4CZ2D

Complex of human varp-ankrd1 with rab32-gppcp. selenomet derivative.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
b'VVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAS-RELATED PROTEIN RAB-32
publication title Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 168
sequence length 168
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4cz2D00
3JUEA 5EIDA 4G8LA 4HLLA 3LJNA 1OY3D 3DEPA 1AP7A 3TWWA 5CERB 4OAVB 5ITZF 2F37A 2F8XK 3JXIA 1D9SA 1MX6A 3V79K 2RFMA 4BSZB 1SW6A 2PNNA 3NOGD 5BXUA 4QQIA 4O1PA 2ETAA 5AQ9A 1IKND 5ENQD 4DX6D 5KBAA 3UXGA 3B7BA 2RFAA 5JA4D 3EHRA 5CEAA 3IXEA 4HNAD 2BKKB 3ZUVB 2AJAA 2XZDG 3W9GA 4DRXE 2KBXA 3HG0D 4HI9A 3TWTA 4DUIA 3B95A 2DZOA 4U95D 1YYHA 4K5BA 2VGEA 5AQBA 5HRYA 1S70B 4ZFHA 3TWVA 2A5EA 1IHBA 2L6BA 4HRLA 4NIKA 2DZNA 1WG0A 5ENSD 3D9HA 5EYLA 4CYMD 1BD8A 4RLYA 2XZTG 3UI2A 2ZGDA 2J8SD 5EIBE 3KEAA 4HRMB 1K1BA 4DX5D 4U8YD 5KNHD 4BEPA 2DWZA 3HRAA 1BI7B 1BU9A 1NFIE 4HI8A 4YDWA 5HKPA 5D66A 4HBDA 3V30A 4HQDA 5FINA 2V5QC 4BETA 1K1AA 1A5EA 2P2CP 1YCSB 5CBOA 1K3ZD 4CZ2D 1AWCB 5FIOA 3T8KA 2B0OE 4U96D 5CEDB 4O60A 3V31A 4GMRA 3AAAC 4G8KA 5AARA 5ENPD 1MX4A 4LG6A 4GPMA 5EYPF 5HS0A 1BI8B 4J7WA 4DX7D 4C48B 4LNUD 1DC2A 3JXJA 3ZU7B 3TWUA 1IXVA 2MYOA 1DCQA 2QC9A 3F6QA 4DX2A 4HRNA 1BLXB 5KNGA 1OT8A 4F1PA 5JMND 2FO1E 4K5CA 1N11A 3EU9A 5ENOD 5CECB 2Y1LE 1MX2A 2XENA 4QFVA 4B93B 3AJIA 3NBNB 1G3NB 3UTMA 3J5PA 3TWRA 2XEEA 4F6RD 1QYMA 2ZGGA 5BXOA 4LSZE 2ETCA 3ZKJA 1MYOA 5AAOA 3V2XA 4N5QA 1N0RA 2NYJA 3T9KA 1SVXA 3V2OA 2F8YA 4UUCA 4JB8P 5EILA 2V4HC 2HE0A 3W9FA 2XEHA 2Y0BG 4DX1A 1UOHA 1WDYA 4J8YA 3TWQA 3TWXA 3EHQA 4O1OA 3Q9UC 4TUMA 5CBNA 4OAUC 4BESA 4K5AB 3C5RA 2BKGA 4HB5A 5AN8A 4BERA 4U8VD 1YMPA 3DEOA 5EN5D 1TR4A 2ETBA 4YDYA 3SO8A 2QYJA 3ZNGA 5ENRD 4ZHBA 2JABA 3J5QB 5AQ7A 1N0QA 2DVWA 3Q9NC 5ENTD 3TWSA 1MJ0A 2KXPC 5KWDA 4Z68A 4ATZD 3NOCD 5AQAA 4A63B
chains in the Genus database with same CATH superfamily
4GZ3A 1OY3D 5G04C 3TXNA 3AG1E 1MQSA 3MKQB 3NOGD 1UW4B 4G25A 1SA4A 2WXJA 4HNAD 2XZDG 3RRMB 2VGEA 2H6HA 5T4YA 3FFLA 4HRLA 1FT2A 1UG3A 1INZA 3TGOA 2IU1A 2IOLA 5KJKA 3UINC 3LKUA 3EUVA 2XGMA 3CR3A 2ZXWE 4UWFA 2GROB 3D9OA 3FH8A 3APFA 2M63A 1DCQA 4GAAA 3LPZA 4F53A 3FUHA 2F0YA 4HLEA 4BFRA 3GYZA 3RIBA 3T9KA 3HVEA 4BX9A 1HE8A 1X81A 2CFZA 3PEVB 5FZSA 3WXXA 3ZHEA 3EJNA 4I2WA 3Q9UC 4TUMA 3HXEA 3CGHA 3CHOA 3R7RA 4K5AB 1U3CA 4XE0A 3QOUA 3E33A 4FADA 2KATA 1FVHA 3SGHA 2R59A 2L0IA 3MX3A 3QWPA 4CRWA 3U66A 4ATZD 3IHYA 4V3IA 4YDEA 4HVBA 4DPRA 2HYZA 3D9NA 3ASDA 4FHJA 3R9AB 2X6KA 1OCOE 2P9SG 3CVXA 3EHRA 2I2OA 2NXPA 4FC8A 3ZW3A 2DIWA 2A5EA 5BNWA 4Y6CA 1TNBA 3RJVA 3CHQA 4DLOA 1BU9A 5D66A 3ZVVA 5AENA 1FVFA 2V5QC 5CBOA 4RVBA 3FTUA 3EHMA 2R03A 3MKQA 4CT0A 3S7FA 4LERA 5AARA 5ENPD 1MX4A 2WVIA 3PRZA 2OOEA 5LCWJ 2PM7A 4UI9J 4K5CA 3NBNB 3UKRG 1V54E 3CVLA 1TN8A 4TRQA 3OAWA 3N71A 3RKVA 4Q69A 3IBEA 4AXHA 4N5QA 3NQPA 2MRIA 2UWJG 1E8ZA 2Y0BG 2FEZA 2X38A 1E7VA 2CHXA 1E8WA 2GRQB 1EYHA 1O1TA 3FTWA 1TNYA 4HOSA 3ISMC 3DSWA 2QZAA 3Q5MA 3ZRHA 2YNQA 3FUDA 1B89A 4NQ0A 2NSZA 3HXCA 1E8YA 5G55A 1KLXA 2ETAA 4L2YA 3UXGA 3CHPA 5KCMA 1H2VC 2WMNA 4YVOA 1YYHA 5B1AE 2VSOE 4JL0A 5CMYA 1OWNA 4HS2A 1GW6A 3ML8A 4AOFA 4I6GA 2GW1A 1TYQG 5JHAA 4XEIG 4YVQC 4LEUA 2WMOA 5CEDB 1HXIA 3S7DA 3ZU7B 5AIJA 1FT1A 1N11A 5A7DB 3AJIA 5FJYA 2FBNA 4RG6A 1G3NB 3DSXA 4DK5A 4LCTA 3QWWA 1ZB1A 4JA9A 5CCLA 4W9RA 1OWOA 2H6GA 3UIPC 4I1OB 1OWMA 2PL2A 3K9IA 2A4ZA 4UQYA 2XEHA 3ASHA 3APDA 2LXMA 3SFYA 3FH7A 3CSTA 3S7BA 2VTBB 1HX8A 3C72A 2YINA 5D2MC 2BKGA 1ELWA 1TJCA 5EN5D 1X5BA 4JEUA 2PM6A 3CEQA 4DI3A 5ENTD 2XGOA 4KMOA 1JCRA 2R2LA 5EIDA 1UJKA 5C1DA 2J49A 2EILE 1KPSB 3Q15A 5FQ8A 3PE4A 1N9AA 4MS6A 2XEVA 3SY2A 3KSLA 4PS7A 4X8QA 2MHKA 2IF4A 1WY6A 3CV0A 3LY8A 1BD8A 2KM4A 3UI2A 5EIBE 3FTSA 3I5PA 3DPYA 