4CYNA

Leishmania major n-myristoyltransferase in complex with an aminoacylpyrrolidine inhibitor (2b)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 125
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cynA00
4B14A 4C7IA 2WSAA 5G1ZA 4CGMA 4CYQA 2YNCC 5G20A 4CAEA 4CGLA 3H5ZA 4B13A 4C2ZA 5A28A 4UFWA 2WUUA 4CYNA 4C7HA 4UCNA 2YNDA 4CAFA 5A27A 3JTKA 4UFVA 5AGEA 4CGPA 4A30A 4CYPA 4UCMA 4C2YA 4CYOA 2YNEA 3IU1A 3IWEA 5G22A 4A95A 4BBHA 3IU2A 5AG6A 4UCPA 4B11A 4A2ZA 4C68A 4UFXA 4A31A 5G21A 4B12A 4CGNA 4C2XA 5AG5A 4CGOA 4A33A 4B10A 2YNCA 5AG7A 4A32A 5AG4A
chains in the Genus database with same CATH superfamily
4JZ0A 1ZLHA 4II9A 3TX8A 4B5OA 2B4BA 4RS2A 5G20A 2GE3A 1LFWA 2ATRA 2WUUA 1ZG9A 4F8ZA 1LAMA 1XFOA 3CDXA 4CAFA 4EMEA 3IFEA 2EWBA 4JD6A 1F2OA 4NGMA 4R9MA 4B5PB 4UIAA 1IU8A 2EK8A 1Q7LA 3PB9X 1Z8TA 2ABZA 4MHYA 3PFEA 4MHNA 1YSJA 4OAEA 2FCKA 2IL4A 2JBJA 3TOAA 2PR8A 5G21A 3SJGA 4CGNA 3CT9A 3F0AA 4OKOA 3QAYA 3KHXA 3PGPA 2J8NA 4MFKA 5J8FA 3H8FA 1ZO0A 1OBRA 5G1ZA 4NGPA 2HC9A 1KUYA 4MY3A 5LRJA 4R7MA 2PJ8A 2IJZA 3FBUA 4Q36A 5LYFA 4F6AA 5I4MA 2BOAA 3KR5A 1BPNA 3PP9A 3PZJA 2V8HA 3KQZA 4UCNA 3B3SA 4UEEA 1F57A 3S6GA 5F47A 3N5FA 3C26A 4A30A 1XBUA 2Q44A 4M6IA 4C2YA 4AG9A 1S7NA 4OC2A 1ON0A 3DSBA 2XEGA 3S9LA 5DWNA 3V8IA 2PJ2A 4A2ZA 4A37A 3DLJA 4LQ6A 1YW6A 4MFJA 1YREA 2ZEDA 4IUSA 1R57A 2Z3PA 4YGOA 4OC3A 4CGOA 2IMOA 3FEEA 3SXOA 5IB0A 2OZGA 2WPWA 3BLNA 3KHZA 4UBRA 3LACA 5JM6A 3SI1A 4NJRA 1VKCA 2FVGA 2PJ7A 4NJQA 4CAWA 3IWWA 3CPAA 3IEHA 5EMIA 2Q51A 3EO4A 1QMUA 4CRYB 4RN7A 4MFLA 1MK4A 1I21A 2KCWA 2OR4A 2PQ8A 3PBEA 2EBJA 4NXYA 2PRBA 2C1CA 3BI1A 4E2AA 1LAPA 4BMHA 2R7HA 2ZELA 2Z11A 1XRYA 2YNEA 2ZXVA 2PJBA 1S5KA 3BXMA 3GKRA 1B87A 3QB8A 3ZJ0A 4A95A 4P4DA 1PCAA 4TNUA 1X12A 2ZW4A 4Y49B 4MY0A 2PRQA 2ZEOA 4P4IA 3PBBA 4R57A 4R6TA 3B3WA 4E0AA 1YR0A 2EUIA 2REEA 4R3LA 1AYEA 4ONWA 5JGFA 3CPXA 3KI9A 3NFZA 3KL9A 4UWIA 1NSLA 4AXVA 6CPAA 3WT4A 2YNCC 3FRMA 3KKWA 4JXRA 1XEBA 1Z8XA 2B4DA 4X2TA 4L8AA 2IQ6A 5HVFA 2AFUA 1AMPA 2ZW6A 1R43A 3PRTA 2PJ0A 2AJ6A 2DEAA 4MFQA 1YK3A 3EXNA 5F09A 2DF5A 3FF3A 3DDDA 4LQGA 2RC4A 3P2HA 5K8MA 2BUEA 2V8GA 3LD2A 5KTCA 2Q43A 1VGYA 1ZG7A 2Q4VA 2HV2A 4OC0A 3HUVA 5H84A 4R3KA 4PXEA 5AG7A 2Q4YA 3OWCA 2B5GA 2Z3MA 1DTDA 4FD6A 4OC5A 4X5KA 5ELYA 1Z5RA 1S7KA 5K8OA 2Q7SA 2VXKA 4AG7A 4CPAA 3EFAA 3IC1A 2YNDA 1Q2CA 1SQHA 3KZWA 3I9SA 7CPAA 1LOKA 2CIJA 2G9DA 4MJ8A 3VWDA 2FXFA 3TO9A 4CYPA 3V38A 3JUWA 4HPSA 1YMEA 3GY9A 1JQGA 1ZLIA 1IB1E 2EO8A 3SJXA 3GUXA 1YVOA 4C68A 3L2NA 4MFZA 3NH4A 3V7ZA 3PB7X 2VZZA 4M6HA 4QVTA 1TKFA 1M4IA 1XJOA 2I3CA 3FXTA 2BEIA 4H89A 4IAVA 2ZPAA 2VBQA 4B10A 2DPSA 5KTAA 3BI0A 2QYVA 4C7IA 2NYQA 2ZEGA 3IGRA 4P6YA 3RBUA 3R9FA 4KUBA 3D3SA 4K3NA 4MMOA 5D8NA 2F7VA 4B5PA 5A28A 1Y9WA 2FS5A 3R9EA 1XOVA 1CBXA 5A27A 4JYWA 3S6KA 2ZEEA 1AUGA 5AGEA 5C88A 3KR4A 3NA6A 4KOYA 4FD4A 4KSIA 1IYLA 2AFSA 3EY5A 3T8WA 2R8VA 2Z3KA 2PJ3A 5CNPA 2CY2A 4BBHA 2PCUA 1IY7A 2ARHA 2F5IA 2FL4A 3IO1A 4FD5A 2HUZA 2D4PA 4P4FA 4P45A 4EWTA 4Q7AA 4A39A 4OP4A 3NE8A 4GM5A 2X7BA 2B58A 4O23A 4P10A 2AFZA 2JLMA 2AE6A 3FJUA 1FY7A 4NGRA 4DJLA 5E96A 2J8MA 1XMTA 2P6FA 3VH9A 4CS0B 1BLLE 1Y0RA 4MRIA 3CZXA 4MCQA 3W6XA 2H5MA 4X8IA 2BSWA 4KUAA 4AVAA 3B3CA 2C27A 3B3TA 1XMBA 1ARLA 2Q0YA 3IU1A 