4CZ2D

Complex of human varp-ankrd1 with rab32-gppcp. selenomet derivative.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
b'VVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
pubmed doi rcsb
molecule keywords RAS-RELATED PROTEIN RAB-32
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 168
sequence length 168
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4cz2D00
3TWUA 2ZGDA 4JB8P 2QYJA 3HRAA 3KEAA 1BU9A 4K5BA 4NIKA 3TWRA 3IXEA 2A5EA 3V2OA 4BESA 4CYMD 5KBAA 4HLLA 4DX6D 2JABA 2ETCA 4U95D 2NYJA 3NOGD 3JXIA 4K5AB 2ZGGA 2F8XK 4YDWA 4DX2A 3UI2A 4ZFHA 5CBNA 1TR4A 3JUEA 3T9KA 3ZUVB 4HQDA 2XEEA 2F37A 3T8KA 1IKND 2XEHA 5ENSD 1MYOA 1N0RA 3D9HA 4HRNA 4OAUC 4C48B 2P2CP 5EYPF 5ENRD 1BI7B 3EHQA 4B93B 3V30A 1BI8B 1AP7A 4QFVA 5BXUA 1SW6A 2PNNA 2DWZA 4F1PA 2V5QC 1AWCB 4BEPA 3V79K 3J5QB 5AAOA 2HE0A 2DVWA 1K1BA 2XZDG 2BKKB 4A63B 4DX7D 4O60A 3TWXA 4DUIA 2DZOA 3J5PA 5HRYA 5EIDA 1D9SA 1DC2A 3HG0D 4QQIA 4OAVB 5AN8A 3EHRA 3TWTA 5CBOA 3TWSA 1OT8A 5KNHD 3TWWA 1BD8A 3W9FA 4BERA 2VGEA 4HBDA 4U8YD 5D66A 2KXPC 3B95A 2F8YA 4N5QA 4U96D 1YMPA 4F6RD 5EILA 1DCQA 4U8VD 3W9GA 4YDYA 2MYOA 1K3ZD 3F6QA 3Q9NC 4J7WA 2BKGA 3LJNA 3Q9UC 1QYMA 4O1PA 5EYLA 2KBXA 5KNGA 1K1AA 5AQ7A 5FINA 3ZNGA 3JXJA 4HNAD 4LNUD 5ENPD 3DEPA 1BLXB 5BXOA 5CERB 3NBNB 4TUMA 5EN5D 1MX2A 4DRXE 4ZHBA 4DX5D 1SVXA 4RLYA 5JMND 4BETA 1IXVA 3ZU7B 5ENTD 4LG6A 4BSZB 5KWDA 3AJIA 3NOCD 5AARA 2Y1LE 3ZKJA 2B0OE 5ENQD 1NFIE 4G8KA 4K5CA 1YYHA 3TWQA 3V31A 5CECB 2V4HC 3UTMA 1MX6A 5JA4D 4CZ2D 1MX4A 5HKPA 1YCSB 1UOHA 5ENOD 4J8YA 1A5EA 2ETAA 2AJAA 3UXGA 4ATZD 4Z68A 5EIBE 4UUCA 4HI8A 3SO8A 4GMRA 5AQAA 5HS0A 3AAAC 3EU9A 4G8LA 2QC9A 4GPMA 5AQ9A 2ETBA 4O1OA 2L6BA 2J8SD 4HRMB 3TWVA 1IHBA 1N11A 3B7BA 2XZTG 3C5RA 3V2XA 4LSZE 5AQBA 2DZNA 5CEAA 1WG0A 5CEDB 4HI9A 1OY3D 2RFAA 4HB5A 2RFMA 1WDYA 4DX1A 1S70B 2FO1E 3DEOA 5FIOA 2Y0BG 1G3NB 2XENA 4HRLA 1MJ0A 1N0QA 5ITZF
chains in the Genus database with same CATH superfamily
2DYSE 5G55A 2QYJA 1BU9A 3ZVVA 4XX5A 3AG1E 2P9UG 4AJWA 4TXPA 3HIZA 3JXIA 3Q7FA 3UI2A 3VTYA 3DPYA 4MKTA 4UWGA 3FUJA 2PL2A 3DSXA 3L16A 4CDNA 4I43A 2XCBA 4MS6A 4B93B 3LVQE 3ZXSA 4KBQA 1TN7A 3L6AA 2C0MA 4JXTA 3QWWA 5CCMA 2AVPA 3RK6A 3MJWA 2E0IA 4N3CA 2LO6A 3B95A 4YDEA 4U0UA 4U8VD 3W9GA 3ZYMA 4BT8A 3L54A 3LJNA 5C2YA 2ZIRA 2KBXA 2WQ7A 3HXCA 3SFXA 1E8WA 4LNUD 5BXOA 3QK0A 2HYZA 2WXGA 1YA0A 1UJKA 4OYSA 2I1KA 1HF8A 3VLEA 3FFLA 4GZ6A 1H0AA 5HS0A 3MV2B 4RG9A 1PC2A 5CEAA 3P2BA 4DX1A 3CVXA 2GW1A 3FH8A 2FI7A 2AW6A 4GAAA 3KD7A 2MRIA 4JB8P 3Q49B 2A5EA 2P58C 4FADA 1UN8A 1UG3A 2NSZA 3CK7A 3SI5A 1IHGA 2XGSA 5T4YA 3NF1A 3X2QE 4DI3A 1D8DA 3IKOB 1OCCE 4E85A 4G2VA 3MA5A 3Q79A 1H2UA 3RKVA 2J4BA 4GB9A 1SW6A 2H6IA 2BF0X 3L17A 1KT1A 2ZISA 3SD5A 5AENA 4APOA 4UI9C 2HO1A 1KT0A 2VSYA 4WWNA 2IOSA 4B8CB 3TWSA 