4CZ2A

Complex of human varp-ankrd1 with rab32-gppcp. selenomet derivative.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
172
Chain Sequence
REHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGLERFGNMTRVYYKEAMGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNMSPSQMDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKMLVNHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED PROTEIN RAB-32
total genus 50
structure length 172
sequence length 176
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4cz2A00
2YV5A 4JIMA 1Z83A 1YVDA 1DELA 4LJ6A 4YQFA 1B23P 3ICQB 1P60A 2Q6TA 1W1WA 1U99A 4KLNA 3X1ZA 2JATA 2AWNA 4C30A 5SZIA 2EFCB 2JLQA 2PH1A 2B7CA 3THYB 4WVFA 4X8LA 2WV9A 1TL7C 3KQLA 1BYIA 2XEXA 4M53A 1KK2A 4A6XA 5KNBA 2W2VA 3WRYC 1I2DA 2QMEA 3C14C 1D8TA 1NRJB 3IBYA 4NCNA 3WBKA 1P9NA 1IAQA 1FPMA 3C5CA 3BXZA 5AJXA 5TB5A 4YMUA 3L82B 1D2NA 4FW9A 4NYMQ 4AYWA 4XWAA 2AWOA 4E5UA 5KPDA 3RWMB 1X1RA 1A5TA 3P32A 1ZU4A 2PMDA 3OZXA 3TE6A 1VG9B 1W36C 3W8RA 2EFEB 1OSNA 2I1VB 5EP4A 3P20A 2IS1A 5LBIA 1CR4A 4ZCIA 1ZNYA 1IHUA 2RGCA 4HZUB 2IX3A 1KI9A 4DIEA 2UZIR 3QF7A 2E1RA 1KK0A 3MCAA 4FIDA 2ZRGA 3HR8A 5FPHA 1KDPA 4XOIA 1US8A 2WWXA 2O8BA 4OQXA 3CNLA 1OLOA 3R20A 2GF9A 3X1YA 4DCSA 1G7CA 1XTJA 3R9IA 1KDTA 5J40A 1KMHB 3K70B 2XTMA 3NIBA 3W9YA 4D25A 4F7WA 3FE2A 3KUDA 1KO5A 2G1JA 2GILA 2BKUA 1CJMA 1CRQA 4M1MA 5KSYA 4BZPA 2VA8A 2G77B 4NKRA 3AB3A 1Z6XA 2HJVA 2G9NA 1XJ0A 2KBEA 3ZVRA 4IXMA 2ZRJA 2W6JA 3REFA 2GZAA 2WOOA 1N5LA 2ZR9A 1KMQA 2EFDB 4NP6A 1Q57A 5JS7A 1COWA 3W5JA 2YWGA 1WBDA 4C2UA 1CP2A 1XRJA 1TEVA 3P1JA 3ZS9A 1RFLA 2ORWA 2F1IA 1DAGA 3QF4A 1RRPA 1T3LA 1G7TA 2IUTA 3Q9LA 4GZLA 2H16A 4IOJA 1GKUB 3RC3A 1G8YA 3H2YA 5J4YA 2VHQA 3AKDA 5JWOA 1KOFA 2QENA 3AVUA 1Z0AA 1GKYA 2NO1A 4TYQA 2B8TA 1IN6A 1E9BA 2WJYA 1AK2A 2BM1A 3VMFA 2XSZD 2G3YA 2FF7A 3AM1A 2F9MA 4P4UA 2W2TA 2D06A 2A5GA 2FG5A 3THYA 4TYYA 1ODFA 3OIWA 5EP3A 1XBTA 2XXAA 2VP6A 1JR3E 1C4OA 1GFIA 1KHTA 1ZM2A 2YKGA 4I1VA 3LBNA 5TDHA 4UNRA 1XEWX 3IPXA 2JLZA 2CLCX 1NIJA 4I4LA 1L2TA 1RRGA 5ELXA 3U7HB 2CHQA 4V0ME 3C7KA 3D3QA 2REBA 5KNCA 3VX3A 2ZI4A 3NBYC 4CRWB 4QNRA 3ZVLA 4I1OA 2NO0A 1KIMA 2OZEA 2J41A 2P3SA 4PQFA 4QJ4A 3AF0A 1SKYE 4P32A 3OIVA 5JWRA 4D0LB 1LB1B 4L16A 1RZ3A 1S9HA 2QGZA 4TT3A 4ZKDA 2OCPA 2KBFA 1WA5A 3UWKA 4NCIA 4QOSA 2BBTA 1G8PA 1GNPA 3MWJA 4DLTA 4AKGA 1UBFA 1E2EA 3IILA 2HUPA 1XD2A 4LYFA 1KMHA 2FEOA 4GOKA 1P4SA 2DWQA 1ZUNB 1KYIA 1YZUA 1W4RA 1TU3A 3V00A 5DI9A 3EASA 3B13B 3FDIA 1MT0A 3S1AB 3T1VA 4LJYA 2V8OA 5AR1A 1FX0A 2EU8A 3DM5A 3ZVNA 3A1WA 4Z1MA 1UEJA 2YWEA 4PC6A 2J87A 1KKLA 4M2LA 3LXRA 2FFQA 3ASYA 1MO3A 1XMIA 4MRSA 1EWQA 5C2JB 2XZPA 4BQSA 3Q5DA 2IC5A 1A1VA 4B3XA 4IDHA 1TADA 4Z1MD 4KHZA 1H8HD 2RGBA 1JXOA 3QKRB 2ZROA 2QM8A 2GBLC 4Q4JA 1RPZA 3VU9A 2QNRA 3LRPA 2CE2X 2FWRA 4LYHA 3DPUA 1ZJ6A 2EFHB 4TMWA 2JDID 5CB8A 221PA 2ASEA 2ZYWX 4NCJA 3LY5A 3QVUA 1BO6A 1IJFA 2FFAA 5LB4A 4V03A 2QORA 5DE3A 4WZAE 2ZJ2A 3UMFA 3PEYA 1D9XA 2EWWA 1IN7A 4MKHA 1PJRA 1KJZA 1ZW6A 2VO1A 4NL4H 2LKCA 1EFRA 1E1QD 1JQLB 2PMKA 3W3ZB 1HURA 5FOVA 2W6ID 2EFGA 3WYGA 3CX7A 4Q7LA 1A2BA 2GK7A 3Q85A 4YDSA 5FBQB 1CR1A 2P6RA 1F2UA 4AYTA 1RE0A 1IXRC 3C15C 2VHTA 2VPPA 2XAUA 4PFSA 1GNQA 1E1QA 1DBSA 3ZIAA 2YWFA 4JS0A 2QTHA 4NYIQ 3FGNA 2JA1A 4UJ3A 1E69A 2J3EA 1PV4A 3AVTA 1GOTA 3R8FA 3KQNA 3NEJA 1E9RA 1QHNA 4DUGD 3RS7A 4GRAA 5EE9A 4D26A 2XITA 1XTRA 3AVQA 2BMJA 3KXLA 4YC7A 2FE4A 2BBSA 1R0YA 4B2IA 5JSZB 3TVTA 1S96A 3SFZA 3S1AA 4BFXA 2MSCB 3LVQE 4YLGA 4EPTA 3CPHA 4Q01A 4ZV4A 5EE3A 1M34E 2FNAA 2QSYA 2Q21A 3A37A 3VR6A 5JHGB 5EXSA 1T6NA 3EAQA 4JLAA 4XTRA 3T15A 4NH0A 4EDHA 4CW7A 4NZYA 2QZ4A 1N6LA 1SVLA 3AP1A 4QM7A 2LKDA 1FMLA 5EXPA 3MJRA 5HCNA 3PXGA 3KQKA 1E98A 1JI0A 3SZRA 3TW4A 1DG1G 2F9LA 4RCZA 1MO4A 4HLQB 1AN0A 4B3CA 4BLRA 1Q12A 4Q1FA 3WHLA 1E2DA 2WAYA 1GG2A 3RWOA 4XWOA 1Q20A 3X1WA 4V0NA 1M7BA 4B3DA 2JIZD 3PEUA 4ITRC 3P4YA 4LJ4A 4UNNA 1VECA 3OEHA 5AJWA 4B73A 4DLVA 4N0EA 4YMSA 3UMSA 1YZLA 2WJJA 4Q5IA 4GI7A 1IY2A 5KSPA 3U5ZB 1GILA 4ZI2A 2O5VA 4TQUS 1NIPA 1P75A 2GXQA 4HLUA 1U9IC 4IKEA 4BLPA 1F3OA 4MDEA 1Q1QA 2ZS8A 1XWIA 4TMZA 3V9PA 1P7CA 2H57A 2A2ZA 5E7JA 5F3WB 1F2UB 2RCNA 2FGKA 3RS0A 3U60B 4DB2A 1I4LD 1Z8FA 5JMTA 5KNDA 2CMKA 3LQQA 5HKKA 1NMZA 2O8FA 4KSBA 2QBYB 1D2EA 1MR3F 4LV8B 1T3SA 5FL7A 4KODA 2OE2A 3B9QA 2ANBA 1WQ1R 2SHKA 1WBBA 3BFXA 3BB4A 3NDPA 4OK5A 3EX7C 1NF3A 1P61B 5JCPA 2D7CA 1SULA 2X1VA 4PSVA 1CF4A 4AKEA 3GMTA 2O8EA 3ECCA 2GVZC 1OXVA 1JECA 1G291 521PA 4UJ5A 2BMDA 4A92A 1SVOA 3QXHA 1YR8A 3GLHE 2JJ8A 2YC2C 2NZJA 1C9KA 3MJHA 4MRRA 4JBWA 2JJ2D 3SQWA 621PA 4C0HA 1ZC3A 1Z3IX 5DN6A 1HE8B 5JLJA 1OFIA 3SN6A 4PO1A 5H1YA 2HDNB 4HEJA 4A15A 1AQYA 2IT1A 1FL9A 1FX0B 1L8QA 3L0IB 1GRNA 1W4AA 2RGAA 4ESHA 4CEJA 4DT1A 1UKZA 3GJ5A 4L4UA 4MA4A 1U90A 1G64A 2ZSDA 1Z6YA 5FOXA 5CB6A 3TR5A 3CNNA 1G7SA 1UEIA 3T12A 2OV2A 3AF4A 1NVUQ 2WPDA 4NCHA 4TQ9A 5HZKA 4JT2A 1CR2A 3THOA 1R8SA 1NKSA 2ZRFA 4Q4JB 1R6BX 4QGAA 2AD5A 2JLRA 3QKUA 3U3KA 5G3ZA 5KTYA 2GTPA 4DHEA 4M0LA 3NBFA 3ZDQA 3JZAA 2GESA 3F0TA 1N2CE 3K0FA 1G5TA 3TIFA 2DFTA 1QHSA 2F6RA 2O52A 2ZU0C 4L8GA 2GCNA 