4CZ2D

Complex of human varp-ankrd1 with rab32-gppcp. selenomet derivative.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
VVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
pubmed doi rcsb
molecule keywords RAS-RELATED PROTEIN RAB-32
molecule tags Signaling protein
source organism Homo sapiens
total genus 57
structure length 168
sequence length 168
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4cz2D00
4K5AB 2XEEA 4QQIA 1IKND 5CECB 4BESA 2F8XK 4N5QA 2L6BA 5ITZF 3D9HA 3V79K 3HG0D 3T8KA 3J5PA 5HS0A 2XZTG 4U95D 5CEDB 1MX6A 2MYOA 4U96D 4C48B 1S70B 1A5EA 4CZ2D 4HI8A 2QYJA 1N11A 3JUEA 3TWSA 1MYOA 1YMPA 5CEAA 2RFAA 4HI9A 3ZUVB 3C5RA 4QFVA 3TWTA 4K5CA 4DX2A 1NFIE 2FO1E 2DZOA 5BXUA 3LJNA 1MX4A 4G8LA 4J8YA 3ZKJA 1UOHA 5EYPF 5JA4D 3TWRA 2HE0A 5FINA 4BERA 1OT8A 4HRLA 4F1PA 3JXIA 4DX7D 4ZHBA 5FIOA 3EHQA 5CBOA 3EHRA 2F37A 1K1BA 4A63B 4U8VD 1K3ZD 3IXEA 2B0OE 2ETAA 5AQ9A 3NBNB 1TR4A 2A5EA 3SO8A 1IXVA 4K5BA 4DX1A 3AJIA 5ENRD 2BKGA 2XZDG 1OY3D 2Y0BG 3EU9A 1D9SA 4O1OA 3V30A 4HRMB 3JXJA 3V2XA 5ENSD 4YDWA 5ENOD 4ZFHA 4JB8P 5ENTD 1AP7A 3DEOA 4HRNA 1N0QA 3HRAA 5AAOA 3B95A 2ETBA 2V5QC 4HNAD 4O60A 4RLYA 3W9GA 5CBNA 3B7BA 5D66A 1YCSB 4Z68A 1WG0A 2BKKB 2ZGDA 5EYLA 3UXGA 3V2OA 1BU9A 1BI8B 4DUIA 2Y1LE 1MX2A 3TWUA 3TWXA 2ETCA 3TWWA 4DX5D 5ENPD 4F6RD 1DC2A 4OAUC 2QC9A 5EIDA 3Q9NC 3T9KA 1N0RA 4HLLA 3NOCD 2AJAA 4CYMD 2PNNA 5JMND 3KEAA 5AQ7A 2V4HC 1IHBA 5AARA 5AQAA 4NIKA 1SVXA 4HBDA 4ATZD 5CERB 4O1PA 4OAVB 2DZNA 5AN8A 1G3NB 4HB5A 1QYMA 3J5QB 3UTMA 4HQDA 5EIBE 4B93B 2JABA 4DX6D 4BETA 4DRXE 2XENA 5AQBA 1DCQA 1SW6A 4GMRA 3F6QA 3UI2A 3NOGD 3Q9UC 4LG6A 4LNUD 1BI7B 4G8KA 2DWZA 4YDYA 5EN5D 3AAAC 2KBXA 4U8YD 1MJ0A 2P2CP 5KWDA 3TWQA 4LSZE 3ZNGA 1WDYA 2J8SD 1AWCB 2F8YA 4UUCA 4GPMA 5KBAA 1YYHA 2VGEA 4TUMA 1K1AA 1BLXB 5EILA 5ENQD 5KNGA 2DVWA 5BXOA 2RFMA 1BD8A 2KXPC 3DEPA 5HKPA 3TWVA 3V31A 2XEHA 5HRYA 2NYJA 3W9FA 4J7WA 3ZU7B 4BEPA 2ZGGA 5KNHD 4BSZB
chains in the Genus database with same CATH superfamily
3ZYLA 2X6FA 4JC8A 1JUQA 4ATGA 3JUIA 4GB9A 3D9JA 2WB2A 2DCPA 5JJ6A 4ANXA 3ASFA 4FHJA 3PZDA 3E32A 3CHMA 3UIPC 4ME2A 3L9TA 4HS2A 4RG6A 3S7JA 2RD0A 4HRLA 1H19A 1SQMA 4ZHBA 1H6OA 3I4RB 3ONKA 1TNBA 2I1JA 3CLJA 3B7UX 2LUHA 3D9OA 2LAIA 2R05A 3DRAA 5KJLA 5ENSD 4YDWA 4U0UA 2KM4A 3DEOA 4UI9K 3MV3B 3W9GA 3CVNA 2C0MA 2PL2A 5G04J 4XKCA 4Z68A 2ZGDA 4V3IA 3KSQA 4UWGA 2ETCA 3MKRA 4KBQA 5G04C 4I17A 3MYVA 4CRWA 2IQCA 4JA7A 4E85A 5JJ7A 4OAVB 3CEQA 4A3VA 3I4GA 4E6HA 2HM8A 1P5QA 1UJKA 3AS8A 4GTMA 4AVXA 4APOA 3CHPA 2F8YA 3ENEA 5B1AE 1E8ZA 5EILA 3ZU7B 4CCAA 4HVBA 1Q2ZA 4UWHA 3RU0A 1JPLA 4JW1A 4QQIA 2XGOA 5KJNA 1UJJA 2YQ8A 3T8KA 3Q7FA 3WG7E 2I6HA 4FU3A 3FH7A 3K9IA 1N52A 3P1UA 1MYOA 3MKQB 3HXFA 4J8YA 2WXLA 2CFUA 2EILE 3QWWA 5FIOA 4J8FA 2IY0C 1K3ZD 4KVOA 3EU9A 4CGVA 2CHXA 3V30A 4R7LA 2KCVA 3DSXA 3URZA 2V5QC 2C0LA 3PNTB 4C9BB 4GTTA 3PE3A 2XRZA 2AJAA 4C0MA 1FVHA 5JMND 3FDHA 3ZYQA 4BT8A 1FCHA 2A5UA 3HVEB 4W9RA 3GW4A 3ASDA 2M63A 1TJFA 4B93B 1OWMA 4L2LA 5M72A 5AQBA 3F6QA 3Q9UC 3S2AA 4APFA 4M3OA 4UI9J 2J8SD 3IHVA 2J08A 3LVRE 5BXOA 3DSVA 5HKPA 2ZGGA 2XEEA 4UI9C 4GTSA 4OYSA 4EZKA 4CGWA 4AXHA 2GRPB 1SZ9A 2FBNA 3NB2A 1RW2A 3SD5A 4FA6A 3G2UA 1GW6A 3S7FA 3B7TA 2HE0A 3T5VA 1IYGA 3TAXA 1HG5A 3FU0A 3RK6A 2F37A 3PEUB 4A63B 4UWKA 3QAQA 5AQ9A 2A5EA 4FHKA 1U3DA 2XEVA 4I9EA 4U0ZA 3HYMB 4KXKB 4GCOA 1AP7A 2OEVA 1S64A 3DWLG 1TN8A 3TWWA 3HXEA 4EZLA 3B7RL 3S7DA 1O1RA 1MQSA 3O48A 3PZ4A 4B89A 1IQRA 1G3NB 4HB5A 3TL5A 4WAFA 3CGHA 4LNUD 2P9UG 5G55A 2X6KA 2LO6A 3VLEA 3SF4A 3DXKG 4AV7A 4A55A 3NZUA 1JCQA 2FI7A 3FUMA 3SHFA 4NURA 1DCEA 4EBAG 3WXXA 4LUNU 2Q7FA 3PNLB 4TXPA 2V4LA 1YMPA 2VGXA 4I1OB 5EKQD 3QARA 3LDZA 5B1BE 2VYIA 5BW8C 2DZOA 2PM7A 2PQNA 3VLFA 4LEUA 1UG3A 4LRZA 4L23A 3DPYA 3FH5A 4I6GA 3EHRA 1ELRA 3SO8A 2KZTB 