3KEZA 4HBDA 3FH7A 3FY4A 4BY6A 3CQCB 3PZDA 3LY9A 3LVRE 3AG3E 1NA3A 2HR2A 1N4QA 5EKQD 4YVOA 5FJYA 2LXLA 3D9IA 3JCKC 4BX9A 3FUIA 2AXVA 4ME2A 5KJMA 4TUMA 1OXJA 2P9KG 1E90A 1SZ9A 1VDYA 5JJ7A 3AG2E 5A23A 4GYOA 2ETBA 3VLDA 1OCRE 3SZ7A 4CT0A 2BTDA 2I2OA 3QOUA 4HB5A 2RFMA 3ULEG 5AYWD 4J8EA 2ZGDA 1HS6A 3T8MA 4E6HA 5KBAA 3CEQA 4BESA 5CHEE 2VSNA 4GU5A 1PAQA 1NL4A 4Y6WA 2NYJA 3NOGD 2VGXA 3Q47B 4NQ0A 3RIBA 3NZSA 3OXGA 1TNYA 1SQMA 3C3RA 1V54E 1U2VG 5H7PA 2P2CP 2AWIA 3CVVA 4I1OB 1EDUA 3BQOA 1BI8B 4AY5A 4QFVA 3NB2A 4DJAA 5CCLA 5AAOA 4LNBA 3IV0A 2YNQA 3DPDA 2R02A 4U96D 4RQIA 1DCQA 1K8KG 1W3BA 3AU4A 4YVQC 4JA9A 1K3ZD 2WXRA 4AIFA 3ABKE 1QYMA 3GZ2A 3PEUB 4OVUA 2L0IA 3NBNB 5BPPA 5EN5D 5LX8A 2XS8A 3DSVA 3NOCD 1H6KA 3OXFA 4MBGA 2EINE 1MX4A 4F7AA 5HKPA 2ETAA 3CVQA 5AIJA 2WM9A 2GRLA 4I1AA 3UT8A 3EU9A 3DSTA 3D9OA 1S70B 4JZYA 2FO1E 2Y0BG 3ML9A 2AXZA 3CK8A 4XI9A 3DSUA 3LY8A 2CG3A 5ENNA 5ARFA 5ANLA 1E7VA 3QB2A 4AOFA 3PNLB 3U66A 3SBSA 1N94A 4GZCA 1DVPA 4EPZA 2WPVA 2WXQA 2BEDA 2QYUA 3C3QA 1AP7A 2VQ2A 4PH4B 3UIPC 3QJZA 1ELRA 4BT9A 4CCAA 2V5FA 4A3TA 3BUAA 2R05A 3ZN3A 5EIDA 1E8YA 3N71A 2OVFA 1WAO1 3CLJA 3TWTA 5ARGA 3AG4E 1BD8A 3FUHA 2OV8A 1RZ4A 2ILRA 2F8YA 2P9LG 3FTYA 5G04C 4UI9K 3R7RA 2KATA 5BV0A 5BV1A 4HOTA 4ACLA 3ZNGA 4ABNA 3PVLA 3UM1A 5ENTD 2IO2C 3ZIMA 2R17C 5HI7A 3UTMA 3B7UX 4JW1A 2KM4A 5ENOD 3DSWA 2WXHA 5AQAA 4G8LA 1ELKA 3RJVA 4G11A 4FJZA 5D2MC 1WG0A 3Q7AA 5FIOA 4TUUA 2WQ6A 3D9NA 1FVHA 2PZIA 4WWOA 3D9JA 3QKYA 5B3SE 2ETCA 3SFYA 2ONDA 3APDA 4APFA 3R9MA 3FWVA 3ZHEA 5CMYA 2XEEA 1N95A 3T8KA 3UQ3A 5ENSD 4GYWA 5EYPF 4ANVA 3EHQA 2R59A 2J07A 2WXIA 2PNNA 1N54A 4ATGA 4JPSA 3ML8A 2XS1A 4RSYA 3LXUX 3D9PA 3DWLG 3HXEA 4FHKA 2WB2A 4HVBA 4JHKA 3EUVA 2KCVA 5IY5E 2GRNB 4GPKA 5D0OD 1U3DA 2PM7A 3U64A 2XPZA 2C2LA 4NACA 4AM9A 4M7CA 3DXKG 3Q73A 3CHOA 2F0YA 4JA7A 3CSFA 4KXKB 5CERB 4FU3A 3ULQA 1MX2A 1Q2ZA 2DYRE 1NI1A 5AARA 2Y1LE 3KSQA 2OEVA 1YYHA 5CECB 3RO3A 3FTXA 4URKA 5JA4D 2XPYA 1TN8A 3I5PA 4EQFA 2H6GA 3E37A 3UT4A 3UM2A 4L2YA 3PZ4A 2J8SD 1IHBA 4Q96A 5BT1A 2XCCA 1OY3D 2KC7A 4N3BA 4I1MA 1JWFA 4NRHB 1LF8A 1IQRA 3I4GA 1TYQG 3MKRA 1S63A 4HOSA 4L1BA 3ULYA 1QZ2A 2JABA 3QC1A 2V0PA 1N4SA 5E76A 3ZUVB 2J49A 4GMJA 4FJYA 3GW4A 4TXQA 4L2LA 2QFCA 2HM8A 4GZ3A 3CSTA 2YINA 2X6IA 4UWFA 1LTXA 2XZDG 4JD2G 1Z6TA 3L22A 3MKQB 3D9MA 2LNIA 3APFA 3D9KA 3E34A 4DK5A 3AS4A 4G26A 1DNPA 3FTSA 3Q9UC 5G05J 4HNAD 5BUZA 1MHQA 4FA6A 1HH8A 3ZPJA 3EIQC 2XGMA 4FLHA 3PDNA 2VSXE 5T8IA 1A5EA 4CT4A 3CHRA 3UXGA 5CRUA 4Z68A 2A4ZA 3SBTB 2Q7FA 3ASGA 3RRMB 2H6FA 3ZW3A 3ASOE 4A55A 2M63A 1XGWA 1MJ0A 3HVEA 3Q75A 3TWUA 1FCHA 2IJGX 3CVYA 4K5BA 3V2OA 3ABLE 3MGBA 4K5AB 4AY6A 3EHMA 4HXIA 2F8XK 3HHMA 1U3CA 1MYOA 3R9AB 1JCQA 5FQ8A 4GA0A 1P5QA 3O48A 3GZSA 4ILHB 2P9SG 2KZTB 3MCXA 4F1PA 4FLBA 4EZLA 2L0TB 3J5QB 4WNGA 