4CYNA

Leishmania major n-myristoyltransferase in complex with an aminoacylpyrrolidine inhibitor (2b)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
molecule tags Transferase
source organism Leishmania major
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
total genus 125
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cynA00
3H5ZA 4CYOA 5G21A 3IWEA 4UFWA 2WUUA 4UCPA 4B14A 4BBHA 4C2ZA 4CYPA 4CYQA 4CAEA 5AG4A 4CGLA 3IU1A 4UFVA 4A31A 4CGNA 4A95A 4C7HA 4B12A 4CGMA 4A33A 2YNCA 4A32A 4CGOA 4C7IA 4A2ZA 4C2YA 5AGEA 4UFXA 2YNCC 4B13A 4CGPA 4CYNA 4UCNA 5AG7A 4B10A 4CAFA 5AG5A 5A27A 2WSAA 3IU2A 3JTKA 4B11A 4C2XA 5A28A 5G20A 2YNDA 4C68A 5G22A 2YNEA 4UCMA 5AG6A 4A30A 5G1ZA
chains in the Genus database with same CATH superfamily
3SI2A 4F8ZA 1XE4A 5FVJA 1QQ9A 1M44A 2ZXVA 4P44A 4NGQA 3TTHA 2ABZA 3WT4A 6CPAA 3TO7A 3KQZA 5HXDA 2ZEDA 4A33A 3GYAA 5I0CA 5JH9A 4UIBA 5JGFA 5ISVA 5DS0A 2VZZA 4YGOA 3PFEA 4BMHA 1IOFA 5KTDA 2XEGA 2GE3A 2A4NA 1IB1E 4CAVA 3DNSA 2PRBA 2B3UA 3T90A 5F49A 1ELMP 1LAPA 1BAVA 2C6GA 1ELLP 3SJFA 1SQHA 2PJ8A 3BHXA 2RB7A 5ELYA 4F6AA 4YFJA 3K2KA 3R96A 3IGRA 2PJCA 3DR6A 1XRYA 2AFXA 4RN7A 5G21A 3S6GA 1BLLE 1Q2CA 1Q2YA 1QSRA 2FT0A 4XNHB 1VGYA 4MHPA 4MHYA 2FIAA 3NE8A 3BJ7A 4KVME 4UFVA 3P2FA 4R87A 3QAHA 5K8NA 4ZYQA 1CG2A 3RZAA 2PDOA 1VHEA 4W9YA 1HDQA 4L89A 1M4LA 2IL4A 2CNSA 3KI9A 4Q38A 3PB7X 2AFWA 4CAFA 4CAWA 4JXRA 4P4DA 2DEAA 1IICA 1JWQA 3N7ZA 4NJRA 2Q04A 1M4IA 3GY9A 4Q7AA 4NEXA 2QECA 4AVCA 4A39A 1CX8A 4OADA 3FB3A 3TX8A 2B5GA 2REEA 2I3CA 3F0AA 2J9AA 4C2ZA 4KS9A 4BBHA 4NJQA 2QIRA 2ZW7A 4GM5A 1TF9A 4OIDA 2V8DA 3CPAA 4KVOE 4CGOA 3H8EA 3MRUA 4MCSA 2REFA 2FCKA 5E96A 1Z8XA 1FY7A 4JYWA 2OB0A 3H8GA 2HUZA 2KCWA 4AB7A 2HV2A 1CP7A 1NSAA 1N71A 1MJ9A 2CTBA 2WSAA 3IWWA 3IWGA 3DSBA 4FD7A 4NCZA 2O4HA 4B11A 4NFRA 1FNOA 1LFWA 4BINA 2R1IA 3I1UA 1BPNA 2BL1A 4P10A 2H5MA 1AMPA 1Y9WA 2ANPA 1IYKA 1R57A 4AVAA 2WUUA 4UCPA 4MFJA 3WC6A 3IU1A 4YWYA 4ONWA 2EK9A 4K3NA 5KTAA 4MFLA 2NYQA 3CXQA 3EXNA 1S7LA 4QUSA 4NXYA 4LUAA 5GCNA 2C6PA 3BJ8A 1LOKA 4OLLA 4C2YA 4F0YA 1XF8A 3IEHA 4DNCA 1YGHA 2B58A 5AG7A 2D4OA 4CRZB 1S3ZA 4H6UA 3VWDA 2JDDA 1XEBA 5JM6A 2AFMA 2BSWA 4P45A 4C2XA 3ISXA 4KOTA 4P6YA 1KWMA 2PR1A 2VXKA 2YNEA 1UWYA 2G3TA 2ZEOA 3IC1A 1Z4RA 3B3CA 4JJXA 1VKCA 5J8FA 4MXUA 3CT9A 4OIWA 3NH5A 1YR0A 3TO6A 4LQ6A 4KSAA 1P4NA 2I00A 4AG7A 3QB8A 4HPSA 4MHDA 4RI1A 1IY7A 3CPXA 5IB0A 5THWA 1S7KA 3B3VA 1XIXA 2OR4A 3FMCA 1TKFA 5K8MA 1XMBA 2B4DA 3GIUA 4H89A 4JXQA 2FE7A 4EWTA 2YNCC 2PQ8A 3PP9A 4M6GA 3VATA 1RO5A 2ZW6A 1Y0YA 2PSWA 4X5KA 5LRKA 2OH1A 2DXQA 2CIJA 4PXBA 5AG5A 5EMIA 1I21A 2R7HA 4B5PB 2JLMA 3PB8X 2JEWA 4A94A 4UEZA 2ZEPA 3S9MA 4JWPA 1YLEA 2ZELA 5C88A 5D8NA 4UF4A 3S6KA 4TWEA 2B5GB 1NMTA 1YX0A 1Y0RA 3UY5A 5D29A 3FXTA 3I3GA 1XMTA 4IF5A 2PJ2A 4J3GA 4CYPA 2Z3LA 2XEFA 4P4JA 1B6BA 1J4JA 1YW6A 3C26A 2POKA 3PBEA 2Q51A 1ZLHA 2EWBA 2F8HA 3NA6A 4KOUA 4KVXA 4ONUA 4G1PA 2PVWA 4X2TA 3R1KA 5HVHA 1QSNA 2P6EA 3FIXA 3BLNA 4KSFA 4OC5A 2PJAA 2XEIA 3FF3A 4X3RA 3VWEA 4IHMA 2XEJA 4YRHA 2CNMA 2O53A 3FBUA 2BUEA 1NSLA 2OOTA 2Z3OA 4PV6A 1X12A 2J8NA 1VHOA 3IU2A 2EUIA 3JTKA 1GYTA 4XPKA 5LRJA 3KHZA 5LYIA 1F2OA 4UBRA 4LX9A 4B6ZA 4CPAA 3RAMA 2DPSA 1IOIA 2Q44A 4KOVA 2ZEHA 5HVGA 3FYNA 4UEEA 5AG6A 4FD6A 