3I3NA 2Y0BG 3UM0A 4I2ZA 3MZLB 5G2NA 3C3QA 5CBNA 4DI4A 2KCLA 2XHEA 3PZ3A 2VSOE 3SBSA 2IONA 3LS8A 3TWXA 3FY4A 5ENPD 3JQ1A 1EF1C 2QC9A 3OTNA 3EIQC 2Y4UA 3ZEFA 3DXMG 4XEIG 4HBDA 2EIJE 2Y69E 4WNGA 1N4QA 3PUKA 5AJDA 4JVSA 2X6IA 2BF0X 4F1PA 4LG6A 4U8YD 5G05J 4TXQA 3Q49B 4UUCA 1QQEA 3EU5A 3Q78A 3V31A 4BX9A 1TNOA 5DBKA 3LY9A 1E8XA 4BSZB 3FUKA 2DBAA 5G05C 5IY5E 5CRVA 1LD7A 2R59A 1KLXA 3L22A 3CHSA 1PY1A 4A1SA 5AJLA 3PRZA 3D9NA 1MX4A 3TWRA 4G1TA 2NSZA 4DX7D 2GRLA 3G2SA 1O5MA 4GYOA 4GTOA 4GZCA 5C1DA 3KEZA 2QYUA 2P9KG 3LVQE 2IU1A 3CIAA 3NZSA 1ZBPA 1ZB1A 1XNFA 3CK8A 3HIZA 4JD2G 4DI3A 1OUVA 2H6FA 3B95A 2ETBA 4OVUA 2X6JA 1YCSB 3CQGB 3MKQA 3UM3A 1TN6A 3V2OA 2R02A 2XGSA 3CVLA 1BPOA 3D9IA 2PNNA 2E0IA 3PEVB 1A17A 4WWNA 2V4HC 5AARA 2QZAA 4I43A 1KT0A 2R2LA 5EIBE 2JABA 4GZDA 3VTYA 4EPZA 2VTBB 2GRRB 3UI2A 5EN5D 1D8DA 1HF8A 1MJ0A 2P2CP 3RO2A 4BTAA 3FUDA 1H2UA 2FF4A 3EDTB 3BU8A 1Y6IA 2GRQB 2OV8A 3FU6A 3LXUX 4K5AB 4ANVA 5BUZA 4XZ4A 3OXLA 4B8CB 2L6BA 1FT1A 3HVEA 3V79K 3ZHEB 1RZ4A 2I9CA 4L7TA 3KSLA 3C72A 1QZ2A 3CVWA 1Y8MA 3MX3A 3FULA 2FO7A 2EQXA 1TNUA 4EQFA 1OT8A 4L9PA 2DYRE 4ACLA 3CHQA 4AOFA 2VJ8A 2B0OE 2V5FA 3RSEG 2BUGA 4J8DA 3RIBA 4MBGA 1N4PA 4XE0A 2WXPA 3UXGA 2J9QA 3RO3A 2R17C 3ZYKA 3E34A 4CYMD 5EX0A 1E8WA 4AIFA 3AS5A 4FJZA 3LY8A 2B6CA 3ASNE 2AXZA 3ML8A 3QWVA 4ATZD 5CERB 2DZNA 2QY7A 1QYMA 3ZN3A 4U04A 1N95A 1DCQA 3R9AB 4NRHB 3TWQA 4I9CA 2C2LA 3ZNGA 2ILRA 3VLDA 5KBAA 3EUVA 3ASHA 3CSTA 3OAWA 4HFGA 5FWQA 4TXRA 3FHEA 3ULEG 5KNHD 3IV0A 2WXRA 1KPSB 2HR2A 4MKTA 3JCKC 3SBTB 3PDNA 1INZA 5AENA 3HG0D 4EBAA 3TXMA 5E75A 2WXKA 4CZ2D 3JUEA 4DLQA 3AG4E 3PREA 3APFA 3L08A 3CVUA 5BXUA 4D10C 3ZGQA 3QNKA 4FLBA 2OCCE 3SGHA 3QKYA 4GYWA 2YINA 4PS7A 2LXLA 2XZDG 4BX8A 1H6KA 3CVPA 2GRNB 4GA1A 4KZCA 5ENOD 1ELWA 4ZFHA 3Q75A 3PH0C 3ESLA 3U4TA 2AW6A 3B7BA 4AM9A 3CHRA 5EYLA 3MEKA 4ILHB 5FZRA 1NA0A 4F6RD 2KCKA 3PE4A 5EIDA 4HLLA 4JL0A 4CDMA 1NL4A 2EIKE 3IBEA 4JZYA 5LFAA 2WMOA 4AY6A 5A23A 3U9WA 2A4ZA 3UT4A 2WXIA 4WWOA 2KZTA 2RKKA 4HOQA 4EECA 1LTXA 3LKUA 1X81A 2L0TB 5ARGA 3ABKE 4HQDA 2F0YA 1W3BA 3ULYA 3UM1A 2WQ6A 3ZIMA 2WMNA 2VSXE 2XRYA 2JEKA 4ILGA 2P9LG 3CKCA 5ENQD 1BD8A 3RRNB 1HZ4A 5CECB 3FTWA 4BESA 3GYZA 2CHWA 2GROB 1HO8A 3CHOA 4DK5A 2IOSA 4AY5A 3MA5A 3JQ0A 5FQ6A 3FTVA 4HI9A 2YHCA 3L17A 4G8LA 2I2OA 1OWOA 3Q5MA 4HOUA 3LJ3A 1E90A 1H6PA 3FH8A 2BKGA 1D9SA 2J07A 3ULQA 1Z5SC 3UT8A 4M7CA 3HRAA 4BTBA 4RLYA 4O6FA 1U2VG 3G2VA 4JXTA 5T4YA 4IRUA 3SZ7A 4Q69A 3UT7A 1UN8A 4FC8A 4OAUC 3T9KA 1DC2A 4GU5A 4U0SA 5AQAA 3ZXPA 1SVXA 3OXFA 4GMJA 2P58C 1FT2A 3ABME 4DLOA 2X3MA 2HYZA 1OWLA 2PQRA 1WY6A 1S0PA 4GMRA 4ILIA 2WXMA 3C3RA 3HXDA 1BLXB 1KZPA 2NYJA 1U3CA 3RAUA 4JEUA 4LNGA 3SFYA 4F1SA 4WNFA 4JA9A 3R7QA 1FVFA 2QYJA 1N11A 2MHKA 3MV2B 2OOEA 2VTBA 5E76A 4GAAA 4DX2A 4G11A 1LF8A 3QOUA 5FINA 4KYOB 1NP7A 1H2VC 4U07A 2WXQA 4KZ0A 3TGOA 3MGBA 3P2BA 4K5BA 4U63A 3APCA 5EDSA 3ZHEA 3SI5A 3QK0A 5JJTA 4BT9A 3Q73A 4O60A 4HNAD 4CEMA 4GA0A 4IN3B 3FUFA 1S63A 5KJKA 4I1MA 1LD8A 4B94A 4I6EA 2KATA 3Q9NC 4ANUA 2IFUA 3KEAA 2J49A 4NACA 4UWLA 1JWFA 3DBSA 3J5QB 4DX6D 4RQIA 1UN9A 4Y6WA 3ML9A 3O4ZA 2AXUA 1SA4A 2L6JA 1WDYA 5ANRA 2XS8A 5BV0A 3TG4A 2DVWA 5HRYA 3BUAA 3QDNA 2J09A 5HI7A 5LCWJ 4YVOA 3AG3E 3CVVA 4OVVA 3LPZA 5HS0A 4Q94A 4MLPA 5LCWC 1N9AA 2AWIA 4K03A 3ZPJA 2FULA 2FEZA 4QFVA 2FO1E 3UMVA 4J8SA 3OXGA 1ZU2A 5LOZA 1E8YA 2X38A 1HU3A 3EHQA 3UPVA 4PDXA 4U8VD 3FU5A 1NA3A 2Y3AA 5D0QD 3AJIA 2WQ7A 5FJYA 3FFLA 5FTPA 4G24A 1DNPA 1YA0A 1MZCA 1NI1A 1MHQA 3UKUG 3FTYA 1TNYA 4GMLA 3CR3A 1DVPA 1EDUA 4KVMA 3Q7AA 4DX5D 1N0RA 3RRMB 1OXJA 3GZSA 4KT6B 3MJWA 5AQ7A 3ZFWA 3TJPA 2VSYA 3AU5A 1FPPA 3CVYA 4L2YA 5AN8A 1D8EA 3NAWA 3IKOB 1HFAA 5T8IA 2WPVA 1N94A 1TYQG 1BI7B 2H6IA 4YDYA 2KBXA 5KWDA 5KJMA 4GPMA 4DJAA 2ZISA 2OEWA 4Y6CA 1H0AA 4J8EA 1JCSA 4KMOA 2IOLA 