2BKKB 4A63B 4DX7D 4EECA 3QAQA 3J5PA 2P9NG 3HG0D 3EHRA 5CBOA 3G2TA 2R2LA 4Q94A 4F6RD 1Z3XA 4IN3B 1D8EA 3R7QA 2A5UA 1TN6A 2WXLA 4BTBA 3FUMA 4P29A 2RG8A 4I2WA 3QDNA 4J8DA 3QWVA 4IYPA 1BLXB 4U07A 1ELWA 4DRXE 2YHCA 3FU0A 4I6JA 5FZRA 1MX6A 3ONLA 4HS2A 4JL0A 2Y3AA 2AJAA 4KVMA 3C98A 4L7TA 4CEMA 4JEUA 4W9RA 4O1OA 2L6BA 4L23A 1S0PA 4HRMB 4UWKA 2GROB 4GTSA 1OWNA 4EZJA 3OTNA 3ESLA 1N0QA 4F53A 1KPSB 3D9LA 5ITZF 1TEZA 1FPPA 3SHFA 3G2SA 1V55E 3UKUG 4M3OA 3AS8A 3FP3A 2XPIA 3O4ZA 3PREA 3URZA 3ZXPA 4LUNU 1N0RA 3ASHA 4UI9J 5T3RA 2VTBA 4TRQA 3NAWA 3QWPA 3ZYLA 3RRNB 1O1TA 1SA4A 2R03A 3BG1B 4A3VA 4BEPA 2YHEA 1FT1A 4GZDA 5FQ4A 4NURA 1HG2A 2IONA 2DZOA 4C9BB 2J09A 4H7YA 2I6HA 4U8YD 4ANUA 3T5XA 2JEKA 1N52A 4EBAA 4J8SA 3Q9NC 3CR3A 4GTRA 4I9CA 5ENPD 3CVWA 2IEJA 4ZHBA 1PY1A 5JMND 3L08A 5LOZA 5KWDA 1E8XA 3UPVA 4G8KA 5C1DA 1N9AA 4KT6B 2X6FA 1EPUA 3B7TA 4J8YA 3LDZA 2WXFA 3TL5A 3CVUA 4JHRA 3U3WA 3PRZA 5KJNA 3CHSA 4LSZE 4MLPA 3FEXA 3FU6A 3PUKA 3OAWA 3AU5A 4IULA 1TJCA 3RO2A 4B89A 3PUJA 4ILGA 2WXOA 2OOEA 1HE8A 2CFUA 3UM0A 4EZKA 2F37A 2WMNA 3FH5A 1JCSA 5E75A 3RU0A 5BXUA 4G23A 4WUYA 2OCCE 3MX3A 2DWZA 4F1SA 2DCPA 2DVWA 3OXLA 5AJLA 3ISMC 4X8QA 5D66A 1H6PA 5ANRA 5EILA 3JUIA 4GCOA 4YDYA 1UW4B 5EX3A 1TNUA 4B0ZA 1TNZA 4BETA 2XQ0A 3ZFWA 3E32A 1TNBA 2IQCA 2X6JA 5FWQA 3FDHA 3I3NA 3V31A 4YNDA 2V4HC 3TAXA 4C0MA 3VLFA 2PQRA 1IYGA 4CDRA 4XEIG 3SY2A 4UUCA 5AQ9A 1N4RA 5J08A 2FF4A 2DZNA 3FEYA 3Q4AB 3LCAA 3L9TA 3MEKA 4TXRA 3U9WA 5CRVA 4N3AA 5LCWC 5AJDA 2J4DA 2XENA 3JYSA 4CRWA 1X81A 3KEAA 4NIKA 2WXMA 4JC8A 2CHWA 3PE3A 2GRRB 4H7XA 2V4LA 2ZGGA 4A1SA 4DX2A 4ZFHA 1TR4A 3T9KA 4U0ZA 3NZUA 2WXPA 3LY7A 3VTXA 4AXHA 4B8AA 5FTPA 1ZB1A 4N5CA 3TG5A 4KVOA 2GGFA 3PEVB 3Q78A 4WNFA 3LEWA 3TXMA 1EYHA 4IRUA 2UY1B 1INZA 1Y6IA 3WG7E 1H2VC 1MZCA 1KZOA 4KZCA 3LKUA 4AVXA 4RLYA 5B1AE 1O5MA 4ANWA 4G24A 3G2WA 2B0OE 3HXDA 1XNFA 4K5CA 4GTPA 2X3MA 4WNDA 3FTZA 1SA5A 2XRYA 4J8FA 2XZTG 3B7RL 4YDOA 5AQBA 2ZXWE 4PUCA 4HRLA 4Y6CA 4GTVA 1JWGA 3KS2A 4K03A 4U95D 2JLBA 5M72A 5A6CA 4OAUC 3S7JA 1OWMA 2L6JA 3S7FA 2LUHA 3HDXA 2IF4A 4WNEA 3IHYA 4RG6A 3FU3A 4N39A 1NZNA 4MRUA 5DBKA 2VSOE 1K1BA 5FT9A 3RRUA 2NXPA 3ASDA 5HRYA 3CHMA 1D9SA 3TXNA 2OEWA 5D0QD 3G2UA 1UN9A 3ABME 2MYOA 1JUQA 1KZPA 3ASNE 4LRZA 3ZGQA 4DI4A 1HFAA 2EILE 1HZ4A 1HG5A 3G2VA 3U4TA 1S64A 4UQYA 4U7EB 2R5SA 3ZKJA 2Y69E 4L9PA 2CG2A 4XKCA 4CZ2D 4LEUA 1UOHA 4UWHA 4ATZD 2B6CA 4GMRA 3EIJA 4PDXA 2C0LA 4GTTA 5FZSA 2FBNA 4UQZA 3B7SA 4GZ5A 3B13A 2J08A 3CKCA 4KZ0A 3E4BA 3SGHA 2X38A 3CVNA 2H6HA 2WMOA 4CYMD 3IXEA 3AS5A 3PZ1A 1MQSA 5DIZA 4YDWA 1GW6A 3EJNA 4GTQA 4XI0A 3FUNA 4C48B 1Y8MA 3PE4A 3FTVA 3V30A 4A1GA 3UT7A 2QY7A 4XIFA 1LD7A 1DCEA 2HE0A 4BFRA 4FC8A 3TWXA 2MOWA 4CDMA 1WM5A 4U0SA 4QQIA 4OAVB 2WXKA 3MKQA 2VGEA 1ZU2A 4FHJA 1YMPA 3C72A 4U63A 4B94A 5CMWA 4XE0A 