5FINA 1OWLA 2DYRE 4JW1A 4MLPA 1HO8A 2DYSE 4GTVA 4KVOA 4G8KA 2OEVA 1TNOA 4C48B 2WXFA 2HO1A 2JEKA 1RZ4A 1MX2A 4UQXA 5EKQD 4PH4B 1OCRE 3PS6A 1HZ4A 4U63A 4MBGA 4AV7A 3DSUA 2WXRA 4U07A 2AXZA 1HH8A 2FULA 2L9BA 3CHMA 3PE3A 5FQ7A 3UX4A 3UT8A 3IV0A 3ZIMA 2P58C 5D0OD 5BW8C 2I1JA 4BERA 2ONDA 4I9EA 1TR4A 2ETBA 5ENRD 4EPZA 3G2TA 5CRUA 2P9PG 3FUKA 5AQAA 1TNUA 4XKCA 4GU5A 3B7TA 1AP7A 3TWWA 3QAQA 3OTNA 3E37A 2XRZA 3I3NA 1IKND 1W3BA 4GTTA 4UWGA 3B7BA 2WXKA 2VTBA 4HI9A 1QZ2A 2GRLA 2LAHA 2L6BA 3CVQA 5ENSD 3AU4A 4CDRA 3FDHA 4A3VA 4M3OA 3C98A 4B89A 4Y6WA 1Q2ZA 4JXTA 4HI8A 3E34A 3SZ7A 3CHSA 2GRRB 4KZ0A 4B94A 3O48A 2XGSA 3MZLB 4ILIA 5B3SE 3TWUA 3NF1A 5J08A 2FO1E 5J90A 1O1SA 4I17A 3G2SA 2EQXA 2AXVA 4XI0A 1ZU2A 1TNZA 3TWRA 1QYMA 2VSNA 2ZGGA 5ANRA 4JPSA 1UN8A 3SBSA 5AYWD 3L82A 2IOSA 2HE0A 2VSYA 4DX1A 5G04J 4WNFA 4ANXA 5CBNA 3NZUA 3U64A 3VLFA 4GZ5A 2BEDA 2EIME 4U8VD 3QNKA 5BUZA 2BUGA 4KVMA 3AG4E 4FA6A 3LCAA 4GTSA 2PQNA 3LXUX 1O1RA 3AS5A 2EIKE 3Q47B 1SW6A 3FU0A 4LRZA 3L9TA 3PNLB 4HXIA 4FU3A 3ABKE 2ILRA 3L08A 4WNGA 2V4LA 2IO3C 1HG2A 3R9MA 4ATGA 3RRUA 3PZ3A 5KJMA 1TN7A 4I1AA 3AS4A 3MKRA 4RLYA 2NC9A 4AIFA 1K1BA 4BEPA 5E75A 4I6JA 3SFZA 2IONA 1YCSB 1IQRA 2V8SE 3ULQA 1JUQA 4GPMA 4E6HA 4I43A 3HXFA 4HRNA 2Y1LE 1H0AA 2FF4A 4G2VA 1SA5A 1UJJA 4F6RD 2X3MA 2V5FA 4FLBA 3ONKA 1JWGA 1SVXA 3ZYMA 4KZCA 1WAO1 4JHRA 4H7YA 2Y4TA 4EZLA 3BUAA 3UT7A 2WQ6A 5DBKA 1NA3A 2Q7FA 1DNPA 1ELRA 4FP7A 3ZPJA 5JHBA 4CDNA 4KXKB 1NZNA 1MJ0A 3ULYA 4G8LA 3DEPA 1KZOA 4AP2A 3HHMA 3Q4AB 3GZ2A 2P9LG 2PNNA 3MCXA 3SFXA 3PH0C 5JA4D 3L13A 2AJAA 4GZCA 5BV0A 5LP0A 4C9BB 4ZFHA 2XZTG 2ZGDA 2XCCA 3HXBA 4CCAA 4DX5D 2WQ7A 5HI7A 3WG7E 3P2BA 4TXQA 3LY7A 3MYVA 4N39A 3T8KA 1TN6A 3GZ1A 1A17A 4TUUA 4ABNA 5CECB 3S7JA 1S64A 5G05C 3PEUB 2RD0A 2J4DA 4F3VA 1N0RA 3FUIA 4A3TA 3V2OA 2KCVA 3SQVA 3T8MA 4JB8P 4GYYA 3TJPA 3FHEA 3FUJA 3AU5A 2OV8A 4G1TA 3NAWA 3FTXA 2R05A 1JWFA 2Y69E 2XPIA 4CDMA 4Q94A 3CVYA 3RRNB 3BQOA 1KT1A 4HOTA 3UKUG 3GZSA 3JQ0A 3LS8A 4HLLA 4BWRA 4OAVB 3JQ1A 3V79K 4URKA 4UWHA 3PNTB 1PC2A 1FCHA 2VGYA 5CEAA 2CHZA 4IULA 3BG1B 4BX8A 5CCMA 4APOA 3NZSA 4K5BA 3E32A 2WXNA 3TL5A 3PZ1A 2XRYA 3FTYA 2WXIA 3SD5A 3L6AA 4PUCA 5H7PA 1XNFA 3CIAA 1OCCE 1LD7A 1IYGA 2X6IA 1K1AA 4I6EA 2P2CP 3HXDA 4U04A 4U0ZA 3BG0B 3DXKG 4O60A 1Z6TA 3AAAC 4NACA 1Z5SC 2KC7A 3FP3A 4A1SA 1H6OA 4UI9C 1OT8A 3D9LA 4F1SA 1N52A 1P5QA 4GB9A 2IO2C 2XEEA 4APFA 4J0UA 3LDZA 1S63A 3ZKJA 4PS8A 2CG2A 3LY9A 2IQCA 4AVXA 4A1GA 5EILA 4RQIA 5B1BE 1FPPA 4HORA 4J8YA 3TWQA 3DXMG 1S0PA 4GA2A 4GMLA 3FTVA 1LF8A 3CLJA 2X6JA 3ASOE 5AQ7A 1E8XA 3L54A 3TG5A 4A55A 3HDXA 2WXLA 1MX6A 1DCEA 1N4RA 3CQGB 4JVSA 4M7CA 5ENQD 2WXGA 5KBAA 3W9GA 4GZ6A 2HR2A 2CFUA 3EHNA 5EX0A 1K8KG 3MJWA 3D9HA 4CYMD 2XS1A 3CVWA 3D9KA 1JPLA 3GW4A 3V30A 2WPVA 4IYPA 4U0SA 2GGFA 4GMRA 3PZ4A 3UMVA 3UQ3A 5KJLA 5FZQA 4GZDA 4HOQA 5JJTA 1PAQA 2B6CA 1E96B 4GMJA 3ASNE 3FUFA 5LFAA 4H7XA 1Z3YA 1E90A 1TEZA 4CGWA 4P29A 3RAUA 3ESKA 1PY1A 4N3AA 4KT6B 2WB2A 4J8DA 4HB5A 1E7UA 3FULA 3NB2A 4YDYA 2QYJA 3E30A 4WWNA 2LSUA 3CVUA 2RKKA 4GTRA 4TXRA 2A5UA 4B8AA 2F37A 1QBQA 3RSEG 5FTPA 4EHMA 4HFGA 3MEKA 2YQ8A 3IXEA 1HS6A 3ZUVB 4CT4A 3MGBA 4BT8A 2I1KA 3B7SA 4GYWA 5HRYA 1TJFA 2KZTB 3TWVA 2DZNA 5CHEE 3RO3A 4E85A 3QK0A 2QYUA 1BI7B 1NFIE 4XI9A 3UIOC 5FIOA 3EDTB 2B0OE 4LG6A 4J7WA 4DX7D 4B8CB 1DC2A 3UPVA 4DJAA 3B7UX 4XZ4A 2C0MA 1QQEA 3CK9A 3ENEA 2UY1B 3MV2B 3LEWA 2ZISA 4U8HA 2WXOA 1WDYA 4XKBA 2C2LA 3B13A 5CRVA 4OAUC 2J9QA 3DRAA 4BESA 2AVPA 1Z3XA 5D0QD 2XPYA 3L16A 3DEOA 4ILHB 4XIFA 3TWSA 4N3CA 3NOCD 2MOWA 4A63B 5ANLA 3RU0A 4FLHA 3U9WA 3LYAA 2P9KG 1D9SA 2VSXE 4FJYA 4G11A 3IEGA 3ZGQA 4QQIA 4LNGA 3ML9A 2RFAA 1VDYA 2OEWA 4YNDA 3R7QA 5EYLA 1WG0A 2IEJA 3I4RB 2OVFA 1U2VG 3G2UA 4U8YD 5KNHD 4GTOA 1XGWA 4RSYA 2XCBA 4BETA 3U3WA 3VLEA 1AWCB 1K3ZD 