQ A;  2PCU A;  3I1U A;  3D8P A;  1UFH A;  3TTH A;  2B5G B;  1M4G A;  1QSM A;  1XEB A;  1PYT B;  1QSN A;  2XEJ A;  2I00 A;  4MFL A;  1CJW A;  2FIA A;  2PJ4 A;  4MFK A;  4UA3 A;  3D66 A;  1YK3 A;  3H5Z A;  1ELM P;  2QVP A;  3KGQ A;  2H5M A;  2OZU A;  3BXM A;  3R9G A;  5F48 A;  3TOA A;  3FYN A;  3SHP A;  2VZY A;  4ZGY B;  4UEF A;  2YNC A;  1TKH A;  1XMB A;  2PJ7 A;  5HVH A;  2QML A;  3ZZI A;  5LRG A;  4Z65 A;  3LAC A;  4C2Y A;  4MMO A;  1Y0R A;  1RO5 A;  3MN8 A;  1CG2 A;  4Q36 A;  2R98 A;  3WC7 A;  2B4D A;  2QEC A;  2YGW A;  3VH9 A;  4WJB A;  3QB8 A;  2ZOG A;  3A9L A;  4QB9 A;  1XE4 A;  4P44 A;  1HEE A;  2J8R A;  5E96 A;  5JH9 A;  5IB9 A;  3B8G A;  4KOV A;  5IB0 A;  3BJ8 A;  1YW4 A;  4OAE A;  5LYI A;  4MY0 A;  1Z8L A;  4CAF A;  3D7H A;  5HMN A;  4CYN A;  2Z10 A;  3CPX A;  3DDD A;  4PXE A;  1XMT A;  3FEE A;  1GYT A;  4I49 A;  2P0W A;  3PEI A;  4H6Z A;  4MI4 A;  4P4J A;  5FVJ A;  3V38 A;  2B58 A;  4NGM A;  3I3G A;  3R9F A;  2ZW4 A;  3G8W A;  3KR5 A;  2WZN A;  3PFO A;  3FED A;  5THW A;  4F0Y A;  4IUS A;  2J8N A;  3T90 A;  1BOB A;  5GCN A;  2AFO A;  2ZEL A;  3B2Y A;  2B4B A;  3LMS A;  4NEX A;  1AYE A;  5JQ4 A;  4PSW A;  1QMU A;  4XNH B;  1F57 A;  4OC5 A;  1HDU A;  1IU8 A;  1VHS A;  2PQ8 A;  4F6A A;  4R8F A;  4JZ0 A;  5JGF A;  1S5K A;  2BCO A;  1KUX A;  5G21 A;  1MJA A;  1YQE A;  2Z3K A;  2PJC A;  1Z2L A;  1M1D A;  2WUU A;  3FF3 A;  2CTB A;  4UFW A;  3FVL A;  1LOK A;  3E0K A;  4U5Y A;  2OH1 A;  3IJ3 A;  3RZA A;  4ZY2 A;  2PJ0 A;  5I4M A;  1YR0 A;  2QYV A;  2GLF A;  4UCM A;  2C6P A;  2IL4 A;  4CS0 B;  4F9U A;  1FT7 A;  4YRH A;  3B3S A;  1LFW A;  4PXC A;  4CGP A;  2Q51 A;  2ZEO A;  4L8A A;  4QC6 A;  2J8M A;  1AUG A;  2PJ9 A;  1BLL E;  1TKJ A;  3D2P A;  4HNW B;  3TC8 A;  5K8O A;  4II9 A;  1LAN A;  1Q2C A;  3OWC A;  1IB1 E;  3QAY A;  4JXQ A;  4RN7 A;  4CGM A;  2QJ8 A;  2B3U A;  2G0B A;  2YNC C;  3F0A A;  4JD6 A;  5J8C A;  3PRT A;  1IID A;  1M4D A;  4KLV A;  1Z4R A;  3CPA A;  4FUU A;  3TFY A;  5EMI A;  1HDQ A;  3FRM A;  4KSF A;  1DE4 C;  2DXQ A;  4H6U A;  2PRQ A;  2V8V A;  4MHP A;  2VQY A;  3GIU A;  2DF5 A;  4A30 A;  3VAR A;  1M4I