2FO7A 3DBSA 1WY6A 3FULA 3Q15A 4O1PA 3E30A 2WXNA 1FT2A 2KCKA 5KNGA 5AQ7A 1H2TC 2OVBA 3PNTB 4BSZB 3SF4A 2PM6A 5JHAA 1NFIE 3CVLA 2GRMA 3LS8A 3ENEA 1BPOA 4AEZC 5EIBE 4HI8A 3SO8A 1H19A 3KAEA 4GPMA 4RVBA 3T5VA 1ZBPA 3C5RA 3EHNA 3CV0A 4JEHA 1WDYA 3RAUA 3BG0B 2VTBB 1E7UA 3LPZA 5B1BE 3JQ1A 2EIME 3Q5MA 2BUGA 4TV3A 4KMOA 3CHQA 3HRAA 4C0EA 4ILIA 4HLLA 4DX6D 1KLXA 2VGXB 4N2QA 4I6GA 3ZYKA 4PS8A 2Y4UA 2XEVA 3HXBA 4HQDA 5JHBA 3D9HA 3KSLA 3GZ1A 5ENRD 4DLOA 5EDSA 3K9IA 4U8HA 5G2NA 2KZTA 2FULA 2NC9A 4DUIA 2IO3C 2XHEA 4UQXA 5AN8A 2L9BA 3ZYQA 3NQPA 3TWWA 4I2ZA 4V3IA 5JJ6A 3ZEFA 3L82A 2X6HA 3ASFA 3FU5A 3SNXA 3MYVA 3S7DA 1H6OA 1K1AA 5KJLA 1E96B 1LD8A 2GRPB 3MV3B 3HYMB 4O6FA 3UM3A 1EF1C 2UWJG 1UJJA 4LCTA 1X5BA 4XZ4A 1N11A 3B7BA 5CEDB 2RFAA 2KCLA 3C3OA 3DEOA 3BU8A 1HXIA 1G3NB 5LFAA 1OCZE 1OUVA 2LAIA 4WWPA 3TWRA 2EIJE 4JVSA 3DXMG 2EQXA 2CHXA 3UX4A 2AXUA 1OCOE 2FEZA 3S2AA 3PS6A 3TJPA 1N4PA 3JQ0A 4F3VA 5KJKA 2VJ8A 2XEHA 4HFGA 4LNGA 1JPLA 4CGWA 2LSUA 3EU5A 4HLEA 1HX8A 3CKBA 2LXMA 3IEGA 3V79K 3CK9A 5BNWA 2LSVA 3QNKA 4N2SA 1OT8A 3W9FA 2I1JA 5KNHD 4GA1A 4BERA 2KXPC 2PQNA 2E2EA 4PS3A 4BWRA 2MHKA 4CGVA 3UKRG 3P1UA 3FUKA 3SQVA 1L5JA 3UMVA 5FQ6A 4HORA 4OVVA 4FULA 5FINA 1OWPA 3DEPA 3DRAA 4GMLA 1SVXA 3PZ2A 1RW2A 3AJIA 3IHVA 4HOQA 2WQHA 4GYYA 3TWQA 3CGHA 4DLQA 2CFZA 2IOLA 1O1SA 5A7DB 2WXJA 2ZU6B 2QC9A 4ANXA 2P9PG 4HI9A 1NP7A 3IBEA 2I9CA 4J0UA 2VYIA 2Y4TA 3RSEG 1A17A 4AV7A 3ZHEB 1O1RA 3JUEA 1B89A 4K0RA 1IKND 1Z5SC 1BI7B 4GA2A 3FHEA 3PH0C 3APCA 2RKKA 1OWLA 2GRQB 3CVPA 4O60A 1E8ZA 5FQ7A 3FTUA 3DSSA 3L13A 3WXXA 3SFZA 4KYOB 2IU1A 4I17A 2EIKE 4I9EA 3F6QA 2BKGA 3EDTB 4WAFA 5EYLA 1OWOA 4AP2A 2XRZA 2X6KA 3JXJA 1NA0A 2RD0A 5G04J 1IXVA 5FZQA 4LERA 2V8SE 4XKBA 5HQ8A 3ONKA 3UINC 4G25A 5JJTA 2CHZA 5LCWJ 2DIWA 3TWVA 1Z3YA 2IY0C 1QBQA 3ESKA 3MZLB 5J90A 3QARA 4FP7A 1QNFA 4GTMA 2XGOA 3LYAA 3I4RB 3LJ3A 5LP0A 5CBNA 5BW8C 1SZAA 4Q69A 3D3MA 4HRNA 3FUDA 3E33A 4DPRA 2DBAA 3CQGB 4I6EA 3CHPA 4BTAA 1JCRA 4HOUA 2V5QC 1AWCB 3S7BA 2P9IG 4J6IA 1DC2A 3GYZA 4BSXA 5EX0A 4N5QA 2UY1A 3FUFA 3TG4A 4J7WA 1TJFA 3BEEA 3TGOA 3PZ3A 2IFUA 4BX8A 2VGYA 4ACKA 4U04A 1IQUA 3FUEA 2J9QA 3ZRHA 4DX5D 4EHMA 4GTOA 3ZU7B 4LG6A 5ENQD 4UWLA 4EBAG 5G05C 2LAHA 3FTWA 1FVFA 1HO8A 5KCMA 1YCSB 3CIAA 1QQEA 2QZAA 4D10C 3UIOC 3AAAC 3UUXA 2WVIA 4PS7A 3V2XA 3HXFA 1HU3A 1TNOA 4JHJA 3HVEB 4R7LA 2YQ8A 4GCNA 4G1TA
chains in the Genus database with same CATH topology