2LNIA 3HIZA 3AS8A 4EECA 3ZXPA 3DPDA 3ASGA 3QC1A 1H6PA 5HS0A 3BEEA 4GYOA 5JJ7A 5HQ8A 3G2VA 4UWKA 4DX2A 3VLDA 4EBAG 3ULEG 5ENOD 3EU9A 4QFVA 4EBAA 2KZTA 3Q73A 1H6KA 2WQHA 4LSZE 2P9UG 3KSQA 2RG8A 2ETCA 3V2XA 4L9PA 5LOZA 2HM8A 1D8EA 4EZKA 4BTAA 3TAXA 3MA5A 3ZYKA 3CVVA 4ACLA 3IKOB 4N5CA 3URZA 5AN8A 1ZBPA 1YMPA 2H6IA 2UY1A 2GRMA 5KWDA 3D9PA 2XS8A 4TXPA 5CERB 1L5JA 2Y4UA 4JC8A 2E0IA 5C2YA 2IY0C 3L17A 3ZYLA 3ZN3A 1UN9A 2BKKB 4GCNA 2KBXA 2DZOA 4TV3A 3ABLE 5AQBA 3TXMA 1Y8MA 5LX8A 1HG5A 3AG2E 4WAFA 4JHJA 4MKTA 5BT1A 3HRAA 3EIJA 5AJDA 5G05J 5E76A 4FJZA 4AJWA 2IJGX 3CHRA 3JUIA 3DBSA 5EYPF 3PREA 3UUXA 1Y6IA 2CG3A 1IXVA 2QC9A 4KYOB 4BTBA 4F1PA 2AXUA 2ZIRA 2ZU6B 2C0LA 3QJZA 3IHVA 4HOUA 3KAEA 4ANWA 2F8YA 4IRUA 4N3BA 3W9FA 5FWQA 3TWXA 3EU5A 3S2AA 3EIQC 3C5RA 3CVPA 3AG3E 3DSVA 4L23A 2JABA 4WNEA 1QNFA 3CVNA 3KS2A 4OYSA 5FQ6A 3FU5A 5DIZA 4C0MA 1EDUA 1HF8A 1N94A 4LNBA 1MZCA 3CKBA 1DVPA 4GTPA 4N2QA 3Q7FA 2WXPA 4BSXA 1H2TC 3B95A 4D10C 4ME2A 2P9IG 2V0PA 2I9CA 4UWLA 4LUNU 4GA1A 1BPOA 3FU3A 1SZAA 2QY7A 3JCKC 2J8SD 1OWPA 4KBQA 4YDWA 4HBDA 4Q96A 2H6FA 3DSSA 3X2QE 4MRUA 4BY6A 2CHWA 4WNDA 3V31A 1BI8B 4LNUD 5JJ6A 2EINE 1WM5A 2VQ2A 4BT9A 5AAOA 1NI1A 4IN3B 3SI5A 1V55E 3FEXA 2R17C 3E4BA 2FI7A 4NRHB 1SZ9A 5LCWC 4YDOA 4J6IA 2XHEA 4I9CA 2VGXB 3FTZA 5FZRA 1N4SA 3VTYA 1SQMA 4I2ZA 4G26A 5A23A 4GTQA 5EDSA 1N0QA 2AW6A 3OXFA 2I6HA 3JUEA 1EF1C 3UT4A 5ITZF 3FEYA 3UM3A 3OXLA 3LJ3A 1JCQA 2JLBA 3I4GA 5FQ4A 2PZIA 5AQ9A 3QDNA 1MHQA 4DX6D 2KCLA 3BU8A 1HFAA 3JYSA 5BV1A 3TWTA 4DUIA 4EQFA 4JD2G 3T5XA 4CEMA 3KEAA 3ZXSA 2XPZA 3HYMB 4WWPA 3FH5A 4ILGA 4CZ2D 3PVLA 3Q7AA 3UM0A 2J09A 3SNXA 2R5SA 3FUMA 3P1UA 3JXJA 4XX5A 5KNGA 5JMND 3PDNA 5AJLA 3FY4A 4B93B 2BF0X 5ARGA 4J8SA 3UTMA 4RG9A 3J5PA 1NP7A 1OCZE 1D8DA 4FULA 1MYOA 3PZDA 3CQCB 4U7EB 3PUJA 1NA0A 3G2WA 4FHKA 5ARFA 4UI9K 5CMWA 2L0TB 3CSFA 2P9NG 3RK6A 5T3RA 2LSVA 2YHCA 3RO2A 5G2NA 4K0RA 4DLQA 3ESLA 1KZPA 4PDXA 3SO8A 4ZHBA 3O4ZA 2OCCE 2LXLA 4EZJA 1LTXA 3Q75A 3KD7A 1RW2A 3QARA 1N4QA 2F8XK 3JXIA 2RFMA 4BSZB 4AY5A 2X6HA 3ABME 2VYIA 4O1PA 2VJ8A 3LVQE 3D9JA 2VGXA 3QB2A 1KT0A 3Q49B 4DRXE 3HG0D 3T5VA 4R7LA 1S70B 1IHBA 4NIKA 3C3QA 3FU6A 4GCOA 2DCPA 4O6FA 4GA0A 4C0EA 5KJNA 3FUEA 4HQDA 2WXQA 2GRPB 3D9MA 3B7RL 3F6QA 2KCKA 1BLXB 3FWVA 4U0UA 4AEZC 3C3RA 3UM2A 3ONLA 2XENA 5ENNA 5A6CA 3QWVA 1LD8A 3QKYA 4ANUA 1IHGA 2LAIA 2NYJA 2FO7A 5IY5E 4UUCA 1O5MA 1U3DA 4JA7A 2AWIA 3EHQA 4OVUA 1OUVA 4ACKA 2Y3AA 1IQUA 4WWOA 1NL4A 4ANVA 4F7AA 4OVVA 2E2EA 2KXPC 4Z68A 1N4PA 5FT9A 3LJNA 1HU3A 2YHEA 3C3OA 5EX3A 4NURA 3ZYQA 2WXMA 1YA0A 3APCA 5BXUA 5M72A 4G23A 2L6JA 3PUKA 4JEHA 2WM9A 3ASFA 2LO6A 4N2SA 4WUYA 4GTMA 4L1BA 1JCSA 2OVBA 3LVRE 2GRNB 4U95D 4L7TA 3D3MA 3ZFWA 3SBTB 2J08A 4AM9A 3CK7A 4HRMB 2DWZA 5HKPA 2BTDA 4JZYA 4CGVA 3HVEB 3KEZA 4UQZA 5T8IA 3OXGA 4PS3A 1A5EA 3CK8A 3ZHEB 4U96D 2EIJE 3CKCA 1N95A 2J07A 4AY6A 2MYOA 4L2LA 3FUNA 4GPKA 2QFCA 1H2UA 3TG4A 3DWLG 3SF4A 3Q78A 3ZEFA 4J8EA 1H19A 5BXOA 2LUHA 3SHFA 3D9IA 3U4TA 4J8FA 2PQRA 1N54A 2V4HC 3VTXA 1UOHA 4O1OA 1EPUA 2X6FA 3Q79A 1ELKA 1OXJA 2WXHA 4I1MA 3L22A 4G24A 2DBAA 3PZ2A 4B0ZA 2XQ0A 4DI4A 2R02A 3ZNGA 3J5QB 5BPPA 4K03A 3MV3B 2DVWA 2J4BA 2IFUA 3DSTA 3Q9NC 4JHKA 3UM1A
chains in the Genus database with same CATH topology