2QJ8A 3PBBA 4R76A 2BO9A 4MFKA 1IGBA 3WR7A 2P6FA 3N5FA 5AG4A 5EC4A 2G0BA 2EO8A 2VEZA 4PXDA 1PCAA 5J8CA 4MHZA 1WWZA 2EK8A 3R9GA 2B3VA 2ZOGA 4PSXA 4C7HA 3WC7A 4R57A 1ZG9A 3EFAA 3CXSA 3F5BA 5DWNA 5LYFA 3KR5A 4AVBA 1Z8WA 2DPTA 4P4BA 4BD9A 1I1DA 3SXOA 1LAMA 3B3TA 4QC6A 1Z8LA 2J8MA 2PC1A 1LRZA 4WWVA 4P4IA 2FS5A 1F57A 2Q7SA 3JUWA 4MBUA 4MY0A 4PSWA 4R7MA 5IX3A 4IUSA 4R3LA 4X8IA 4E0AA 1UFHA 2ATRA 1KUYA 2QYVA 2V8GA 4M6IA 4QVTA 4KLVA 3T9YA 1ZO0A 4KORA 1S7NA 2EBJA 3CZXA 3EO4A 1VHSA 1HDUA 2PJ5A 2Z3KA 1IIDA 3LACA 2AFSA 3FEEA 3JVNA 2ZEGA 4NGNA 4DYOA 2ZPAA 2PJBA 2FXFA 4OC0A 3TOBA 3PB6X 4AG9A 3B3WA 2BEIA 2YNCA 3D2MA 3HUVA 3NE7A 4UFXA 3FX6A 1XJOA 2FL4A 2JDCA 3QAYA 4UCNA 4OMEA 1M4GA 2PIZA 4HNYB 3D2PA 3KGQA 3IJ3A 1BO4A 4KUBA 2Z0ZA 1HEEA 3D7GA 2K5TA 4A37A 4H2KA 4FWUA 4E2AA 4I49A 2R8VA 3TOAA 4UCMA 4XPLA 2D4PA 5LYLA 3R9FA 2V8HA 4MY3A 4OC1A 4UFWA 3W6XA 3PB9X 3R95A 3BXMA 3D7DA 4UIAA 1U6MA 3FECA 3D3SA 3LD2A 5K8OA 2GFQA 5BWAB 5K8PA 4JLYA 2PIYA 1CM0A 2BCOA 3B2YA 1QMUA 4UEFA 4C7IA 4R3KA 3SJGA 4KLWA 4NF1A 1DE4C 1RXTA 4QB9A 4GS4A 4UWJA 4WJBA 5HH1A 2AFUA 2B4DB 2I79A 3DLJA 3VH9A 4MFPA 4PK3A 4OP4A 2JBKA 2HB6A 3W6SA 4E8OA 2ZOFA 2IJZA 4F9VA 5CPAA 3G3SA 4JD6A 3V7ZA 4DUKA 3S9LA 4RUHA 2HQYA 1R3NA 2WPWA 4TNUA 3F8KA 3ZZIA 2C27A 2ZENA 2GLFA 2RFHA 4K30A 4PPZA 7CPAA 2C1CA 4CGLA 1EE3P 1TKHA 1M1DA 5H86A 4A95A 3SHPA 3L2NA 4NGPA 2PE3A 1QSOA 3DDDA 4NGSA 1F2PA 4HNXB 5CBMA 4NGMA 5F47A 4MFZA 3DR8A 2Z3MA 1CPSA 4DJLA 1XBUA 2GANA 2VL1A 4ORFA 1DTDA 1YVOA 2QMLA 1Y7EA 2RC4A 3SXNA 5A27A 4ZI6A 4B5PA 3PFOA 3IIBA 2X7BA 3FH4A 2OZHA 1YQEA 4M6HA 3PB4X 4FD5A 4FBEA 1Y7RA 2HC9A 2Q43A 4OAEA 5HMNA 1MJBA 1Z8TA 4KOWA 2VQYA 3A9LA 4OKOA 1X10A 4CYQA 4CAEA 4EVYA 4HNWB 1Y9KA 4A31A 5H84A 2BOAA 1ON0A 4MI4A 5LRGA 4MMOA 1ZLIA 2JBJA 3TO9A 3SJEA 3D68A 1V0CA 4ZY1A 4HKFA 1CBXA 2DF5A 4FAIA 3LMSA 4R8FA 3D7HA 3BI0A 1CP6A 2AFZA 2VI7A 4ZX9A 4F0XA 4ZX8A 3B35A 3FNCA 5A28A 4KZTA 1OBRA 3E0KA 3WC5A 2AE6A 2ZW5A 3DGVA 3T8WA 1YVKA 2O28A 3D4UA 2GU2A 2PJ4A 3RO0A 4MHNA 2FIWA 2PRQA 3S9NA 1Z9UA 2CTCA 2Q4VA 1AUGA 4XNHC 4KOYA 2WZNA 2Z11A 2CXAA 1IU8A 1FT7A 3GUXA 1RTQA 4MRIA 4UA3A 5CNPA 3RYOA 1L0CA 3GB0A 2OU2A 3OWCA 1BPMA 3TFYA 2Z3PA 4CGPA 1Z4EA 3D67A 3EC4A 1XFOA 2GLJA 2P0WA 2PJ0A 3KR4A 3NH4A 3TCVA 3GLJA 2JEVA 4XPDC 2YNDA 3K9TA 1KUXA 2PJ1A 4C68A 3KQXA 1H8LA 1YSJA 1R43A 2PJ7A 1CPXA 4KOXA 5G1ZA 4JZ0A 1YREA 1BOBA 4L8AA 1MK4A 5F46A 3SI0A 3SI1A 2CNTA 4MJ8A 3H8FA 1KUVA 4PQAA 5JPHA 2AJ6A 8CPAA 2J8RA 1PUAA 4CGNA 3IO1A 4KUAA 3NH8A 1S60A 3HLPA 4U5YA 4MFQA 1KZFA 4Y49C 3B8GA 3JRUA 2Q7BA 1Z5RA 2CF4A 2ODFA 3CDXA 4NSQA 1YMEA 5F48A 4B10A 4LQGA 3TE4A 5EBVA 1Q7LA 4OC3A 2ZEFA 1YLOA 4MCRA 3D8PA 4CAXA 3RNZA 3S6HA 4QBJA 1I12A 3R9EA 4A30A 2B4BA 3QNVA 2Q4YA 1OZPA 2G3AA 4H6ZA 3W91A 2OZGA 2R98A 4CYOA 2FSRA 1K4JA 3MGDA 3PRTA 2WYRA 3GKRA 3VARA 4ZY0A 4FD4A 4IAVA 4A38A 1TXRA 4OC4A 1JQGA 1WK4A 2EVNA 3CXPA 4P4FA 1YW4A 4RS2A 5DWMA 2PR8A 4CGMA 5C82A 3MN8A 1ZG8A 1QSMA 4Y49B 4CS0B 2QVPA 5I4MA 5KTCA 2F5IA 2WPXA 2NSMA 2FVGA 4O23A 2Z10A 4EMEA 1ARMA 2PJ6A 4R9MA 3D7FA 1AYEA 2C6CA 1YK3A 4Q36A 4PXEA 2AFOA 1A2ZA 1QSTA 2ZEMA 4NGTA 3TT2A 2NMTA 3I9SA 2PVVA 4PK2A 5LYDA 4NGRA 3IWEA 4B14A 1LCPA 3WABA 2VBQA 4FUUA 4YU9A 3FEDA 3G8WA 4PXCA 3BI1A 4GXHA 3PEIA 2YGWA 1M4DA 3FRMA 2ZEEA 4CRYB 1ARLA 