3TWUA 2ZGDA 4JB8P 2QYJA 3HRAA 3KEAA 1BU9A 4K5BA 4NIKA 3TWRA 3IXEA 2A5EA 3V2OA 4BESA 4CYMD 5KBAA 4HLLA 4DX6D 2JABA 2ETCA 4U95D 2NYJA 3NOGD 3JXIA 4K5AB 2ZGGA 2F8XK 4YDWA 4DX2A 3UI2A 4ZFHA 5CBNA 1TR4A 3JUEA 3T9KA 3ZUVB 4HQDA 2XEEA 2F37A 3T8KA 1IKND 2XEHA 5ENSD 1MYOA 1N0RA 3D9HA 4HRNA 4OAUC 4C48B 2P2CP 5EYPF 5ENRD 1BI7B 3EHQA 4B93B 3V30A 1BI8B 1AP7A 4QFVA 5BXUA 1SW6A 2PNNA 2DWZA 4F1PA 2V5QC 1AWCB 4BEPA 3V79K 3J5QB 5AAOA 2HE0A 2DVWA 1K1BA 2XZDG 2BKKB 4A63B 4DX7D 4O60A 3TWXA 4DUIA 2DZOA 3J5PA 5HRYA 5EIDA 1D9SA 1DC2A 3HG0D 4QQIA 4OAVB 5AN8A 3EHRA 3TWTA 5CBOA 3TWSA 1OT8A 5KNHD 3TWWA 1BD8A 3W9FA 4BERA 2VGEA 4HBDA 4U8YD 5D66A 2KXPC 3B95A 2F8YA 4N5QA 4U96D 1YMPA 4F6RD 5EILA 1DCQA 4U8VD 3W9GA 4YDYA 2MYOA 1K3ZD 3F6QA 3Q9NC 4J7WA 2BKGA 3LJNA 3Q9UC 1QYMA 4O1PA 5EYLA 2KBXA 5KNGA 1K1AA 5AQ7A 5FINA 3ZNGA 3JXJA 4HNAD 4LNUD 5ENPD 3DEPA 1BLXB 5BXOA 5CERB 3NBNB 4TUMA 5EN5D 1MX2A 4DRXE 4ZHBA 4DX5D 1SVXA 4RLYA 5JMND 4BETA 1IXVA 3ZU7B 5ENTD 4LG6A 4BSZB 5KWDA 3AJIA 3NOCD 5AARA 2Y1LE 3ZKJA 2B0OE 5ENQD 1NFIE 4G8KA 4K5CA 1YYHA 3TWQA 3V31A 5CECB 2V4HC 3UTMA 1MX6A 5JA4D 4CZ2D 1MX4A 5HKPA 1YCSB 1UOHA 5ENOD 4J8YA 1A5EA 2ETAA 2AJAA 3UXGA 4ATZD 4Z68A 5EIBE 4UUCA 4HI8A 3SO8A 4GMRA 5AQAA 5HS0A 3AAAC 3EU9A 4G8LA 2QC9A 4GPMA 5AQ9A 2ETBA 4O1OA 2L6BA 2J8SD 4HRMB 3TWVA 1IHBA 1N11A 3B7BA 2XZTG 3C5RA 3V2XA 4LSZE 5AQBA 2DZNA 5CEAA 1WG0A 5CEDB 4HI9A 1OY3D 2RFAA 4HB5A 2RFMA 1WDYA 4DX1A 1S70B 2FO1E 3DEOA 5FIOA 2Y0BG 1G3NB 2XENA 4HRLA 1MJ0A 1N0QA 5ITZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWU A;  2ZGD A;  4JB8 P;  2QYJ A;  3HRA A;  3KEA A;  1BU9 A;  4K5B A;  4NIK A;  3TWR A;  3IXE A;  2A5E A;  3V2O A;  4BES A;  4CYM D;  5KBA A;  4HLL A;  4DX6 D;  2JAB A;  2ETC A;  4U95 D;  2NYJ A;  3NOG D;  3JXI A;  4K5A B;  2ZGG A;  2F8X K;  4YDW A;  4DX2 A;  3UI2 A;  4ZFH A;  5CBN A;  1TR4 A;  3JUE A;  3T9K A;  3ZUV B;  4HQD A;  2XEE A;  2F37 A;  3T8K A;  1IKN D;  2XEH A;  5ENS D;  1MYO A;  1N0R A;  3D9H A;  4HRN A;  4OAU C;  4C48 B;  2P2C P;  5EYP F;  5ENR D;  1BI7 B;  3EHQ A;  4B93 B;  3V30 A;  1BI8 B;  1AP7 A;  4QFV A;  5BXU A;  1SW6 A;  2PNN A;  2DWZ A;  4F1P A;  2V5Q C;  1AWC B;  4BEP A;  3V79 K;  3J5Q B;  5AAO A;  2HE0 A;  2DVW A;  1K1B A;  2XZD G;  2BKK B;  4A63 B;  4DX7 D;  4O60 A;  3TWX A;  4DUI A;  2DZO A;  3J5P A;  5HRY A;  5EID A;  1D9S A;  1DC2 A;  3HG0 D;  4QQI A;  4OAV B;  5AN8 A;  3EHR A;  3TWT A;  5CBO A;  3TWS A;  1OT8 A;  5KNH D;  3TWW A;  1BD8 A;  3W9F A;  4BER A;  2VGE A;  4HBD A;  4U8Y D;  5D66 A;  2KXP C;  3B95 A;  2F8Y A;  4N5Q A;  4U96 D;  1YMP A;  4F6R D;  5EIL A;  1DCQ A;  4U8V D;  3W9G A;  4YDY A;  2MYO A;  1K3Z D;  3F6Q A;  3Q9N C;  4J7W A;  2BKG A;  3LJN A;  3Q9U C;  1QYM A;  4O1P A;  5EYL A;  2KBX A;  5KNG A;  1K1A A;  5AQ7 A;  5FIN A;  3ZNG A;  3JXJ A;  4HNA D;  4LNU D;  5ENP D;  3DEP A;  1BLX B;  5BXO A;  5CER B;  3NBN B;  4TUM A;  5EN5 D;  1MX2 A;  4DRX E;  4ZHB A;  4DX5 D;  1SVX A;  4RLY A;  5JMN D;  4BET A;  1IXV A;  3ZU7 B;  5ENT D;  4LG6 A;  4BSZ B;  5KWD A;  3AJI A;  3NOC D;  5AAR A;  2Y1L E;  3ZKJ A;  2B0O E;  5ENQ D;  1NFI E;  4G8K A;  4K5C A;  1YYH A;  3TWQ A;  3V31 