3JUEA 5EIDA 4G8LA 4HLLA 3LJNA 1OY3D 3DEPA 1AP7A 3TWWA 5CERB 4OAVB 5ITZF 2F37A 2F8XK 3JXIA 1D9SA 1MX6A 3V79K 2RFMA 4BSZB 1SW6A 2PNNA 3NOGD 5BXUA 4QQIA 4O1PA 2ETAA 5AQ9A 1IKND 5ENQD 4DX6D 5KBAA 3UXGA 3B7BA 2RFAA 5JA4D 3EHRA 5CEAA 3IXEA 4HNAD 2BKKB 3ZUVB 2AJAA 2XZDG 3W9GA 4DRXE 2KBXA 3HG0D 4HI9A 3TWTA 4DUIA 3B95A 2DZOA 4U95D 1YYHA 4K5BA 2VGEA 5AQBA 5HRYA 1S70B 4ZFHA 3TWVA 2A5EA 1IHBA 2L6BA 4HRLA 4NIKA 2DZNA 1WG0A 5ENSD 3D9HA 5EYLA 4CYMD 1BD8A 4RLYA 2XZTG 3UI2A 2ZGDA 2J8SD 5EIBE 3KEAA 4HRMB 1K1BA 4DX5D 4U8YD 5KNHD 4BEPA 2DWZA 3HRAA 1BI7B 1BU9A 1NFIE 4HI8A 4YDWA 5HKPA 5D66A 4HBDA 3V30A 4HQDA 5FINA 2V5QC 4BETA 1K1AA 1A5EA 2P2CP 1YCSB 5CBOA 1K3ZD 4CZ2D 1AWCB 5FIOA 3T8KA 2B0OE 4U96D 5CEDB 4O60A 3V31A 4GMRA 3AAAC 4G8KA 5AARA 5ENPD 1MX4A 4LG6A 4GPMA 5EYPF 5HS0A 1BI8B 4J7WA 4DX7D 4C48B 4LNUD 1DC2A 3JXJA 3ZU7B 3TWUA 1IXVA 2MYOA 1DCQA 2QC9A 3F6QA 4DX2A 4HRNA 1BLXB 5KNGA 1OT8A 4F1PA 5JMND 2FO1E 4K5CA 1N11A 3EU9A 5ENOD 5CECB 2Y1LE 1MX2A 2XENA 4QFVA 4B93B 3AJIA 3NBNB 1G3NB 3UTMA 3J5PA 3TWRA 2XEEA 4F6RD 1QYMA 2ZGGA 5BXOA 4LSZE 2ETCA 3ZKJA 1MYOA 5AAOA 3V2XA 4N5QA 1N0RA 2NYJA 3T9KA 1SVXA 3V2OA 2F8YA 4UUCA 4JB8P 5EILA 2V4HC 2HE0A 3W9FA 2XEHA 2Y0BG 4DX1A 1UOHA 1WDYA 4J8YA 3TWQA 3TWXA 3EHQA 4O1OA 3Q9UC 4TUMA 5CBNA 4OAUC 4BESA 4K5AB 3C5RA 2BKGA 4HB5A 5AN8A 4BERA 4U8VD 1YMPA 3DEOA 5EN5D 1TR4A 2ETBA 4YDYA 3SO8A 2QYJA 3ZNGA 5ENRD 4ZHBA 2JABA 3J5QB 5AQ7A 1N0QA 2DVWA 3Q9NC 5ENTD 3TWSA 1MJ0A 2KXPC 5KWDA 4Z68A 4ATZD 3NOCD 5AQAA 4A63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUE A;  5EID A;  4G8L A;  4HLL A;  3LJN A;  1OY3 D;  3DEP A;  1AP7 A;  3TWW A;  5CER B;  4OAV B;  5ITZ F;  2F37 A;  2F8X K;  3JXI A;  1D9S A;  1MX6 A;  3V79 K;  2RFM A;  4BSZ B;  1SW6 A;  2PNN A;  3NOG D;  5BXU A;  4QQI A;  4O1P A;  2ETA A;  5AQ9 A;  1IKN D;  5ENQ D;  4DX6 D;  5KBA A;  3UXG A;  3B7B A;  2RFA A;  5JA4 D;  3EHR A;  5CEA A;  3IXE A;  4HNA D;  2BKK B;  3ZUV B;  2AJA A;  2XZD G;  3W9G A;  4DRX E;  2KBX A;  3HG0 D;  4HI9 A;  3TWT A;  4DUI A;  3B95 A;  2DZO A;  4U95 D;  1YYH A;  4K5B A;  2VGE A;  5AQB A;  5HRY A;  1S70 B;  4ZFH A;  3TWV A;  2A5E A;  1IHB A;  2L6B A;  4HRL A;  4NIK A;  2DZN A;  1WG0 A;  5ENS D;  3D9H A;  5EYL A;  4CYM D;  1BD8 A;  4RLY A;  2XZT G;  3UI2 A;  2ZGD A;  2J8S D;  5EIB E;  3KEA A;  4HRM B;  1K1B A;  4DX5 D;  4U8Y D;  5KNH D;  4BEP A;  2DWZ A;  3HRA A;  1BI7 B;  1BU9 A;  1NFI E;  4HI8 A;  4YDW A;  5HKP A;  5D66 A;  4HBD A;  3V30 A;  4HQD A;  5FIN A;  2V5Q C;  4BET A;  1K1A A;  1A5E A;  2P2C P;  1YCS B;  5CBO A;  1K3Z D;  4CZ2 D;  1AWC B;  5FIO A;  3T8K A;  2B0O E;  4U96 D;  5CED B;  4O60 A;  3V31 A;  4GMR A;  3AAA C;  4G8K A;  5AAR A;  5ENP D;  1MX4 A;  4LG6 A;  4GPM A;  5EYP F;  5HS0 A;  1BI8 B;  4J7W A;  4DX7 D;  4C48 B;  4LNU D;  1DC2 A;  3JXJ A;  3ZU7 B;  3TWU A;  1IXV A;  2MYO A;  1DCQ A;  2QC9 A;  3F6Q A;  4DX2 A;  4HRN A;  1BLX B;  5KNG A;  1OT8 A;  4F1P A;  5JMN D;  2FO1 E;  4K5C A;  1N11 A;  3EU9 A;  5ENO D;  5CEC B;  2Y1L E;  1MX2 A;  2XEN A;  4QFV A;  4B93 B;  3AJI A;  3NBN B;  1G3N B;  3UTM A;  3J5P A;  3TWR A;  2XEE A;  4F6R D;  1QYM A;  2ZGG A;  5BXO A;  4LSZ E;  2ETC A;  3ZKJ A;  1MYO A;  5AAO A;  3V2X A;  4N5Q A;  1N0R A;  2NYJ A;  3T9K A;  1SVX A;  3V2O A;  2F8Y A;  4UUC A;  4JB8 P;  5EIL A;  2V4H C;  2HE0 A;  3W9F A;  2XEH A;  2Y0B G;  4DX1 A;  1UOH A;  1WDY A;  4J8Y A;  3TWQ A;  3TWX A;  3EHQ A;  4O1O A;  3Q9U C;  4TUM A;  5CBN A;  4OAU C;  4BES A;  4K5A B;  3C5R A;  2BKG A;  4HB5 A;  5AN8 A;  4BER A;  4U8V D;  1YMP A;  3DEO A;  5EN5 D;  1TR4 A;  2ETB A;  4YDY A;  3SO8 A;  2QYJ A;  3ZNG A;  5ENR D;  4ZHB A;  2JAB A;  3J5Q B;  5AQ7 A;  1N0Q A;  2DVW A;  3Q9N C;  5ENT D;  3TWS A;  1MJ0 A;  2KXP C;  5KWD A;  4Z68 A;  4ATZ D;  3NOC D;  5AQA A;  4A63 B; 
#chains in the Genus database with same CATH topology