3IWEA 3LWUA 1M1DA 4ZYQA 2B3VA 3JRUA 2ANPA 2G3AA 4UFXA 4IK2A 2RFHA 4KLVA 3RZAA 4XNHC 4JXQA 4KVME 3QAHA 5EBVA 1Z4EA 2QMLA 8CPAA 2P6EA 4IF5A 4M85A 1N71A 2CNSA 4C2ZA 4NSQA 5J1QA 1M4DA 3TT2A 4UFVA 4UA3A 3FB3A 1S7LA 1QSRA 2O4HA 1YLEA 4H6UA 4MCSA 4PV6A 4TWEA 3WC5A 2Z3OA 1YW4A 2C6PA 4UEZA 3MRUA 2YGWA 5DS0A 1IIDA 4E8OA 5HVHA 2PC1A 3K2KA 2G0BA 1MJAA 1X10A 4AVBA 4F9VA 2G3TA 5D29A 2JEWA 3R9GA 5IX3A 2VEZA 1QSMA 1YX0A 2Z3LA 1KZFA 2PIZA 4ZX8A 4NFRA 1VHSA 4PXBA 3TE4A 3I3GA 5LYDA 3FH4A 2FT0A 3H5ZA 3F8KA 3DNSA 3PEIA 5THWA 1LRZA 3GIUA 4KOXA 1CG2A 5LRGA 3RNZA 4A38A 5KTDA 2QJ8A 5ISVA 1PUAA 2QIRA 3TC8A 2DXQA 4CGPA 2D4OA 1VIXA 2OZHA 4UCMA 1HDUA 5K8PA 4FUUA 4HKFA 2ODFA 3ISZA 1NMTA 1P4NA 2Z0ZA 1Z2LA 3R1KA 1CM0A 2A4NA 2CF4A 2OB0A 3JVNA 4K30A 1BPMA 1ARMA 1WWZA 2Q04A 2PJAA 3H8GA 5IB9A 4FWUA 4OC4A 4FAIA 4F9UA 1CP6A 2PIYA 3A9LA 1Z8LA 3W6SA 1H8LA 4ONUA 1KUVA 2R1IA 4KLWA 4PXCA 4MXUA 4CYQA 4J3GA 4JWPA 1NSAA 2WYRA 4AVCA 3K9TA 1CPXA 4MBUA 1QSTA 4P44A 1GYTA 2ZEHA 5I0CA 3KASA 3D2PA 1QSOA 2B4DB 4G1PA 3TOBA 2P0WA 4KVXA 2OH1A 3VWEA 1RTQA 3FMCA 3SHPA 1M44A 2ZOGA 3LODA 4U9ZA 3F5BA 4FBEA 3B8GA 4B11A 2B3UA 2QVPA 2HB6A 4WJBA 2PJ5A 4ORFA 4B12A 1HEEA 4XPLA 3D7GA 4NF1A 1I1DA 1VHOA 5F48A 2AFMA 2Z10A 2ZEPA 1LANA 1CJWA 2JDCA 4PQAA 4RI1A 4ZBGA 3VARA 3KQXA 3T90A 3RAMA 3I1UA 4UEFA 1KUXA 1PYTB 4AB7A 1Z9UA 4B13A 1YLOA 3MN8A 4YWYA 4X3RA 4CYNA 2AFWA 3PB8X 4KOUA 2R98A 1M4GA 2QECA 3B35A 4CAVA 1TIQA 3S6FA 4ZY1A 2OOTA 2Z3NA 5LYIA 3G3SA 4OC1A 4DNCA 2ZENA 2V8DA 1PU9A 3D7HA 1I12A 4A94A 2CXAA 2PJ1A 2Q4ZA 5HMNA 4XPDB 5K8NA 4A31A 2FSRA 2NSMA 2ZEFA 4QB9A 4XNHB 2EVNA 2PDOA 4L89A 4MFPA 1YVKA 4NGTA 4XPKA 3D68A 4B14A 5LRKA 2GANA 2POKA 4NGNA 2JEVA 2GFQA 2F8HA 5FVJA 4KOVA 2C6GA 4KZTA 5JPHA 4F0XA 1K4JA 2EK9A 4PK2A 3RO0A 3TCVA 5CBMA 2GIVA 3JTKA 3BHXA 2P6GA 1CP7A 1ELMP 2OZUA 2PJ6A 2C6CA 1IOFA 1MJBA 4R8FA 3FX6A 1JWQA 4CRZB 1S3ZA 2FIAA 4KVOE 4UIBA 4NCZA 2J8RA 5G22A 3H4QA 5IV0A 3PB6X 3IU2A 4NGSA 4PSWA 3G8WA 4XPDC 3NE7A 2OU2A 3IJ3A 5BWAB 1F2PA 2PVVA 4W9YA 2GLFA 1R3NA 2V77A 2YNCA 4ZI6A 1U6MA 4QC6A 4A32A 5HXDA 4JJXA 3TO6A 5HVGA 1BAVA 2GLJA 1Z4RA 3CXSA 4PXDA 3RYOA 3S6HA 3WC7A 4B6ZA 4CGMA 5DWMA 4RUHA 3B3VA 4CAEA 4P4BA 4QUSA 4CGLA 3QNVA 4MCRA 3FECA 3DR8A 2CNTA 3WC6A 3CXPA 2REFA 4UF4A 4Z65A 4ZX9A 1UWYA 3KGQA 2NMTA 3FVLA 4OIDA 2XEFA 5LYLA 4M6GA 4MHDA 1M4LA 4UWJA 1FNOA 4F0YA 1WK4A 1CX8A 3SJFA 3K9UA 2BO9A 3N7ZA 4PSXA 3WR7A 4FD7A 1NE9A 5EC4A 5H86A 2VL1A 3BJ7A 2Y0MA 4UCPA 5AG6A 1BO4A 1BOBA 3VATA 3UY5A 1IYKA 1IOIA 1Q2YA 2GU2A 1B6BA 3D67A 4EFDA 4U5YA 1Y7RA 3D2MA 3EC4A 4U9YA 1Y7EA 3FYNA 1XIXA 4JLYA 3W91A 1A2ZA 4NEXA 2XEIA 3FNCA 3D4UA 4HNWB 3FEDA 4GXHA 5F49A 3FIXA 4P4EA 4OLLA 3SI0A 3TFYA 4C7HA 4I49A 4QBJA 4Q38A 1ELLP 2PR1A 2PSWA 2AFXA 3NH5A 2BL1A 4PPZA 2ZOFA 3SJEA 4WWVA 2CTBA 2ZW5A 1QSNA 4BD9A 3MGDA 3D8PA 1EE3P 1HDQA 1XE4A 2PJ9A 4YU9A 3B7IA 5CPAA 1RO5A 5F46A 3D66A 4OMEA 1CPSA 1QQ9A 4OIWA 5AG5A 3CXQA 1S60A 1YQEA 3PB4X 4LX9A 4DUKA 2J9AA 5AG4A 1FT7A 4EVYA 4H2KA 1VHEA 4KOWA 2Q7BA 3E0KA 3BJ8A 2VZYA 2AFOA 4NGQA 2O53A 3NH8A 3WABA 2K5TA 3S9NA 1L0CA 1TXRA 4R76A 1S7FA 4GS4A 4KORA 3ZZIA 3DR6A 3GYAA 1IICA 3SXNA 1TKJA 3IWGA 3H8EA 2GREA 4LUAA 1IGBA 2O28A 1Q2DA 1LCPA 4MI4A 1Y9KA 3R96A 5JH9A 1TF8A 4BINA 2VI7A 2V8VA 1OZPA 1TF9A 