2I1KA 3L54A 2F8XK 4RVBA 2GGFA 5LP0A 2MYOA 3DSWA 4U96D 1S70B 3E4BA 3FTZA 4G23A 3TWSA 2P9PG 1SA5A 2WXGA 3BEEA 2XCCA 3PUJA 1OCCE 4AJWA 5ENNA 4GTPA 3MCXA 3C3OA 2LNIA 3EHNA 3L13A 4FLHA 5D0OD 2PZIA 3ESKA 3CSFA 3LYAA 3NBNB 4I1AA 3JXJA 5BPPA 5J08A 2EIME 1O1TA 4EZJA 4N3AA 1E96B 2ZU6B 3LCAA 3FUNA 3KD7A 4XIFA 3AG1E 4I6JA 4AEZC 4U8HA 4DUIA 2E2EA 5T3RA 3DSTA 1EYHA 4GTQA 2P9NG 4MS6A 2V0PA 3FUJA 4G26A 3ZW3A 3L82A 1Z3XA 3G2WA 5FQ8A 4N2SA 3ONLA 4G8KA 2DWZA 3CQCB 4UQYA 4BEPA 1K8KG 5ANLA 3T8MA 1HX8A 4GCNA 1TN7A 2ZXWE 2UY1B 5B3SE 5BT1A 5BV1A 1MX6A 4CDNA 4C48B 4B0ZA 2VQ2A 2HO1A 5FQ4A 1HH8A 5CEAA 4FP7A 2RFAA 3C5RA 3RJVA 4ACKA 1NFIE 5EX3A 3SQVA 3ZKJA 5FT9A 1OWNA 5JHBA 2J4BA 3LY7A 3JXIA 4JPSA 1JCRA 4F3VA 4ANWA 3ZVVA 3D9LA 4H7YA 1VDYA 2ETAA 5ENRD 1OCZE 2WQHA 2L0IA 4YNDA 5BNWA 2CFZA 5ENTD 3Q15A 3FTXA 1Z6TA 4GZ6A 3ASGA 3Q79A 2Y1LE 1MX2A 4UQZA 3FP3A 3R7RA 1EPUA 2NC9A 1E7UA 5CMYA 2PM6A 4HOTA 1IHBA 1WM5A 1TNZA 1B89A 4K0RA 1UW4B 5A6CA 4DRXE 2XENA 3ZYMA 2GW1A 3QB2A 4NQ0A 4GZ5A 5C2YA 2BEDA 4G2VA 1KZOA 3L6AA 3DEPA 5AIJA 3W9FA 5D2MC 2VSNA 3IHYA 1IKND 2WXOA 3IEGA 3FUEA 4HI8A 4UWFA 3TG5A 4TUUA 2DYSE 4HLEA 4JHRA 3TWTA 2P9IG 4GPKA 3QWPA 4GTRA 4DPRA 1PC2A 4URKA 1N54A 5FZQA 3T5XA 3NF1A 4U7EB 3EHMA 5CBOA 3B13A 2AXVA 3CK9A 4PS8A 3FEYA 1OCOE 1OY3D 2MOWA 4O1OA 3V2XA 3HXCA 2IJGX 4GA2A 4JB8P 4XI9A 5LX8A 4BFRA 1HXIA 3KAEA 3SFZA 4PUCA 3TWUA 4FADA 3APDA 5JHAA 3UQ3A 5J90A 3LEWA 3D9PA 4NIKA 4N3BA 3D9MA 2JLBA 1N4RA 1SZAA 4XX5A 3UTMA 1HS6A 4WUYA 1O1SA 4BSXA 4LNBA 3CKBA 4UQXA 2EINE 2UWJG 4FULA 2R5SA 2ZIRA 4J6IA 3ABLE 3AS4A 1YYHA 2VGEA 4TUMA 2KC7A 2KXPC 3TWVA 1JWGA 4N39A 3FUIA 2P9SG 5AYWD 4L1BA 3QC1A 3BG1B 2X6HA 3FEXA 4JEHA 3SFXA 3EIJA 4LCTA 3DSUA 1V55E 4K5CA 3LJNA 4P29A 3D9KA 4N5CA 4BERA 4XI0A 3PZ2A 3UINC 3QJZA 2AVPA 4RG9A 5CMWA 4CT4A 2WXFA 3GZ2A 4AP2A 3I5PA 1TR4A 1IXVA 4BWRA 5H7PA 3ISMC 3JYSA 3HHMA 4LERA 4HOSA 4Q96A 4TRQA 3CK7A 1PAQA 3DSSA 5HQ8A 1QBQA 1OWPA 2BKKB 1ELKA 5FQ7A 3FTSA 2IF4A 1BU9A 3Q47B 4JHKA 1BI8B 4BY6A 3C98A 3UUXA 3NOCD 4WNEA 4GZ3A 4EHMA 1QNFA 4I2WA 2CG2A 4X8QA 3UM2A 3PZ1A 4PS3A 4B8AA 1E7VA 4WWPA 3EJNA 3NOGD 1AWCB 4ABNA 4J0UA 1K1AA 2IEJA 2VGYA 3KS2A 3L16A 3PS6A 1Z3YA 1IQUA 3R9MA 4N5QA 2WXHA 4F53A 2XS1A 5CCLA 3J5PA 2XZTG 1A5EA 2OVFA 3TXNA 3CVQA 2WM9A 4GYYA 4XKBA 3BG0B 3S7BA 2MRIA 3G2TA 3E33A 1UOHA 5EYPF 5JA4D 3ASOE 3ZXSA 3CVXA 2WXJA 1HE8A 3UX4A 2WVIA 3B7SA 3FUHA 3IXEA 4DX1A 2H6HA 3BQOA 4F7AA 2UY1A 4HRMB 3GZ1A 2RG8A 1WAO1 2CHZA 1TEZA 4HRNA 4YDEA 5AAOA 2XGMA 1H2TC 5D66A 2XCBA 3FWVA 1WG0A 3N71A 3RRUA 2NXPA 2J4DA 1IHGA 5A7DB 4GTVA 3SY2A 2XQ0A 3E30A 3NQPA 5CRUA 1V54E 2Y4TA 4G25A 3FU3A 2DIWA 3FTUA 4A3TA 4N3CA 1L5JA 4PH4B 4YVQC 3UKRG 4FJYA 2V8SE 4LSZE 2LXMA 1XGWA 2RFMA 4J7WA 3AU4A 4HXIA 2GRMA 3RKVA 2ONDA 3Q4AB 5ITZF 2YNQA 3CV0A 4RSYA 2OVBA 3D9HA 5CEDB 4U95D 5CHEE 3SNXA 4C0EA 3ZUVB 5DIZA 3HDXA 5CCMA 3ZRHA 2LAHA 5KCMA 4A1GA 2LSUA 4IYPA 4CT0A 1KT1A 2LSVA 4JHJA 1K1BA 2QFCA 5ARFA 2XPYA 3U3WA 2XPIA 1N4SA 3U64A 4IULA 1N0QA 4H7XA 2BTDA 1X5BA 4MRUA 4CDRA 1OCRE 4TV3A 2YHEA 2L9BA 3VTXA 2IO3C 2WXNA 5FZSA 2CG3A 3PVLA 4O1PA 3E37A 4HORA 1NZNA 3AG2E 3X2QE 2H6GA 2XPZA 4WNDA 3UIOC 2VGXB 4BETA 2IO2C 3HXBA 1SW6A 3AAAC 3DPDA 4N2QA 2R03A 3D3MA 5KNGA 4YDOA 2XEHA 1HG2A 1TJCA 3U66A
chains in the Genus database with same CATH topology