A;  5LRJ A;  4R76 A;  4F9V A;  3CXP A;  4C2Z A;  4NGP A;  4P4F A;  3TT2 A;  5AGE A;  4AG9 A;  3W91 A;  4NGR A;  2PSW A;  2OOT A;  2PIZ A;  3CXQ A;  1L0C A;  2PJ8 A;  4JWP A;  4KOU A;  4KUA A;  5D29 A;  2EWB A;  4FD5 A;  1ZG8 A;  4KOX A;  2PC1 A;  5H84 A;  3RBU A;  4BIN A;  4E0A A;  2ZXV A;  4X3R A;  1IY7 A;  1KUY A;  4CYO A;  3SJX A;  4UF4 A;  2CIJ A;  2G3T A;  2JBK A;  3KHX A;  3N7Z A;  3PBB A;  3EC4 A;  3GYA A;  1LAM A;  2PJ3 A;  4B5P A;  3JRU A;  2WPX A;  3TCV A;  2PJA A;  3PZJ A;  3S9M A;  3GKR A;  4KOY A;  1CPS A;  1Y7E A;  3RO0 A;  1TXR A;  2RC4 A;  1ZG9 A;  3JVN A;  4MCP A;  4A31 A;  4TNU A;  1LAP A;  1CX8 A;  2ATR A;  2Z0Z A;  1BPN A;  2WYR A;  4OAD A;  4ORF A;  4PXB A;  3D68 A;  2BSW A;  2B3V A;  4IHM A;  2PJ2 A;  2ZW7 A;  3H4Q A;  4KOW A;  2R8V A;  4AXV A;  4BBH A;  1TF8 A;  4FAI A;  3S6K A;  2AFU A;  4JXR A;  5KTC A;  2JEW A;  4C7I A;  1XOV A;  2HC9 A;  2FE7 A;  2PJ1 A;  3PB6 X;  4UEZ A;  1ARM A;  4MXU A;  5DWN A;  3B35 A;  1YGH A;  1R3N A;  1PCA A;  1Z8W A;  2Z11 A;  4A38 A;  2POK A;  2Z3N A;  4XPD C;  1ZLH A;  4CYQ A;  1VHE A;  4NGQ A;  4AG7 A;  2ZPA A;  4UCN A;  4EME A;  4PPZ A;  4ZYQ A;  2PIY A;  1H8L A;  3K9U A;  1Z9U A;  4G1P A;  3RYO A;  1P4N A;  2I3C A;  4UWI A;  5HXD A;  4OIW A;  2C6G A;  2PE3 A;  2K5T A; 
#chains in the Genus database with same CATH homology
 1WWZ A;  4J3G A;  2JDD A;  2Q4V A;  4C7H A;  4RI1 A;  4QUS A;  5F49 A;  2PR8 A;  2REF A;  3LD2 A;  4B14 A;  1B6B A;  3FB3 A;  2AE6 A;  1KUV A;  2Q0Y A;  2B5G A;  4Y49 C;  4MBU A;  3S6H A;  5A27 A;  4B13 A;  3LOD A;  4NF1 A;  4HNX B;  3DNS A;  2PRB A;  3TO6 A;  2EVN A;  3DSB A;  3KKW A;  1PUA A;  1XF8 A;  1WK4 A;  3JUW A;  1TIQ A;  2D4O A;  4X5K A;  4A33 A;  4UFV A;  2BEI A;  4HKF A;  3P2F A;  5CNP A;  3F5B A;  1MJ9 A;  2R1I A;  4M85 A;  4ONU A;  1ON0 A;  2DPT A;  2BL1 A;  4K30 A;  3G3S A;  1FY7 A;  3DR8 A;  2QIR A;  5ISV A;  2FT0 A;  1B87 A;  4MY3 A;  4KOS A;  4MFP A;  2ZW6 A;  5G22 A;  2VBQ A;  4UFX A;  4KUB A;  2WPW A;  1V0C A;  5AG6 A;  2JLM A;  3IGR A;  1BO4 A;  2CXA A;  4JLY A;  2GIV A;  3QAH A;  1S7N A;  5EBV A;  4XPL A;  5A28 A;  3EXN