4A2ZA 1Z2LA 5AGEA 4F9UA 3V8IA 4KSIA 2GREA 1TKJA 4CYNA 1TF8A 3FVLA 2V77A 3RBUA 3IFEA 5J1QA 4M3SA 1NE9A 4II9A 2P6GA 3D66A 2VZYA 3B3SA 4KOSA 2ZW4A 2V8VA 1PYTB 4ZBGA 1TIQA 3KZWA 5G20A 5IB9A 3S6FA 1P0HA 4M85A 3KASA 2G9DA 1Q2DA 5HVFA 4MCPA 1IYLA 4ZY2A 1GHEA 3H5ZA 4B5OA 1B87A 1PU9A 3P2HA 3KHXA 3V38A 3ZJ0A 3PGPA 1S5KA 2GIVA 3EY5A 3KKWA 2PCUA 4U9YA 4IK2A 2IQ6A 1LANA 2PJ3A 3B7IA 4B12A 4OC2A 1VIXA 2Q0YA 4A32A 4EFDA 3K9UA 2F7VA 3H4QA 2IMOA 2Y0MA 4B13A 4ZGYB 2ARHA 2Q4ZA 5JQ4A 4MCQA 2OZUA 1MJAA 3ISZA 3PZJA 3FJUA 4P4EA 4R6TA 2PJ9A 1S7FA 4XPDB 2Z3NA 3TC8A 4Z65A 3NFZA 1XOVA 4AXVA 5G22A 3SJXA 5F09A 1ZG7A 4UWIA 5IV0A 1CJWA 4U9ZA 2CY2A 3LWUA 3KL9A 3LODA
chains in the Genus database with same CATH topology
1XE4A 5FVJA 1M44A 2ZXVA 3TTHA 3TO7A 4A33A 3GYAA 5I0CA 5ISVA 2VZZA 4YGOA 4BMHA 5KTDA 2GE3A 2A4NA 1IB1E 4CAVA 3DNSA 2PRBA 2B3UA 3T90A 5F49A 1SQHA 4F6AA 4YFJA 3R96A 3IGRA 3DR6A 5G21A 3S6GA 1Q2CA 1Q2YA 1QSRA 2FT0A 4XNHB 4UFVA 2FIAA 3BJ7A 4KVME 3P2FA 4R87A 3QAHA 2PDOA 4L89A 2IL4A 2CNSA 4Q38A 4CAFA 4CAWA 4JXRA 1IICA 3N7ZA 2Q04A 1M4IA 3GY9A 4NEXA 2QECA 4AVCA 4OADA 3FB3A 2B5GA 2REEA 3F0AA 4C2ZA 4KS9A 4BBHA 2QIRA 2ZW7A 4KVOE 4CGOA 2REFA 2FCKA 5E96A 1FY7A 2OB0A 2HUZA 2KCWA 4AB7A 2HV2A 1MJ9A 1N71A 2WSAA 4B11A 3IWGA 3DSBA 4FD7A 4NCZA 2R1IA 2BL1A 2H5MA 1Y9WA 1IYKA 1R57A 4AVAA 2WUUA 4UCPA 4MFJA 3IU1A 5KTAA 4MFLA 3CXQA 3EXNA 1S7LA 4QUSA 4NXYA 4LUAA 5GCNA 3BJ8A 4OLLA 4C2YA 4F0YA 1XF8A 4DNCA 1YGHA 2B58A 5AG7A 2D4OA 4CRZB 1S3ZA 4H6UA 3VWDA 2JDDA 1XEBA 2BSWA 4C2XA 4KOTA 2PR1A 2VXKA 2YNEA 2G3TA 4JJXA 1Z4RA 1VKCA 5J8FA 1YR0A 3TO6A 4KSAA 1P4NA 2I00A 4AG7A 3QB8A 4MHDA 4RI1A 5IB0A 1S7KA 1XIXA 2B4DA 4H89A 4JXQA 2FE7A 2YNCC 2PQ8A 3PP9A 1RO5A 2ZW6A 4X5KA 2PSWA 2OH1A 2DXQA 5AG5A 1I21A 2R7HA 4B5PB 2JLMA 4JWPA 1YLEA 5C88A 3S6KA 2B5GB 1NMTA 1YX0A 3UY5A 3FXTA 3I3GA 1XMTA 4IF5A 4J3GA 4CYPA 2Z3LA 1B6BA 1J4JA 3C26A 4KOUA 4ONUA 4KVXA 3R1KA 1QSNA 2P6EA 3FIXA 3BLNA 4KSFA 3VWEA 4YRHA 2CNMA 3FBUA 2BUEA 1NSLA 2Z3OA 4PV6A 2J8NA 4XPKA 3IU2A 2EUIA 3JTKA 4UBRA 4LX9A 2DPSA 2Q44A 4KOVA 3FYNA 5AG6A 4FD6A 4MFKA 3WR7A 2P6FA 5AG4A 5EC4A 2G0BA 2VEZA 5J8CA 1WWZA 3R9GA 2B3VA 4C7HA 4PSXA 4R57A 3EFAA 3CXSA 3F5BA 5DWNA 4AVBA 2DPTA 1I1DA 3SXOA 4QC6A 2J8MA 2PC1A 1LRZA 4MBUA 2FS5A 3JUWA 4MY0A 5IX3A 4PSWA 4IUSA 4R3LA 4E0AA 1UFHA 2ATRA 1KUYA 4QVTA 3T9YA 4KLVA 1ZO0A 4KORA 1S7NA 3EO4A 1VHSA 2Z3KA 1IIDA 3JVNA 2ZPAA 3TOBA 2FXFA 4AG9A 2BEIA 2YNCA 3D2MA 3NE7A 4UFXA 2FL4A 2JDCA 4UCNA 1M4GA 4HNYB 3D2PA 4KUBA 1BO4A 2Z0ZA 2K5TA 4E2AA 4I49A 2R8VA 3TOAA 4UCMA 4XPLA 2D4PA 3R9FA 4MY3A 4UFWA 3W6XA 3R95A 1U6MA 3LD2A 3D3SA 5BWAB 4JLYA 1CM0A 4C7IA 4R3KA 4KLWA 4NF1A 1RXTA 4QB9A 5HH1A 4GS4A 4UWJA 2B4DB 2I79A 4MFPA 4PK3A 3W6SA 4E8OA 3G3SA 4JD6A 2HQYA 2WPWA 3F8KA 3ZZIA 2C27A 4K30A 4CGLA 1M1DA 5H86A 4A95A 3SHPA 1QSOA 3DDDA 4HNXB 5F47A 4MFZA 3DR8A 2Z3MA 2GANA 4ORFA 1YVOA 2RC4A 2QMLA 5A27A 3SXNA 4B5PA 2X7BA 2OZHA 4FD5A 1Y7RA 4OAEA 5HMNA 1MJBA 4KOWA 2VQYA 3A9LA 4CYQA 4CAEA 4EVYA 4HNWB 1Y9KA 4A31A 5H84A 4MI4A 1ON0A 3TO9A 1V0CA 4HKFA 2VI7A 4F0XA 3FNCA 5A28A 4KZTA 3E0KA 2AE6A 2ZW5A 1YVKA 2O28A 2FIWA 1Z9UA 2Q4VA 4XNHC 4KOYA 2Z11A 2CXAA 4UA3A 5CNPA 3RYOA 1L0CA 2OU2A 3OWCA 3TFYA 2Z3PA 4CGPA 1Z4EA 3EC4A 2P0WA 3TCVA 2JEVA 4XPDC 2YNDA 1KUXA 4C68A 4KOXA 