 4GZ3 A;  1OY3 D;  5G04 C;  3TXN A;  3AG1 E;  1MQS A;  3MKQ B;  3NOG D;  1UW4 B;  4G25 A;  1SA4 A;  2WXJ A;  4HNA D;  2XZD G;  3RRM B;  2VGE A;  2H6H A;  5T4Y A;  3FFL A;  4HRL A;  1FT2 A;  1UG3 A;  1INZ A;  3TGO A;  2IU1 A;  2IOL A;  5KJK A;  3UIN C;  3LKU A;  3EUV A;  2XGM A;  3CR3 A;  2ZXW E;  4UWF A;  2GRO B;  3D9O A;  3FH8 A;  3APF A;  2M63 A;  1DCQ A;  4GAA A;  3LPZ A;  4F53 A;  3FUH A;  2F0Y A;  4HLE A;  4BFR A;  3GYZ A;  3RIB A;  3T9K A;  3HVE A;  4BX9 A;  1HE8 A;  1X81 A;  2CFZ A;  3PEV B;  5FZS A;  3WXX A;  3ZHE A;  3EJN A;  4I2W A;  3Q9U C;  4TUM A;  3HXE A;  3CGH A;  3CHO A;  3R7R A;  4K5A B;  1U3C A;  4XE0 A;  3QOU A;  3E33 A;  4FAD A;  2KAT A;  1FVH A;  3SGH A;  2R59 A;  2L0I A;  3MX3 A;  3QWP A;  4CRW A;  3U66 A;  4ATZ D;  3IHY A;  4V3I A;  4YDE A;  4HVB A;  4DPR A;  2HYZ A;  3D9N A;  3ASD A;  4FHJ A;  3R9A B;  2X6K A;  1OCO E;  2P9S G;  3CVX A;  3EHR A;  2I2O A;  2NXP A;  4FC8 A;  3ZW3 A;  2DIW A;  2A5E A;  5BNW A;  4Y6C A;  1TNB A;  3RJV A;  3CHQ A;  4DLO A;  1BU9 A;  5D66 A;  3ZVV A;  5AEN A;  1FVF A;  2V5Q C;  5CBO A;  4RVB A;  3FTU A;  3EHM A;  2R03 A;  3MKQ A;  4CT0 A;  3S7F A;  4LER A;  5AAR A;  5ENP D;  1MX4 A;  2WVI A;  3PRZ A;  2OOE A;  5LCW J;  2PM7 A;  4UI9 J;  4K5C A;  3NBN B;  3UKR G;  1V54 E;  3CVL A;  1TN8 A;  4TRQ A;  3OAW A;  3N71 A;  3RKV A;  4Q69 A;  3IBE A;  4AXH A;  4N5Q A;  3NQP A;  2MRI A;  2UWJ G;  1E8Z A;  2Y0B G;  2FEZ A;  2X38 A;  1E7V A;  2CHX A;  1E8W A;  2GRQ B;  1EYH A;  1O1T A;  3FTW A;  1TNY A;  4HOS A;  3ISM C;  3DSW A;  2QZA A;  3Q5M A;  3ZRH A;  2YNQ A;  3FUD A;  1B89 A;  4NQ0 A;  2NSZ A;  3HXC A;  1E8Y A;  5G55 A;  1KLX A;  2ETA A;  4L2Y A;  3UXG A;  3CHP A;  5KCM A;  1H2V C;  2WMN A;  4YVO A;  1YYH A;  5B1A E;  2VSO E;  4JL0 A;  5CMY A;  1OWN A;  4HS2 A;  1GW6 A;  3ML8 A;  4AOF A;  4I6G A;  2GW1 A;  1TYQ G;  5JHA A;  4XEI G;  4YVQ C;  4LEU A;  2WMO A;  5CED B;  1HXI A;  3S7D A;  3ZU7 B;  5AIJ A;  1FT1 A;  1N11 A;  5A7D B;  3AJI A;  5FJY A;  2FBN A;  4RG6 A;  1G3N B;  3DSX A;  4DK5 A;  4LCT A;  3QWW A;  1ZB1 A;  4JA9 A;  5CCL A;  4W9R A;  1OWO A;  2H6G A;  3UIP C;  4I1O B;  1OWM A;  2PL2 A;  3K9I A;  2A4Z A;  4UQY A;  2XEH A;  3ASH A;  3APD A;  2LXM A;  3SFY A;  3FH7 A;  3CST A;  3S7B A;  2VTB B;  1HX8 A;  3C72 A;  2YIN A;  5D2M C;  2BKG A;  1ELW A;  1TJC A;  5EN5 D;  1X5B A;  4JEU A;  2PM6 A;  3CEQ A;  4DI3 A;  5ENT D;  2XGO A;  4KMO A;  1JCR A;  2R2L A;  5EID A;  1UJK A;  5C1D A;  2J49 A;  2EIL E;  1KPS B;  3Q15 A;  5FQ8 A;  3PE4 A;  1N9A A;  4MS6 A;  2XEV A;  3SY2 A;  3KSL A;  4PS7 A;  4X8Q A;  2MHK A;  2IF4 A;  1WY6 A;  3CV0 A;  3LY8 A;  1BD8 A;  2KM4 A;  3UI2 A;  5EIB E;  3FTS A;  3I5P A;  3DPY A;  5FIN A;  1OWL A;  2DYR E;  4JW1 A;  4MLP A;  1HO8 A;  2DYS E;  4GTV A;  4KVO A;  4G8K A;  2OEV A;  1TNO A;  4C48 B;  2WXF A;  2HO1 A;  2JEK A;  1RZ4 A;  1MX2 A;  4UQX A;  5EKQ D;  4PH4 B;  1OCR E;  3PS6 A;  1HZ4 A;  4U63 A;  4MBG A;  4AV7 A;  3DSU A;  2WXR A;  4U07 A;  2AXZ A;  1HH8 A;  2FUL A;  2L9B A;  3CHM A;  3PE3 A;  5FQ7 A;  3UX4 A;  3UT8 A;  3IV0 A;  3ZIM A;  2P58 C;  5D0O D;  5BW8 C;  2I1J A;  4BER A;  2OND A;  4I9E A;  1TR4 A;  2ETB A;  5ENR D;  4EPZ A;  3G2T A;  5CRU A;  2P9P G;  3FUK A;  5AQA A;  1TNU A;  4XKC A;  4GU5 A;  3B7T A;  1AP7 A;  3TWW A;  3QAQ A;  3OTN A;  3E37 A;  2XRZ A;  3I3N A;  1IKN D;  1W3B A;  4GTT A;  4UWG A;  3B7B A;  2WXK A;  2VTB A;  4HI9 A;  1QZ2 A;  2GRL A;  2LAH A;  2L6B A;  3CVQ A;  5ENS D;  3AU4 A;  4CDR A;  3FDH A;  4A3V A;  4M3O A;  3C98 A;  4B89 A;  4Y6W A;  1Q2Z A;  4JXT A;  4HI8 A;  3E34 A;  3SZ7 A;  3CHS A;  2GRR B;  4KZ0 A;  4B94 A;  3O48 A;  2XGS A;  3MZL B;  4ILI A;  5B3S E;  3TWU A;  3NF1 A;  5J08 A;  2FO1 E;  5J90 A;  1O1S A;  4I17 A;  3G2S A;  2EQX A;  2AXV A;  4XI0 A;  1ZU2 A;  1TNZ A;  3TWR A;  1QYM A;  2VSN A;  2ZGG A;  5ANR A;  4JPS A;  1UN8 A;  3SBS A;  5AYW D;  3L82 A;  2IOS A;  2HE0 A;  2VSY A;  4DX1 A;  5G04 J;  4WNF A;  4ANX A;  5CBN A;  3NZU A;  3U64 A;  3VLF A;  4GZ5 A;  2BED A;  2EIM E;  4U8V D;  3QNK A;  5BUZ A;  2BUG A;  4KVM A;  3AG4 E;  4FA6 A;  3LCA A;  4GTS A;  2PQN A;  3LXU X;  1O1R A;  3AS5 A;  2EIK E;  3Q47 B;  