A;  2P6E A;  4R3L A;  1YX0 A;  4R87 A;  3S6F A;  2REE A;  3EO4 A;  2FL4 A;  5C82 A;  2PR1 A;  1RXT A;  4HNY B;  4CAE A;  4H89 A;  4YGO A;  3R1K A;  1Z4E A;  1YVO A;  2PDO A;  3W6X A;  4A2Z A;  2KCW A;  4C2X A;  4LUA A;  2Y0M A;  4UWJ A;  4EVY A;  4C68 A;  2HUZ A;  4KOT A;  3EY5 A;  5KTA A;  5IX3 A;  4KVM E;  5AG4 A;  1Q2Y A;  3I9S A;  3V8I A;  4QBJ A;  1OZP A;  5KTD A;  3JTK A;  4CRZ B;  5AG5 A;  5H86 A;  2YNE A;  3D2M A;  1S7L A;  2Z3O A;  4CAV A;  3PGP A;  4A95 A;  1S7F A;  1IYL A;  3EFA A;  2F5I A;  1P0H A;  3FXT A;  4CGL A;  2OZH A;  4JJX A;  2FXF A;  5JPH A;  3DR6 A;  4BMH A;  5I0C A;  2VEZ A;  3P2H A;  3MGD A;  3BJ7 A;  3C26 A;  4R3K A;  3TOB A;  4FD4 A;  4U9Y A;  5F46 A;  3CXS A;  5J8F A;  3VWE A;  1CM0 A;  1M44 A;  2HV2 A;  3FBU A;  2FSR A;  3IU2 A;  4CYP A;  1SQH A;  4IF5 A;  2B4D B;  2P6G A;  3TO9 A;  4KZT A;  2YND A;  2VXK A;  1GHE A;  1XIX A;  1MK4 A;  2C27 A;  4KS9 A;  1VKC A;  2VI7 A;  1N71 A;  1I21 A;  5DWM A;  4NCZ A;  3R9E A;  2Z3P A;  2OB0 A;  4B10 A;  4AVC A;  3TE4 A;  4E8O A;  4AVB A;  5G20 A;  3W6S A;  4KSA A;  5HH1 A;  2GAN A;  2ARH A;  4CGO A;  4MFQ A;  4KOR A;  4B11 A;  2O28 A;  5BWA B;  4L89 A;  1S60 A;  4KVO E;  2FIW A;  1YLE A;  1LRZ A;  2ZW5 A;  3BLN A;  1S3Z A;  4FD7 A;  4XPD B;  1YRE A;  1Y9K A;  4XPK A;  2WSA A;  4PSX A;  3IWE A;  4NXY A;  3GY9 A;  1U6M A;  2R7H A;  2D4P A;  2X7B A;  4KVX A;  2Z3L A;  5G1Z A;  3FNC A;  2DPS A;  4NSQ A;  2AJ6 A;  2CY2 A;  1K4J A;  4FD6 A;  4GS4 A;  4CGN A;  5AG7 A;  4AVA A;  2FCK A;  4PK2 A;  3UY5 A;  2Q04 A;  4LX9 A;  3ZJ0 A;  5C88 A;  2FS5 A;  4Q38 A;  1S7K A;  4A32 A;  2CNT A;  4Y49 B;  3T9Y A;  1PU9 A;  4QVT A;  4U9Z A;  4MHD A;  3TO7 A;  5IV0 A;  4PK3 A;  2BUE A;  2OU2 A;  3S6G A;  4OLL A;  4UBR A;  2I79 A;  2Q7B A;  4R9M A;  2EUI A;  1I1D A;  5F47 A;  1YVK A;  1Q2D A;  2A4N A;  4B5P B;  1I12 A;  2OZG A;  1MJB A;  3SXN A;  4ZBG A;  2JEV A;  1Y7R A;  4PV6 A;  1ZO0 A;  2HQY A;  4R57 A;  4E2A A;  2JDC A;  1NSL A;  3R96 A;  1QSR A;  3ZZI A;  2G3A A;  3WR7 A;  2NMT A;  4MFJ A;  5EC4 A;  4B12 A;  3NE7 A;  1KZF A;  1IIC A;  3VWD A;  3IU1 A;  4AB7 A;  3D3S