4IEEA 4M8NE 2JLWA 1X3SA 1XTSA 4OQLA 2W2XA 2WSSD 1ZUHA 4ZO4A 2NO6A 1FQJA 2P65A 2BOVA 1N6IA 2YOGA 1JALA 4BUJA 4JJZA 1I4DD 2FSIA 2D2FA 5LDDC 3GJ0A 2ZJ5A 3SS8A 2IYLD 3RAPR 1VYVA 3TW8B 4OHXA 3VFDA 1OXUA 4OI0A 3VNVA 1ELOA 1IN8A 4P3YA 3GEEA 2QQ0A 4MGKR 1ANKA 2WSSA 1KZGB 4CT4B 4EIWA 1E9SA 3D6TB 5HZHA 4ZI3A 4AG5A 2B7BA 2J0UA 2PCLA 1Z5ZA 1Z6AA 1GDDA 3JVVA 4JBXA 5CLLA 4TMTA 2E9SA 3EZ6A 2FFHA 5FUXA 4PHTA 4D4MA 2Z4SA 5B30A 3J81k 3G0HA 2DBYA 2BC9A 1VG0B 2P2LA 1SGWA 4XVRA 1MH1A 1I2MA 1TUIA 3B85A 1D5CA 3ZQ6A 1TQ2A 1OIVA 3GD7A 3RVBA 4D81A 2DFKB 2IW3A 3WNDA 4ERNA 1YJ5A 3HU3A 4RD0A 2OCBA 1MV5A 3O8DA 3MG9A 1OIWA 2C5LA 3C16C 4O2LA 3ZZTA 1OPXA 3ZJYA 1CRPA 3FTQA 2V54A 1IM2A 4LGMA 5JZVA 4DLWA 5DHAA 2IUUA 1R8QA 4DSNA 3LD9A 4M9QA 2ZJAA 1G16A 2VTKA 4R7ZA 1MABB 3IPYA 1F6BA 1D9ZA 2RGNA 1GL7A 1NI3A 4GBMA 4DSUA 5AUQA 1IJEA 4IVPA 1SXJC 1JR6A 1ESNA 3A1UA 4Q7MB 3TUJC 3ND9A 2H5EA 1OFUX 4ON9A 1JB1A 1KKMA 3DHWC 3THWA 1AS3A 1DE0A 3MFYA 3FHTA 2F1HA 2CHGA 3T34A 5FTKA 2ZETA 4OJKA 4CEIB 2G0NA 2L0XA 3GLFA 2IS2A 4LYJA 1OT3A 1I4TD 1W0KD 3Q7QA 4OK3A 2BBOA 2NGRA 4W9MC 3EPKA 1N6OA 2W58A 1BIFA 4NYIR 2XXAB 2PT7A 3CWQA 3IHWA 4MDFA 4NDZA 3BORA 3PR1A 1AZTA 1DO2A 3MLEA 1NY6A 4UXJA 3EZ9A 1ZIOA 4Q9IA 2OFWA 1RJ9B 1ZC4A 2QPOA 1W0KA 3W5IA 3OAAA 2ZRLA 4C2TA 1OE0A 3CZQA 4AKIA 3NVAA 4IVQA 2HCBA 4ACBA 2CK3D 4N1AA 3QXJA 1ZD1A 2YNMA 4KFSA 2Z4RA 4RFVA 5DIFA 2BMFA 3QPUA 4RZ3A 4IHQA 4Z51A 3KKPA 4KU4A 1OJLA 4HATA 4M1KA 3W3AA 3CPJB 5HPYB 4JLBA 5IK2D 2QBYA 2HXYA 1IXSB 4ABYA 1GAJA 1Z07A 3I61A 5E7MA 4O0MA 3PJRA 2OXRA 2CE7A 2VBCA 4JLNA 1UKYA 1ZCAA 4NU0A 1S3GA 2P5TB 3QKRA 4PSKA 2JJ1A 4Q9JA 2PZGA 4DEYA 1YKSA 1COWD 3SBDA 1K6MA 3CRVA 1VCIA 4JLOA 4ZDWA 2Z0MA 2H18A 2C96A 2ORIA 3NBXX 4PPQA 5JFGA 3SQXA 1HE1C 4DJTA 2FX3A 2PL3A 4DEXA 4YXWD 3EARA 1E2LA 3B6EA 4AI6A 1BMFD 3QVVA 4PPFA 5CJ2A 2VHUA 3U6KA 2LWIA 2QT0A 2HT1A 4U02A 1XPRA 1R5NA 1JPJA 1CJTC 2Z43A 3N2IA 4OHZA 1P73A 1UBGA 4IFEA 2QPTA 3FYHA 4HAZA 1N25A 2QP4A 3MAAC 4D6PA 2ATVA 3FHCB 4BFTA 4WAUA 2V9PA 3NXSA 1RKBA 3RYTC 3PIRA 1LFDB 1L4YA 2ZRMA 3T35A 3K9LA 1Z28A 4JT4A 1ZM9A 2H7VA 3PITA 2JLYA 1NJFA 1U98A 1EFHA 1QHIA 2V4ZA 1JR3D 1JAIA 3F5FA 4MQBA 1F5NA 1T8TA 1DAFA 3K0AB 4QNMA 1R5BA 2ZSAA 5EE0A 3FMIA 1W7AA 3K0SA 4LK2A 3JZMA 2KSQA 2QAGC 2ZE8A 3EIEA 1SVWA 2XTNA 1YZQA 3KJHA 5ANRB 1MKYA 1OYYA 4EPXA 4N0DA 2QTFA 2ZUCA 4QHYA 2N42A 2QN6A 2QAGB 5FBLB 4B48A 2N1BA 3KZ1E 3I92A 2Q3MA 4A0RA 1G5PA 1U81A 1OHHD 3OIUA 5BYKA 2IXFA 1TTTA 3U3MA 3FMFA 5CM8B 5J4HA 5A0FA 1P2VA 2FFBA 3BIFA 2QG6A 3HPQA 4KLZA 3RLFA 1BS1A 1OH8A 4OQMA 4TMVA 1XDBA 3KXIA 4RVCA 3B7GA 4M1OA 1VHLA 4JZKA 3IEVA 1AS2A 3Q7PA 1AKYA 3B8HA 2QMUA 3EWSA 5FR2A 1GL6A 4NBSA 2R6DA 3SHFA 5L3VA 3GCGA 4D80A 5DI3A 1X6VA 3PCRB 2PJRA 5M04A 3QQ5A 2PLFA 4KYUA 5HR5A 2IK8A 2ZTSA 5E7IA 5BN3A 1FQKA 2HT6A 5JJIA 4BFZA 3R8CA 4HDOB 4OI4A 4QRHA 4EPVA 2J1LA 1FMJA 1L4UA 5L3QA 2JDIA 5CYOA 3WP1B 2JLVA 1E2NA 3BAFA 5C46F 1ZM3A 4ZCLA 2GA8A 4QGGA 3RABA 4NCKA 3K09A 2BCGY 3TAUA 1S0UA 1J99A 2C2HA 2QMHA 2QM7A 2ZVQX 4Q1AA 3ADCA 1XJQA 1TQDA 1XD9A 5EUMA 2QRNA 2A30A 4MGYR 2C9YA 2R8RA 4V0LA 2W6IA 3NBZC 2VP2A 5JBQA 1E99A 1UM8A 1WE2A 5LD2C 2FEMA 1U8ZA 1FUKA 3CF6R 1G19A 3CM0A 4URZR 3SBEA 3I73A 3LWNA 4J0QA 2F7SA 1BKDR 3MGCA 4QBIA 3SFVA 4Y0AA 1W36B 4IDOA 2EW1A 5BXQC 4M4SA 2IEYA 4IFBA 4JLKA 5FI0B 3K70C 2IYTA 4B3BA 5GJCA 1CJUC 5KSZA 3GLHB 3T5GA 5CIQA 1KDOA 4Q00A 3K8YA 4Q7KA 4WXPA 2EVWX 4CEHB 2GEUA 4HLUC 3RDPA 3LX8A 2PCJA 2QAGA 2YYZA 1E9CA 1KNXA 2FSGA 4PX9A 4HUQB 2UKDA 3P27A 2IYWA 4H9GA 4CZ2A 2ANCA 2HV8A 1ZP6A 3VU9B 3FMOB 2ODBA 1TF5A 1G3QA 3VHXA 3OFND 1VKJA 4GZMA 5IK2A 2BWJA 1D2MA 3RANA 4F93B 5JJLA 3EC1A 4I99A 1E32A 4PHFA 1T5LA 1HH4A 1Z2CA 3IKJA 3OEEA 4JLVA 3SJBA 3RNLA 1SVSA 3U44A 5AUOB 5FL3A 2Q9BA 3ADKA 2JASA 2ODEA 3CWZA 3GEIA 4Z8YA 5D3MB 4KI0A 4JJKA 4KSCA 4C0AC 1VDZA 4PO9A 3DEFA 3AF2A 2A3RA 4IDQA 3SE0A 4OJQA 1IQPA 3UKDA 1H8EA 3R9WA 2J7KA 4Q9HA 3BB1A 3BFKA 1HV8A 5E95A 1GRQA 2JAQA 4GPTA 1OIXA 5B58C 1DS6A 1PUIA 4NMMA 2R44A 3OE7D 4LCBA 3ZVMA 1FFHA 3CR8A 1WDTA 5FR1A 1II8A 1WP9A 3EA5A 1OV4A 4LJ7A 4EJSB 4PZZA 3L0SA 1Z47A 1YZTA 3B1WA 2ZITA 4CT5A 1KAOA 3UG7A 5CIWA 1G21E 2AFHE 3HPRA 1G3IA 1AM4D 1O3YA 1W46A 3RS3A 4MUAA 2QEQA 4Q7JB 1U9IA 4Q4HA 2YOFA 2C99A 3HJNA 3LBIA 1W47A 2YWHA 2ZJ8A 4TYPA 1R0XA 1UBCA 4OQFA 3RRZA 3AVVA 2ZRCA 3K0FB 2YOHA 1G6HA 1E2QA 1T4GA 1SXJB 4A8JC 5FPSA 2C98A 4EFMA 4M1WA 3SJCA 721PA 3PEVA 2AKYA 1M2OB 3GLGE 1LF0A 1TPZA 1Z06A 2FN4A 4A2WA 1E2GA 4DLUA 4LHYA 4Q48A 1NY5A 4HUQA 2PT5A 4LZZA 4YMWA 3LQRA 5K8UA 1N6HA 1DO0A 2EYUA 3T61A 1EFCA 1FOEB 3T1QA 3U2QA 2ODNA 3VX4A 4D82A 2HF9A 4YONB 3Q5EA 3ZGXA 2QRZA 4URYR 2RHDA 1OHHA 1N5JA 2D4HA 2VIIA 3CF0A 4GNKA 3TK1A 2DYKA 1RC8A 4G0NA 2KJQA 2QY9A 2WJVA 1E2JA 4U00A 4DCVA 3WRXC 2X8AA 1HQYE 5C18A 2RGEA 4A0GA 1GWNA 4RY2A 2RGNC 2WMOB 2MMCA 1UKVY 2NMVA 3DDCA 1DAKA 3LDAA 1HA3A 4QHTA 3KJGA 1JPNA 1G18A 1KSJA 1XXHE 4B47A 2AHOA 4NTZA 3VR4A 2V6IA 4LUCA 4CEIA 3KJEA 3B1ZA 4GOXA 3LA6A 5HTKA 1LF5A 1Z0KA 4Q1CA 3TUIC 5CDFE 2W83A 3AP2A 1CS4C 3BS4A 4X8HA 2MSDB 4FMBB 1KTVA 1XMJA 1QHYA 2PEZA 3P26A 4G5OA 2XX3A 2O8FB 1G1MA 1E1RA 4ACAA 5FFMA 4A2QA 1ZMXA 