4KOSA 3S9MA 3DGVA 3R95A 2RB7A 2FE7A 3GLJA 2JDDA 4MHZA 4Y49C 3TTHA 4HNYB 4ZY2A 4C2XA 3LMSA 4YRHA 4A33A 1Z8WA 5C82A 4HNXB 5J8CA 1UFHA 2PJ4A 2ZW7A 4H6ZA 2WSAA 2HQYA 3P2FA 2ZEMA 4DYOA 4PK3A 1Y0YA 3B2YA 4KSFA 1DE4C 1P0HA 3D7FA 1KWMA 4YFJA 1MJ9A 2PE3A 1ZG8A 2CTCA 2WZNA 4P4JA 2B5GB 4UFWA 1V0CA 4MHPA 2PVWA 3GB0A 5HH1A 3PFOA 4KS9A 2JBKA 2BCOA 4MCPA 3HLPA 3ISXA 1YGHA 4KSAA 4M3SA 2FIWA 3SI2A 4KOTA 4ZGYB 2PJCA 4CYOA 5GCNA 2CNMA 3IIBA 1J4JA 3D7DA 1RXTA 3T9YA 4CAXA 3TO7A 4IHMA 2DPTA 1TKHA 2I00A 4R87A 2I79A 5JQ4A 1GHEA 2VQYA 1XF8A 4ZY0A 2XEJA 2WPXA 4OADA
chains in the Genus database with same CATH topology
4II9A 4B5OA 2B4BA 4RS2A 5G20A 2GE3A 2ATRA 2WUUA 4CAFA 4JD6A 4R9MA 4B5PB 4OAEA 2FCKA 2IL4A 3TOAA 2PR8A 5G21A 4CGNA 3F0AA 3PGPA 2J8NA 4MFKA 5J8FA 1ZO0A 5G1ZA 1KUYA 4MY3A 3FBUA 4Q36A 4F6AA 3PZJA 3PP9A 4UCNA 3S6GA 5F47A 3C26A 4A30A 2Q44A 4C2YA 4AG9A 1S7NA 1ON0A 3DSBA 5DWNA 3V8IA 4A2ZA 4MFJA 1YREA 4IUSA 1R57A 2Z3PA 4YGOA 4CGOA 3SXOA 5IB0A 2OZGA 2WPWA 3BLNA 4UBRA 1VKCA 4CAWA 3EO4A 4CRYB 4MFLA 1MK4A 1I21A 2KCWA 2PQ8A 4NXYA 2PRBA 4E2AA 4BMHA 2R7HA 3QB8A 2Z11A 2YNEA 2ZXVA 1S5KA 3GKRA 3ZJ0A 1B87A 4A95A 2ZW4A 4Y49B 4MY0A 4R57A 4E0AA 1YR0A 2EUIA 2REEA 4R3LA 1NSLA 4UWIA 2YNCC 3FRMA 3KKWA 4JXRA 1XEBA 2B4DA 4L8AA 2ZW6A 2AJ6A 4MFQA 1YK3A 3EXNA 3DDDA 2RC4A 3P2HA 5KTCA 2BUEA 3LD2A 2Q4VA 2HV2A 5H84A 4R3KA 5AG7A 2Q4YA 3OWCA 2B5GA 2Z3MA 4FD6A 4X5KA 1S7KA 2VXKA 4AG7A 3EFAA 2YNDA 1Q2CA 1SQHA 3I9SA 4MJ8A 3VWDA 2FXFA 3TO9A 4CYPA 3JUWA 3GY9A 1IB1E 1YVOA 4C68A 4MFZA 2VZZA 4QVTA 1M4IA 3FXTA 4H89A 2BEIA 4B10A 2ZPAA 2VBQA 2DPSA 5KTAA 4C7IA 3IGRA 3R9FA 4KUBA 3D3SA 4B5PA 5A28A 1Y9WA 2FS5A 3R9EA 5A27A 3S6KA 5AGEA 5C88A 4KOYA 4FD4A 1IYLA 3EY5A 2R8VA 2Z3KA 5CNPA 2CY2A 4BBHA 2ARHA 2F5IA 2FL4A 4FD5A 2HUZA 2D4PA 2X7BA 2B58A 2JLMA 2AE6A 1FY7A 5E96A 2J8MA 1XMTA 2P6FA 4CS0B 3W6XA 2H5MA 2BSWA 4KUAA 4AVAA 2C27A 2Q0YA 3IU1A 3IWEA 1M1DA 2B3VA 2G3AA 4UFXA 4KLVA 4XNHC 4JXQA 4KVME 3QAHA 5EBVA 1Z4EA 2QMLA 2P6EA 4IF5A 4M85A 1N71A 2CNSA 4C2ZA 4NSQA 1M4DA 3TT2A 4UFVA 4UA3A 3FB3A 1S7LA 1QSRA 1YLEA 4H6UA 4PV6A 2Z3OA 2YGWA 1IIDA 4E8OA 2PC1A 2G0BA 1MJAA 4AVBA 2G3TA 3R9GA 5IX3A 2VEZA 1QSMA 2Z3LA 1YX0A 1KZFA 1VHSA 3TE4A 3I3GA 2FT0A 3H5ZA 3F8KA 3DNSA 1LRZA 4KOXA 5KTDA 5ISVA 1PUAA 2QIRA 2DXQA 4CGPA 2D4OA 2OZHA 4UCMA 4HKFA 1NMTA 1P4NA 2Z0ZA 3R1KA 1CM0A 2A4NA 2OB0A 3JVNA 4K30A 1WWZA 2Q04A 3A9LA 3W6SA 4ONUA 4CYQA 1KUVA 2R1IA 4KLWA 4J3GA 4JWPA 4AVCA 4MBUA 1QSTA 5I0CA 3D2PA 1QSOA 2B4DB 3TOBA 2P0WA 4KVXA 2OH1A 3VWEA 3SHPA 1M44A 3LODA 4U9ZA 3F5BA 3B8GA 4B11A 2B3UA 4ORFA 4B12A 4XPLA 4NF1A 1I1DA 5F48A 2Z10A 1CJWA 2JDCA 4RI1A 4ZBGA 3T90A 1KUXA 4AB7A 1Z9UA 4B13A 4CYNA 4KOUA 2R98A 1M4GA 2QECA 4CAVA 1TIQA 3S6FA 2Z3NA 3G3SA 4DNCA 1PU9A 1I12A 2CXAA 5HMNA 4XPDB 4A31A 2FSRA 4QB9A 4XNHB 2EVNA 2PDOA 4L89A 4MFPA 1YVKA 4XPKA 4B14A 2GANA 2JEVA 5FVJA 4KOVA 4KZTA 5JPHA 4F0XA 1K4JA 4PK2A 3TCVA 2GIVA 3JTKA 2P6GA 2OZUA 1MJBA 4CRZB 1S3ZA 2FIAA 4KVOE 4NCZA 2J8RA 5G22A 3H4QA 5IV0A 3IU2A 4PSWA 3G8WA 4XPDC 3NE7A 2OU2A 5BWAB 2YNCA 1U6MA 4QC6A 4A32A 4JJXA 3TO6A 4CGMA 1Z4RA 3CXSA 3S6HA 3RYOA 5DWMA 4CAEA 4QUSA 4CGLA 3DR8A 2CNTA 3CXPA 2REFA 2NMTA 4MHDA 4UWJA 4F0YA 1WK4A 3K9UA 3N7ZA 4PSXA 3WR7A 4FD7A 1NE9A 5EC4A 5H86A 3BJ7A 2Y0MA 