1SW6 A;  3FU0 A;  4LRZ A;  3L9T A;  3PNL B;  4HXI A;  4FU3 A;  3ABK E;  2ILR A;  3L08 A;  4WNG A;  2V4L A;  2IO3 C;  1HG2 A;  3R9M A;  4ATG A;  3RRU A;  3PZ3 A;  5KJM A;  1TN7 A;  4I1A A;  3AS4 A;  3MKR A;  4RLY A;  2NC9 A;  4AIF A;  1K1B A;  4BEP A;  5E75 A;  4I6J A;  3SFZ A;  2ION A;  1YCS B;  1IQR A;  2V8S E;  3ULQ A;  1JUQ A;  4GPM A;  4E6H A;  4I43 A;  3HXF A;  4HRN A;  2Y1L E;  1H0A A;  2FF4 A;  4G2V A;  1SA5 A;  1UJJ A;  4F6R D;  2X3M A;  2V5F A;  4FLB A;  3ONK A;  1JWG A;  1SVX A;  3ZYM A;  4KZC A;  1WAO 1;  4JHR A;  4H7Y A;  2Y4T A;  4EZL A;  3BUA A;  3UT7 A;  2WQ6 A;  5DBK A;  1NA3 A;  2Q7F A;  1DNP A;  1ELR A;  4FP7 A;  3ZPJ A;  5JHB A;  4CDN A;  4KXK B;  1NZN A;  1MJ0 A;  3ULY A;  4G8L A;  3DEP A;  1KZO A;  4AP2 A;  3HHM A;  3Q4A B;  3GZ2 A;  2P9L G;  2PNN A;  3MCX A;  3SFX A;  3PH0 C;  5JA4 D;  3L13 A;  2AJA A;  4GZC A;  5BV0 A;  5LP0 A;  4C9B B;  4ZFH A;  2XZT G;  2ZGD A;  2XCC A;  3HXB A;  4CCA A;  4DX5 D;  2WQ7 A;  5HI7 A;  3WG7 E;  3P2B A;  4TXQ A;  3LY7 A;  3MYV A;  4N39 A;  3T8K A;  1TN6 A;  3GZ1 A;  1A17 A;  4TUU A;  4ABN A;  5CEC B;  3S7J A;  1S64 A;  5G05 C;  3PEU B;  2RD0 A;  2J4D A;  4F3V A;  1N0R A;  3FUI A;  4A3T A;  3V2O A;  2KCV A;  3SQV A;  3T8M A;  4JB8 P;  4GYY A;  3TJP A;  3FHE A;  3FUJ A;  3AU5 A;  2OV8 A;  4G1T A;  3NAW A;  3FTX A;  2R05 A;  1JWF A;  2Y69 E;  2XPI A;  4CDM A;  4Q94 A;  3CVY A;  3RRN B;  3BQO A;  1KT1 A;  4HOT A;  3UKU G;  3GZS A;  3JQ0 A;  3LS8 A;  4HLL A;  4BWR A;  4OAV B;  3JQ1 A;  3V79 K;  4URK A;  4UWH A;  3PNT B;  1PC2 A;  1FCH A;  2VGY A;  5CEA A;  2CHZ A;  4IUL A;  3BG1 B;  4BX8 A;  5CCM A;  4APO A;  3NZS A;  4K5B A;  3E32 A;  2WXN A;  3TL5 A;  3PZ1 A;  2XRY A;  3FTY A;  2WXI A;  3SD5 A;  3L6A A;  4PUC A;  5H7P A;  1XNF A;  3CIA A;  1OCC E;  1LD7 A;  1IYG A;  2X6I A;  1K1A A;  4I6E A;  2P2C P;  3HXD A;  4U04 A;  4U0Z A;  3BG0 B;  3DXK G;  4O60 A;  1Z6T A;  3AAA C;  4NAC A;  1Z5S C;  2KC7 A;  3FP3 A;  4A1S A;  1H6O A;  4UI9 C;  1OT8 A;  3D9L A;  4F1S A;  1N52 A;  1P5Q A;  4GB9 A;  2IO2 C;  2XEE A;  4APF A;  4J0U A;  3LDZ A;  1S63 A;  3ZKJ A;  4PS8 A;  2CG2 A;  3LY9 A;  2IQC A;  4AVX A;  4A1G A;  5EIL A;  4RQI A;  5B1B E;  1FPP A;  4HOR A;  4J8Y A;  3TWQ A;  3DXM G;  1S0P A;  4GA2 A;  4GML A;  3FTV A;  1LF8 A;  3CLJ A;  2X6J A;  3ASO E;  5AQ7 A;  1E8X A;  3L54 A;  3TG5 A;  4A55 A;  3HDX A;  2WXL A;  1MX6 A;  1DCE A;  1N4R A;  3CQG B;  4JVS A;  4M7C A;  5ENQ D;  2WXG A;  5KBA A;  3W9G A;  4GZ6 A;  2HR2 A;  2CFU A;  3EHN A;  5EX0 A;  1K8K G;  3MJW A;  3D9H A;  4CYM D;  2XS1 A;  3CVW A;  3D9K A;  1JPL A;  3GW4 A;  3V30 A;  2WPV A;  4IYP A;  4U0S A;  2GGF A;  4GMR A;  3PZ4 A;  3UMV A;  3UQ3 A;  5KJL A;  5FZQ A;  4GZD A;  4HOQ A;  5JJT A;  1PAQ A;  2B6C A;  1E96 B;  4GMJ A;  3ASN E;  3FUF A;  5LFA A;  4H7X A;  1Z3Y A;  1E90 A;  1TEZ A;  4CGW A;  4P29 A;  3RAU A;  3ESK A;  1PY1 A;  4N3A A;  4KT6 B;  2WB2 A;  4J8D A;  4HB5 A;  1E7U A;  3FUL A;  3NB2 A;  4YDY A;  2QYJ A;  3E30 A;  4WWN A;  2LSU A;  3CVU A;  2RKK A;  4GTR A;  4TXR A;  2A5U A;  4B8A A;  2F37 A;  1QBQ A;  3RSE G;  5FTP A;  4EHM A;  4HFG A;  3MEK A;  2YQ8 A;  3IXE A;  1HS6 A;  3ZUV B;  4CT4 A;  3MGB A;  4BT8 A;  2I1K A;  3B7S A;  4GYW A;  5HRY A;  1TJF A;  2KZT B;  3TWV A;  2DZN A;  5CHE E;  3RO3 A;  4E85 A;  3QK0 A;  2QYU A;  1BI7 B;  1NFI E;  4XI9 A;  3UIO C;  5FIO A;  3EDT B;  2B0O E;  4LG6 A;  4J7W A;  4DX7 D;  4B8C B;  1DC2 A;  3UPV A;  4DJA A;  3B7U X;  4XZ4 A;  2C0M A;  1QQE A;  3CK9 A;  3ENE A;  2UY1 B;  3MV2 B;  3LEW A;  2ZIS A;  4U8H A;  2WXO A;  1WDY A;  4XKB A;  2C2L A;  3B13 A;  5CRV A;  4OAU C;  2J9Q A;  3DRA A;  4BES A;  2AVP A;  1Z3X A;  5D0Q D;  2XPY A;  3L16 A;  3DEO A;  4ILH B;  4XIF A;  