2R6GA 2ERXA 2J45A 3BE4A 1W4BA 3GJ8A 1Z0JA 4V0OA 5J4LA 5JHHB 3EZ7A 1XFAA 2CL0X 1E79D 3KFVA 4CIDA 4KO8A 1W48A 1M7HA 4MYHA 2GRJA 2XSZA 3AVYA 4FD2A 3M6AA 4OYHA 3O8RA 2GF0A 2O8EB 4O2RA 2LCFA 4PTLA 3ZD6A 3GEHA 4AWXA 4C7OA 2AK2A 4TLAA 3NKVA 2P6NA 1NVXQ 3A1TA 3N2EA 1YZNA 4PC7A 1IONA 1E3MA 4ASUD 2HXSA 3ND8A 8OHMA 5H8WA 3GJ4A 2FV8A 3PUWA 4FINA 4HDQB 4EPWA 4FMCF 3PUXA 1NKTA 5G53C 5BN5A 2FGJA 3SOPA 1ETUA 2JLSA 5FBRB 4CVNA 3RSOA 3O8CA 3D7MA 3EZ2A 3AF1A 4HLDA 3L0OA 4HAWA 3A6PC 1NVVR 3I3SR 2VRWA 1G20E 3CX6A 2YZ2A 4OI2A 3A1VA 3GLHA 4ZIRA 4JL5A 1LVGA 2GCOB 2ZRPA 1E9FA 5EP1A 4A4DA 1T0JB 3X1DA 4OL0A 3FKSD 2GEDA 4CEHA 1NLFA 5FTLA 1ZUIA 2EQBA 2GHIA 2OAQ1 4NYJQ 1W0JA 3HP1A 1X1SA 2J59A 1ZNWA 4D4LA 4Q03A 4OK6A 4RZUA 4G3XA 1DADA 4BGDA 1VIAA 2QUZA 4XVUA 1NMYA 4P4SB 1QVAA 2H1LA 4X8OA 2BIFA 4XWKA 4S2EA 4KJZA 1XZQA 5DO9A 1E94E 3QI2A 5K8TA 3GFPA 2GXAA 1OKKA 3Q3JB 5G41A 4A1FA 4A0FA 3EIHA 3BK7A 1SVIA 3ONWA 3AUXA 1DVRA 5SZJA 1SHKA 4JLJA 1FP6A 1LV7A 3QKSB 2ZSBA 4EJSC 4XD7D 4TSFD 3QUSA 4OHWA 1LY1A 2AFIE 1OKKD 5C4GB 4BE7B 2IXEA 2GNOA 4B2LA 4MKIA 4LC1A 4TTQA 5BW8A 1FZQA 4LHVA 4O25A 1O87A 2ZJOA 1XTQA 5KDDA 2ZSEA 1IY0A 3OE7A 4PPNA 4L15A 1G9XA 1RRFA 4HI0E 5CJPA 2J7PD 2FU5C 1E2MA 3VR3A 3FPAA 2GXSA 2J0UB 2ZJBA 4LBYA 4QJ3A 3SEAA 3X1XA 5LD2B 3QJYA 1Z0DA 2HLDA 1A2KC 1XEWY 1GSIA 4P0TA 2WTUA 3UPUA 1NNEA 4C7OB 2IYZA 3TSOA 2BM0A 2AXPA 4BZQA 4KXFB 3CZPA 1QG2A 2QE7D 4HB2A 4JVLA 1OFTA 4TWZA 3DZ8A 1FNNA 2BV3A 1EG7A 2OUKA 2RB4A 2WWWA 4FMDF 2OILA 1XD2B 4Q4HB 3REGA 2WOJA 2QROA 3RS5A 3BJIC 4G5QA 4R98A 3VTKA 5HE8A 4TZ6A 1II0A 3ZS8A 4BEJA 1RYHA 1T5IA 3L2OB 2ZS7A 3VQTA 1VHTA 4C0BA 2JJ2A 4A0HA 3EWAA 1MRSA 4DCUA 1AZSC 2GCOA 2ZJZA 1UJ2A 2A5DA 4PHHA 3X2SA 1R10A 2VP4A 1MABA 3KDSE 3NWJA 1TUEA 5JWHA 3FOZA 4JLPA 3TMKA 2OLKA 1XB2A 2NO7A 1HT1E 4MITA 2GJ8A 1VPLA 1GZSA 2WWIA 4F91B 4GOJA 4HAYA 4PC1A 1E2KA 3EG5A 5JI3E 2AD1A 5BN4A 1AGPA 4RZ2A 2GJKA 2CL7X 5CYPA 5LPNA 5FBWB 2GEVA 5IDVA 2CLSA 4WIAA 1W49A 1NVWQ 2WKPA 5DI3B 4ESVA 2I1QA 4LY6A 2CCGA 4MGZR 3L43A 1YU9A 2C95A 2IHYA 3KL4A 3W6OA 1ZYUA 3UWOA 4QM6A 2ZRBA 2ZRNA 2WHXA 2W0SA 5L3RA 4FN5A 3K9NA 2P5SA 2WWGA 3EPHA 5JS8A 1Q3TA 2ZI5A 1NSFA 4IEIA 3THXA 1E0JA 5CDFA 2WJIA 2R65A 3U3JA 1S3SA 3H86A 3BERA 1GKIA 1XP8A 3T06B 3OEHD 3LBHA 2F43B 3WBJA 1QG4A 3CRMA 3DO6A 4URUR 1HUQA 2FPMA 1PLKA 2WWHA 1UF9A 2GK6A 4LC0A 1ZNXA 3ZH9B 1IY1A 2WICA 1EK0A 2MMGA 1GP2A 1KSHA 2GXUA 3PENA 5FPTA 2D74A 3K0CA 2RHMA 4LBVA 4DDVA 3TBKA 4W5JA 2WIAA 5K8LA 5HE9A 2WWFA 1RW4A 5KHOC 1PLLA 2CDNA 5AK0A 4PAMA 4EPYA 4WW0A 4RFSB 4QKQA 1U8AA 1E0SA 4BLOA 3AVWA 3QY0A 4BWYA 2D7DA 1E2IA 1Z0FA 2IYRA 1U8YA 2ZM5A 3R7WA 1R5OA 1QF9A 1KI3A 2X2FA 2ZRIA 4HB4A 3TVDA 1XCGB 2BJWA 4DC9A 4QGFA 4LSGA 4ZIRB 3TRFA 1U0HC 3GJXC 1U2RA 2ZAMA 1YQTA 3A4MA 3B60A 4UXIA 2V55B 2XZOA 2ZE6A 4KV9A 3RHFA 2HYDA 2R6CA 2YHSA 4I1SA 1FUUA 5FOWA 4CGZA 3AKCA 1VYUA 5FH9A 1NN5A 1E96A 2XNDD 1CLUA 1TEXA 1VG8A 1PUJA 3BRWD 2QL6A 4JSYA 2XTZA 2P67A 3IHLA 1P62B 4QG7A 3U44B 4PC3A 4TL6A 3E1SA 2QU8A 3F3YA 4PR0A 1UKEA 3KB1A 1JEDA 1UDWA 5FOTA 4W7SA 4WZBE 1YR6A 3CF2A 1OXTA 4HUTA 4DDTA 1TF7A 2VHJA 1N5KA 4M22A 4TMXA 3ZYCA 4YMVA 3QG1A 1KK1A 4GMXA 2ZYUX 4TMKA 2O8CA 4ARZB 2CHVA 1NG1A 1Q22A 4D4JA 4DRZA 4HDCA 3V4FA 4KBGA 2OAP1 3QENA 5EQTA 4LI0A 4US0R 1KJYA 1E2FA 3WMGA 1HTWA 5TXGA 5AJZA 5AUNB 4Q21A 1JEEA 4LBWA 4AG6A 4KVAA 5EJEA 3A1SA 4PAQA 5AJVB 2JLUA 3VKWA 3CNOA 4QHSA 2QQEA 2ECKA 4C9BA 3I5XA 3V4RA 5GADl 4ZPXA 2ZAOA 4MYUA 4PZYA 1E6CA 1WRBA 1RRCA 4ZDKA 1OH6A 3PEWA 1DARA 2G1KA 2MSEB 3OHMA 3U4QB 1KGDA 2ZI3A 3AH8A 1KI6B 4EAQA 4KVGA 4TQAA 4TZ0A 1JBKA 2NIPA 3CH5A 2OFXA 2ZXUA 5JJKA 2O8DB 2ZYTX 1KSFX 3L8ZA 5JRZA 1G8HA 3VR5A 2WIBA 2OESA 4TTPA 4V02A 3ZZ0A 3Q8XB 4DXAA 2CVHA 1Q21A 2J46A 2REOA 1SQ5A 421PA 4FWTA 2J5XA 3VKGA 4JL6A 4RD6A 1YZGA 2WZQA 4CEJB 3QBVA 1XEXA 3N5CA 5C1BA 3UATA 1IBRA 2ZR0A 1DAIA 3TGPA 1G4AE 3NDBB 5G40A 1LW7A 2YINC 4DDUA 5KO2A 3CX8A 1LNZA 1NMXA 2PX0A 4L9WA 5FPKA 2ZSFA 4AY2A 2ZEJA 3C8UA 3SU8A 1Q44A 3U7GA 2IS6A 5CITA 1ZM7A 2CLDX 5IRCD 1R0ZA 4PPGA 4HAXA 3GFTA 1ZM4A 3I72A 1XJCA 5GJVC 3HWSA 1K5DA 3EZFA 1IN5A 3BD9A 1N0VC 3JVUA 2C78A 2OG2A 1N6PA 5E4FA 4Y0VA 1JJVA 3SJAA 1OB5A 5F9FA 4LHWA 4DKXA 5KDLA 4FCTA 2A5YB 1JR3A 3LO5A 5LB2A 1G5RA 1KZ7B 2ZRDA 4GT1A 1M1YE 1AIPA 1EFRD 4MYTA 1KSGA 4MUBA 3TSWA 4A9AA 1ZD8A 2R9VA 1YRAA 1KI2A 4EQ6B 1NLYA 4D0GA 3SHWA 4B43A 3DOEA 1VG1A 4LYAA 5TY0A 3QBTA 1N6KA 2IYYA 3A58B 3ICEA 3SC3A 1P2UA 3BOSA 3DL0A 4IRUB 4LBZA 4PZLA 4I81A 1GUAA 2ZUDA 2VYFA 2REXB 1WMSA 1YR7A 1KI4A 2V7QA 1T8UA 1E2PA 3KUCA 4JYBA 1VCMA 5L3SA 2WJGA 3QXCA 4TLCA 1KI6A 3ZD7A 3LFUA 2CK3A 4KFTA 2W6JD 3UANA 4W5HA 4RZXA 4DSTA 1DEKA 1HYQA 4LJAA 3ZLJA 4MRPA 4PAOA 2BEJA 1EXMA 4OI1A 4GDFA 1XF9A 4LWZA 4JLMA 1NLZA 2VH5R 4BZXA 4DB4A 2KWIA 4IOMA 1P2TA 1S1CA 4WXRA 1PZNA 4A8JA 4PQRA 3QKSA 1Z22A 3UG6A 1CIPA 2ZR7A 1XEXB 4EFNA 4BLTA 2VP9A 1AS0A 1UFQA 2R6FA 1XCMA 3MWLA 1II8B 4BFWA 1N3BA 3BH0A 1OYWA 2P0EA 4LV6A 3QXSA 1PLJA 2GAOA 3K0CC 5IT5A 3CR7A 1T0HB 2OBMA 2FSFA 1ESMA 2E87A 3KKQA 3C41J 4AC9A 2J9RA 2BDTA 2KB0A 4GSYA 4URWR 4ZDIA 4GL2A 3IO3A 1V43A 4QBFA 2FPKA 5DGXA 5L3QB 4JMPA 1BYUA 4P4SA 3KQHA 