4UCPA 5AG6A 1BO4A 1BOBA 3UY5A 1IYKA 1Q2YA 1B6BA 4U5YA 1Y7RA 3D2MA 3EC4A 4U9YA 3FYNA 1XIXA 4JLYA 3W91A 4NEXA 3FNCA 4HNWB 5F49A 3FIXA 4OLLA 3TFYA 4C7HA 4I49A 4QBJA 4Q38A 2PR1A 2PSWA 2BL1A 2ZW5A 1QSNA 3MGDA 3D8PA 1XE4A 5F46A 1RO5A 5AG5A 3CXQA 1S60A 4LX9A 5AG4A 4EVYA 4KOWA 2Q7BA 3E0KA 3BJ8A 2VZYA 2K5TA 1L0CA 1S7FA 4GS4A 4KORA 3ZZIA 3DR6A 3GYAA 1IICA 3SXNA 3IWGA 4LUAA 2O28A 1Q2DA 4MI4A 1Y9KA 3R96A 2VI7A 1OZPA 4KOSA 3R95A 2FE7A 2JDDA 3TTHA 4Y49C 4HNYB 4C2XA 4YRHA 4A33A 5C82A 4HNXB 5J8CA 1UFHA 2ZW7A 4H6ZA 2WSAA 2HQYA 3P2FA 4PK3A 4KSFA 1P0HA 4YFJA 1MJ9A 2B5GB 4UFWA 1V0CA 5HH1A 4KS9A 1YGHA 4KSAA 4M3SA 2FIWA 4KOTA 4ZGYB 4CYOA 5GCNA 2CNMA 1J4JA 1RXTA 3T9YA 4CAXA 3TO7A 2DPTA 2I00A 4R87A 2I79A 5JQ4A 1GHEA 2VQYA 1XF8A 2WPXA 4OADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B14 A;  4C7I A;  2WSA A;  5G1Z A;  4CGM A;  4CYQ A;  2YNC C;  5G20 A;  4CAE A;  4CGL A;  3H5Z A;  4B13 A;  4C2Z A;  5A28 A;  4UFW A;  2WUU A;  4CYN A;  4C7H A;  4UCN A;  2YND A;  4CAF A;  5A27 A;  3JTK A;  4UFV A;  5AGE A;  4CGP A;  4A30 A;  4CYP A;  4UCM A;  4C2Y A;  4CYO A;  2YNE A;  3IU1 A;  3IWE A;  5G22 A;  4A95 A;  4BBH A;  3IU2 A;  5AG6 A;  4UCP A;  4B11 A;  4A2Z A;  4C68 A;  4UFX A;  4A31 A;  5G21 A;  4B12 A;  4CGN A;  4C2X A;  5AG5 A;  4CGO A;  4A33 A;  4B10 A;  2YNC A;  5AG7 A;  4A32 A;  5AG4 A; 
#chains in the Genus database with same CATH topology
 4JZ0 A;  1ZLH A;  4II9 A;  3TX8 A;  4B5O A;  2B4B A;  4RS2 A;  5G20 A;  2GE3 A;  1LFW A;  2ATR A;  2WUU A;  1ZG9 A;  4F8Z A;  1LAM A;  1XFO A;  3CDX A;  4CAF A;  4EME A;  3IFE A;  2EWB A;  4JD6 A;  1F2O A;  4NGM A;  4R9M A;  4B5P B;  4UIA A;  1IU8 A;  2EK8 A;  1Q7L A;  3PB9 X;  1Z8T A;  2ABZ A;  4MHY A;  3PFE A;  4MHN A;  1YSJ A;  4OAE A;  2FCK A;  2IL4 A;  2JBJ A;  3TOA A;  2PR8 A;  5G21 A;  3SJG A;  4CGN A;  3CT9 A;  3F0A A;  4OKO A;  3QAY A;  3KHX A;  3PGP A;  2J8N A;  4MFK A;  5J8F A;  3H8F A;  1ZO0 A;  1OBR A;  5G1Z A;  4NGP A;  2HC9 A;  1KUY A;  4MY3 A;  5LRJ A;  4R7M A;  2PJ8 A;  2IJZ A;  3FBU A;  4Q36 A;  5LYF A;  4F6A A;  5I4M A;  2BOA A;  3KR5 A;  1BPN A;  3PP9 A;  3PZJ A;  2V8H A;  3KQZ A;  4UCN A;  3B3S A;  4UEE A;  1F57 A;  3S6G A;  5F47 A;  3N5F A;  3C26 A;  4A30 A;  1XBU A;  2Q44 A;  4M6I A;  4C2Y A;  4AG9 A;  1S7N A;  4OC2 A;  1ON0 A;  3DSB A;  2XEG A;  3S9L A;  5DWN A;  3V8I A;  2PJ2 A;  4A2Z A;  4A37 A;  3DLJ A;  4LQ6 A;  1YW6 A;  4MFJ A;  1YRE A;  2ZED A;  4IUS A;  1R57 A;  2Z3P A;  4YGO A;  4OC3 A;  4CGO A;  2IMO A;  3FEE A;  3SXO A;  5IB0 A;  2OZG A;  2WPW A;  3BLN A;  3KHZ A;  4UBR A;  3LAC A;  5JM6 A;  3SI1 A;  4NJR A;  1VKC A;  2FVG A;  2PJ7 A;  4NJQ A;  4CAW A;  3IWW A;  3CPA A;  3IEH A;  5EMI A;  2Q51 A;  3EO4 A;  1QMU A;  4CRY B;  4RN7 A;  4MFL A;  1MK4 A;  1I21 A;  2KCW A;  2OR4 A;  2PQ8 A;  3PBE A;  2EBJ A;  4NXY A;  2PRB A;  2C1C A;  3BI1 A;  4E2A A;  1LAP A;  4BMH A;  2R7H A;  2ZEL A;  2Z11 A;  1XRY A;  2YNE A;  2ZXV A;  2PJB A;  1S5K A;  3BXM A;  3GKR A;  1B87 A;  3QB8 A;  3ZJ0 A;  4A95 A;  4P4D A;  1PCA A;  4TNU A;  1X12 A;  2ZW4 A;  4Y49 B;  4MY0 A;  2PRQ A;  2ZEO A;  4P4I A;  3PBB A;  4R57 A;  4R6T A;  3B3W A;  4E0A A;  1YR0 A;  2EUI A;  2REE A;  4R3L A;  1AYE A;  