4K5AB 2XEEA 4QQIA 1IKND 5CECB 4BESA 2F8XK 4N5QA 2L6BA 5ITZF 3D9HA 3V79K 3HG0D 3T8KA 3J5PA 5HS0A 2XZTG 4U95D 5CEDB 1MX6A 2MYOA 4U96D 4C48B 1S70B 1A5EA 4CZ2D 4HI8A 2QYJA 1N11A 3JUEA 3TWSA 1MYOA 1YMPA 5CEAA 2RFAA 4HI9A 3ZUVB 3C5RA 4QFVA 3TWTA 4K5CA 4DX2A 1NFIE 2FO1E 2DZOA 5BXUA 3LJNA 1MX4A 4G8LA 4J8YA 3ZKJA 1UOHA 5EYPF 5JA4D 3TWRA 2HE0A 5FINA 4BERA 1OT8A 4HRLA 4F1PA 3JXIA 4DX7D 4ZHBA 5FIOA 3EHQA 5CBOA 3EHRA 2F37A 1K1BA 4A63B 4U8VD 1K3ZD 3IXEA 2B0OE 2ETAA 5AQ9A 3NBNB 1TR4A 2A5EA 3SO8A 1IXVA 4K5BA 4DX1A 3AJIA 5ENRD 2BKGA 2XZDG 1OY3D 2Y0BG 3EU9A 1D9SA 4O1OA 3V30A 4HRMB 3JXJA 3V2XA 5ENSD 4YDWA 5ENOD 4ZFHA 4JB8P 5ENTD 1AP7A 3DEOA 4HRNA 1N0QA 3HRAA 5AAOA 3B95A 2ETBA 2V5QC 4HNAD 4O60A 4RLYA 3W9GA 5CBNA 3B7BA 5D66A 1YCSB 4Z68A 1WG0A 2BKKB 2ZGDA 5EYLA 3UXGA 3V2OA 1BU9A 1BI8B 4DUIA 2Y1LE 1MX2A 3TWUA 3TWXA 2ETCA 3TWWA 4DX5D 5ENPD 4F6RD 1DC2A 4OAUC 2QC9A 5EIDA 3Q9NC 3T9KA 1N0RA 4HLLA 3NOCD 2AJAA 4CYMD 2PNNA 5JMND 3KEAA 5AQ7A 2V4HC 1IHBA 5AARA 5AQAA 4NIKA 1SVXA 4HBDA 4ATZD 5CERB 4O1PA 4OAVB 2DZNA 5AN8A 1G3NB 4HB5A 1QYMA 3J5QB 3UTMA 4HQDA 5EIBE 4B93B 2JABA 4DX6D 4BETA 4DRXE 2XENA 5AQBA 1DCQA 1SW6A 4GMRA 3F6QA 3UI2A 3NOGD 3Q9UC 4LG6A 4LNUD 1BI7B 4G8KA 2DWZA 4YDYA 5EN5D 3AAAC 2KBXA 4U8YD 1MJ0A 2P2CP 5KWDA 3TWQA 4LSZE 3ZNGA 1WDYA 2J8SD 1AWCB 2F8YA 4UUCA 4GPMA 5KBAA 1YYHA 2VGEA 4TUMA 1K1AA 1BLXB 5EILA 5ENQD 5KNGA 2DVWA 5BXOA 2RFMA 1BD8A 2KXPC 3DEPA 5HKPA 3TWVA 3V31A 2XEHA 5HRYA 2NYJA 3W9FA 4J7WA 3ZU7B 4BEPA 2ZGGA 5KNHD 4BSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5A B;  2XEE A;  4QQI A;  1IKN D;  5CEC B;  4BES A;  2F8X K;  4N5Q A;  2L6B A;  5ITZ F;  3D9H A;  3V79 K;  3HG0 D;  3T8K A;  3J5P A;  5HS0 A;  2XZT G;  4U95 D;  5CED B;  1MX6 A;  2MYO A;  4U96 D;  4C48 B;  1S70 B;  1A5E A;  4CZ2 D;  4HI8 A;  2QYJ A;  1N11 A;  3JUE A;  3TWS A;  1MYO A;  1YMP A;  5CEA A;  2RFA A;  4HI9 A;  3ZUV B;  3C5R A;  4QFV A;  3TWT A;  4K5C A;  4DX2 A;  1NFI E;  2FO1 E;  2DZO A;  5BXU A;  3LJN A;  1MX4 A;  4G8L A;  4J8Y A;  3ZKJ A;  1UOH A;  5EYP F;  5JA4 D;  3TWR A;  2HE0 A;  5FIN A;  4BER A;  1OT8 A;  4HRL A;  4F1P A;  3JXI A;  4DX7 D;  4ZHB A;  5FIO A;  3EHQ A;  5CBO A;  3EHR A;  2F37 A;  1K1B A;  4A63 B;  4U8V D;  1K3Z D;  3IXE A;  2B0O E;  2ETA A;  5AQ9 A;  3NBN B;  1TR4 A;  2A5E A;  3SO8 A;  1IXV A;  4K5B A;  4DX1 A;  3AJI A;  5ENR D;  2BKG A;  2XZD G;  1OY3 D;  2Y0B G;  3EU9 A;  1D9S A;  4O1O A;  3V30 A;  4HRM B;  3JXJ A;  3V2X A;  5ENS D;  4YDW A;  5ENO D;  4ZFH A;  4JB8 P;  5ENT D;  1AP7 A;  3DEO A;  4HRN A;  1N0Q A;  3HRA A;  5AAO A;  3B95 A;  2ETB A;  2V5Q C;  4HNA D;  4O60 A;  4RLY A;  3W9G A;  5CBN A;  3B7B A;  5D66 A;  1YCS B;  4Z68 A;  1WG0 A;  2BKK B;  2ZGD A;  5EYL A;  3UXG A;  3V2O A;  1BU9 A;  1BI8 B;  4DUI A;  2Y1L E;  1MX2 A;  3TWU A;  3TWX A;  2ETC A;  3TWW A;  4DX5 D;  5ENP D;  4F6R D;  1DC2 A;  4OAU C;  2QC9 A;  5EID A;  3Q9N C;  3T9K A;  1N0R A;  4HLL A;  3NOC D;  2AJA A;  4CYM D;  2PNN A;  5JMN D;  3KEA A;  5AQ7 A;  2V4H C;  1IHB A;  5AAR A;  5AQA A;  4NIK A;  1SVX A;  4HBD A;  4ATZ D;  5CER B;  4O1P A;  4OAV B;  2DZN A;  5AN8 A;  1G3N B;  4HB5 A;  1QYM A;  3J5Q B;  3UTM A;  4HQD A;  5EIB E;  4B93 B;  2JAB A;  4DX6 D;  4BET A;  4DRX E;  2XEN A;  5AQB A;  1DCQ A;  1SW6 A;  4GMR A;  3F6Q A;  3UI2 A;  3NOG D;  3Q9U C;  4LG6 A;  4LNU D;  1BI7 B;  4G8K A;  2DWZ A;  4YDY A;  5EN5 D;  3AAA C;  2KBX A;  4U8Y D;  1MJ0 A;  2P2C P;  5KWD A;  3TWQ A;  4LSZ E;  3ZNG A;  1WDY A;  2J8S D;  1AWC B;  2F8Y A;  4UUC A;  4GPM A;  5KBA A;  1YYH A;  2VGE A;  4TUM A;  1K1A A;  1BLX B;  5EIL A;  5ENQ D;  5KNG A;  2DVW A;  5BXO A;  2RFM A;  1BD8 A;  2KXP C;  3DEP A;  5HKP A;  3TWV A;  3V31 A;  2XEH A;  5HRY A;  2NYJ A;  3W9F A;  4J7W A;  3ZU7 B;  4BEP A;  2ZGG A;  5KNH D;  4BSZ B; 
#chains in the Genus database with same CATH topology