3TWS A;  4N3C A;  3NOC D;  2MOW A;  4A63 B;  5ANL A;  3RU0 A;  4FLH A;  3U9W A;  3LYA A;  2P9K G;  1D9S A;  2VSX E;  4FJY A;  4G11 A;  3IEG A;  3ZGQ A;  4QQI A;  4LNG A;  3ML9 A;  2RFA A;  1VDY A;  2OEW A;  4YND A;  3R7Q A;  5EYL A;  1WG0 A;  2IEJ A;  3I4R B;  2OVF A;  1U2V G;  3G2U A;  4U8Y D;  5KNH D;  4GTO A;  1XGW A;  4RSY A;  2XCB A;  4BET A;  3U3W A;  3VLE A;  1AWC B;  1K3Z D;  2LNI A;  3HIZ A;  3AS8 A;  4EEC A;  3ZXP A;  3DPD A;  3ASG A;  3QC1 A;  1H6P A;  5HS0 A;  3BEE A;  4GYO A;  5JJ7 A;  5HQ8 A;  3G2V A;  4UWK A;  4DX2 A;  3VLD A;  4EBA G;  3ULE G;  5ENO D;  3EU9 A;  4QFV A;  4EBA A;  2KZT A;  3Q73 A;  1H6K A;  2WQH A;  4LSZ E;  2P9U G;  3KSQ A;  2RG8 A;  2ETC A;  3V2X A;  4L9P A;  5LOZ A;  2HM8 A;  1D8E A;  4EZK A;  4BTA A;  3TAX A;  3MA5 A;  3ZYK A;  3CVV A;  4ACL A;  3IKO B;  4N5C A;  3URZ A;  5AN8 A;  1ZBP A;  1YMP A;  2H6I A;  2UY1 A;  2GRM A;  5KWD A;  3D9P A;  2XS8 A;  4TXP A;  5CER B;  1L5J A;  2Y4U A;  4JC8 A;  2E0I A;  5C2Y A;  2IY0 C;  3L17 A;  3ZYL A;  3ZN3 A;  1UN9 A;  2BKK B;  4GCN A;  2KBX A;  2DZO A;  4TV3 A;  3ABL E;  5AQB A;  3TXM A;  1Y8M A;  5LX8 A;  1HG5 A;  3AG2 E;  4WAF A;  4JHJ A;  4MKT A;  5BT1 A;  3HRA A;  3EIJ A;  5AJD A;  5G05 J;  5E76 A;  4FJZ A;  4AJW A;  2IJG X;  3CHR A;  3JUI A;  3DBS A;  5EYP F;  3PRE A;  3UUX A;  1Y6I A;  2CG3 A;  1IXV A;  2QC9 A;  4KYO B;  4BTB A;  4F1P A;  2AXU A;  2ZIR A;  2ZU6 B;  2C0L A;  3QJZ A;  3IHV A;  4HOU A;  3KAE A;  4ANW A;  2F8Y A;  4IRU A;  4N3B A;  3W9F A;  5FWQ A;  3TWX A;  3EU5 A;  3S2A A;  3EIQ C;  3C5R A;  3CVP A;  3AG3 E;  3DSV A;  4L23 A;  2JAB A;  4WNE A;  1QNF A;  3CVN A;  3KS2 A;  4OYS A;  5FQ6 A;  3FU5 A;  5DIZ A;  4C0M A;  1EDU A;  1HF8 A;  1N94 A;  4LNB A;  1MZC A;  3CKB A;  1DVP A;  4GTP A;  4N2Q A;  3Q7F A;  2WXP A;  4BSX A;  1H2T C;  3B95 A;  4D10 C;  4ME2 A;  2P9I G;  2V0P A;  2I9C A;  4UWL A;  4LUN U;  4GA1 A;  1BPO A;  3FU3 A;  1SZA A;  2QY7 A;  3JCK C;  2J8S D;  1OWP A;  4KBQ A;  4YDW A;  4HBD A;  4Q96 A;  2H6F A;  3DSS A;  3X2Q E;  4MRU A;  4BY6 A;  2CHW A;  4WND A;  3V31 A;  1BI8 B;  4LNU D;  5JJ6 A;  2EIN E;  1WM5 A;  2VQ2 A;  4BT9 A;  5AAO A;  1NI1 A;  4IN3 B;  3SI5 A;  1V55 E;  3FEX A;  2R17 C;  3E4B A;  2FI7 A;  4NRH B;  1SZ9 A;  5LCW C;  4YDO A;  4J6I A;  2XHE A;  4I9C A;  2VGX B;  3FTZ A;  5FZR A;  1N4S A;  3VTY A;  1SQM A;  4I2Z A;  4G26 A;  5A23 A;  4GTQ A;  5EDS A;  1N0Q A;  2AW6 A;  3OXF A;  2I6H A;  3JUE A;  1EF1 C;  3UT4 A;  5ITZ F;  3FEY A;  3UM3 A;  3OXL A;  3LJ3 A;  1JCQ A;  2JLB A;  3I4G A;  5FQ4 A;  2PZI A;  5AQ9 A;  3QDN A;  1MHQ A;  4DX6 D;  2KCL A;  3BU8 A;  1HFA A;  3JYS A;  5BV1 A;  3TWT A;  4DUI A;  4EQF A;  4JD2 G;  3T5X A;  4CEM A;  3KEA A;  3ZXS A;  2XPZ A;  3HYM B;  4WWP A;  3FH5 A;  4ILG A;  4CZ2 D;  3PVL A;  3Q7A A;  3UM0 A;  2J09 A;  3SNX A;  2R5S A;  3FUM A;  3P1U A;  3JXJ A;  4XX5 A;  5KNG A;  5JMN D;  3PDN A;  5AJL A;  3FY4 A;  4B93 B;  2BF0 X;  5ARG A;  4J8S A;  3UTM A;  4RG9 A;  3J5P A;  1NP7 A;  1OCZ E;  1D8D A;  4FUL A;  1MYO A;  3PZD A;  3CQC B;  4U7E B;  3PUJ A;  1NA0 A;  3G2W A;  4FHK A;  5ARF A;  4UI9 K;  5CMW A;  2L0T B;  3CSF A;  2P9N G;  3RK6 A;  5T3R A;  2LSV A;  2YHC A;  3RO2 A;  5G2N A;  4K0R A;  4DLQ A;  3ESL A;  1KZP A;  4PDX A;  3SO8 A;  4ZHB A;  3O4Z A;  2OCC E;  2LXL A;  4EZJ A;  1LTX A;  3Q75 A;  3KD7 A;  1RW2 A;  3QAR A;  1N4Q A;  2F8X K;  3JXI A;  2RFM A;  4BSZ B;  4AY5 A;  2X6H A;  3ABM E;  2VYI A;  4O1P A;  2VJ8 A;  3LVQ E;  3D9J A;  2VGX A;  3QB2 A;  1KT0 A;  3Q49 B;  4DRX E;  3HG0 D;  3T5V A;  4R7L A;  1S70 B;  1IHB A;  4NIK A;  3C3Q A;  3FU6 A;  4GCO A;  2DCP A;  4O6F A;  4GA0 A;  4C0E A;  5KJN A;  3FUE A;  4HQD A;  2WXQ A;  2GRP B;  3D9M A;  3B7R L;  3F6Q A;  2KCK