A;  5CEC B;  2V4H C;  3UTM A;  1MX6 A;  5JA4 D;  4CZ2 D;  1MX4 A;  5HKP A;  1YCS B;  1UOH A;  5ENO D;  4J8Y A;  1A5E A;  2ETA A;  2AJA A;  3UXG A;  4ATZ D;  4Z68 A;  5EIB E;  4UUC A;  4HI8 A;  3SO8 A;  4GMR A;  5AQA A;  5HS0 A;  3AAA C;  3EU9 A;  4G8L A;  2QC9 A;  4GPM A;  5AQ9 A;  2ETB A;  4O1O A;  2L6B A;  2J8S D;  4HRM B;  3TWV A;  1IHB A;  1N11 A;  3B7B A;  2XZT G;  3C5R A;  3V2X A;  4LSZ E;  5AQB A;  2DZN A;  5CEA A;  1WG0 A;  5CED B;  4HI9 A;  1OY3 D;  2RFA A;  4HB5 A;  2RFM A;  1WDY A;  4DX1 A;  1S70 B;  2FO1 E;  3DEO A;  5FIO A;  2Y0B G;  1G3N B;  2XEN A;  4HRL A;  1MJ0 A;  1N0Q A;  5ITZ F; 
#chains in the Genus database with same CATH topology
 2DYS E;  5G55 A;  2QYJ A;  1BU9 A;  3ZVV A;  4XX5 A;  3AG1 E;  2P9U G;  4AJW A;  4TXP A;  3HIZ A;  3JXI A;  3Q7F A;  3UI2 A;  3VTY A;  3DPY A;  4MKT A;  4UWG A;  3FUJ A;  2PL2 A;  3DSX A;  3L16 A;  4CDN A;  4I43 A;  2XCB A;  4MS6 A;  4B93 B;  3LVQ E;  3ZXS A;  4KBQ A;  1TN7 A;  3L6A A;  2C0M A;  4JXT A;  3QWW A;  5CCM A;  2AVP A;  3RK6 A;  3MJW A;  2E0I A;  4N3C A;  2LO6 A;  3B95 A;  4YDE A;  4U0U A;  4U8V D;  3W9G A;  3ZYM A;  4BT8 A;  3L54 A;  3LJN A;  5C2Y A;  2ZIR A;  2KBX A;  2WQ7 A;  3HXC A;  3SFX A;  1E8W A;  4LNU D;  5BXO A;  3QK0 A;  2HYZ A;  2WXG A;  1YA0 A;  1UJK A;  4OYS A;  2I1K A;  1HF8 A;  3VLE A;  3FFL A;  4GZ6 A;  1H0A A;  5HS0 A;  3MV2 B;  4RG9 A;  1PC2 A;  5CEA A;  3P2B A;  4DX1 A;  3CVX A;  2GW1 A;  3FH8 A;  2FI7 A;  2AW6 A;  4GAA A;  3KD7 A;  2MRI A;  4JB8 P;  3Q49 B;  2A5E A;  2P58 C;  4FAD A;  1UN8 A;  1UG3 A;  2NSZ A;  3CK7 A;  3SI5 A;  1IHG A;  2XGS A;  5T4Y A;  3NF1 A;  3X2Q E;  4DI3 A;  1D8D A;  3IKO B;  1OCC E;  4E85 A;  4G2V A;  3MA5 A;  3Q79 A;  1H2U A;  3RKV A;  2J4B A;  4GB9 A;  1SW6 A;  2H6I A;  2BF0 X;  3L17 A;  1KT1 A;  2ZIS A;  3SD5 A;  5AEN A;  4APO A;  4UI9 C;  2HO1 A;  1KT0 A;  2VSY A;  4WWN A;  2IOS A;  4B8C B;  3TWS A;  3KEZ A;  4HBD A;  3FH7 A;  3FY4 A;  4BY6 A;  3CQC B;  3PZD A;  3LY9 A;  3LVR E;  3AG3 E;  1NA3 A;  2HR2 A;  1N4Q A;  5EKQ D;  4YVO A;  5FJY A;  2LXL A;  3D9I A;  3JCK C;  4BX9 A;  3FUI A;  2AXV A;  4ME2 A;  5KJM A;  4TUM A;  1OXJ A;  2P9K G;  1E90 A;  1SZ9 A;  1VDY A;  5JJ7 A;  3AG2 E;  5A23 A;  4GYO A;  2ETB A;  3VLD A;  1OCR E;  3SZ7 A;  4CT0 A;  2BTD A;  2I2O A;  3QOU A;  4HB5 A;  2RFM A;  3ULE G;  5AYW D;  4J8E A;  2ZGD A;  1HS6 A;  3T8M A;  4E6H A;  5KBA A;  3CEQ A;  4BES A;  5CHE E;  2VSN A;  4GU5 A;  1PAQ A;  1NL4 A;  4Y6W A;  2NYJ A;  3NOG D;  2VGX A;  3Q47 B;  4NQ0 A;  3RIB A;  3NZS A;  3OXG A;  1TNY A;  1SQM A;  3C3R A;  1V54 E;  1U2V G;  5H7P A;  2P2C P;  2AWI A;  3CVV A;  4I1O B;  1EDU A;  3BQO A;  1BI8 B;  4AY5 A;  4QFV A;  3NB2 A;  4DJA A;  5CCL A;  5AAO A;  4LNB A;  3IV0 A;  2YNQ A;  3DPD