 3ZYL A;  2X6F A;  4JC8 A;  1JUQ A;  4ATG A;  3JUI A;  4GB9 A;  3D9J A;  2WB2 A;  2DCP A;  5JJ6 A;  4ANX A;  3ASF A;  4FHJ A;  3PZD A;  3E32 A;  3CHM A;  3UIP C;  4ME2 A;  3L9T A;  4HS2 A;  4RG6 A;  3S7J A;  2RD0 A;  4HRL A;  1H19 A;  1SQM A;  4ZHB A;  1H6O A;  3I4R B;  3ONK A;  1TNB A;  2I1J A;  3CLJ A;  3B7U X;  2LUH A;  3D9O A;  2LAI A;  2R05 A;  3DRA A;  5KJL A;  5ENS D;  4YDW A;  4U0U A;  2KM4 A;  3DEO A;  4UI9 K;  3MV3 B;  3W9G A;  3CVN A;  2C0M A;  2PL2 A;  5G04 J;  4XKC A;  4Z68 A;  2ZGD A;  4V3I A;  3KSQ A;  4UWG A;  2ETC A;  3MKR A;  4KBQ A;  5G04 C;  4I17 A;  3MYV A;  4CRW A;  2IQC A;  4JA7 A;  4E85 A;  5JJ7 A;  4OAV B;  3CEQ A;  4A3V A;  3I4G A;  4E6H A;  2HM8 A;  1P5Q A;  1UJK A;  3AS8 A;  4GTM A;  4AVX A;  4APO A;  3CHP A;  2F8Y A;  3ENE A;  5B1A E;  1E8Z A;  5EIL A;  3ZU7 B;  4CCA A;  4HVB A;  1Q2Z A;  4UWH A;  3RU0 A;  1JPL A;  4JW1 A;  4QQI A;  2XGO A;  5KJN A;  1UJJ A;  2YQ8 A;  3T8K A;  3Q7F A;  3WG7 E;  2I6H A;  4FU3 A;  3FH7 A;  3K9I A;  1N52 A;  3P1U A;  1MYO A;  3MKQ B;  3HXF A;  4J8Y A;  2WXL A;  2CFU A;  2EIL E;  3QWW A;  5FIO A;  4J8F A;  2IY0 C;  1K3Z D;  4KVO A;  3EU9 A;  4CGV A;  2CHX A;  3V30 A;  4R7L A;  2KCV A;  3DSX A;  3URZ A;  2V5Q C;  2C0L A;  3PNT B;  4C9B B;  4GTT A;  3PE3 A;  2XRZ A;  2AJA A;  4C0M A;  1FVH A;  5JMN D;  3FDH A;  3ZYQ A;  4BT8 A;  1FCH A;  2A5U A;  3HVE B;  4W9R A;  3GW4 A;  3ASD A;  2M63 A;  1TJF A;  4B93 B;  1OWM A;  4L2L A;  5M72 A;  5AQB A;  3F6Q A;  3Q9U C;  3S2A A;  4APF A;  4M3O A;  4UI9 J;  2J8S D;  3IHV A;  2J08 A;  3LVR E;  5BXO A;  3DSV A;  5HKP A;  2ZGG A;  2XEE A;  4UI9 C;  4GTS A;  4OYS A;  4EZK A;  4CGW A;  4AXH A;  2GRP B;  1SZ9 A;  2FBN A;  3NB2 A;  1RW2 A;  3SD5 A;  4FA6 A;  3G2U A;  1GW6 A;  3S7F A;  3B7T A;  2HE0 A;  3T5V A;  1IYG A;  3TAX A;  1HG5 A;  3FU0 A;  3RK6 A;  2F37 A;  3PEU B;  4A63 B;  4UWK A;  3QAQ A;  5AQ9 A;  2A5E A;  4FHK A;  1U3D A;  2XEV A;  4I9E A;  4U0Z A;  3HYM B;  4KXK B;  4GCO A;  1AP7 A;  2OEV A;  1S64 A;  3DWL G;  1TN8 A;  3TWW A;  3HXE A;  4EZL A;  3B7R L;  3S7D A;  1O1R A;  1MQS A;  3O48 A;  3PZ4 A;  4B89 A;  1IQR A;  1G3N B;  4HB5 A;  3TL5 A;  4WAF A;  3CGH A;  4LNU D;  2P9U G;  5G55 A;  2X6K A;  2LO6 A;  3VLE A;  3SF4 A;  3DXK G;  4AV7 A;  4A55 A;  3NZU A;  1JCQ A;  2FI7 A;  3FUM A;  3SHF A;  4NUR A;  1DCE A;  4EBA G;  3WXX A;  4LUN U;  2Q7F A;  3PNL B;  4TXP A;  2V4L A;  1YMP A;  2VGX A;  4I1O B;  5EKQ D;  3QAR A;  3LDZ A;  5B1B E;  2VYI A;  5BW8 C;  2DZO A;  2PM7 A;  2PQN A;  3VLF A;  4LEU A;  1UG3 A;  4LRZ A;  4L23 A;  3DPY A;  3FH5 A;  4I6G A;  3EHR A;  1ELR A;  3SO8 A;  2KZT B;  3I3N A;  2Y0B G;  3UM0 A;  4I2Z A;  3MZL B;  5G2N A;  3C3Q A;  5CBN A;  4DI4 A;  2KCL A;  2XHE A;  3PZ3 A;  2VSO E;  3SBS A;  2ION A;  3LS8 A;  3TWX A;  3FY4 A;  5ENP D;  3JQ1 A;  1EF1 C;  2QC9 A;  3OTN A;  3EIQ C;  2Y4U A;  3ZEF A;  3DXM G;  4XEI G;  4HBD A;  2EIJ E;  2Y69 E;  4WNG A;  1N4Q A;  3PUK A;  5AJD A;  4JVS A;  2X6I A;  2BF0 X;  4F1P A;  4LG6 A;  4U8Y D;  5G05 J;  4TXQ A;  3Q49 B;  4UUC A;  1QQE A;  3EU5 A;  3Q78 A;  3V31 A;  4BX9 A;  1TNO A;  5DBK A;  3LY9 A;  1E8X A;  4BSZ B;  3FUK A;  2DBA A;  5G05 C;  5IY5 E;  5CRV A;  1LD7 A;  2R59 A;  1KLX A;  3L22 A;  3CHS A;  1PY1 A;  4A1S A;  5AJL A;  3PRZ A;  3D9N A;  1MX4 A;  3TWR A;  4G1T A;  2NSZ A;  4DX7 D;  2GRL A;  3G2S A;  1O5M A;  4GYO A;  4GTO A;  4GZC A;  5C1D A;  3KEZ A;  2QYU A;  2P9K G;  3LVQ E;  2IU1 A;  3CIA A;  3NZS A;  1ZBP A;  1ZB1 A;  1XNF A;  3CK8 A;  3HIZ A;  4JD2 G;  4DI3 A;  1OUV A;  2H6F A;  3B95 A;  2ETB A;  4OVU A;  2X6J A;  1YCS B;  3CQG B;  3MKQ A;  3UM3 A;  1TN6 A;  3V2O A;  2R02 A;  2XGS A;  3CVL A;  1BPO A;  3D9I A;  2PNN A;  2E0I A;  3PEV B;  1A17 A;  4WWN A;  2V4H C;  5AAR A;  2QZA A;  4I43 A;  1KT0 A;  2R2L A;  5EIB E;  2JAB A;  4GZD A;  3VTY A;  4EPZ A;  2VTB B;  2GRR B;  3UI2 A;  5EN5 D;  1D8D A;  1HF8 A;  1MJ0 A;  2P2C P;  3RO2 A;  4BTA A;  3FUD A;  1H2U A;  2FF4 A;  3EDT B;  3BU8 A;  1Y6I A;  2GRQ B;  2OV8 A;  3FU6 A;  3LXU X;  4K5A B;  4ANV A;  5BUZ A;  4XZ4 A;  3OXL A;  4B8C B;  2L6B A;  1FT1 A;  3HVE A;  3V79 K;  3ZHE B;  1RZ4 A;  2I9C