4ONW A;  5JGF A;  3CPX A;  3KI9 A;  3NFZ A;  3KL9 A;  4UWI A;  1NSL A;  4AXV A;  6CPA A;  3WT4 A;  2YNC C;  3FRM A;  3KKW A;  4JXR A;  1XEB A;  1Z8X A;  2B4D A;  4X2T A;  4L8A A;  2IQ6 A;  5HVF A;  2AFU A;  1AMP A;  2ZW6 A;  1R43 A;  3PRT A;  2PJ0 A;  2AJ6 A;  2DEA A;  4MFQ A;  1YK3 A;  3EXN A;  5F09 A;  2DF5 A;  3FF3 A;  3DDD A;  4LQG A;  2RC4 A;  3P2H A;  5K8M A;  2BUE A;  2V8G A;  3LD2 A;  5KTC A;  2Q43 A;  1VGY A;  1ZG7 A;  2Q4V A;  2HV2 A;  4OC0 A;  3HUV A;  5H84 A;  4R3K A;  4PXE A;  5AG7 A;  2Q4Y A;  3OWC A;  2B5G A;  2Z3M A;  1DTD A;  4FD6 A;  4OC5 A;  4X5K A;  5ELY A;  1Z5R A;  1S7K A;  5K8O A;  2Q7S A;  2VXK A;  4AG7 A;  4CPA A;  3EFA A;  3IC1 A;  2YND A;  1Q2C A;  1SQH A;  3KZW A;  3I9S A;  7CPA A;  1LOK A;  2CIJ A;  2G9D A;  4MJ8 A;  3VWD A;  2FXF A;  3TO9 A;  4CYP A;  3V38 A;  3JUW A;  4HPS A;  1YME A;  3GY9 A;  1JQG A;  1ZLI A;  1IB1 E;  2EO8 A;  3SJX A;  3GUX A;  1YVO A;  4C68 A;  3L2N A;  4MFZ A;  3NH4 A;  3V7Z A;  3PB7 X;  2VZZ A;  4M6H A;  4QVT A;  1TKF A;  1M4I A;  1XJO A;  2I3C A;  3FXT A;  2BEI A;  4H89 A;  4IAV A;  2ZPA A;  2VBQ A;  4B10 A;  2DPS A;  5KTA A;  3BI0 A;  2QYV A;  4C7I A;  2NYQ A;  2ZEG A;  3IGR A;  4P6Y A;  3RBU A;  3R9F A;  4KUB A;  3D3S A;  4K3N A;  4MMO A;  5D8N A;  2F7V A;  4B5P A;  5A28 A;  1Y9W A;  2FS5 A;  3R9E A;  1XOV A;  1CBX A;  5A27 A;  4JYW A;  3S6K A;  2ZEE A;  1AUG A;  5AGE A;  5C88 A;  3KR4 A;  3NA6 A;  4KOY A;  4FD4 A;  4KSI A;  1IYL A;  2AFS A;  3EY5 A;  3T8W A;  2R8V A;  2Z3K A;  2PJ3 A;  5CNP A;  2CY2 A;  4BBH A;  2PCU A;  1IY7 A;  2ARH A;  2F5I A;  2FL4 A;  3IO1 A;  4FD5 A;  2HUZ A;  2D4P A;  4P4F A;  4P45 A;  4EWT A;  4Q7A A;  4A39 A;  4OP4 A;  3NE8 A;  4GM5 A;  2X7B A;  2B58 A;  4O23 A;  4P10 A;  2AFZ A;  2JLM A;  2AE6 A;  3FJU A;  1FY7 A;  4NGR A;  4DJL A;  5E96 A;  2J8M A;  1XMT A;  2P6F A;  3VH9 A;  4CS0 B;  1BLL E;  1Y0R A;  4MRI A;  3CZX A;  4MCQ A;  3W6X A;  2H5M A;  4X8I A;  2BSW A;  4KUA A;  4AVA A;  3B3C A;  2C27 A;  3B3T A;  1XMB A;  1ARL A;  2Q0Y A;  3IU1 A;  3IWE A;  3LWU A;  1M1D A;  4ZYQ A;  2B3V A;  3JRU A;  2ANP A;  2G3A A;  4UFX A;  4IK2 A;  2RFH A;  4KLV A;  3RZA A;  4XNH C;  4JXQ A;  4KVM E;  3QAH A;  5EBV A;  1Z4E A;  2QML A;  8CPA A;  2P6E A;  4IF5 A;  4M85 A;  1N71 A;  2CNS A;  4C2Z A;  4NSQ A;  5J1Q A;  1M4D A;  3TT2 A;  4UFV A;  4UA3 A;  3FB3 A;  1S7L A;  1QSR A;  2O4H A;  1YLE A;  4H6U A;  4MCS A;  4PV6 A;  4TWE A;  3WC5 A;  2Z3O A;  1YW4 A;  2C6P A;  4UEZ A;  3MRU A;  2YGW A;  5DS0 A;  1IID A;  4E8O A;  5HVH A;  2PC1 A;  3K2K A;  2G0B A;  1MJA A;  1X10 A;  4AVB A;  4F9V A;  2G3T A;  5D29 A;  2JEW A;  3R9G A;  5IX3 A;  2VEZ A;  1QSM A;  1YX0 A;  2Z3L A;  1KZF A;  2PIZ A;  4ZX8 A;  4NFR A;  1VHS A;  4PXB A;  3TE4 A;  3I3G A;  5LYD A;  3FH4 A;  2FT0 A;  3H5Z A;  3F8K A;  3DNS A;  3PEI A;  5THW A;  1LRZ A;  3GIU A;  4KOX A;  1CG2 A;  5LRG A;  3RNZ A;  4A38 A;  5KTD A;  2QJ8 A;  5ISV A;  1PUA A;  2QIR A;  3TC8 A;  2DXQ A;  4CGP A;  2D4O A;  1VIX A;  2OZH A;  4UCM A;  1HDU A;  5K8P A;  4FUU A;  4HKF A;  2ODF A;  3ISZ A;  1NMT A;  1P4N A;  2Z0Z A;  1Z2L A;  3R1K A;  1CM0 A;  2A4N A;  2CF4 A;  2OB0 A;  3JVN A;  4K30 A;  1BPM A;  1ARM A;  1WWZ A;  2Q04 A;  2PJA A;  3H8G A;  5IB9 A;  4FWU A;  4OC4 A;  4FAI A;  4F9U A;  1CP6 A;  2PIY A;  3A9L A;  1Z8L A;  3W6S A;  1H8L A;  4ONU A;  1KUV A;  2R1I A;  4KLW A;  4PXC A;  4MXU A;  4CYQ A;  4J3G A;  4JWP A;  1NSA A;  2WYR A;  4AVC A;  3K9T A;  1CPX A;  4MBU A;  1QST A;  4P44 A;  1GYT A;  2ZEH A;  5I0C A;  3KAS A;  3D2P A;  1QSO A;  2B4D B;  4G1P A;  3TOB A;  2P0W A;  4KVX A;  2OH1 A;  3VWE A;  1RTQ A;  3FMC A;  3SHP A;  1M44 A;  2ZOG A;  3LOD A;  4U9Z A;  3F5B A;  4FBE A;  3B8G A;  4B11 A;  2B3U A;  2QVP A;  2HB6 A;  4WJB A;  2PJ5 A;  4ORF A;  4B12 A;  1HEE A;  4XPL A;  3D7G A;  4NF1 A;  1I1D A;  1VHO A;  5F48 A;  2AFM A;  2Z10 A;  2ZEP A;  1LAN A;  1CJW A;  2JDC A;  4PQA A;  4RI1 A;  4ZBG A;  3VAR A;  3KQX A;  3T90 A;  3RAM A;  3I1U A;  4UEF A;  1KUX A;  1PYT B;  4AB7 A;  1Z9U A;  4B13 A;  1YLO A;  3MN8 A;  4YWY A;  4X3R A;  4CYN A;  2AFW A;  3PB8 X;  4KOU A;  2R98 A;  1M4G A;  2QEC A;  3B35 A;  4CAV A;  1TIQ A;  3S6F A;  4ZY1 A;  2OOT A;  2Z3N A;  5LYI A;  3G3S A;  4OC1 A;  4DNC A;  2ZEN A;  2V8D A;  1PU9 A;  3D7H A;  1I12 A;  4A94 A;  2CXA A;  2PJ1 A;  2Q4Z A;  5HMN A;  4XPD B;  5K8N A;  4A31 A;  2FSR A;  2NSM A;  2ZEF A;  4QB9 A;  4XNH B;  2EVN A;  2PDO A;  4L89 A;  4MFP A;  1YVK A;  4NGT A;  4XPK A;  3D68 A;  4B14 A;  5LRK A;  2GAN A;  2POK A;  4NGN A;  2JEV A;  2GFQ A;  2F8H A;  5FVJ A;  4KOV A;  2C6G A;  4KZT A;  5JPH A;  4F0X A;  1K4J A;  2EK9 A;  4PK2 A;  3RO0 A;  3TCV A;  5CBM A;  2GIV A;  3JTK A;  3BHX A;  2P6G A;  1CP7 A;  1ELM P;  2OZU A;  2PJ6 A;  2C6C A;  1IOF A;  1MJB A;  4R8F A;  3FX6 A;  1JWQ A;  4CRZ B;  1S3Z A;  2FIA A;  4KVO E;  4UIB A;  4NCZ A;  2J8R A;  5G22 A;  3H4Q A;  5IV0 A;  3PB6 X;  3IU2 A;  4NGS A;  4PSW A;  3G8W A;  4XPD C;  3NE7 A;  2OU2 A;  3IJ3 A;  5BWA B;  1F2P A;  2PVV A;  4W9Y A;  2GLF A;  1R3N A;  2V77 A;  2YNC A;  4ZI6 A;  1U6M A;  4QC6 A;  4A32 A;  5HXD A;  4JJX A;  3TO6 A;  5HVG A;  1BAV A;  2GLJ A;  1Z4R A;  3CXS A;  4PXD A;  3RYO A;  3S6H A;  3WC7 A;  4B6Z A;  4CGM A;  5DWM A;  4RUH A;  3B3V A;  4CAE A;  4P4B A;  4QUS A;  4CGL A;  3QNV A;  4MCR A;  3FEC A;  3DR8 A;  2CNT A;  3WC6 A;  3CXP A;  2REF A;  4UF4 A;  4Z65 A;  4ZX9 A;  1UWY A;  3KGQ A;  2NMT A;  3FVL A;  4OID A;  2XEF A;  5LYL A;  4M6G A;  4MHD A;  1M4L A;  4UWJ A;  1FNO A;  4F0Y A;  1WK4 A;  1CX8 A;  3SJF A;  3K9U A;  2BO9 A;  3N7Z A;  4PSX A;  3WR7 A;  4FD7 A;  1NE9 A;  5EC4 A;  5H86 A;  2VL1 A;  3BJ7 A;  2Y0M A;  4UCP A;  5AG6 A;  1BO4 A;  1BOB A;  3VAT A;  3UY5 A;  1IYK A;  1IOI A;  1Q2Y A;  2GU2 A;  1B6B A;  3D67 A;  4EFD A;  4U5Y A;  1Y7R A;  3D2M A;  3EC4 A;  4U9Y A;  1Y7E A;  3FYN A;  1XIX A;  4JLY A;  3W91 A;  1A2Z A;  4NEX A;  2XEI A;  3FNC A;  3D4U A;  4HNW B;  3FED A;  4GXH A;  5F49 A;  3FIX A;  4P4E A;  4OLL A;  3SI0 A;  3TFY A;  4C7H A;  4I49 A;  4QBJ A;  4Q38 A;  1ELL P;  2PR1 A;  2PSW A;  2AFX A;  3NH5 A;  2BL1 A;  4PPZ A;  2ZOF A;  3SJE A;  4WWV A;  2CTB A;  2ZW5 A;  1QSN A;  4BD9 A;  3MGD A;  3D8P A;  1EE3 P;  1HDQ A;  1XE4 A;  2PJ9 A;  4YU9 A;  3B7I A;  5CPA A;  1RO5 A;  5F46 A;  3D66 A;  4OME A;  1CPS A;  1QQ9 A;  4OIW A;  5AG5 A;  3CXQ A;  1S60 A;  1YQE A;  3PB4 X;  4LX9 A;  4DUK A;  2J9A A;  5AG4 