4V0MA 2QT1A 2RGGA 5JEEA 1E4VA 4TYWA 5FBVB 3IQXA 1E1RD 4MKFA 4E09A 2RH5A 2PBRA 2ONJA 4B74A 3THWB 3FWYA 3IIMA 2PJZA 3GJ6A 5J47A 3GLGB 2QMOA 4DLYA 3LX5A 2R2AA 1J8YF 2R62A 2QTVB 3FVQA 4U5XA 3U61B 3MWYW 3GJ7A 1UBEA 2IEZA 3BWDD 1MO6A 1Z29A 4US1R 1VCNA 4TN1A 1OW3B 1AKEA 3GQBA 3AEZA 4ASUA 3I32A 1J7KA 4HSEA 4LX0A 4EFLA 3WYAA 4Q4AB 4IW3B 1GL9B 4F4IA 3RRYA 2CXXA 4M1SA 4IOLA 4S35A 4Q47A 4TT3D 4OHVA 3LV8A 4QBGB 3CKLA 1DAEA 2O0KA 2JEOA 5GJBA 3BH6A 1IN4A 2CCJA 1E9AA 5FUVA 1VCOA 4JKIA 2AL7A 3FKSA 5DYGA 3U3OA 2PX3A 2A5FA 3T1OA 1FW6A 1KI7A 3PFIA 5BYJA 3LAWA 4FMCB 2B21A 4KFUA 3ETLA 2IHBA 2VSXA 2JGNA 4QL3A 4DIDA 4RD4A 5GVSA 1A82A 2XJ9A 3EW9A 4Q1BA 4R2HA 3PV0A 2ERYA 4YDHB 3TQFA 3WMEA 4A8JB 2Q9CA 2NTYC 5DN6D 2AXNA 5KYKA 4LJ9A 1N0WA 1HQCA 2I3BA 3QE0A 4MRNA 4LV5B 2O8DA 3BB3A 1NG9A 2DCUA 5D3MA 2V6JA 3I5YA 1HY3A 2DY1A 3QF4B 1N6RA 4NYJR 3UXMA 1Z6GA 3LXXA 3H84A 3SR0A 5DNYB 3GFOA 4IXNA 5JRJA 4W5WA 3NC0C 3WHKA 3W6NA 3SJZA 1W4CA 1WCV1 3GJ3A 2ZI7A 2G83A 2OT3B 1GITA 4ZCMA 3NHBA 3QXXA 4MH0R 3SYKA 3H4MA 1G8GA 2OCYC 1HEIA 3WMFA 4BEBA 5DLQC 4B2PA 3QPVA 4XVQA 3L8YA 4F92B 4CF7A 3T1TA 2FOLA 2F55A 4BPBA 2CEAA 1HT2E 2RKOA 4C0SA 4O3MA 3EXAA 1KO7A 3MSXA 4RD2A 4DLXA 4ZDJA 4UNSA 4H1UA 4E07A 3WNBA 2AK3A 5L8VA 1LS1A 4RKFA 2GVDC 2Q9AA 3IUYA 3CPEA 1J8MF 5DSZA 3TLXA 4QC2A 2AX4A 2RGXA 3LW7A 1R7RA 4JL8A 5J4VA 2GAAA 2VHCA 2WJHA 4M1TA 4DUGA 1JQJC 3O47A 1P9RA 4Q4AA 4RFSA 1TX4B 1ZNZA 2QE7A 5D3QA 1VIYA 3EPJA 1KO1A 4US2R 3NTUA 1G3RA 4N3NA 2FJUA 5EXTA 2FSHA 3R7WB 4LHZA 1XMVA 3ADDA 3IBGA 5B2ZA 4EQ6A 2C04A 3UIEA 1W5TA 4IJMA 3EC2A 4BLSA 1FTNA 2OCAA 1KO8A 2C8VA 2HEIA 1N6NA 2BCJQ 1E9EA 2IYVA 1H65A 1OXSC 4TTRA 2V3CC 3CB4A 2IYXA 2C9OA 4D4KA 4QXAA 1T3HA 4QFMA 2GWHA 2XJ4A 1CEEA 4E22A 2WKRA 3BC1A 4RSGA 4DCTA 2EWVA 3D8BA 5L3SB 2PZEA 1MO5A 3KQUA 4GMDA 4JLDA 3HDTA 3R9XA 4B44A 2BMEA 3GLIA 3AP3A 2F3TA 3TNFA 1P6XA 1F48A 4AKHA 1TMKA 5KSOA 3QEOA 1W5SA 1DPFA 4B71A 5EXXA 1P72A 2OSBA 2QA5A 2KE5A 2QPAA 4II7A 4B35A 1W2GA 1CXZA 1WF3A 2Q0HA 1WXQA 3TR0A 3N70A 3P4XA 4IOKA 3C5HA 4V0KA 4AURA 1YZKA 2QP3A 1E4YA 2JLXA 4HAVA 4C0KA 1H8HA 1GVNB 1DTSA 1Z2AA 2YJTD 4WZ6A 1OF1A 1Z08A 4ILEA 5EP2A 3TJZA 2J0QA 1E79A 3B9PA 4A82A 4EKDA 2O0JA 1J70A 1Z6TA 3I8SA 3AKYA 4LPKA 3CRRA 1VTKA 1QDEA 1TAGA 3I1FA 5DISB 2AR7A 3M0EA 1B0UA 4FCWA 3W90A 1LTQA 4XIGS 4KYIB 4JSTA 2ZPTX 4B6EA 3NC1C 5FL7D 4BASA 3UMRA 2ZVPX 2XNSA 1DAHA 3GLGA 3VHLB 2DR3A 4LJ5A 2DFLA 3LNCA 1IXZA 1Q1EA 4R9UC 3LH5A 1NVVQ 3LVRE 2XZLA 1XU4A 4NONA 4C3ZA 1AA9A 1M7GA 2VLIA 2O8CB 4G5RA 2NOAA 1V5WA 2VSOA 4KCGA 3WY9A 1XNJA 1XXHA 2D3WA 5TV2A 1W36D 1J90A 3KX2A 2CCKA 2CJWA 4KAXA 3UK6A 1T91A 3OF5A 2J7PA 3DMDA 3QEJA 3IQWA 1SHZA 2F3RA 3EIQA 3B1YA 3ZIAD 3MMPA 1QBKC 3QNUA 3RRMA 2OBNA 1NP6A 2PLRA 3QSYA 4C0JA 1MOZA 5H68A 4OQNA 4EPRA 1JNYA 1TQ4A 1F60A 2ZRHA 1OXXK 2ZS9A 5JCZA 5BQ5A 2ZUBA 4AK9A 4B6FA 3KKMA 4AIIA 4D2IA 1M8PA 1UADA 2IA5A 3QG5A 4PSAA 3TH5A 2V1UA 4JVMA 4XJXA 2PEYA 1CBUA 1EESA 2C77A 1XCPA 1AJEA 1ZAKA 3W6PA 2FDCA 2OEPA 121PA 4P33A 5FTMA 4B33A 1G7RA 3HU2A 1S8FA 2GETA 1QHHA 4D0NA 1UPTA 3WYFA 4JKYA 1JAHA 2WPDD 2OFOA 2YC4C 5F9HA 1SVMA 1T9HA 4XD7A 3VAAA 1N5IA 1X8LA 3DKVA 5KUTA 2ZU6A 2GJSA 4TSFA 2GZHA 2CBZA 1XMSA 4AD8A 4LOAA 1K5GA 1M6NA 1AGRA 4MKGA 3W34A 3M1IA 3U3RA 2WBLC 4ZKEA 1XX6A 2JIZA 3RC8A 2RMKA 2AN9A 4K8OA 5HCIA 1YHNA 3NG1A 1ZINA 2WAXA 5CLQA 3F8TA 2UVQA 3FMPB 5EUQB 1K8RA 4KFRA 1OFHA 1ZD9A 5KOYA 1XD8A 3A36A 3K09C 1DOAA 4C0LA 3GLFB 2IYQA 3QIAA 1OH5A 1US8B 1OH7A 1S4QA 2PZFA 4TYNA 1Z63A 4PHGA 3MRSA 2GCPA 3AKEA 3CH4B 5H70A 4BFSA 1VMAA 4Q1DA 2A7QA 1CU1A 3L0PA 2K5UA 3MD0A 3SNHA 4JVNA 4RD3A 4P4TA 5SZKB 3IIJA 4CYMA 2RAPA 4XTCS 2ZREA 4FI3C 1BOFA 4PO8A 1UDXA 3NH6A 3CRW1 4WBSA 3LLUA 4IDPA 3WP0A 1SXJE 1OB2A 2TMKA 1P5ZB 3ASZA 1U0JA 3IO5A 2VF7A 3BBPA 2FMXA 1EX6A 1W2HA 5F98A 4QBHA 3KKNA 2VP0A 3AVOA 3MUFA 2BEKA 3CLVA 1KO4A 3MWKA 3U7FB 3K0EA 5E3HA 3FB4A 4DDWA 4RJLA 4B3GA 2HYIC 4UNQA 4BFVA 1G3MA 5FTJA 2W00A 1J2JA 1MRNA 1X8JA 3TUZC 3FFAA 3IDQA 1G4UR 1P2SA 1QHHB 2X2EA 4KITB 1AQUA 4C4PA 2X19A 3I62A 1R2QA 1C1YA 2IUSA 2OHFA 2ZQ5A 5FI1B 2B8WA 2ZANA 5JI2E 1NL3A 3KTAB 3U7EB 4M1YA 4HAUA 3GLIB 1F2TA 3GPLA 3FHOA 3ZQJA 1CJVC 1XEFA 3K1JA 2XOKD 5JSZA 1JJ7A 1X8KA 4UKDA 4URVR 4RD1A 1H8ED 5CK4A 3CONA 4NPHA 2QP9X 1NBMA 4DZZA 3I4LA 4Q4LA 4DLZA 5A4JA 3LW8A 3A4LA 2ZI9A 4XSGA 1R0WA 4BFYA 4B34A 3BH7A 2XOKA 5CK5A 2QGNA 2GJAA 2DWPA 2OM2A 2XNDA 5EE5B 5TVKA 2ATXA 3NH9A 2NPFA 1G8FA 5TARA 4E03A 4EUNA 4H1VA 1XTIA 4DWJA 1Y3AA 2G0TA 1P9WA 4L9SA 4DBLC 1NBMD 1TQ6A 2F43A 1X86B 4HB3A 4LPSA 4X8MA 3SI7A 3VR2A 3U4QA 4MRVA 2A5JA 2OO7A 1E0AA 3BGWA 1QHXA 4Q18A 1GRRA 4OHYA 3KKOA 2GZDA 3HYRA 2NO9A 5FOSA 3NEYA 1N0UA 2IYUA 3SYNA 2OBLA 1EWRA 1ZCBA 2ZJYA 2CNWD 4HLCA 4G5SA 1Q3HA 2ZE7A 1CJKC 1RYFA 4WOPA 4G1UC 1YR9A 2NQ2C 4NHOA 2O0HA 3CRQA 3RSLA 3WNCA 4JYCA 2V1XA 2Q3FA 3ZZUA 3IGFA 1XZPA 2DHRA 1P3JA 3AGPA 1ZBDA 1UAAA 4TLEA 4DLSA 3QPWA 2CVFA 2P6UA 2H92A 4IVRA 4BFUA 2IS4A 821PA 4PANA 3EPLA 1BMFA 4GP7A 4FCVA 3G5UA 1NBME 2GKSA 2QI9C 4BRWA 3B82A 3TAHA 3T5DA 1G6OA 1M74A 1A7JA 3FFBA 4M9XA 3QKTA 4I1UA 5GJWC 4POAA 1E2HA 2NG1A 3FKQA 5FOUA 4B76A 5B64A 5IF9A 5EZ5A 4QGHA 2OXCA 4QJ5A 2GDJA 3TSZA 4LRWA 5DYIA 2ODWA 3TQCA 4Z8XA 4BRUA 3B2EA 4CDGA 1F2TB 2G88A 2VF8A 2IWHA 3CUEF 2UZ3A 3RRNA 2WSMA 1Q1BA 3DMNA 1EGAA 1R4AA 1EFUA 2D62A 1Q1ZA 4Q1EA 1S9DA 2R6AA 5UKDA 2WWYA 5KDOA 2Z6VA 2ZRKA 1KI1A 3VNUA 3TKLA 2IYSA 5KPJA 5J5CA 1QZXA 5EZ6B 3SDZA 4Q66C 1DG3A 1GTVA 1EX7A 3PG5A 4TLDA 2FZ4A 3I8XA 4GP6A 2NZ8A 3E2IA 4F4CA 4URXR 1KAGA 1SVKA 4FXPA 5FPYA 4HB0A 4L5BA 4TL7A 3CIOA 4RCYA 3D31A 1TU4A 3PQCA 4U7DA 3DOFA 5AJYA 5IHPA 5AUPB 2D2EA 4PQYA 2YVUA 4ARZA 2ONKA 3RS2A 1CTQA 4NE2A 2IL1A 2EYQA 3PUZA 4DT1B 5G3YA 2G6BA 2B92A 4BECA 1Y63A 5P21A 1NSTA 2XB2A 3DKPA 3DZDA 4M9SA 1GNRA 3B5JA 2VEDA 4FMDB 2A78A 2J0VA 2XB4A 5JECA 1SKYB 1RIFA 2HF8A 2Q3HA 3B78A 3B1XA 4P31A 5AWFC 2Y8EA 3PUYA 5KU1A 3AQ4A 5B57C 3AGQA 5HKKD 1QVRA 3QOFA 5BWMA 4R71A 3KFXA 1RJ9A 2C03A 4KBFA 4PC2A 1G17A 1YRBA 4M9ZA 4JVSB 3HU1A 2F1RA 2ZE5A 3AV0B 3AF3A 3OAAD 2FZLA 4A36A 3K70D 1CULC 1NN1A 2A9KA 1FNMA 1U0LA 2FH5B 3A8TA 4K46A 4R2IA 4UQOA 3GLIE 2JCSA 1ZRHA 2C9CA 2HCJB 3Q72A 4K81B 2WMNB 2J0SA 2H8KA 2QSZA 1E0KA 2V7QD 3IEUA 4IDNA 2BVNA 2CL6X 2IWRA 2VQSA 5SZHB 3B1VA 1LS6A 2WKQA 3PUVA 4B3FX 4DCNA 1S1MA 4A2PA 3LLMA 1W0JD 1L7VC 3E70C 2WVJA 2FA9A 3G82C 5EE1A 4JBYA 3E5HA 1ZVQA 1QHGA 2VSFA 5DHFA 5J4KA 4HYYA 3U6BA 1VYTA 4G5GA 1II9A 1W44A 1TF2A 2HJGA 2BBWA 4XSHA 5K8IA 4OBEA 4YXWA 2XGJA 1S2MA 1U94A 1D6JA 4MGIR 4F38A 1ZU5A 1QRAA 5FUWA 1KJWA 2KI5A 1A4RA 1CKEA 2I4IA 2X77A 4C0QC 3EA0A 1BH2A 3GLFE 2B6HA 2GBLA 1XPUA 3K9GA 3ADBA 2IF0A 1E9DA 3HYTA 2F1JA 3KTAA 3OESA 2Z5FA 1FP7A 5CM9C 3THXB 1Z0IA 2RGDA 4OKSA 1XXHB 1NN0A 1PVOA 5F2EA 4Q19A 1Q0UA 1G41A 1JXMA 4UXHA 1EFTA 3VR1A 3RS4A 1XPOA 1KY2A 4EJSA 1GM5A 1CR0A 4DVGA 2VL7A 1IOZA 2FPLA 2ZIAA 4RKEA 3KJIA 5TMPA 1RVDA 3AVPA 1KK3A 3OIYA 3SYLA 2NPIA 3K53A 3BFVA 3A4NA 3CO5A 3NHAA 3C4JA 3K0AA 1SXJD 4WA7A 1SKQA 2HLDD 3M4YA 1GIAA 4DLRA 4XH9B 5GVRA 4Q9LA 3AVXA 2IF2A 4MYCA 1TNDA 2ZI6A 2AKAB 4G01B 3WXMA 2DPXA 1DAMA 1NN3A 2JJ1D 4F4JA 2OLJA 4YMTA 3CW2A 2ORVA 1KI8A 1ZIPA 2DFNA 2O8BB 2ZYVX 4HZUA 2BJVA 3GP8A 3K9HA 2QAJA 4AYXA 2CNWA 4HZIA 4BLQA 2H17A 4NYMR 4A6PA 1ONBA 1SXJA 1WB9A 2BKEA 5JEDA 2IXGA 4UNPA 2DB3A 5FUYA 5A5GA 4LDJA 3DM9B 4LJ8A 3W8NA 1KDRA 4M21A 4B75A 5C4MA 4TL9A 3CBQA 3OEED 2CJWB 3H0KA 3HR7A 4TLBA 3OFNA 2GJ9A 3KXKA 3KB2A 2WM9B 3IIKA 5FTNA 3VKHA 1G3UA 1XTKA 2BHRA 3DVLA 4B32A 3AUYA 2W0MA 4DSOA 4FWIB 1SZPA 2ZRAA 4TL8A 5DH9A 1KY3A 4GFDA 3O8BA 2N46A 1KNQA 4Q02A 2DWOA 1FTSA 2IBMA 2Z83A 1YE8A 3H1TA 4PXAA 4LHXA 1NJGA 3PVSA 4Z54A 6Q21A 4Q9KA 2VP5A
chains in the Genus database with same CATH superfamily
1ENPA 1I9CA 2YV5A 4D44A 3DLBA 1R88A 4RKQA 3KYBA 3MPOA 3BWMA 3ENZA 2PYDA 3AR2A 5HF5A 2ZJ6A 1P60A 4YQFA 2Q6TA 5A5DA 5JBIA 1HWYA 2I0FA 2A1UB 1IZ0A 3W8DA 1YCHA 3FWZA 3L7NA 4L07A 2AWNA 5KX5A 2A8YA 4G8CA 5SZIA 3OZGA 4YUVA 3BL6A 3IT1A 2EFCB 2JLQA 1AKVA 3CJTA 3V1TC 4GPIB 1H6AA 3AO0B 5DLDA 4D79A 2RAVA 3QZUA 5JPCA 1AA6A 3HWWA 5EZSA 4M53A 2OYRA 2W22A 3CLRD 3EWIA 3F4LA 4MEBA 2YIJA 4HDSB 5TQVA 1E64A 5TB5A 3C5CA 3BXZA 1EH5A 1XCLA 2QDXA 3MCVA 4I5GA 3OIDA 4J0HA 1LDGA 4UTZA 5MGBA 3UJNA 4XWAA 1I7QB 4J6FA 3TCXB 2AC2A 3RWMB 1X1RA 3LBYA 2Q1UA 3DD5A 1KP9A 3OZXA 3E2PA 4EMSA 1OTHA 1TM3E 2EFEB 2O7RA 3W8RA 1OSNA 3ZNQA 3E7FA 1U5AA 3A25A 5EP4A 1FFSA 4XFJA 1BC5A 1Y8QB 1IHUA 2CZGA 2RGCA 4H60A 3GJQA 1I1QB 1OREA 3AFMA 3PRKE 2G7ZA 2JEYA 2QGFA 2UZIR 4JX8A 4W6ZA 4DMGA 1JYFA 3H7AA 3PD7A 4F6RB 4FIDA 1ML4A 4GGOA 1B3BA 1MXHA 1US8A 3R20A 1OLOA 2DHDA 3D43A 1F51E 5BV7A 3LSTA 1I13A 5J40A 2PR7A 3VXKA 1M5TA 1KMHB 4KWTA 3CLHA 3WL6A 2E21A 1G63A 1Z2EA 4EB0A 3KUDA 1M6VA 2G1JA 5KSYA 1CRQA 4M1MA 3M3PA 4BZPA 4Z9FA 4XUEA 2A58A 3IUBA 1YZHA 5E1MA 4QVIA 1GQOA 4OQ4A 2I8CA 4FLFA 2G9NA 1XJ0A 2FP3A 2KBEA 4UDYX 5JADA 1PFGA 4GX2A 4UQPA 3K5PA 4E5NA 1WXXA 2GZAA 4ROSA 3TD2A 1ZN7A 3U0VA 2LUOA 7REQA 5JS7A 1Q57A 4DG8A 1ZONA 4X93A 2YWGA 4ZO9A 5A3JA 3LYAA 1YKGA 1WBDA 3WL7A 4PZCA 1ECBA 4M54A 3ZS9A 4KKXB 3M6XA 2IXDA 5IZCA 1FVHA 2CL5A 4TTIA 2IOQA 1G7TA 3Q9LA 4GZLA 1WF6A 2H16A 3I3OA 3O8OB 5E2IA 1W96A 4Q39A 4WGGA 6AT1A 5J4YA 5LFAA 4PF1A 1R4ZA 5JD4A 4YJ2B 1HT3A 2J4DA 5KREA 1XKQA 3QY9A 3K2BA 4BKPA 1IN6A 1E9BA 1VJRA 1EAYA 2XSZD 3ENKA 4B8YA 1WZIA 4ZVQA 3LM8A 4CUKA 1T13A 1TIBA 2FG5A 2PJDA 4ESOA 3FG9A 1DX6A 5J23A 1E4OA 2I2CA 1T9ZA 1AKMA 3SCZA 1ODFA 1T8PA 2RHWA 4Q3AA 2POCA 3QVTA 4J3NA 3Q88A 3GP5A 2ISSD 2OD9A 3NBXX 4MKZA 4NFSA 4Y2HA 5JSQA 2Z6AA 3A9SA 1DQPA 4BC0A 4C4ZA 3MWFA 4O2AF 3U3DA 1ZM2A 2AEEA 1BD3A 2G70A 2X2OA 2Z57A 4RMIA 1RLMA 2HB6A 3UJCA 1XEWX 3IPXA 2X9GA 2VSQA 3L7LA 3JWIA 1SCKA 3QKWA 5ELXA 1RRGA 3EXHB 4WK4B 4XCQA 2CHQA 5AKKA 4ZRNA 3C7KA 3U7HB 2OY0A 1WU8A 2YWXA 3BWEA 1RSZA 5KNCA 3ITDA 3ZV5A 3GGSA 2AUTA 3H6GA 1JLLB 2XKBA 4DA6A 2NO0A 2JC3A 1JX6A 4G23A 3KHKA 1RAAA 4QJ4A 2QX7A 2BY4A 3AF0A 1CZRA 4P32A 3SKYA 4EGQA 4Q3BA 1L7PA 4KMOA 2QMZA 4PVCA 3ZX5A 1QKJA 4KWHA 3D7LA 2AG8A 3KYDA 3G2IA 3ZD9A 5JATA 1MN6A 4I9UA 2BBTA 1FNCA 4NCIA 4QOSA 1JKIA 4PLYA 5B7NA 2HFJA 1DQSA 1UBFA 4RVNA 2AV6A 3GDOA 1E2EA 4L51A 1BTOA 1M2JA 2NSDA 1KMHA 5E2BA 4E1VA 4ALKA 4CM4B 1KYIA 2FR1A 1O7JA 2EKQA 4N39A 5DBFA 1GGHA 1RPTA 3S1AB 4I9GA 4J76A 4ZU1X 3MWDB 2VJKA 1GA1A 