A;  2R02 A;  4U96 D;  4RQI A;  1DCQ A;  1K8K G;  1W3B A;  3AU4 A;  4YVQ C;  4JA9 A;  1K3Z D;  2WXR A;  4AIF A;  3ABK E;  1QYM A;  3GZ2 A;  3PEU B;  4OVU A;  2L0I A;  3NBN B;  5BPP A;  5EN5 D;  5LX8 A;  2XS8 A;  3DSV A;  3NOC D;  1H6K A;  3OXF A;  4MBG A;  2EIN E;  1MX4 A;  4F7A A;  5HKP A;  2ETA A;  3CVQ A;  5AIJ A;  2WM9 A;  2GRL A;  4I1A A;  3UT8 A;  3EU9 A;  3DST A;  3D9O A;  1S70 B;  4JZY A;  2FO1 E;  2Y0B G;  3ML9 A;  2AXZ A;  3CK8 A;  4XI9 A;  3DSU A;  3LY8 A;  2CG3 A;  5ENN A;  5ARF A;  5ANL A;  1E7V A;  3QB2 A;  4AOF A;  3PNL B;  3U66 A;  3SBS A;  1N94 A;  4GZC A;  1DVP A;  4EPZ A;  2WPV A;  2WXQ A;  2BED A;  2QYU A;  3C3Q A;  1AP7 A;  2VQ2 A;  4PH4 B;  3UIP C;  3QJZ A;  1ELR A;  4BT9 A;  4CCA A;  2V5F A;  4A3T A;  3BUA A;  2R05 A;  3ZN3 A;  5EID A;  1E8Y A;  3N71 A;  2OVF A;  1WAO 1;  3CLJ A;  3TWT A;  5ARG A;  3AG4 E;  1BD8 A;  3FUH A;  2OV8 A;  1RZ4 A;  2ILR A;  2F8Y A;  2P9L G;  3FTY A;  5G04 C;  4UI9 K;  3R7R A;  2KAT A;  5BV0 A;  5BV1 A;  4HOT A;  4ACL A;  3ZNG A;  4ABN A;  3PVL A;  3UM1 A;  5ENT D;  2IO2 C;  3ZIM A;  2R17 C;  5HI7 A;  3UTM A;  3B7U X;  4JW1 A;  2KM4 A;  5ENO D;  3DSW A;  2WXH A;  5AQA A;  4G8L A;  1ELK A;  3RJV A;  4G11 A;  4FJZ A;  5D2M C;  1WG0 A;  3Q7A A;  5FIO A;  4TUU A;  2WQ6 A;  3D9N A;  1FVH A;  2PZI A;  4WWO A;  3D9J A;  3QKY A;  5B3S E;  2ETC A;  3SFY A;  2OND A;  3APD A;  4APF A;  3R9M A;  3FWV A;  3ZHE A;  5CMY A;  2XEE A;  1N95 A;  3T8K A;  3UQ3 A;  5ENS D;  4GYW A;  5EYP F;  4ANV A;  3EHQ A;  2R59 A;  2J07 A;  2WXI A;  2PNN A;  1N54 A;  4ATG A;  4JPS A;  3ML8 A;  2XS1 A;  4RSY A;  3LXU X;  3D9P A;  3DWL G;  3HXE A;  4FHK A;  2WB2 A;  4HVB A;  4JHK A;  3EUV A;  2KCV A;  5IY5 E;  2GRN B;  4GPK A;  5D0O D;  1U3D A;  2PM7 A;  3U64 A;  2XPZ A;  2C2L A;  4NAC A;  4AM9 A;  4M7C A;  3DXK G;  3Q73 A;  3CHO A;  2F0Y A;  4JA7 A;  3CSF A;  4KXK B;  5CER B;  4FU3 A;  3ULQ A;  1MX2 A;  1Q2Z A;  2DYR E;  1NI1 A;  5AAR A;  2Y1L E;  3KSQ A;  2OEV A;  1YYH A;  5CEC B;  3RO3 A;  3FTX A;  4URK A;  5JA4 D;  2XPY A;  1TN8 A;  3I5P A;  4EQF A;  2H6G A;  3E37 A;  3UT4 A;  3UM2 A;  4L2Y A;  3PZ4 A;  2J8S D;  1IHB A;  4Q96 A;  5BT1 A;  2XCC A;  1OY3 D;  2KC7 A;  4N3B A;  4I1M A;  1JWF A;  4NRH B;  1LF8 A;  1IQR A;  3I4G A;  1TYQ G;  3MKR A;  1S63 A;  4HOS A;  4L1B A;  3ULY A;  1QZ2 A;  2JAB A;  3QC1 A;  2V0P A;  1N4S A;  5E76 A;  3ZUV B;  2J49 A;  4GMJ A;  4FJY A;  3GW4 A;  4TXQ A;  4L2L A;  2QFC A;  2HM8 A;  4GZ3 A;  3CST A;  2YIN A;  2X6I A;  4UWF A;  1LTX A;  2XZD G;  4JD2 G;  1Z6T A;  3L22 A;  3MKQ B;  3D9M A;  2LNI A;  3APF A;  3D9K A;  3E34 A;  4DK5 A;  3AS4 A;  4G26 A;  1DNP A;  3FTS A;  3Q9U C;  5G05 J;  4HNA D;  5BUZ A;  1MHQ A;  4FA6 A;  1HH8 A;  3ZPJ A;  3EIQ C;  2XGM A;  4FLH