5G1ZA 1BOBA 4L8AA 1YREA 1MK4A 5F46A 2CNTA 4MJ8A 5JPHA 1KUVA 2AJ6A 2J8RA 1PUAA 4CGNA 4KUAA 1S60A 4U5YA 4MFQA 1KZFA 4Y49C 3B8GA 2Q7BA 5F48A 4NSQA 4B10A 3TE4A 5EBVA 3D8PA 4CAXA 3S6HA 4QBJA 1I12A 3R9EA 4A30A 2B4BA 2Q4YA 1OZPA 2G3AA 4H6ZA 3W91A 2OZGA 2R98A 4CYOA 2FSRA 1K4JA 3MGDA 3GKRA 4FD4A 1WK4A 2EVNA 3CXPA 4RS2A 5DWMA 4CGMA 2PR8A 5C82A 1QSMA 4Y49B 4CS0B 5KTCA 2F5IA 2WPXA 2Z10A 4R9MA 1YK3A 4Q36A 1QSTA 3TT2A 2NMTA 3I9SA 4PK2A 4B14A 3IWEA 2VBQA 3G8WA 2YGWA 1M4DA 3FRMA 4CRYB 4A2ZA 5AGEA 3V8IA 4CYNA 4II9A 4M3SA 1NE9A 2P6GA 2VZYA 4ZBGA 4KOSA 2ZW4A 1TIQA 5G20A 3S6FA 1P0HA 4M85A 1Q2DA 1IYLA 1GHEA 3H5ZA 4B5OA 1B87A 1PU9A 3P2HA 3ZJ0A 3PGPA 1S5KA 2GIVA 3EY5A 3KKWA 4U9YA 4B12A 2Q0YA 4A32A 3K9UA 3H4QA 2Y0MA 4B13A 4ZGYB 2ARHA 5JQ4A 2OZUA 1MJAA 3PZJA 1S7FA 4XPDB 2Z3NA 5G22A 5IV0A 4UWIA 1CJWA 4U9ZA 2CY2A 3LODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H5Z A;  4CYO A;  5G21 A;  3IWE A;  4UFW A;  2WUU A;  4UCP A;  4B14 A;  4BBH A;  4C2Z A;  4CYP A;  4CYQ A;  4CAE A;  5AG4 A;  4CGL A;  3IU1 A;  4UFV A;  4A31 A;  4CGN A;  4A95 A;  4C7H A;  4B12 A;  4CGM A;  4A33 A;  2YNC A;  4A32 A;  4CGO A;  4C7I A;  4A2Z A;  4C2Y A;  5AGE A;  4UFX A;  2YNC C;  4B13 A;  4CGP A;  4CYN A;  4UCN A;  5AG7 A;  4B10 A;  4CAF A;  5AG5 A;  5A27 A;  2WSA A;  3IU2 A;  3JTK A;  4B11 A;  4C2X A;  5A28 A;  5G20 A;  2YND A;  4C68 A;  5G22 A;  2YNE A;  4UCM A;  5AG6 A;  4A30 A;  5G1Z A; 
#chains in the Genus database with same CATH topology
 3SI2 A;  4F8Z A;  1XE4 A;  5FVJ A;  1QQ9 A;  1M44 A;  2ZXV A;  4P44 A;  4NGQ A;  3TTH A;  2ABZ A;  3WT4 A;  6CPA A;  3TO7 A;  3KQZ A;  5HXD A;  2ZED A;  4A33 A;  3GYA A;  5I0C A;  5JH9 A;  4UIB A;  5JGF A;  5ISV A;  5DS0 A;  2VZZ A;  4YGO A;  3PFE A;  4BMH A;  1IOF A;  5KTD A;  2XEG A;  2GE3 A;  2A4N A;  1IB1 E;  4CAV A;  3DNS A;  2PRB A;  2B3U A;  3T90 A;  5F49 A;  1ELM P;  1LAP A;  1BAV A;  2C6G A;  1ELL P;  3SJF A;  1SQH A;  2PJ8 A;  3BHX A;  2RB7 A;  5ELY A;  4F6A A;  4YFJ A;  3K2K A;  3R96 A;  3IGR A;  2PJC A;  3DR6 A;  1XRY A;  2AFX A;  4RN7 A;  5G21 A;  3S6G A;  1BLL E;  1Q2C A;  1Q2Y A;  1QSR A;  2FT0 A;  4XNH B;  1VGY A;  4MHP A;  4MHY A;  2FIA A;  3NE8 A;  3BJ7 A;  4KVM E;  4UFV A;  3P2F A;  4R87 A;  3QAH A;  5K8N A;  4ZYQ A;  1CG2 A;  3RZA A;  2PDO A;  1VHE A;  4W9Y A;  1HDQ A;  4L89 A;  1M4L A;  2IL4 A;  2CNS A;  3KI9 A;  4Q38 A;  3PB7 X;  2AFW A;  4CAF A;  4CAW A;  4JXR A;  4P4D A;  2DEA A;  1IIC A;  1JWQ A;  3N7Z A;  4NJR A;  2Q04 A;  1M4I A;  3GY9 A;  4Q7A A;  4NEX A;  2QEC A;  4AVC A;  4A39 A;  1CX8 A;  4OAD A;  3FB3 A;  3TX8 A;  2B5G A;  2REE A;  2I3C A;  3F0A A;  2J9A A;  4C2Z A;  4KS9 A;  4BBH A;  4NJQ A;  2QIR A;  2ZW7 A;  4GM5 A;  1TF9 A;  4OID A;  2V8D A;  3CPA A;  4KVO E;  4CGO A;  3H8E A;  3MRU A;  4MCS A;  2REF A;  2FCK A;  5E96 A;  1Z8X A;  1FY7 A;  4JYW A;  2OB0 A;  3H8G A;  2HUZ A;  2KCW A;  4AB7 A;  2HV2 A;  1CP7 A;  1NSA A;  1N71 A;  1MJ9 A;  2CTB A;  2WSA A;  3IWW A;  3IWG A;  3DSB A;  4FD7 A;  4NCZ A;  2O4H A;  4B11 A;  4NFR A;  1FNO A;  1LFW A;  4BIN A;  2R1I A;  3I1U A;  1BPN A;  2BL1 A;  4P10 A;  2H5M A;  1AMP A;  1Y9W A;  2ANP A;  1IYK A;  1R57 A;  4AVA A;  2WUU A;  4UCP A;  4MFJ A;  3WC6 A;  3IU1 A;  