A;  4L7T A;  3KSL A;  3C72 A;  1QZ2 A;  3CVW A;  1Y8M A;  3MX3 A;  3FUL A;  2FO7 A;  2EQX A;  1TNU A;  4EQF A;  1OT8 A;  4L9P A;  2DYR E;  4ACL A;  3CHQ A;  4AOF A;  2VJ8 A;  2B0O E;  2V5F A;  3RSE G;  2BUG A;  4J8D A;  3RIB A;  4MBG A;  1N4P A;  4XE0 A;  2WXP A;  3UXG A;  2J9Q A;  3RO3 A;  2R17 C;  3ZYK A;  3E34 A;  4CYM D;  5EX0 A;  1E8W A;  4AIF A;  3AS5 A;  4FJZ A;  3LY8 A;  2B6C A;  3ASN E;  2AXZ A;  3ML8 A;  3QWV A;  4ATZ D;  5CER B;  2DZN A;  2QY7 A;  1QYM A;  3ZN3 A;  4U04 A;  1N95 A;  1DCQ A;  3R9A B;  4NRH B;  3TWQ A;  4I9C A;  2C2L A;  3ZNG A;  2ILR A;  3VLD A;  5KBA A;  3EUV A;  3ASH A;  3CST A;  3OAW A;  4HFG A;  5FWQ A;  4TXR A;  3FHE A;  3ULE G;  5KNH D;  3IV0 A;  2WXR A;  1KPS B;  2HR2 A;  4MKT A;  3JCK C;  3SBT B;  3PDN A;  1INZ A;  5AEN A;  3HG0 D;  4EBA A;  3TXM A;  5E75 A;  2WXK A;  4CZ2 D;  3JUE A;  4DLQ A;  3AG4 E;  3PRE A;  3APF A;  3L08 A;  3CVU A;  5BXU A;  4D10 C;  3ZGQ A;  3QNK A;  4FLB A;  2OCC E;  3SGH A;  3QKY A;  4GYW A;  2YIN A;  4PS7 A;  2LXL A;  2XZD G;  4BX8 A;  1H6K A;  3CVP A;  2GRN B;  4GA1 A;  4KZC A;  5ENO D;  1ELW A;  4ZFH A;  3Q75 A;  3PH0 C;  3ESL A;  3U4T A;  2AW6 A;  3B7B A;  4AM9 A;  3CHR A;  5EYL A;  3MEK A;  4ILH B;  5FZR A;  1NA0 A;  4F6R D;  2KCK A;  3PE4 A;  5EID A;  4HLL A;  4JL0 A;  4CDM A;  1NL4 A;  2EIK E;  3IBE A;  4JZY A;  5LFA A;  2WMO A;  4AY6 A;  5A23 A;  3U9W A;  2A4Z A;  3UT4 A;  2WXI A;  4WWO A;  2KZT A;  2RKK A;  4HOQ A;  4EEC A;  1LTX A;  3LKU A;  1X81 A;  2L0T B;  5ARG A;  3ABK E;  4HQD A;  2F0Y A;  1W3B A;  3ULY A;  3UM1 A;  2WQ6 A;  3ZIM A;  2WMN A;  2VSX E;  2XRY A;  2JEK A;  4ILG A;  2P9L G;  3CKC A;  5ENQ D;  1BD8 A;  3RRN B;  1HZ4 A;  5CEC B;  3FTW A;  4BES A;  3GYZ A;  2CHW A;  2GRO B;  1HO8 A;  3CHO A;  4DK5 A;  2IOS A;  4AY5 A;  3MA5 A;  3JQ0 A;  5FQ6 A;  3FTV A;  4HI9 A;  2YHC A;  3L17 A;  4G8L A;  2I2O A;  1OWO A;  3Q5M A;  4HOU A;  3LJ3 A;  1E90 A;  1H6P A;  3FH8 A;  2BKG A;  1D9S A;  2J07 A;  3ULQ A;  1Z5S C;  3UT8 A;  4M7C A;  3HRA A;  4BTB A;  4RLY A;  4O6F A;  1U2V G;  3G2V A;  4JXT A;  5T4Y A;  4IRU A;  3SZ7 A;  4Q69 A;  3UT7 A;  1UN8 A;  4FC8 A;  4OAU C;  3T9K A;  1DC2 A;  4GU5 A;  4U0S A;  5AQA A;  3ZXP A;  1SVX A;  3OXF A;  4GMJ A;  2P58 C;  1FT2 A;  3ABM E;  4DLO A;  2X3M A;  2HYZ A;  1OWL A;  2PQR A;  1WY6 A;  1S0P A;  4GMR A;  4ILI A;  2WXM A;  3C3R A;  3HXD A;  1BLX B;  1KZP A;  2NYJ A;  1U3C A;  3RAU A;  4JEU A;  4LNG A;  3SFY A;  4F1S A;  4WNF A;  4JA9 A;  3R7Q A;  1FVF A;  2QYJ A;  1N11 A;  2MHK A;  3MV2 B;  2OOE A;  2VTB A;  5E76 A;  4GAA A;  4DX2 A;  4G11 A;  1LF8 A;  3QOU A;  5FIN A;  4KYO B;  1NP7 A;  1H2V C;  4U07 A;  2WXQ A;  4KZ0 A;  3TGO A;  3MGB A;  3P2B A;  4K5B A;  4U63 A;  3APC A;  5EDS A;  3ZHE A;  3SI5 A;  3QK0 A;  5JJT A;  4BT9 A;  3Q73 A;  4O60 A;  4HNA D;  4CEM A;  4GA0 A;  4IN3 B;  3FUF A;  1S63 A;  5KJK A;  4I1M A;  1LD8 A;  4B94 A;  4I6E A;  2KAT A;  3Q9N C;  4ANU A;  2IFU A;  3KEA A;  2J49 A;  4NAC A;  4UWL A;  1JWF A;  3DBS A;  3J5Q B;  4DX6 D;  4RQI A;  1UN9 A;  4Y6W A;  3ML9 A;  3O4Z A;  2AXU A;  1SA4 A;  2L6J A;  1WDY A;  5ANR A;  2XS8 A;  5BV0 A;  3TG4 A;  2DVW A;  5HRY A;  3BUA A;  3QDN A;  2J09 A;  5HI7 A;  5LCW J;  4YVO A;  3AG3 E;  3CVV A;  4OVV A;  3LPZ A;  5HS0 A;  4Q94 A;  4MLP A;  5LCW C;  1N9A A;  2AWI A;  4K03 A;  3ZPJ A;  2FUL A;  2FEZ A;  4QFV A;  2FO1 E;  3UMV A;  4J8S A;  3OXG A;  1ZU2 A;  5LOZ A;  1E8Y A;  2X38 A;  1HU3 A;  3EHQ A;  3UPV A;  4PDX A;  4U8V D;  3FU5 A;  1NA3 A;  2Y3A A;  5D0Q D;  3AJI A;  2WQ7 A;  5FJY A;  3FFL A;  5FTP A;  4G24 A;  1DNP A;  1YA0 A;  1MZC A;  1NI1 A;  1MHQ A;  3UKU G;  3FTY A;  1TNY A;  4GML A;  3CR3 A;  1DVP A;  1EDU A;  4KVM A;  3Q7A A;  4DX5 D;  1N0R A;  3RRM