A;  1FT7 A;  4EVY A;  4H2K A;  1VHE A;  4KOW A;  2Q7B A;  3E0K A;  3BJ8 A;  2VZY A;  2AFO A;  4NGQ A;  2O53 A;  3NH8 A;  3WAB A;  2K5T A;  3S9N A;  1L0C A;  1TXR A;  4R76 A;  1S7F A;  4GS4 A;  4KOR A;  3ZZI A;  3DR6 A;  3GYA A;  1IIC A;  3SXN A;  1TKJ A;  3IWG A;  3H8E A;  2GRE A;  4LUA A;  1IGB A;  2O28 A;  1Q2D A;  1LCP A;  4MI4 A;  1Y9K A;  3R96 A;  5JH9 A;  1TF8 A;  4BIN A;  2VI7 A;  2V8V A;  1OZP A;  1TF9 A;  4KOS A;  3S9M A;  3DGV A;  3R95 A;  2RB7 A;  2FE7 A;  3GLJ A;  2JDD A;  4MHZ A;  4Y49 C;  3TTH A;  4HNY B;  4ZY2 A;  4C2X A;  3LMS A;  4YRH A;  4A33 A;  1Z8W A;  5C82 A;  4HNX B;  5J8C A;  1UFH A;  2PJ4 A;  2ZW7 A;  4H6Z A;  2WSA A;  2HQY A;  3P2F A;  2ZEM A;  4DYO A;  4PK3 A;  1Y0Y A;  3B2Y A;  4KSF A;  1DE4 C;  1P0H A;  3D7F A;  1KWM A;  4YFJ A;  1MJ9 A;  2PE3 A;  1ZG8 A;  2CTC A;  2WZN A;  4P4J A;  2B5G B;  4UFW A;  1V0C A;  4MHP A;  2PVW A;  3GB0 A;  5HH1 A;  3PFO A;  4KS9 A;  2JBK A;  2BCO A;  4MCP A;  3HLP A;  3ISX A;  1YGH A;  4KSA A;  4M3S A;  2FIW A;  3SI2 A;  4KOT A;  4ZGY B;  2PJC A;  4CYO A;  5GCN A;  2CNM A;  3IIB A;  1J4J A;  3D7D A;  1RXT A;  3T9Y A;  4CAX A;  3TO7 A;  4IHM A;  2DPT A;  1TKH A;  2I00 A;  4R87 A;  2I79 A;  5JQ4 A;  1GHE A;  2VQY A;  1XF8 A;  4ZY0 A;  2XEJ A;  2WPX A;  4OAD A; 
#chains in the Genus database with same CATH homology
 4II9 A;  4B5O A;  2B4B A;  4RS2 A;  5G20 A;  2GE3 A;  2ATR A;  2WUU A;  4CAF A;  4JD6 A;  4R9M A;  4B5P B;  4OAE A;  2FCK A;  2IL4 A;  3TOA A;  2PR8 A;  5G21 A;  4CGN A;  3F0A A;  3PGP A;  2J8N A;  4MFK A;  5J8F A;  1ZO0 A;  5G1Z A;  1KUY A;  4MY3 A;  3FBU A;  4Q36 A;  4F6A A;  3PZJ A;  3PP9 A;  4UCN A;  3S6G A;  5F47 A;  3C26 A;  4A30 A;  2Q44 A;  4C2Y A;  4AG9 A;  1S7N A;  1ON0 A;  3DSB A;  5DWN A;  3V8I A;  4A2Z A;  4MFJ A;  1YRE A;  4IUS A;  1R57 A;  2Z3P A;  4YGO A;  4CGO A;  3SXO A;  5IB0 A;  2OZG A;  2WPW A;  3BLN A;  4UBR A;  1VKC A;  4CAW A;  3EO4 A;  4CRY B;  4MFL A;  1MK4 A;  1I21 A;  2KCW A;  2PQ8 A;  4NXY A;  2PRB A;  4E2A A;  4BMH A;  2R7H A;  3QB8 A;  2Z11 A;  2YNE A;  2ZXV A;  1S5K A;  3GKR A;  3ZJ0 A;  1B87 A;  4A95 A;  2ZW4 A;  4Y49 B;  4MY0 A;  4R57 A;  4E0A A;  1YR0 A;  2EUI A;  2REE A;  4R3L A;  1NSL A;  4UWI A;  2YNC C;  3FRM A;  3KKW A;  4JXR A;  1XEB A;  2B4D A;  4L8A A;  2ZW6 A;  2AJ6 A;  4MFQ A;  1YK3 A;  3EXN A;  3DDD A;  2RC4 A;  3P2H A;  5KTC A;  2BUE A;  3LD2 A;  2Q4V A;  2HV2 A;  5H84 A;  4R3K A;  5AG7 A;  2Q4Y A;  3OWC A;  2B5G A;  2Z3M A;  4FD6 A;  4X5K A;  1S7K A;  2VXK A;  4AG7 A;  3EFA A;  2YND A;  1Q2C A;  1SQH A;  3I9S A;  4MJ8 A;  3VWD A;  2FXF A;  3TO9 A;  4CYP A;  3JUW A;  3GY9 A;  1IB1 E;  1YVO A;  4C68 A;  4MFZ A;  2VZZ A;  4QVT A;  1M4I A;  3FXT A;  4H89 A;  2BEI A;  4B10 A;  2ZPA A;  2VBQ A;  2DPS A;  5KTA A;  4C7I A;  3IGR A;  3R9F A;  4KUB A;  3D3S A;  4B5P A;  5A28 A;  1Y9W A;  2FS5 A;  3R9E A;  5A27 A;  3S6K A;  5AGE A;  5C88 A;  4KOY A;  4FD4 A;  1IYL A;  3EY5 A;  2R8V A;  2Z3K A;  5CNP A;  2CY2 A;  4BBH A;  2ARH A;  2F5I A;  2FL4 A;  4FD5 A;  2HUZ A;  2D4P A;  2X7B A;  2B58 A;  2JLM A;  2AE6 A;  1FY7 A;  5E96 A;  2J8M A;  1XMT A;  2P6F A;  4CS0 B;  3W6X A;  2H5M A;  2BSW A;  4KUA A;  4AVA A;  2C27 A;  