4YWY A;  4ONW A;  2EK9 A;  4K3N A;  5KTA A;  4MFL A;  2NYQ A;  3CXQ A;  3EXN A;  1S7L A;  4QUS A;  4NXY A;  4LUA A;  5GCN A;  2C6P A;  3BJ8 A;  1LOK A;  4OLL A;  4C2Y A;  4F0Y A;  1XF8 A;  3IEH A;  4DNC A;  1YGH A;  2B58 A;  5AG7 A;  2D4O A;  4CRZ B;  1S3Z A;  4H6U A;  3VWD A;  2JDD A;  1XEB A;  5JM6 A;  2AFM A;  2BSW A;  4P45 A;  4C2X A;  3ISX A;  4KOT A;  4P6Y A;  1KWM A;  2PR1 A;  2VXK A;  2YNE A;  1UWY A;  2G3T A;  2ZEO A;  3IC1 A;  1Z4R A;  3B3C A;  4JJX A;  1VKC A;  5J8F A;  4MXU A;  3CT9 A;  4OIW A;  3NH5 A;  1YR0 A;  3TO6 A;  4LQ6 A;  4KSA A;  1P4N A;  2I00 A;  4AG7 A;  3QB8 A;  4HPS A;  4MHD A;  4RI1 A;  1IY7 A;  3CPX A;  5IB0 A;  5THW A;  1S7K A;  3B3V A;  1XIX A;  2OR4 A;  3FMC A;  1TKF A;  5K8M A;  1XMB A;  2B4D A;  3GIU A;  4H89 A;  4JXQ A;  2FE7 A;  4EWT A;  2YNC C;  2PQ8 A;  3PP9 A;  4M6G A;  3VAT A;  1RO5 A;  2ZW6 A;  1Y0Y A;  2PSW A;  4X5K A;  5LRK A;  2OH1 A;  2DXQ A;  2CIJ A;  4PXB A;  5AG5 A;  5EMI A;  1I21 A;  2R7H A;  4B5P B;  2JLM A;  3PB8 X;  2JEW A;  4A94 A;  4UEZ A;  2ZEP A;  3S9M A;  4JWP A;  1YLE A;  2ZEL A;  5C88 A;  5D8N A;  4UF4 A;  3S6K A;  4TWE A;  2B5G B;  1NMT A;  1YX0 A;  1Y0R A;  3UY5 A;  5D29 A;  3FXT A;  3I3G A;  1XMT A;  4IF5 A;  2PJ2 A;  4J3G A;  4CYP A;  2Z3L A;  2XEF A;  4P4J A;  1B6B A;  1J4J A;  1YW6 A;  3C26 A;  2POK A;  3PBE A;  2Q51 A;  1ZLH A;  2EWB A;  2F8H A;  3NA6 A;  4KOU A;  4KVX A;  4ONU A;  4G1P A;  2PVW A;  4X2T A;  3R1K A;  5HVH A;  1QSN A;  2P6E A;  3FIX A;  3BLN A;  4KSF A;  4OC5 A;  2PJA A;  2XEI A;  3FF3 A;  4X3R A;  3VWE A;  4IHM A;  2XEJ A;  4YRH A;  2CNM A;  2O53 A;  3FBU A;  2BUE A;  1NSL A;  2OOT A;  2Z3O A;  4PV6 A;  1X12 A;  2J8N A;  1VHO A;  3IU2 A;  2EUI A;  3JTK A;  1GYT A;  4XPK A;  5LRJ A;  3KHZ A;  5LYI A;  1F2O A;  4UBR A;  4LX9 A;  4B6Z A;  4CPA A;  3RAM A;  2DPS A;  1IOI A;  2Q44 A;  4KOV A;  2ZEH A;  5HVG A;  3FYN A;  4UEE A;  5AG6 A;  4FD6 A;  2QJ8 A;  3PBB A;  4R76 A;  2BO9 A;  4MFK A;  1IGB A;  3WR7 A;  2P6F A;  3N5F A;  5AG4 A;  5EC4 A;  2G0B A;  2EO8 A;  2VEZ A;  4PXD A;  1PCA A;  5J8C A;  4MHZ A;  1WWZ A;  2EK8 A;  3R9G A;  2B3V A;  2ZOG A;  4PSX A;  4C7H A;  3WC7 A;  4R57 A;  1ZG9 A;  3EFA A;  3CXS A;  3F5B A;  5DWN A;  5LYF A;  3KR5 A;  4AVB A;  1Z8W A;  2DPT A;  4P4B A;  4BD9 A;  1I1D A;  3SXO A;  1LAM A;  3B3T A;  4QC6 A;  1Z8L A;  2J8M A;  2PC1 A;  1LRZ A;  4WWV A;  4P4I A;  2FS5 A;  1F57 A;  2Q7S A;  3JUW A;  4MBU A;  4MY0 A;  4PSW A;  4R7M A;  5IX3 A;  4IUS A;  4R3L A;  4X8I A;  4E0A A;  1UFH A;  2ATR A;  1KUY A;  2QYV A;  2V8G A;  4M6I A;  4QVT A;  4KLV A;  3T9Y A;  1ZO0 A;  4KOR A;  1S7N A;  2EBJ A;  3CZX A;  3EO4 A;  1VHS A;  1HDU A;  2PJ5 A;  2Z3K A;  1IID A;  3LAC A;  2AFS A;  3FEE A;  3JVN A;  2ZEG A;  4NGN A;  4DYO A;  2ZPA A;  2PJB A;  2FXF A;  4OC0 A;  3TOB A;  3PB6 X;  4AG9 A;  3B3W A;  2BEI A;  2YNC A;  3D2M A;  3HUV A;  3NE7 A;  4UFX A;  3FX6 A;  1XJO A;  2FL4 A;  2JDC A;  3QAY A;  4UCN A;  4OME A;  1M4G A;  2PIZ A;  4HNY B;  3D2P A;  3KGQ A;  3IJ3 A;  1BO4 A;  4KUB A;  2Z0Z A;  1HEE A;  3D7G A;  2K5T A;  4A37 A;  4H2K A;  4FWU A;  4E2A A;  4I49 A;  2R8V A;  3TOA A;  4UCM A;  4XPL A;  2D4P A;  5LYL A;  3R9F A;  2V8H A;  4MY3 A;  4OC1 