2AOUA 4EDFA 3SEQA 2EU8A 3M6UA 2VT7A 2Z8YM 3VO2A 2DMRA 2FUG1 1D03A 1X7DA 1QS0B 1KAMA 2YWEA 1JGTA 2OO5A 1GTRA 4BBZA 1EVJA 3CYFA 1QX3A 2JZNA 3JSXA 1V71A 4RK6A 4Z3DA 3FIJA 4X44A 3UJ7A 1MO3A 1BXZA 2QQFA 2R8XA 3CKKA 3PI6A 3EIOA 1KEWA 4WUTA 4XW2A 5FNVB 2G9UA 1IZ8A 4KQ9A 4DR6B 2VJAA 2NXJA 1OWNA 2P4UA 2OHOA 2PRSA 3AR6A 4P36A 2R1UA 1L4BA 3VH4A 5BVHA 1FYXA 4PXYA 4HQ0A 1PR4A 3OFSA 3GO4A 4J6EA 4KXYA 4KHZA 1H8HD 4Z1MD 2RGBA 1CFJA 1GPJA 1JXOA 3OG9A 3Q6IA 5I9IA 1KWKA 2VATA 2E5LB 2QM8A 5LNK6 3IVXA 3O38A 1EUYA 4HPXB 8GPBA 4AO7A 3VU9A 4HTFB 1SOVA 2FWRA 5ALMA 2PGOA 5DTIA 4IYJA 5TF4A 5HQ3B 2ZSHA 3O90A 1KAHA 2VYND 1AKWA 3DPUA 1SZJG 2XT9A 4EKNB 1N3IA 2B5WA 4L6AA 5HUQA 4TMWA 3ELDA 2JDID 4OUDB 3EGWA 3S99A 3AETB 4KE8A 4MAFA 4JOQA 1BO6A 3BMOA 4EUFA 1IJFA 1H3EA 2FFAA 2A1UA 2H31A 2QORA 3RT1A 5E9QA 1VA5A 2DF8A 2ZJ2A 5DNVA 1RC0A 4MKHA 4PZDA 4NL4H 3I5MA 4DCOA 2Y77A 4FNAA 4RL4A 4XVHA 2GPJA 3PF8A 2J31A 3LYUA 4XAQA 4BLUA 2PZ8A 1HURA 2ZQZA 3K3PA 2Q8PA 5COAA 2EFGA 5C37A 1I4WA 1A2BA 2GK7A 4YDSA 4L5YA 2WM8A 1OLSA 3N74A 3RF7A 3AI7A 3EFEA 2P6RA 3PXAA 4NXMB 2RIPA 2P6MA 4BO4A 1HDZA 3SXUA 2XMPA 5C1IA 1LBEA 2A92A 2YWFA 1A9XA 4JS0A 2IZ6A 1DHTA 4PG6A 3IIIA 1UMDA 3FGNA 5ALLA 2JA1A 2ZIWB 4PSDA 2ZUTA 4HQOA 1DAOA 1JU9A 1XZJA 1PV4A 1Z25A 3PNLA 5HCUA 4MWZA 2YXPX 3AJAA 3ZH2A 1Y6JA 2OBXA 1GPYA 1IVYA 3BXPA 2PZBA 2YWJA 2IZZA 2IOFK 2Z9BA 3H2BA 3KOUA 3ORHA 2XWBF 2A3NA 3L92A 1E1DA 2BFWA 5KYXB 5ER6A 1BE0A 1NXSA 3ISVA 2Q0SA 4MI6A 5I7OA 2VXYA 1CV2A 2H4YA 2F3PA 5C35A 3S1AA 3M1AA 1MFZA 3QEMA 4NBUA 1ENYA 4Q01A 1M34E 5EE3A 5CFQA 2Q21A 3VR6A 2PKQP 4D3DA 3EAQA 3T15A 4CW7A 2UYYA 1F4LA 1N6LA 1SVLA 3FBTA 3TL2A 2XCUA 3LJKA 3UKOA 2V6MA 4DAOA 4XLLA 4G1MB 3DS8A 1M1ZA 3UFBA 1FMLA 5EXPA 4GC5A 3RVNA 3L4BA 2WJZB 3RUPA 2Y76A 3SZRA 1ZKDA 4UU1A 1C80A 2R84A 4U4AA 1VHDA 1ZG3A 2WB4A 4CPDA 1C50A 5LUBA 3MJDA 5CT4A 3WB2A 2WP0A 1GKKA 3OETA 3BYZA 3PVCA 1DSSG 5FWYA 5KVSA 4CQLB 5HHTA 2X0KA 3UXYA 4AF7A 1A9TA 2Y0CA 4V0NA 3U7QA 2R8EA 5C1OA 4MI1A 1M7BA 1POXA 3NTVA 4B3DA 2JIZD 4EENA 4AZ0B 2H0RA 2OHGA 3P4YA 4RY0A 3PL5A 4OBXA 4UNNA 3OEHA 4PWZA 2K4MA 1B26A 1N1DA 3KQYA 4FZVA 1SC3A 3QVJA 4HOYA 4YMSA 5FWDA 3ZTYA 4GI7A 4OXRA 4J0GA 1C5KA 1FNDA 1GILA 4ZI2A 5T67A 5ITSA 4TQUS 4K8RB 3WVNA 3HUFA 2HDOA 5E4TA 3V7YA 4HLUA 3R7DA 2V7WA 1PHRA 2ZS8A 1PVDA 1AC5A 2RI6A 4OLFA 5FAXA 1P7CA 3CMMA 3G68A 2EX4A 3AI1A 3PHBE 3P97A 3QEAZ 4RDIA 4I0WB 3KT6A 1OVMA 1BHSA 1UFVA 1Y1SA 2G36A 2FGKA 1Y4AE 4GBED 3T7IA 3U60B 1YHZA 2CMKA 4KE7A 5I9SA 6GPBA 3WC4A 1YNOA 2HNBA 2R60A 5JVDF 3NHRA 2AKEA 3PNKA 4MR8B 1DV2A 1ISFA 5EMKA 2QBYB 1EUDB 4UOZA 3AIKA 4LV8B 3HJGA 3UY4A 4LF7B 1UXJA 4NOKA 3B9QA 5ALEA 4UD6A 2IUEA 1CUHA 4UEWA 2IODA 3NDPA 4J91A 5DCLA 1CY6A 3D6UA 3N8IA 4JITA 4WXMA 4J2TA 2IIPA 5LP6F 3KJNA 4DWOA 1GL3A 3M83A 1E5DA 4K3VA 1JZQA 3LVBA 4OGKA 1G291 1GU7A 1SKBA 521PA 4CCWA 3EYWA 3P9SA 4U7JA 4HH0A 3G8YA 4B3TB 3GLHE 1XVTA 3Q9UA 2YC2C 2PZAA 3ZWCA 1U28A 2NZJA 4ONEA 3F3MA 2WHRA 3L7BA 5AT1A 3OOHA 2JJ2D 1OAAA 1ORWA 3L40A 4PLFA 2ZSIA 621PA 3SQWA 3QEMB 5IBRA 4AJJA 1Y42X 1ZC3A 1DEOA 3C7CB 4D9GA 2WR8A 1T4DA 1D0IA 1N2GA 1W5AA 1E18A 2CFSA 3RSQA 1FW8A 5CA1F 2OCXA 2PGJA 5H1YA 5LZ7A 4RTPA 3W78A 2IT1A 3IURA 5FPQA 4M37A 3NBAA 3OZIA 2WV7A 1V6SA 2XECA 5EUBA 1VPEA 1MVOA 4JI8B 1P1RA 1UKZA 5DEOA 5E1BA 2ZB4A 2FDXA 1E3DA 2ZSDA 2PNJA 3Q98A 5B3KA 5FOXA 4OQDA 3TFWA 3JXEA 3VZBA 5H3LA 4YUZA 4AXXA 4C5BA 1MJ5A 1EK2A 2PKWA 4BQQA 4EW2A 2DQ4A 3ET4A 3IP9A 2BGKA 3AF4A 2I7VA 3Q8MA 4IM7A 3P96A 1T26A 1P2FA 2PSFA 4MINA 1D8AA 1H0KA 1Y8QA 4MS1A 3X3HA 1R8SA 5HZKA 1NKSA 1A98A 1IM8A 1CUEA 2M9MA 2YQ4A 2ODAA 3FHLA 3FPSA 4OUKX 2FW0A 5LDGA 1RWOA 3JY6A 2IBSA 2HPHA 3QTBA 4XPIB 3SZ3A 1EU1A 4M0LA 1MJGM 3NBFA 3IB3A 3ZDQA 4ZQGA 1XLWA 4WN9B 4B9EA 2YWRA 3QE9Y 3F0TA 3S2EA 1U2PA 1L3CA 2QG9A 4PY2A 3ML1A 1ZZGA 3LFHA 4DSAA 2F6RA 3O74A 2ZFUA 3TW0A 5TQ0B 2H2DA 3NFYA 2IV3A 2WSSD 1RKQA 5ERXA 2CFOA 5KWVA 2NO6A 1FQJA 2Z8YA 2ZUUA 4AW9A 2BOVA 3VSCA 1PNRA 1JALA 5H4GA 1YJXA 5T8KA 4YLYA 1R3UA 3GJ0A 4KKVA 3USZA 1HF3A 2ZJ5A 1MW9X 1N34B 1QU2A 4QDJA 5CFZA 1NLMA 1VYVA 1MB0A 1WXIA 3VFDA 7REQB 3VNVA 1IN8A 2ZWOA 1OPRA 2HV9A 2P2CA 1ANKA 3LGXA 2WSSA 4F4DA 4V39A 4PSCA 3B20A 4KPYA 4OGFA 2M6KA 4CR6A 2B1QA 4NJEB 4EIWA 1C1HA 1M2VA 4QATA 2YIVX 4MJ7A 4BV3A 2L2QA 2ZBUA 3STWA 1Z6AA 4JBXA 5KAMA 2B35A 4TMTA 4FYWA 3M2PA 4WZZA 5ECGC 5FUXA 4F1JA 1NMSA 2Y92A 2XTJA 2QX9A 1VG0B 4NG4A 1H2WA 1NF9A 2P2LA 3NVMB 5JAPA 1XTPA 3Q8LA 5K2OA 4B9AA 2DVMA 1QP8A 1UBMS 5EESA 3I0ZA 3LL7A 1TQ2A 4WLOA 5EKTA 4MS3A 4TWJA 4K87A 3TIXB 3RVBA 4P3OA 1EYZA 2ODTX 3PQ5A 1K0UA 4U3JA 1VM6A 5KOJA 4BO3A 4A7PA 4DMHA 5AI4A 2OBYA 5FNVF 4OU4A 4REQA 3VU8A 2WI8A 5B3JA 2C5LA 3FR7A 2ZM6B 3ZJYA 4AP6A 1CRPA 2FK7A 2JAOA 2V54A 4FX5A 4ZVVA 3K32A 4DLWA 2YVAA 1EZ1A 2QN8A 3F96A 3O4FA 4LF8B 1R8QA 4DN6A 3H42B 1JIXA 5FLXA 2C94A 2C0QA 2Q2WA 3ZXYA 3I6BA 1JHAA 5ARDA 2C5HA 3SX4A 3IPYA 1J22A 5KVQA 4DSUA 4IVPA 1JR6A 1SXJC 1ESNA 3A1UA 4Q7MB 4CMGA 1JF8A 5DTQA 4LE2A 1OFUX 2HLHA 1V5FA 1L4GA 2P77A 3DHWC 2OSVA 3UENA 4DJDC 1HETA 5I5EA 3T34A 4BEVA 2VNJA 2ZETA 3ANYB 4QPPA 2L0XA 3GLFA 2IS2A 1OT3A 3IPRA 2QHXA 3I04A 1TYDE 2B30A 