2Q0Y A;  3IU1 A;  3IWE A;  1M1D A;  2B3V A;  2G3A A;  4UFX A;  4KLV A;  4XNH C;  4JXQ A;  4KVM E;  3QAH A;  5EBV A;  1Z4E A;  2QML A;  2P6E A;  4IF5 A;  4M85 A;  1N71 A;  2CNS A;  4C2Z A;  4NSQ A;  1M4D A;  3TT2 A;  4UFV A;  4UA3 A;  3FB3 A;  1S7L A;  1QSR A;  1YLE A;  4H6U A;  4PV6 A;  2Z3O A;  2YGW A;  1IID A;  4E8O A;  2PC1 A;  2G0B A;  1MJA A;  4AVB A;  2G3T A;  3R9G A;  5IX3 A;  2VEZ A;  1QSM A;  2Z3L A;  1YX0 A;  1KZF A;  1VHS A;  3TE4 A;  3I3G A;  2FT0 A;  3H5Z A;  3F8K A;  3DNS A;  1LRZ A;  4KOX A;  5KTD A;  5ISV A;  1PUA A;  2QIR A;  2DXQ A;  4CGP A;  2D4O A;  2OZH A;  4UCM A;  4HKF A;  1NMT A;  1P4N A;  2Z0Z A;  3R1K A;  1CM0 A;  2A4N A;  2OB0 A;  3JVN A;  4K30 A;  1WWZ A;  2Q04 A;  3A9L A;  3W6S A;  4ONU A;  4CYQ A;  1KUV A;  2R1I A;  4KLW A;  4J3G A;  4JWP A;  4AVC A;  4MBU A;  1QST A;  5I0C A;  3D2P A;  1QSO A;  2B4D B;  3TOB A;  2P0W A;  4KVX A;  2OH1 A;  3VWE A;  3SHP A;  1M44 A;  3LOD A;  4U9Z A;  3F5B A;  3B8G A;  4B11 A;  2B3U A;  4ORF A;  4B12 A;  4XPL A;  4NF1 A;  1I1D A;  5F48 A;  2Z10 A;  1CJW A;  2JDC A;  4RI1 A;  4ZBG A;  3T90 A;  1KUX A;  4AB7 A;  1Z9U A;  4B13 A;  4CYN A;  4KOU A;  2R98 A;  1M4G A;  2QEC A;  4CAV A;  1TIQ A;  3S6F A;  2Z3N A;  3G3S A;  4DNC A;  1PU9 A;  1I12 A;  2CXA A;  5HMN A;  4XPD B;  4A31 A;  2FSR A;  4QB9 A;  4XNH B;  2EVN A;  2PDO A;  4L89 A;  4MFP A;  1YVK A;  4XPK A;  4B14 A;  2GAN A;  2JEV A;  5FVJ A;  4KOV A;  4KZT A;  5JPH A;  4F0X A;  1K4J A;  4PK2 A;  3TCV A;  2GIV A;  3JTK A;  2P6G A;  2OZU A;  1MJB A;  4CRZ B;  1S3Z A;  2FIA A;  4KVO E;  4NCZ A;  2J8R A;  5G22 A;  3H4Q A;  5IV0 A;  3IU2 A;  4PSW A;  3G8W A;  4XPD C;  3NE7 A;  2OU2 A;  5BWA B;  2YNC A;  1U6M A;  4QC6 A;  4A32 A;  4JJX A;  3TO6 A;  4CGM A;  1Z4R A;  3CXS A;  3S6H A;  3RYO A;  5DWM A;  4CAE A;  4QUS A;  4CGL A;  3DR8 A;  2CNT A;  3CXP A;  2REF A;  2NMT A;  4MHD A;  4UWJ A;  4F0Y A;  1WK4 A;  3K9U A;  3N7Z A;  4PSX A;  3WR7 A;  4FD7 A;  1NE9 A;  5EC4 A;  5H86 A;  3BJ7 A;  2Y0M A;  4UCP A;  5AG6 A;  1BO4 A;  1BOB A;  3UY5 A;  1IYK A;  1Q2Y A;  1B6B A;  4U5Y A;  1Y7R A;  3D2M A;  3EC4 A;  4U9Y A;  3FYN A;  1XIX A;  4JLY A;  3W91 A;  4NEX A;  3FNC A;  4HNW B;  5F49 A;  3FIX A;  4OLL A;  3TFY A;  4C7H A;  4I49 A;  4QBJ A;  4Q38 A;  2PR1 A;  2PSW A;  2BL1 A;  2ZW5 A;  1QSN A;  3MGD A;  3D8P A;  1XE4 A;  5F46 A;  1RO5 A;  5AG5 A;  3CXQ A;  1S60 A;  4LX9 A;  5AG4 A;  4EVY A;  4KOW A;  2Q7B A;  3E0K A;  3BJ8 A;  2VZY A;  2K5T A;  1L0C A;  1S7F A;  4GS4 A;  4KOR A;  3ZZI A;  3DR6 A;  3GYA A;  1IIC A;  3SXN A;  3IWG A;  4LUA A;  2O28 A;  1Q2D A;  4MI4 A;  1Y9K A;  3R96 A;  2VI7 A;  1OZP A;  4KOS A;  3R95 A;  2FE7 A;  2JDD A;  3TTH A;  4Y49 C;  4HNY B;  4C2X A;  4YRH A;  4A33 A;  5C82 A;  4HNX B;  5J8C A;  1UFH A;  2ZW7 A;  4H6Z A;  2WSA A;  2HQY A;  3P2F A;  4PK3 A;  4KSF A;  1P0H A;  4YFJ A;  1MJ9 A;  2B5G B;  4UFW A;  1V0C A;  5HH1 A;  4KS9 A;  1YGH A;  4KSA A;  4M3S A;  2FIW A;  4KOT A;  4ZGY B;  4CYO A;  5GCN A;  2CNM A;  1J4J A;  1RXT A;  3T9Y A;  4CAX A;  3TO7 A;  2DPT A;  2I00 A;  4R87 A;  2I79 A;  5JQ4 A;  1GHE A;  2VQY A;  1XF8 A;  2WPX A;  4OAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...