A;  4UFW A;  3W6X A;  3PB9 X;  3R95 A;  3BXM A;  3D7D A;  4UIA A;  1U6M A;  3FEC A;  3D3S A;  3LD2 A;  5K8O A;  2GFQ A;  5BWA B;  5K8P A;  4JLY A;  2PIY A;  1CM0 A;  2BCO A;  3B2Y A;  1QMU A;  4UEF A;  4C7I A;  4R3K A;  3SJG A;  4KLW A;  4NF1 A;  1DE4 C;  1RXT A;  4QB9 A;  4GS4 A;  4UWJ A;  4WJB A;  5HH1 A;  2AFU A;  2B4D B;  2I79 A;  3DLJ A;  3VH9 A;  4MFP A;  4PK3 A;  4OP4 A;  2JBK A;  2HB6 A;  3W6S A;  4E8O A;  2ZOF A;  2IJZ A;  4F9V A;  5CPA A;  3G3S A;  4JD6 A;  3V7Z A;  4DUK A;  3S9L A;  4RUH A;  2HQY A;  1R3N A;  2WPW A;  4TNU A;  3F8K A;  3ZZI A;  2C27 A;  2ZEN A;  2GLF A;  2RFH A;  4K30 A;  4PPZ A;  7CPA A;  2C1C A;  4CGL A;  1EE3 P;  1TKH A;  1M1D A;  5H86 A;  4A95 A;  3SHP A;  3L2N A;  4NGP A;  2PE3 A;  1QSO A;  3DDD A;  4NGS A;  1F2P A;  4HNX B;  5CBM A;  4NGM A;  5F47 A;  4MFZ A;  3DR8 A;  2Z3M A;  1CPS A;  4DJL A;  1XBU A;  2GAN A;  2VL1 A;  4ORF A;  1DTD A;  1YVO A;  2QML A;  1Y7E A;  2RC4 A;  3SXN A;  5A27 A;  4ZI6 A;  4B5P A;  3PFO A;  3IIB A;  2X7B A;  3FH4 A;  2OZH A;  1YQE A;  4M6H A;  3PB4 X;  4FD5 A;  4FBE A;  1Y7R A;  2HC9 A;  2Q43 A;  4OAE A;  5HMN A;  1MJB A;  1Z8T A;  4KOW A;  2VQY A;  3A9L A;  4OKO A;  1X10 A;  4CYQ A;  4CAE A;  4EVY A;  4HNW B;  1Y9K A;  4A31 A;  5H84 A;  2BOA A;  1ON0 A;  4MI4 A;  5LRG A;  4MMO A;  1ZLI A;  2JBJ A;  3TO9 A;  3SJE A;  3D68 A;  1V0C A;  4ZY1 A;  4HKF A;  1CBX A;  2DF5 A;  4FAI A;  3LMS A;  4R8F A;  3D7H A;  3BI0 A;  1CP6 A;  2AFZ A;  2VI7 A;  4ZX9 A;  4F0X A;  4ZX8 A;  3B35 A;  3FNC A;  5A28 A;  4KZT A;  1OBR A;  3E0K A;  3WC5 A;  2AE6 A;  2ZW5 A;  3DGV A;  3T8W A;  1YVK A;  2O28 A;  3D4U A;  2GU2 A;  2PJ4 A;  3RO0 A;  4MHN A;  2FIW A;  2PRQ A;  3S9N A;  1Z9U A;  2CTC A;  2Q4V A;  1AUG A;  4XNH C;  4KOY A;  2WZN A;  2Z11 A;  2CXA A;  1IU8 A;  1FT7 A;  3GUX A;  1RTQ A;  4MRI A;  4UA3 A;  5CNP A;  3RYO A;  1L0C A;  3GB0 A;  2OU2 A;  3OWC A;  1BPM A;  3TFY A;  2Z3P A;  4CGP A;  1Z4E A;  3D67 A;  3EC4 A;  1XFO A;  2GLJ A;  2P0W A;  2PJ0 A;  3KR4 A;  3NH4 A;  3TCV A;  3GLJ A;  2JEV A;  4XPD C;  2YND A;  3K9T A;  1KUX A;  2PJ1 A;  4C68 A;  3KQX A;  1H8L A;  1YSJ A;  1R43 A;  2PJ7 A;  1CPX A;  4KOX A;  5G1Z A;  4JZ0 A;  1YRE A;  1BOB A;  4L8A A;  1MK4 A;  5F46 A;  3SI0 A;  3SI1 A;  2CNT A;  4MJ8 A;  3H8F A;  1KUV A;  4PQA A;  5JPH A;  2AJ6 A;  8CPA A;  2J8R A;  1PUA A;  4CGN A;  3IO1 A;  4KUA A;  3NH8 A;  1S60 A;  3HLP A;  4U5Y A;  4MFQ A;  1KZF A;  4Y49 C;  3B8G A;  3JRU A;  2Q7B A;  1Z5R A;  2CF4 A;  2ODF A;  3CDX A;  4NSQ A;  1YME A;  5F48 A;  4B10 A;  4LQG A;  3TE4 A;  5EBV A;  1Q7L A;  4OC3 A;  2ZEF A;  1YLO A;  4MCR A;  3D8P A;  4CAX A;  3RNZ A;  3S6H A;  4QBJ A;  1I12 A;  3R9E A;  4A30 A;  2B4B A;  3QNV A;  2Q4Y A;  1OZP A;  2G3A A;  4H6Z A;  3W91 A;  2OZG A;  2R98 A;  4CYO A;  2FSR A;  1K4J A;  3MGD A;  3PRT A;  2WYR A;  3GKR A;  3VAR A;  4ZY0 A;  4FD4 A;  4IAV A;  4A38 A;  1TXR A;  4OC4 A;  1JQG A;  1WK4 A;  2EVN A;  3CXP A;  4P4F A;  1YW4 A;  4RS2 A;  5DWM A;  2PR8 A;  4CGM A;  5C82 A;  3MN8 A;  1ZG8 A;  1QSM A;  4Y49 B;  4CS0 B;  2QVP A;  5I4M A;  5KTC A;  2F5I A;  2WPX A;  2NSM A;  2FVG A;  4O23 A;  2Z10 A;  4EME A;  1ARM A;  2PJ6 A;  4R9M A;  3D7F A;  1AYE A;  2C6C A;  