B;  1OXJ A;  3GZS A;  4KT6 B;  3MJW A;  5AQ7 A;  3ZFW A;  3TJP A;  2VSY A;  3AU5 A;  1FPP A;  3CVY A;  4L2Y A;  5AN8 A;  1D8E A;  3NAW A;  3IKO B;  1HFA A;  5T8I A;  2WPV A;  1N94 A;  1TYQ G;  1BI7 B;  2H6I A;  4YDY A;  2KBX A;  5KWD A;  5KJM A;  4GPM A;  4DJA A;  2ZIS A;  2OEW A;  4Y6C A;  1H0A A;  4J8E A;  1JCS A;  4KMO A;  2IOL A;  2I1K A;  3L54 A;  2F8X K;  4RVB A;  2GGF A;  5LP0 A;  2MYO A;  3DSW A;  4U96 D;  1S70 B;  3E4B A;  3FTZ A;  4G23 A;  3TWS A;  2P9P G;  1SA5 A;  2WXG A;  3BEE A;  2XCC A;  3PUJ A;  1OCC E;  4AJW A;  5ENN A;  4GTP A;  3MCX A;  3C3O A;  2LNI A;  3EHN A;  3L13 A;  4FLH A;  5D0O D;  2PZI A;  3ESK A;  3CSF A;  3LYA A;  3NBN B;  4I1A A;  3JXJ A;  5BPP A;  5J08 A;  2EIM E;  1O1T A;  4EZJ A;  4N3A A;  1E96 B;  2ZU6 B;  3LCA A;  3FUN A;  3KD7 A;  4XIF A;  3AG1 E;  4I6J A;  4AEZ C;  4U8H A;  4DUI A;  2E2E A;  5T3R A;  3DST A;  1EYH A;  4GTQ A;  2P9N G;  4MS6 A;  2V0P A;  3FUJ A;  4G26 A;  3ZW3 A;  3L82 A;  1Z3X A;  3G2W A;  5FQ8 A;  4N2S A;  3ONL A;  4G8K A;  2DWZ A;  3CQC B;  4UQY A;  4BEP A;  1K8K G;  5ANL A;  3T8M A;  1HX8 A;  4GCN A;  1TN7 A;  2ZXW E;  2UY1 B;  5B3S E;  5BT1 A;  5BV1 A;  1MX6 A;  4CDN A;  4C48 B;  4B0Z A;  2VQ2 A;  2HO1 A;  5FQ4 A;  1HH8 A;  5CEA A;  4FP7 A;  2RFA A;  3C5R A;  3RJV A;  4ACK A;  1NFI E;  5EX3 A;  3SQV A;  3ZKJ A;  5FT9 A;  1OWN A;  5JHB A;  2J4B A;  3LY7 A;  3JXI A;  4JPS A;  1JCR A;  4F3V A;  4ANW A;  3ZVV A;  3D9L A;  4H7Y A;  1VDY A;  2ETA A;  5ENR D;  1OCZ E;  2WQH A;  2L0I A;  4YND A;  5BNW A;  2CFZ A;  5ENT D;  3Q15 A;  3FTX A;  1Z6T A;  4GZ6 A;  3ASG A;  3Q79 A;  2Y1L E;  1MX2 A;  4UQZ A;  3FP3 A;  3R7R A;  1EPU A;  2NC9 A;  1E7U A;  5CMY A;  2PM6 A;  4HOT A;  1IHB A;  1WM5 A;  1TNZ A;  1B89 A;  4K0R A;  1UW4 B;  5A6C A;  4DRX E;  2XEN A;  3ZYM A;  2GW1 A;  3QB2 A;  4NQ0 A;  4GZ5 A;  5C2Y A;  2BED A;  4G2V A;  1KZO A;  3L6A A;  3DEP A;  5AIJ A;  3W9F A;  5D2M C;  2VSN A;  3IHY A;  1IKN D;  2WXO A;  3IEG A;  3FUE A;  4HI8 A;  4UWF A;  3TG5 A;  4TUU A;  2DYS E;  4HLE A;  4JHR A;  3TWT A;  2P9I G;  4GPK A;  3QWP A;  4GTR A;  4DPR A;  1PC2 A;  4URK A;  1N54 A;  5FZQ A;  3T5X A;  3NF1 A;  4U7E B;  3EHM A;  5CBO A;  3B13 A;  2AXV A;  3CK9 A;  4PS8 A;  3FEY A;  1OCO E;  1OY3 D;  2MOW A;  4O1O A;  3V2X A;  3HXC A;  2IJG X;  4GA2 A;  4JB8 P;  4XI9 A;  5LX8 A;  4BFR A;  1HXI A;  3KAE A;  3SFZ A;  4PUC A;  3TWU A;  4FAD A;  3APD A;  5JHA A;  3UQ3 A;  5J90 A;  3LEW A;  3D9P A;  4NIK A;  4N3B A;  3D9M A;  2JLB A;  1N4R A;  1SZA A;  4XX5 A;  3UTM A;  1HS6 A;  4WUY A;  1O1S A;  4BSX A;  4LNB A;  3CKB A;  4UQX A;  2EIN E;  2UWJ G;  4FUL A;  2R5S A;  2ZIR A;  4J6I A;  3ABL E;  3AS4 A;  1YYH A;  2VGE A;  4TUM A;  2KC7 A;  2KXP C;  3TWV A;  1JWG A;  4N39 A;  3FUI A;  2P9S G;  5AYW D;  4L1B A;  3QC1 A;  3BG1 B;  2X6H A;  3FEX A;  4JEH A;  3SFX A;  3EIJ A;  4LCT A;  3DSU A;  1V55 E;  4K5C A;  3LJN A;  4P29 A;  3D9K A;  4N5C A;  4BER A;  4XI0 A;  3PZ2 A;  3UIN C;  3QJZ A;  2AVP A;  4RG9 A;  5CMW A;  4CT4 A;  2WXF A;  3GZ2 A;  4AP2 A;  3I5P A;  1TR4 A;  1IXV A;  4BWR A;  5H7P A;  3ISM C;  3JYS A;  3HHM A;  4LER A;  4HOS A;  4Q96 A;  4TRQ A;  3CK7 A;  1PAQ A;  3DSS A;  5HQ8 A;  1QBQ A;  1OWP A;  2BKK B;  1ELK A;  5FQ7 A;  3FTS A;  2IF4 A;  1BU9 A;  3Q47 B;  4JHK A;  1BI8 B;  4BY6 A;  3C98 A;  3UUX A;  3NOC D;  4WNE A;  4GZ3 A;  4EHM A;  1QNF A;  4I2W A;  2CG2 A;  4X8Q A;  3UM2 A;  3PZ1 A;  4PS3 A;  4B8A A;  1E7V A;  4WWP A;  3EJN A;  3NOG D;  1AWC B;  4ABN A;  4J0U A;  1K1A A;  2IEJ A;  2VGY A;  3KS2 A;  3L16 A;  3PS6 A;  1Z3Y A;  1IQU A;  3R9M A;  4N5Q A;  2WXH A;  4F53 A;  2XS1 A;  5CCL A;  3J5P A;  2XZT G;  1A5E A;  2OVF A;  3TXN A;  3CVQ A;  2WM9 A;  4GYY A;  4XKB A;  3BG0 B;  3S7B