2BBOA 2XA9A 1JG2A 4R0VA 1GYPA 3C1UA 3WB0A 2HMYB 1HNZB 4W1SA 2VQDA 1Q7GA 1C81A 1DLJA 4HDNA 4LXIA 5IPFA 3CWQA 3IHWA 4DNPA 4HJXA 4NDZA 2X4DA 4CLXA 3CE6A 3QKIA 3Q12A 1ZIOA 4QBKA 2C8KA 2PNFA 2Q3DA 1P7ZA 1U4SA 4X0EA 4EI8A 2OFWA 2IH4A 1ZC4A 1W0KA 1QZZA 3OAAA 1QRUA 5JVDB 1OE0A 4FOTA 3T4XA 4PFQA 5F4ZA 4IVQA 4B45A 1QS0A 3LC0A 2XMDA 3FUVA 1G8KA 1P17A 2WIDA 5TT1A 4H7PA 3A32A 3WL4A 5ENZA 5DIFA 3LY8A 1GR1A 1C3OA 6ABPA 4Z51A 1Z74A 1NR7A 4JI2B 1SXGA 4BN4A 2FI1A 4M1KA 3H8SA 3W3AA 5HPYB 2J3IA 4JLBA 1R9NA 4ZMRA 2HXYA 1IXSB 4X92A 4RF2A 1GAJA 3P71T 1ARZA 1RAGA 4Z53A 3KZVA 3E8MA 2P5TB 3PJGA 3QU2A 1HG0A 2JJ1A 1YA6A 1FSPA 5LXTB 5KCZA 2ID7A 3IB6A 1TMGE 2JAWA 1VCIA 3IOBA 2PMFA 4JLOA 1XKXA 1X7GA 3BZWA 3TZQA 2CJXA 3UGKA 1NT4A 5HQ3A 5JFGA 3FZEA 5CEFA 1HE1C 4BEWA 5F5NA 2Q4RA 5K0EA 2G9VA 1MT3A 2PL3A 3OWOA 2I34A 5KTMA 4XPZA 4F9FA 4KOAA 2QRHA 3OI7A 2PUWA 4HKTA 4AI6A 3G17A 4YT4A 3H8WA 1BMFD 3QVVA 4PINA 4IP0A 1S6YA 1BE6A 1KS2A 3IAEA 5CJ2A 1IMOA 3U1VA 3PNYA 4ZPJA 4R8MA 5JMPA 1R5NA 1JPJA 2Z43A 3RG8A 3NYIA 2XKKA 1XI2A 3KALA 4Y6SA 5EWJB 2NACA 1P73A 3WLRA 1UBGA 2VHEA 4E2YA 4NESA 1XZGA 5LQNA 4JB8A 4JZYA 4Y2PA 4BFTA 4WAUA 5B2FA 3Q4GA 3RYTC 4IDDA 4WK2B 4ZCSA 1XKTA 1XVAA 4D9FA 4DPLA 4HUJA 1UWLA 4KXMA 1NBWB 3PLNA 4YV0A 5A2GA 5H82A 3K9LA 1THZA 4QTZA 1PQPA 4QUAA 1LW6E 4R81A 5A4MS 3D5QA 4DR5B 2CNBA 1QHIA 1EVLA 1Z5PA 2RJ3A 3L8HA 3TSCA 4MQBA 3TZLA 2IY8A 2IUFA 4LTMA 5EQJB 2IYPA 1QCDA 1V3QE 3AHJA 3QU7A 4ZFNA 1NYTA 5D5QA 8ADHA 3HYNA 3QELB 4ZOAA 2IOYA 4LOIA 3EIEA 2QW0X 1XU7A 4NJOA 2I4TA 3TM4A 4ZYTA 2WZCA 3FCXA 1JQAA 1JLRA 1K7CA 1OYYA 1QYWA 4OHMA 2EXXA 2CFCA 2DG2A 3DAHA 3M3HA 4GR9A 4N0DA 2PT9A 4MTLA 2BRUA 1E5QA 1Y8RA 2R96A 2QN6A 2QAGB 4YO8A 5FBLB 3KZ1E 3AI3A 1AZWA 1A69A 2X8JA 3AYXB 3DE0X 1E6WA 4ITUA 1W0CA 2IXFA 1CF9A 2PXXA 3AU8A 3FJOA 3TRHA 2PMBA 3KQPA 1GTMA 3HB9A 1VMEA 2XADA 5A0FA 4CQMA 1DFHA 3IVCA 1ULHA 2GHTA 1P2VA 3IDFA 5TX7A 4KTVE 2Q5JA 3JQFC 3BIFA 3RLFA 3VI3B 1EZZA 2NSHA 1JSCA 4II3A 4WKPA 4OQMA 2Q62A 1K1EA 1E7RA 1I9GA 2VJOA 5DRTA 5EIXA 1TKRA 1RI1A 3JV7A 1AXEA 1THMA 4GG1A 3H83A 3IEVA 2ECFA 3X43A 3AL3A 3AZPA 4KXXA 3T0FA 1CZLA 3GCGA 3KL2A 3N5KA 4D80A 5DI3A 1KY4A 3ID6C 3QV1A 1SRQA 1TUBB 2CHFA 3AHDA 4B7ZA 4CM1A 5M04A 1Y4UA 1ZEMA 2PLFA 4KYUA 1BW9B 1EG2A 1ZRSA 2X6QA 4O63O 5AH0A 3UCXA 3V8PA 1VRVA 2QI9F 3HCFA 4DJJA 4YB8A 1D1QA 2XGGA 1A5SB 1A5ZA 1B6TA 1UR5A 2B1JA 2XF8A 3ZHTA 4PAWA 2P9ZA 2Z2XA 4KNWA 4Z2AA 4Y98A 2JDIA 1WUYA 3WP1B 5A5VA 4ZOLA 3SSAA 2JLVA 2VAMA 4N48A 3KFLA 5E6RA 5CVTA 5AW4A 1ND5A 2AG5A 3BD6A 2NO4A 4F96A 5JBNA 4J94A 5I7FA 5JTTA 3KTDA 4RKRA 3MSCA 3ZX4A 1J99A 5HXAA 4YI3A 1Z2PX 5DP2A 2PKCA 1XJQA 3O83A 3P9RA 5EUMA 2QRNA 4GLOA 3QU9A 4DQLA 3FI0A 1T15A 4ENPA 2JLAA 1NJ5A 3JYPA 4MGYR 4CLEA 2C9YA 2D13A 3O84A 2ECPA 1YFJA 2W6IA 1ZK2A 2EW2A 1SBCA 1X1TA 3C6KA 3DJFA 3QMMA 5LD2C 3NRJA 1ZUNA 3WIDA 1G19A 4ZREA 1GPNA 1AHPA 2QX4A 1CNMA 4FYVA 1NMEA 2DFPA 2OP1A 3MINB 4IDOA 3C3PA 2QR5A 3P8ZA 5HJ7A 4WERA 5BXQC 1RXWA 2ORYA 2IEYA 3MVEA 1V3UA 3I64A 1BVUA 4IFBA 1TM1E 3GLVA 3IDZA 2BFDB 2Y1WA 3K9QO 2DFDA 3NHZA 4L4YA 5TJHA 3NOQA 5KYGA 5BN1A 1WG8A 4Q7KA 2GEUA 2OGTA 3H3FA 1YJBA 4HLUC 3RDPA 1QGED 2CMHA 3TO5A 3ENNA 1HL7A 4UMVA 1T2VA 2NZXA 2QAGA 2IPMA 3K4HA 1GT91 1Q0QA 4Z4GA 3E03A 4PLTA 5JNUA 2RH8A 2X8JB 3KS9A 4OX9Y 1XU9A 4OHCA 3CLUD 4CZ2A 1BN7A 1JHPA 4QU8A 2WDPA 1YI1A 1VSVA 4WBNB 1QZTA 1Z73A 1ZP6A 1YK0A 2JAUA 4F06A 3FMOB 2YUIA 1ZCZA 2LBPA 1SXIA 3N2ZB 4J8PA 5FRDA 4GVPA 3OFND 3ZZNA 4I66A 1TEZA 3K30A 1VKJA 1X9GA 2HMVA 4HY3A 4V0SA 2QR3A 4IHKA 4XJSA 1Y8CA 2JHPA 3FUUA 1E32A 1OLUB 1T5LA 3KPYA 3IKJA 1OZ0A 4IIYA 3KP1A 4MMXB 1Z16A 4CMCA 3ADKA 3A1EA 3LT0A 3ENWA 3I04M 3ONDA 3HUDA 2WSIA 3W2GA 4AKTA 1RWXA 3R5JA 4OSOA 2MDTA 4C0AC 4PO9A 1FMCA 2M1XA 1Y1LA 2ZIGA 3PPXA 1FK8A 3W0LB 1IQPA 4KXQA 1RYMA 4YFYA 1UPXA 1VGVA 1EBFA 2FSVA 3TGWA 3UKDA 3R9WA 2NP6A 4OHBA 4J1TC 5A02A 3A6DA 1GRQA 1SPBS 2JAQA 4FX2A 1X8XA 1U6JA 5GZ6A 5CW1A 3ZVMA 3QVMA 1FFHA 4XDYA 5BQPA 3AM4A 2JFVA 1QO7A 1WDTA 2XWPA 2Y66A 5BMVF 5FLKA 1II8A 5FR1A 1K68A 3DB1A 4D9BA 2V7XA 1YZTA 3NT4A 1WQ3A 3CS3A 4CT5A 2EFYA 3BQ9A 3UG7A 2OYSA 1EINA 2G4VA 3AG6A 4HWTA 1ECCA 3HK2A 3R3ZA 4I8IA 1AM4D 1W46A 3P0HA 1FFXB 1G38A 4NZOA 3M6LA 3VPAA 1I4OA 5KNBD 1U9IA 4J7CA 2P4EA 2C99A 1OC4A 3GIWA 2QN1A 2ZJ8A 4TYPA 3RRZA 1R0XA 4OQFA 3VI4B 3UK7A 4B83A 3NM4A 3AVVA 3IUEA 2A86A 3I05A 1OX6A 2ZRCA 1A8UA 2YOHA 5BR7A 1QSGA 1Z88A 1E1YA 2IUYA 1G6HA 1P0PA 4OJTA 4ID9A 2BFBA 1E2QA 3TOVA 2TYSB 5DMHA 2ON6A 2XOEA 1UQRA 5IAAA 3DMFA 2W6OA 2C4NA 3C3CA 3CE9A 4EVRA 4I3FA 1NX6A 2BHTA 4DLUA 2PTGA 2QG4A 3N1UA 5EFZA 3VOBA 4U3JB 1KZ6A 1PJZA 2KLBA 4FR5A 4RTOA 4LISA 4KIUA 2IS6A 1YVUA 2DY0A 1QNLA 3AM3A 5HILA 5K8UA 1Y48E 4HBZA 4UBJA 1U0EA 3T1QA 4J0CA 3U2QA 4MWGA 3VX4A 3ANSA 4P35A 5DBEX 5T4EA 1QVWA 3HKBB 1UOOA 4P7FA 4NFLA 1QCCA 3NTOA 1BGXT 3FPEA 3V7NA 4J7AA 5AVYA 3P0EA 1OHHA 3AFOA 2D4HA 3OH8A 5DNDA 2DYKA 2HHAA 3K70C 3VR4D 1WZCA 3K96A 3SP1A 2WJVA 1Z45A 4U00A 1TRHA 4Z49A 5FTWA 2X8AA 3CB2A 4FE4A 1U28C 1HQYE 1CEXA 1N2BA 1VOTA 2RGEA 2NUPA 4IIDA 3SEFA 3PL1A 3V42A 3RU7A 2YBDA 4JY7A 3V1LA 4PS1A 4POOA 2NMVA 3DDCA 4B31A 2LW7A 3S55A 4I2VA 