1YK3 A;  4Q36 A;  4PXE A;  2AFO A;  1A2Z A;  1QST A;  2ZEM A;  4NGT A;  3TT2 A;  2NMT A;  3I9S A;  2PVV A;  4PK2 A;  5LYD A;  4NGR A;  3IWE A;  4B14 A;  1LCP A;  3WAB A;  2VBQ A;  4FUU A;  4YU9 A;  3FED A;  3G8W A;  4PXC A;  3BI1 A;  4GXH A;  3PEI A;  2YGW A;  1M4D A;  3FRM A;  2ZEE A;  4CRY B;  1ARL A;  4A2Z A;  1Z2L A;  5AGE A;  4F9U A;  3V8I A;  4KSI A;  2GRE A;  1TKJ A;  4CYN A;  1TF8 A;  3FVL A;  2V77 A;  3RBU A;  3IFE A;  5J1Q A;  4M3S A;  1NE9 A;  4II9 A;  2P6G A;  3D66 A;  2VZY A;  3B3S A;  4KOS A;  2ZW4 A;  2V8V A;  1PYT B;  4ZBG A;  1TIQ A;  3KZW A;  5G20 A;  5IB9 A;  3S6F A;  1P0H A;  4M85 A;  3KAS A;  2G9D A;  1Q2D A;  5HVF A;  4MCP A;  1IYL A;  4ZY2 A;  1GHE A;  3H5Z A;  4B5O A;  1B87 A;  1PU9 A;  3P2H A;  3KHX A;  3V38 A;  3ZJ0 A;  3PGP A;  1S5K A;  2GIV A;  3EY5 A;  3KKW A;  2PCU A;  4U9Y A;  4IK2 A;  2IQ6 A;  1LAN A;  2PJ3 A;  3B7I A;  4B12 A;  4OC2 A;  1VIX A;  2Q0Y A;  4A32 A;  4EFD A;  3K9U A;  2F7V A;  3H4Q A;  2IMO A;  2Y0M A;  4B13 A;  4ZGY B;  2ARH A;  2Q4Z A;  5JQ4 A;  4MCQ A;  2OZU A;  1MJA A;  3ISZ A;  3PZJ A;  3FJU A;  4P4E A;  4R6T A;  2PJ9 A;  1S7F A;  4XPD B;  2Z3N A;  3TC8 A;  4Z65 A;  3NFZ A;  1XOV A;  4AXV A;  5G22 A;  3SJX A;  5F09 A;  1ZG7 A;  4UWI A;  5IV0 A;  1CJW A;  4U9Z A;  2CY2 A;  3LWU A;  3KL9 A;  3LOD A; 
#chains in the Genus database with same CATH homology
 1XE4 A;  5FVJ A;  1M44 A;  2ZXV A;  3TTH A;  3TO7 A;  4A33 A;  3GYA A;  5I0C A;  5ISV A;  2VZZ A;  4YGO A;  4BMH A;  5KTD A;  2GE3 A;  2A4N A;  1IB1 E;  4CAV A;  3DNS A;  2PRB A;  2B3U A;  3T90 A;  5F49 A;  1SQH A;  4F6A A;  4YFJ A;  3R96 A;  3IGR A;  3DR6 A;  5G21 A;  3S6G A;  1Q2C A;  1Q2Y A;  1QSR A;  2FT0 A;  4XNH B;  4UFV A;  2FIA A;  3BJ7 A;  4KVM E;  3P2F A;  4R87 A;  3QAH A;  2PDO A;  4L89 A;  2IL4 A;  2CNS A;  4Q38 A;  4CAF A;  4CAW A;  4JXR A;  1IIC A;  3N7Z A;  2Q04 A;  1M4I A;  3GY9 A;  4NEX A;  2QEC A;  4AVC A;  4OAD A;  3FB3 A;  2B5G A;  2REE A;  3F0A A;  4C2Z A;  4KS9 A;  4BBH A;  2QIR A;  2ZW7 A;  4KVO E;  4CGO A;  2REF A;  2FCK A;  5E96 A;  1FY7 A;  2OB0 A;  2HUZ A;  2KCW A;  4AB7 A;  2HV2 A;  1MJ9 A;  1N71 A;  2WSA A;  4B11 A;  3IWG A;  3DSB A;  4FD7 A;  4NCZ A;  2R1I A;  2BL1 A;  2H5M A;  1Y9W A;  1IYK A;  1R57 A;  4AVA A;  2WUU A;  4UCP A;  4MFJ A;  3IU1 A;  5KTA A;  4MFL A;  3CXQ A;  3EXN A;  1S7L A;  4QUS A;  4NXY A;  4LUA A;  5GCN A;  3BJ8 A;  4OLL A;  4C2Y A;  4F0Y A;  1XF8 A;  4DNC A;  1YGH A;  2B58 A;  5AG7 A;  2D4O A;  4CRZ B;  1S3Z A;  4H6U A;  3VWD A;  2JDD A;  1XEB A;  2BSW A;  4C2X A;  4KOT A;  2PR1 A;  2VXK A;  2YNE A;  2G3T A;  4JJX A;  1Z4R A;  1VKC A;  5J8F A;  1YR0 A;  3TO6 A;  4KSA A;  1P4N A;  2I00 A;  4AG7 A;  3QB8 A;  4MHD A;  4RI1 A;  5IB0 A;  1S7K A;  1XIX A;  2B4D A;  4H89 A;  4JXQ A;  2FE7 A;  2YNC C;  2PQ8 A;  3PP9 A;  1RO5 A;  2ZW6 A;  4X5K A;  2PSW A;  2OH1 A;  2DXQ A;  5AG5 A;  1I21 A;  2R7H A;  4B5P B;  2JLM A;  4JWP A;  1YLE A;  5C88 A;  3S6K A;  2B5G B;  1NMT A;  1YX0 A;  3UY5 A;  3FXT A;  3I3G A;  1XMT A;  4IF5 A;  4J3G A;  4CYP A;  2Z3L A;  1B6B A;  1J4J A;  3C26 A;  4KOU A;  4ONU A;  4KVX A;  3R1K A;  1QSN A;  2P6E A;  3FIX A;  3BLN A;  4KSF A;  3VWE A;  4YRH A;  2CNM A;  3FBU A;  