A;  1BLX B;  3FWV A;  4U0U A;  4AEZ C;  3C3R A;  3UM2 A;  3ONL A;  2XEN A;  5ENN A;  5A6C A;  3QWV A;  1LD8 A;  3QKY A;  4ANU A;  1IHG A;  2LAI A;  2NYJ A;  2FO7 A;  5IY5 E;  4UUC A;  1O5M A;  1U3D A;  4JA7 A;  2AWI A;  3EHQ A;  4OVU A;  1OUV A;  4ACK A;  2Y3A A;  1IQU A;  4WWO A;  1NL4 A;  4ANV A;  4F7A A;  4OVV A;  2E2E A;  2KXP C;  4Z68 A;  1N4P A;  5FT9 A;  3LJN A;  1HU3 A;  2YHE A;  3C3O A;  5EX3 A;  4NUR A;  3ZYQ A;  2WXM A;  1YA0 A;  3APC A;  5BXU A;  5M72 A;  4G23 A;  2L6J A;  3PUK A;  4JEH A;  2WM9 A;  3ASF A;  2LO6 A;  4N2S A;  4WUY A;  4GTM A;  4L1B A;  1JCS A;  2OVB A;  3LVR E;  2GRN B;  4U95 D;  4L7T A;  3D3M A;  3ZFW A;  3SBT B;  2J08 A;  4AM9 A;  3CK7 A;  4HRM B;  2DWZ A;  5HKP A;  2BTD A;  4JZY A;  4CGV A;  3HVE B;  3KEZ A;  4UQZ A;  5T8I A;  3OXG A;  4PS3 A;  1A5E A;  3CK8 A;  3ZHE B;  4U96 D;  2EIJ E;  3CKC A;  1N95 A;  2J07 A;  4AY6 A;  2MYO A;  4L2L A;  3FUN A;  4GPK A;  2QFC A;  1H2U A;  3TG4 A;  3DWL G;  3SF4 A;  3Q78 A;  3ZEF A;  4J8E A;  1H19 A;  5BXO A;  2LUH A;  3SHF A;  3D9I A;  3U4T A;  4J8F A;  2PQR A;  1N54 A;  2V4H C;  3VTX A;  1UOH A;  4O1O A;  1EPU A;  2X6F A;  3Q79 A;  1ELK A;  1OXJ A;  2WXH A;  4I1M A;  3L22 A;  4G24 A;  2DBA A;  3PZ2 A;  4B0Z A;  2XQ0 A;  4DI4 A;  2R02 A;  3ZNG A;  3J5Q B;  5BPP A;  4K03 A;  3MV3 B;  2DVW A;  2J4B A;  2IFU A;  3DST A;  3Q9N C;  4JHK A;  3UM1 A; 
#chains in the Genus database with same CATH homology
 3JUE A;  5EID A;  4G8L A;  4HLL A;  3LJN A;  1OY3 D;  3DEP A;  1AP7 A;  3TWW A;  5CER B;  4OAV B;  5ITZ F;  2F37 A;  2F8X K;  3JXI A;  1D9S A;  1MX6 A;  3V79 K;  2RFM A;  4BSZ B;  1SW6 A;  2PNN A;  3NOG D;  5BXU A;  4QQI A;  4O1P A;  2ETA A;  5AQ9 A;  1IKN D;  5ENQ D;  4DX6 D;  5KBA A;  3UXG A;  3B7B A;  2RFA A;  5JA4 D;  3EHR A;  5CEA A;  3IXE A;  4HNA D;  2BKK B;  3ZUV B;  2AJA A;  2XZD G;  3W9G A;  4DRX E;  2KBX A;  3HG0 D;  4HI9 A;  3TWT A;  4DUI A;  3B95 A;  2DZO A;  4U95 D;  1YYH A;  4K5B A;  2VGE A;  5AQB A;  5HRY A;  1S70 B;  4ZFH A;  3TWV A;  2A5E A;  1IHB A;  2L6B A;  4HRL A;  4NIK A;  2DZN A;  1WG0 A;  5ENS D;  3D9H A;  5EYL A;  4CYM D;  1BD8 A;  4RLY A;  2XZT G;  3UI2 A;  2ZGD A;  2J8S D;  5EIB E;  3KEA A;  4HRM B;  1K1B A;  4DX5 D;  4U8Y D;  5KNH D;  4BEP A;  2DWZ A;  3HRA A;  1BI7 B;  1BU9 A;  1NFI E;  4HI8 A;  4YDW A;  5HKP A;  5D66 A;  4HBD A;  3V30 A;  4HQD A;  5FIN A;  2V5Q C;  4BET A;  1K1A A;  1A5E A;  2P2C P;  1YCS B;  5CBO A;  1K3Z D;  4CZ2 D;  1AWC B;  5FIO A;  3T8K A;  2B0O E;  4U96 D;  5CED B;  4O60 A;  3V31 A;  4GMR A;  3AAA C;  4G8K A;  5AAR A;  5ENP D;  1MX4 A;  4LG6 A;  4GPM A;  5EYP F;  5HS0 A;  1BI8 B;  4J7W A;  4DX7 D;  4C48 B;  4LNU D;  1DC2 A;  3JXJ A;  3ZU7 B;  3TWU A;  1IXV A;  2MYO A;  1DCQ A;  2QC9 A;  3F6Q A;  4DX2 A;  4HRN A;  1BLX B;  5KNG A;  1OT8 A;  4F1P A;  5JMN D;  2FO1 E;  4K5C A;  1N11 A;  3EU9 A;  5ENO D;  5CEC B;  2Y1L E;  1MX2 A;  2XEN A;  4QFV A;  4B93 B;  3AJI A;  3NBN B;  1G3N B;  3UTM A;  3J5P A;  3TWR A;  2XEE A;  4F6R D;  1QYM A;  2ZGG A;  5BXO A;  4LSZ E;  2ETC A;  3ZKJ A;  1MYO A;  5AAO A;  3V2X A;  4N5Q A;  1N0R A;  2NYJ A;  3T9K A;  1SVX A;  3V2O A;  2F8Y A;  4UUC A;  4JB8 P;  5EIL A;  2V4H C;  2HE0 A;  3W9F A;  2XEH A;  2Y0B G;  4DX1 A;  1UOH A;  1WDY A;  4J8Y A;  3TWQ A;  3TWX A;  3EHQ A;  4O1O A;  3Q9U C;  4TUM A;  5CBN A;  4OAU C;  4BES A;  4K5A B;  3C5R A;  2BKG A;  4HB5 A;  5AN8 A;  4BER A;  4U8V D;  1YMP A;  3DEO A;  5EN5 D;  1TR4 A;  2ETB A;  4YDY A;  3SO8 A;  2QYJ A;  3ZNG A;  5ENR D;  4ZHB A;  2JAB A;  3J5Q B;  5AQ7 A;  1N0Q A;  2DVW A;  3Q9N C;  5ENT D;  3TWS A;  1MJ0 A;  2KXP C;  5KWD A;  4Z68 A;  4ATZ D;  3NOC D;  5AQA A;  4A63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...