A;  3IWG A;  2CNS A;  4YFJ A;  4MJ8 A;  4CRY B;  4CAX A;  3SXO A;  4M3S A;  4CAW A;  4DNC A;  1IYK A;  3R95 A;  2P6F A;  4B5O A;  1R57 A;  3F8K A;  4KLW A;  1QST A;  2Z3M A;  2GE3 A;  1NE9 A;  4MFZ A;  4XNH C;  1Y9W A;  4F0X A;  2Q4Y A;  4RS2 A;  1J4J A;  4UCP A;  3PP9 A;  1NMT A;  1QSO A;  3FIX A;  2CNM A;  2Q44 A;  3D8P A;  1UFH A;  3TTH A;  2B5G B;  1M4G A;  1QSM A;  1XEB A;  1QSN A;  2I00 A;  4MFL A;  1CJW A;  2FIA A;  4MFK A;  4UA3 A;  1YK3 A;  3H5Z A;  3R9G A;  2H5M A;  2OZU A;  3TOA A;  5F48 A;  3FYN A;  3SHP A;  2VZY A;  4ZGY B;  2YNC A;  2QML A;  4C2Y A;  1RO5 A;  4Q36 A;  2R98 A;  2B4D A;  2QEC A;  2YGW A;  3QB8 A;  3A9L A;  4QB9 A;  1XE4 A;  2J8R A;  5E96 A;  3B8G A;  4KOV A;  5IB0 A;  3BJ8 A;  4OAE A;  4MY0 A;  4CAF A;  5HMN A;  4CYN A;  2Z10 A;  3DDD A;  1XMT A;  4I49 A;  2P0W A;  4H6Z A;  4MI4 A;  5FVJ A;  2B58 A;  3I3G A;  3R9F A;  2ZW4 A;  3G8W A;  4F0Y A;  4IUS A;  2J8N A;  3T90 A;  1BOB A;  5GCN A;  2B4B A;  4NEX A;  5JQ4 A;  4PSW A;  4XNH B;  4F6A A;  1VHS A;  2PQ8 A;  1S5K A;  1KUX A;  5G21 A;  1MJA A;  2Z3K A;  1M1D A;  2WUU A;  4UFW A;  4U5Y A;  3E0K A;  2OH1 A;  1YR0 A;  4UCM A;  2IL4 A;  4CS0 B;  4YRH A;  4CGP A;  4L8A A;  4QC6 A;  2J8M A;  4II9 A;  4HNW B;  3D2P A;  1Q2C A;  3OWC A;  4JXQ A;  1IB1 E;  4CGM A;  2B3U A;  2G0B A;  2YNC C;  3F0A A;  4JD6 A;  5J8C A;  1IID A;  1M4D A;  4KLV A;  1Z4R A;  3TFY A;  3FRM A;  4KSF A;  2DXQ A;  4H6U A;  2VQY A;  4A30 A;  1M4I A;  3CXP A;  4C2Z A;  3TT2 A;  5AGE A;  4AG9 A;  3W91 A;  2PSW A;  3CXQ A;  1L0C A;  4JWP A;  4KOU A;  4KUA A;  4FD5 A;  4KOX A;  2PC1 A;  5H84 A;  4E0A A;  2ZXV A;  1KUY A;  4CYO A;  2G3T A;  3N7Z A;  3EC4 A;  3GYA A;  4B5P A;  2WPX A;  3TCV A;  3PZJ A;  3GKR A;  4KOY A;  4A31 A;  3JVN A;  2RC4 A;  2ATR A;  2Z0Z A;  4OAD A;  4ORF A;  2BSW A;  2B3V A;  4KOW A;  2ZW7 A;  3H4Q A;  4BBH A;  5KTC A;  2R8V A;  3S6K A;  4JXR A;  4C7I A;  2FE7 A;  5DWN A;  1YGH A;  2Z11 A;  2Z3N A;  4XPD C;  4CYQ A;  4AG7 A;  2ZPA A;  4UCN A;  3K9U A;  1Z9U A;  3RYO A;  1P4N A;  4UWI A;  2VZZ A;  2K5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...