2BUE A;  1NSL A;  2Z3O A;  4PV6 A;  2J8N A;  4XPK A;  3IU2 A;  2EUI A;  3JTK A;  4UBR A;  4LX9 A;  2DPS A;  2Q44 A;  4KOV A;  3FYN A;  5AG6 A;  4FD6 A;  4MFK A;  3WR7 A;  2P6F A;  5AG4 A;  5EC4 A;  2G0B A;  2VEZ A;  5J8C A;  1WWZ A;  3R9G A;  2B3V A;  4C7H A;  4PSX A;  4R57 A;  3EFA A;  3CXS A;  3F5B A;  5DWN A;  4AVB A;  2DPT A;  1I1D A;  3SXO A;  4QC6 A;  2J8M A;  2PC1 A;  1LRZ A;  4MBU A;  2FS5 A;  3JUW A;  4MY0 A;  5IX3 A;  4PSW A;  4IUS A;  4R3L A;  4E0A A;  1UFH A;  2ATR A;  1KUY A;  4QVT A;  3T9Y A;  4KLV A;  1ZO0 A;  4KOR A;  1S7N A;  3EO4 A;  1VHS A;  2Z3K A;  1IID A;  3JVN A;  2ZPA A;  3TOB A;  2FXF A;  4AG9 A;  2BEI A;  2YNC A;  3D2M A;  3NE7 A;  4UFX A;  2FL4 A;  2JDC A;  4UCN A;  1M4G A;  4HNY B;  3D2P A;  4KUB A;  1BO4 A;  2Z0Z A;  2K5T A;  4E2A A;  4I49 A;  2R8V A;  3TOA A;  4UCM A;  4XPL A;  2D4P A;  3R9F A;  4MY3 A;  4UFW A;  3W6X A;  3R95 A;  1U6M A;  3LD2 A;  3D3S A;  5BWA B;  4JLY A;  1CM0 A;  4C7I A;  4R3K A;  4KLW A;  4NF1 A;  1RXT A;  4QB9 A;  5HH1 A;  4GS4 A;  4UWJ A;  2B4D B;  2I79 A;  4MFP A;  4PK3 A;  3W6S A;  4E8O A;  3G3S A;  4JD6 A;  2HQY A;  2WPW A;  3F8K A;  3ZZI A;  2C27 A;  4K30 A;  4CGL A;  1M1D A;  5H86 A;  4A95 A;  3SHP A;  1QSO A;  3DDD A;  4HNX B;  5F47 A;  4MFZ A;  3DR8 A;  2Z3M A;  2GAN A;  4ORF A;  1YVO A;  2RC4 A;  2QML A;  5A27 A;  3SXN A;  4B5P A;  2X7B A;  2OZH A;  4FD5 A;  1Y7R A;  4OAE A;  5HMN A;  1MJB A;  4KOW A;  2VQY A;  3A9L A;  4CYQ A;  4CAE A;  4EVY A;  4HNW B;  1Y9K A;  4A31 A;  5H84 A;  4MI4 A;  1ON0 A;  3TO9 A;  1V0C A;  4HKF A;  2VI7 A;  4F0X A;  3FNC A;  5A28 A;  4KZT A;  3E0K A;  2AE6 A;  2ZW5 A;  1YVK A;  2O28 A;  2FIW A;  1Z9U A;  2Q4V A;  4XNH C;  4KOY A;  2Z11 A;  2CXA A;  4UA3 A;  5CNP A;  3RYO A;  1L0C A;  2OU2 A;  3OWC A;  3TFY A;  2Z3P A;  4CGP A;  1Z4E A;  3EC4 A;  2P0W A;  3TCV A;  2JEV A;  4XPD C;  2YND A;  1KUX A;  4C68 A;  4KOX A;  5G1Z A;  1BOB A;  4L8A A;  1YRE A;  1MK4 A;  5F46 A;  2CNT A;  4MJ8 A;  5JPH A;  1KUV A;  2AJ6 A;  2J8R A;  1PUA A;  4CGN A;  4KUA A;  1S60 A;  4U5Y A;  4MFQ A;  1KZF A;  4Y49 C;  3B8G A;  2Q7B A;  5F48 A;  4NSQ A;  4B10 A;  3TE4 A;  5EBV A;  3D8P A;  4CAX A;  3S6H A;  4QBJ A;  1I12 A;  3R9E A;  4A30 A;  2B4B A;  2Q4Y A;  1OZP A;  2G3A A;  4H6Z A;  3W91 A;  2OZG A;  2R98 A;  4CYO A;  2FSR A;  1K4J A;  3MGD A;  3GKR A;  4FD4 A;  1WK4 A;  2EVN A;  3CXP A;  4RS2 A;  5DWM A;  4CGM A;  2PR8 A;  5C82 A;  1QSM A;  4Y49 B;  4CS0 B;  5KTC A;  2F5I A;  2WPX A;  2Z10 A;  4R9M A;  1YK3 A;  4Q36 A;  1QST A;  3TT2 A;  2NMT A;  3I9S A;  4PK2 A;  4B14 A;  3IWE A;  2VBQ A;  3G8W A;  2YGW A;  1M4D A;  3FRM A;  4CRY B;  4A2Z A;  5AGE A;  3V8I A;  4CYN A;  4II9 A;  4M3S A;  1NE9 A;  2P6G A;  2VZY A;  4ZBG A;  4KOS A;  2ZW4 A;  1TIQ A;  5G20 A;  3S6F A;  1P0H A;  4M85 A;  1Q2D A;  1IYL A;  1GHE A;  3H5Z A;  4B5O A;  1B87 A;  1PU9 A;  3P2H A;  3ZJ0 A;  3PGP A;  1S5K A;  2GIV A;  3EY5 A;  3KKW A;  4U9Y A;  4B12 A;  2Q0Y A;  4A32 A;  3K9U A;  3H4Q A;  2Y0M A;  4B13 A;  4ZGY B;  2ARH A;  5JQ4 A;  2OZU A;  1MJA A;  3PZJ A;  1S7F A;  4XPD B;  2Z3N A;  5G22 A;  5IV0 A;  4UWI A;  1CJW A;  4U9Z A;  2CY2 A;  3LOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...