4O02B 1G18A 5F1PA 3JATA 2AHOA 3C0KA 3UHAA 2YN0A 3VR4A 4UTPA 5F5LA 4YRKA 4PRLA 3KJEA 2O50A 2GCGA 4GOXA 5B6JA 2W2OA 2FN8A 5TSDA 3IFSA 1B0ZA 1LF5A 1Z0KA 3DLCA 3U81A 4Q1CA 3A6JA 3TNJA 2MT9A 5CFOA 2W83A 3M33A 5KSWB 2ORED 4QNNA 2P5UA 3A6FA 4GD3Q 1C7QA 1W73A 1JT9A 3HFRA 3KLBA 2IP1A 4JODA 4G5OA 2XX3A 4O5OA 5HKAA 1BVHA 3MB8A 2FPIB 4Y1EA 1W35A 1BVRA 4WUVA 1P9OA 1ZVMA 2CXUA 1FDVA 1XO1A 1P1CA 3IQZA 4JXKA 2VF4X 4IUBS 4V0OA 5J4LA 1Z0JA 3FLBA 3IBFA 2R8PA 5D3KA 3RJ5A 1N0IA 2CL0X 1UBJS 2Z3ZA 1JDBB 1IJKA 1W48A 2PBZA 1M7HA 4HHEA 4IDFA 4FD2A 4EY3A 2ZTLA 1WZUA 4OYHA 4ZXPA 3VDMA 2VJNA 2HMUA 2W2KB 2Z9CA 4YP1A 1K0FA 2JBAB 3KT0A 1BJTA 4J75A 1PT5A 4INJA 4RPHA 3DTVD 1R6VA 1XN4A 2ZYIA 3ZD6A 3ZCRA 2A4MA 1JAYA 5TR9A 2CB9A 4C7OA 1OBFO 2AR0A 1QRRA 1NVXQ 2P6NA 1T9KA 3CZAA 4P34A 2JFWA 3D2LA 4PC7A 2HXSA 3ND8A 4KQWA 4COOA 5HJEA 2QRLA 1W29A 3JQ6A 1STOA 3PUWA 4FINA 4HDQB 4YAKA 3A9CA 2EKDA 4FMCF 2OC9A 2C57A 1XPJA 2WLSA 5AKGA 3EWNA 3L7DA 3AF6A 2JLSA 5LL6P 3CF4G 1SEVA 2EBUA 4CVNA 3O8CA 3D7MA 3EZ2A 3TXAA 1IULA 5HOQA 2C8JA 1HGXA 1NVVR 1P8AA 2AJ8A 1YJCA 1AXRA 1J8DA 4BYMA 1RR6A 1VZ2A 4RMJA 5F73A 5JVDA 3QFFA 3A1VA 3PNOA 2E18A 2GCOB 4L28A 2A9FA 3OSUA 4UFOA 4A4DA 4ZT3A 3F6CA 3TLAA 4QO8A 2ZRQA 3RUIA 5ENVA 3TD9A 1YH3A 4K6MA 5LQKA 5AIAA 5T4HA 2BF7A 2EQBA 2GHIA 1ZGCA 4NYJQ 1BD4A 3L04A 4IDBA 4R3NA 4NBRA 4OGLA 2D6FA 1SKAA 4PWYA 1ZNWA 4Q03A 4OK6A 2Q5FA 4RZUA 4F2HA 4G3XA 1DADA 4BGDA 1VIAA 3ND5A 4XVUA 1F6WA 3AESA 3BMNB 3EFHA 3C3XA 3BRWA 2Z3WA 4XWKA 1ESDA 4IJWA 1MOSA 3AW8A 4PRYA 2NUPB 5FFNA 2BKXA 1SIUA 2ACWA 1DC5A 3HCOA 4JNCA 4LVUA 3F67A 3GFPA 4DIMA 2VJCA 3UATA 1XWWA 2QUHA 4A0FA 2QL5A 3BK7A 1SVIA 3NRBA 2GFQA 3I58A 5HF9A 1IXKA 2IZOA 4ZHSA 2NTVA 4LE1A 4BU1A 4C7KA 3MLAA 4NJMA 5B53A 3SS9X 5DWDA 4TLMB 4QTYA 2OV6A 4UEJA 3QUSA 4OHWA 1ZRMA 1R4NA 2PMEA 4JQOA 1R27A 3QVSA 5C4GB 2APJA 3DFZA 3A3PA 1DXYA 1XNHA 5GONB 5JXWA 1Z8HA 3HR4A 3LHDA 1XALA 4WT7A 1PZGA 4I1YA 2PT6A 5DT2A 3WIBA 4EO4A 4RQTA 3H9BA 1IY0A 2JFYA 3AY0A 4MAMA 2LCIA 4V38A 3OLWA 2E4UA 4LFCB 5LJIA 3IAM1 2J7PD 1NVAA 2IDZA 1PZHA 1VP9A 3FPAA 1VMDA 2GXSA 3HMQA 2ZJBA 3G0BA 3O26A 1BE1A 3H8VA 4LBYA 1XROA 3MCWA 3H4VA 1RRMA 3I09A 4MUXA 4P7BA 5LD2B 4BAUA 2XRZA 2HLDA 4C7OB 1PZMA 2IYZA 4Y7DA 1PGNA 2BM0A 2JAPA 4GUDA 1B6SA 1B41A 1AGYA 3CZPA 1QG2A 3UMSA 4ES6A 3K70B 3DZ8A 4GKJB 2BV3A 2RB4A 2OUKA 2RONA 3Q41A 1Y8AA 3CUUA 3WJ1A 1XD2B 5HKLA 1OC2A 4NEHB 2G72A 3KT3A 3FWHA 1WCXA 1NQUA 3WE7A 3VTKA 4YQZA 5HE8A 2Q1TA 1II0A 3H5RA 1KBOA 4ML3A 5TS3A 1QYVA 3L2OB 4BEJA 1HSZA 3GEDA 3FRJA 1MRSA 1AZSC 2GCOA 1HXHA 2X2PA 4N7MA 1FU7A 4AROA 1SU4A 2A5DA 2O0MA 1FMFA 4H4CA 2VDKB 1FSZA 3DZKA 3IHTA 2H1FA 3TLMA 2IXBA 3CUSA 3OE1A 2H9IA 5HK9A 2CZCA 5CEJA 2HWWA 4OBWA 1MORA 2E4XA 4J2OA 1AKUA 2XVYA 3BMNA 4F91B 2OMKA 5KJ6A 1J00A 1JIKA 3P2KA 4P3XA 1U3TA 1I1OA 3I0MA 2DERA 3UYLA 5BORA 4RENA 2I3DA 5AVJA 1NAHA 5LPNA 5FBWB 3QPBA 4EHLA 5K3AA 1KFKB 1VHQA 2QRQA 2PU5A 3O0TA 4EYKA 4TSKA 4F45A 5ARBA 3NS7A 4P4GA 5C8YB 4G2NA 4LY6A 1P0IA 1TQHA 3FYUC 5A7HA 3L8DA 3RHTA 2CXPA 2D00A 3L43A 5TPZA 3RVJA 4EO9A 3M5WA 1IEWA 3W6OA 4BP9A 2Y0BA 4QM6A 2ECQA 5DM2A 3SC6A 2W0SA 1BS9A 3K9NA 1W2WB 2JARA 4R2JA 3SIRA 1SIBE 3NKFA 5J1SB 2ZI5A 3L5OA 3OKFA 3SXJA 3LUBA 4WH0A 1K63A 5AM0A 2W70A 3Q3EA 2QXUA 1S3SA 3H86A 2X8WA 3IJPA 4DY6A 1ZH4A 2VQEB 2VF5X 3BERA 4ENUA 2DUNA 1PWYE 3C3MA 4DJ5X 1CK4A 5EOVA 3HDGA 3CRMA 3DO6A 1ZL0A 1SHTX 1QU3A 1Z8DA 2GOYA 5H3CA 3S1LA 3TR6A 3ZH9B 2GK6A 5DM1A 4UEQA 2VJYA 1IY1A 3I12A 2XY4A 1R6UA 1O57A 3KXPA 1UP4A 3DLIA 4MS4B 1SD1A 1P2DA 2G1UA 2MMGA 7AT1A 5JC8A 1DWOA 1GP2A 3LKDA 3T54A 2BFMA 3KJQA 3STVA 1ST3A 4DDVA 1QIHA 2QV0A 2CXNA 2WIAA 4D56A 1U3UA 2BMWA 4PLVA 5H81A 2WQ7A 2I87A 3OPNA 4CDNA 4YCNA 4LFBB 4BLWA 5KHOC 2FW8A 5G2OA 2WU8A 1L5KA 2Q4BA 4TV9F 4PAMA 1R9JA 5M2QA 2XIQA 3DLTA 1VPWA 4NCAA 3PQ7A 4KQ6A 2ZYAA 3HBMA 1A1SA 4H7IA 4P5EA 2ZM5A 4U2KA 2RHRA 1QB7A 3G1UA 1QF9A 2X2FA 3ELBA 3TVDA 5AK4A 1MVNA 1XCGB 4Z9YA 4DC9A 4RKYA 4LSGA 1OAOA 3NB0A 5I8ZA 4XCVA 2H48A 2FZKA 1YQTA 1L4KA 4PAGA 3B60A 4H7HA 5K03A 1E3JA 2V55B 4QECA 1H3FA 3E7XA 2HYDA 1TGYA 1FUUA 3RLIA 3UT5B 5JXGA 3GMDA 4ZVKA 4CGZA 4F1WA 2I3ZA 4G24A 5E3JA 3KVYA 1I2AA 4UULA 1CLUA 1YDWA 3DFMA 1O77A 4FOOA 1HKHA 2QZSA 4FFNA 2RK4A 4JSYA 1NW5A 3O9MA 1P62B 1SCAA 2H08A 3JQBA 4RY8A 3E9RA 3ONEA 2R1VA 4P7GA 1V11B 1J7JA 3OU2A 3DDUA 2QU8A 3E1SA 5BWNA 3P9ZA 4MWDA 5MFZA 4PR0A 1UKEA 1U2ZA 3KB1A 4MUKA 3V97A 1JEDA 5ESXA 1Q3KA 1IZ7A 2HKIA 3H9GA 3UBMA 1X2EA 1XVUA 1JDTA 3CF2A 2ET6A 2P8SA 3I45A 1LX6A 1L6RA 4K6KA 4EMTA 3WXBA 5HX7A 1N5KA 4KLRA 4M22A 4JI1B 3LC2O 4JLWA 4LXUA 4HC4A 2E37A 2W8BA 2CHVA 2YFKA 3E9ZA 4KPUB 2GZ2A 3ZWWA 1Q22A 4QDZA 4LNUB 4DRZA 4HDCA 5EY5B 3I2IA 3V4FA 3WDLA 1GLVA 5I01A 3GN2A 2OAP1 1C0IA 4K7JA 1ZH8A 1PSWA 2CFIA 1VFNA 3NWOA 2AYXA 1WMBA 1QQBA 1FJ2A 1M2KA 3FA2A 3QPAA 2QN7A 3MGAA 5EJEA 3A1SA 3EDCA 3MT0A 1JIJA 2M2IA 2XAAA 3OFVA 5ALWA 1R50A 2A0UA 2C4VA 2EL9A 1RNLA 3CZ5A 5AJVB 1GLGA 3WA7A 2JLUA 3EG9B 1ORIA 3OJOA 1LTHR 4C9BA 5G1NA 5JZ9A 4W5OA 2NU7A 3PUKA 3ZJ5A 3V4RA 1IL0A 1SEPA 4ZPXA 2EG9A 5GADl 1RRCA 4PZYA 2A88A 1GPBA 5IP5A 4BKMA 1LQ2A 3ZZ1A 4JC4A 1VDMA 3V7FA 3PEWA 1RCTE