A;  2MRI A;  3G2T A;  3E33 A;  1UOH A;  5EYP F;  5JA4 D;  3ASO E;  3ZXS A;  3CVX A;  2WXJ A;  1HE8 A;  3UX4 A;  2WVI A;  3B7S A;  3FUH A;  3IXE A;  4DX1 A;  2H6H A;  3BQO A;  4F7A A;  2UY1 A;  4HRM B;  3GZ1 A;  2RG8 A;  1WAO 1;  2CHZ A;  1TEZ A;  4HRN A;  4YDE A;  5AAO A;  2XGM A;  1H2T C;  5D66 A;  2XCB A;  3FWV A;  1WG0 A;  3N71 A;  3RRU A;  2NXP A;  2J4D A;  1IHG A;  5A7D B;  4GTV A;  3SY2 A;  2XQ0 A;  3E30 A;  3NQP A;  5CRU A;  1V54 E;  2Y4T A;  4G25 A;  3FU3 A;  2DIW A;  3FTU A;  4A3T A;  4N3C A;  1L5J A;  4PH4 B;  4YVQ C;  3UKR G;  4FJY A;  2V8S E;  4LSZ E;  2LXM A;  1XGW A;  2RFM A;  4J7W A;  3AU4 A;  4HXI A;  2GRM A;  3RKV A;  2OND A;  3Q4A B;  5ITZ F;  2YNQ A;  3CV0 A;  4RSY A;  2OVB A;  3D9H A;  5CED B;  4U95 D;  5CHE E;  3SNX A;  4C0E A;  3ZUV B;  5DIZ A;  3HDX A;  5CCM A;  3ZRH A;  2LAH A;  5KCM A;  4A1G A;  2LSU A;  4IYP A;  4CT0 A;  1KT1 A;  2LSV A;  4JHJ A;  1K1B A;  2QFC A;  5ARF A;  2XPY A;  3U3W A;  2XPI A;  1N4S A;  3U64 A;  4IUL A;  1N0Q A;  4H7X A;  2BTD A;  1X5B A;  4MRU A;  4CDR A;  1OCR E;  4TV3 A;  2YHE A;  2L9B A;  3VTX A;  2IO3 C;  2WXN A;  5FZS A;  2CG3 A;  3PVL A;  4O1P A;  3E37 A;  4HOR A;  1NZN A;  3AG2 E;  3X2Q E;  2H6G A;  2XPZ A;  4WND A;  3UIO C;  2VGX B;  4BET A;  2IO2 C;  3HXB A;  1SW6 A;  3AAA C;  3DPD A;  4N2Q A;  2R03 A;  3D3M A;  5KNG A;  4YDO A;  2XEH A;  1HG2 A;  1TJC A;  3U66 A; 
#chains in the Genus database with same CATH homology
 4K5A B;  2XEE A;  4QQI A;  1IKN D;  5CEC B;  4BES A;  2F8X K;  4N5Q A;  2L6B A;  5ITZ F;  3D9H A;  3V79 K;  3HG0 D;  3T8K A;  3J5P A;  5HS0 A;  2XZT G;  4U95 D;  5CED B;  1MX6 A;  2MYO A;  4U96 D;  4C48 B;  1S70 B;  1A5E A;  4CZ2 D;  4HI8 A;  2QYJ A;  1N11 A;  3JUE A;  3TWS A;  1MYO A;  1YMP A;  5CEA A;  2RFA A;  4HI9 A;  3ZUV B;  3C5R A;  4QFV A;  3TWT A;  4K5C A;  4DX2 A;  1NFI E;  2FO1 E;  2DZO A;  5BXU A;  3LJN A;  1MX4 A;  4G8L A;  4J8Y A;  3ZKJ A;  1UOH A;  5EYP F;  5JA4 D;  3TWR A;  2HE0 A;  5FIN A;  4BER A;  1OT8 A;  4HRL A;  4F1P A;  3JXI A;  4DX7 D;  4ZHB A;  5FIO A;  3EHQ A;  5CBO A;  3EHR A;  2F37 A;  1K1B A;  4A63 B;  4U8V D;  1K3Z D;  3IXE A;  2B0O E;  2ETA A;  5AQ9 A;  3NBN B;  1TR4 A;  2A5E A;  3SO8 A;  1IXV A;  4K5B A;  4DX1 A;  3AJI A;  5ENR D;  2BKG A;  2XZD G;  1OY3 D;  2Y0B G;  3EU9 A;  1D9S A;  4O1O A;  3V30 A;  4HRM B;  3JXJ A;  3V2X A;  5ENS D;  4YDW A;  5ENO D;  4ZFH A;  4JB8 P;  5ENT D;  1AP7 A;  3DEO A;  4HRN A;  1N0Q A;  3HRA A;  5AAO A;  3B95 A;  2ETB A;  2V5Q C;  4HNA D;  4O60 A;  4RLY A;  3W9G A;  5CBN A;  3B7B A;  5D66 A;  1YCS B;  4Z68 A;  1WG0 A;  2BKK B;  2ZGD A;  5EYL A;  3UXG A;  3V2O A;  1BU9 A;  1BI8 B;  4DUI A;  2Y1L E;  1MX2 A;  3TWU A;  3TWX A;  2ETC A;  3TWW A;  4DX5 D;  5ENP D;  4F6R D;  1DC2 A;  4OAU C;  2QC9 A;  5EID A;  3Q9N C;  3T9K A;  1N0R A;  4HLL A;  3NOC D;  2AJA A;  4CYM D;  2PNN A;  5JMN D;  3KEA A;  5AQ7 A;  2V4H C;  1IHB A;  5AAR A;  5AQA A;  4NIK A;  1SVX A;  4HBD A;  4ATZ D;  5CER B;  4O1P A;  4OAV B;  2DZN A;  5AN8 A;  1G3N B;  4HB5 A;  1QYM A;  3J5Q B;  3UTM A;  4HQD A;  5EIB E;  4B93 B;  2JAB A;  4DX6 D;  4BET A;  4DRX E;  2XEN A;  5AQB A;  1DCQ A;  1SW6 A;  4GMR A;  3F6Q A;  3UI2 A;  3NOG D;  3Q9U C;  4LG6 A;  4LNU D;  1BI7 B;  4G8K A;  2DWZ A;  4YDY A;  5EN5 D;  3AAA C;  2KBX A;  4U8Y D;  1MJ0 A;  2P2C P;  5KWD A;  3TWQ A;  4LSZ E;  3ZNG A;  1WDY A;  2J8S D;  1AWC B;  2F8Y A;  4UUC A;  4GPM A;  5KBA A;  1YYH A;  2VGE A;  4TUM A;  1K1A A;  1BLX B;  5EIL A;  5ENQ D;  5KNG A;  2DVW A;  5BXO A;  2RFM A;  1BD8 A;  2KXP C;  3DEP A;  5HKP A;  3TWV A;  3V31 A;  2XEH A;  5HRY A;  2NYJ A;  3W9F A;  4J7W A;  3ZU7 B;  4BEP A;  2ZGG A;  5KNH D;  4BSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...