A;  3PDN A;  2VSX E;  5T8I A;  1A5E A;  4CT4 A;  3CHR A;  3UXG A;  5CRU A;  4Z68 A;  2A4Z A;  3SBT B;  2Q7F A;  3ASG A;  3RRM B;  2H6F A;  3ZW3 A;  3ASO E;  4A55 A;  2M63 A;  1XGW A;  1MJ0 A;  3HVE A;  3Q75 A;  3TWU A;  1FCH A;  2IJG X;  3CVY A;  4K5B A;  3V2O A;  3ABL E;  3MGB A;  4K5A B;  4AY6 A;  3EHM A;  4HXI A;  2F8X K;  3HHM A;  1U3C A;  1MYO A;  3R9A B;  1JCQ A;  5FQ8 A;  4GA0 A;  1P5Q A;  3O48 A;  3GZS A;  4ILH B;  2P9S G;  2KZT B;  3MCX A;  4F1P A;  4FLB A;  4EZL A;  2L0T B;  3J5Q B;  4WNG A;  2BKK B;  4A63 B;  4DX7 D;  4EEC A;  3QAQ A;  3J5P A;  2P9N G;  3HG0 D;  3EHR A;  5CBO A;  3G2T A;  2R2L A;  4Q94 A;  4F6R D;  1Z3X A;  4IN3 B;  1D8E A;  3R7Q A;  2A5U A;  1TN6 A;  2WXL A;  4BTB A;  3FUM A;  4P29 A;  2RG8 A;  4I2W A;  3QDN A;  4J8D A;  3QWV A;  4IYP A;  1BLX B;  4U07 A;  1ELW A;  4DRX E;  2YHC A;  3FU0 A;  4I6J A;  5FZR A;  1MX6 A;  3ONL A;  4HS2 A;  4JL0 A;  2Y3A A;  2AJA A;  4KVM A;  3C98 A;  4L7T A;  4CEM A;  4JEU A;  4W9R A;  4O1O A;  2L6B A;  4L23 A;  1S0P A;  4HRM B;  4UWK A;  2GRO B;  4GTS A;  1OWN A;  4EZJ A;  3OTN A;  3ESL A;  1N0Q A;  4F53 A;  1KPS B;  3D9L A;  5ITZ F;  1TEZ A;  1FPP A;  3SHF A;  3G2S A;  1V55 E;  3UKU G;  4M3O A;  3AS8 A;  3FP3 A;  2XPI A;  3O4Z A;  3PRE A;  3URZ A;  3ZXP A;  4LUN U;  1N0R A;  3ASH A;  4UI9 J;  5T3R A;  2VTB A;  4TRQ A;  3NAW A;  3QWP A;  3ZYL A;  3RRN B;  1O1T A;  1SA4 A;  2R03 A;  3BG1 B;  4A3V A;  4BEP A;  2YHE A;  1FT1 A;  4GZD A;  5FQ4 A;  4NUR A;  1HG2 A;  2ION A;  2DZO A;  4C9B B;  2J09 A;  4H7Y A;  2I6H A;  4U8Y D;  4ANU A;  3T5X A;  2JEK A;  1N52 A;  4EBA A;  4J8S A;  3Q9N C;  3CR3 A;  4GTR A;  4I9C A;  5ENP D;  3CVW A;  2IEJ A;  4ZHB A;  1PY1 A;  5JMN D;  3L08 A;  5LOZ A;  5KWD A;  1E8X A;  3UPV A;  4G8K A;  5C1D A;  1N9A A;  4KT6 B;  2X6F A;  1EPU A;  3B7T A;  4J8Y A;  3LDZ A;  2WXF A;  3TL5 A;  3CVU A;  4JHR A;  3U3W A;  3PRZ A;  5KJN A;  3CHS A;  4LSZ E;  4MLP A;  3FEX A;  3FU6 A;  3PUK A;  3OAW A;  3AU5 A;  4IUL A;  1TJC A;  3RO2 A;  4B89 A;  3PUJ A;  4ILG A;  2WXO A;  2OOE A;  1HE8 A;  2CFU A;  3UM0 A;  4EZK A;  2F37 A;  2WMN A;  3FH5 A;  1JCS A;  5E75 A;  3RU0 A;  5BXU A;  4G23 A;  4WUY A;  2OCC E;  3MX3 A;  2DWZ A;  4F1S A;  2DCP A;  2DVW A;  3OXL A;  5AJL A;  3ISM C;  4X8Q A;  5D66 A;  1H6P A;  5ANR A;  5EIL A;  3JUI A;  4GCO A;  4YDY A;  1UW4 B;  5EX3 A;  1TNU A;  4B0Z A;  1TNZ A;  4BET A;  2XQ0 A;  3ZFW A;  3E32 A;  1TNB A;  2IQC A;  2X6J A;  5FWQ A;  3FDH A;  3I3N A;  3V31 A;  4YND A;  2V4H C;  3TAX A;  4C0M A;  3VLF A;  2PQR A;  1IYG A;  4CDR A;  4XEI G;  3SY2 A;  4UUC A;  5AQ9 A;  1N4R A;  5J08 A;  2FF4 A;  2DZN A;  3FEY A;  3Q4A B;  3LCA A;  3L9T A;  3MEK A;  4TXR A;  3U9W A;  5CRV A;  4N3A A;  5LCW C;  5AJD A;  2J4D A;  2XEN A;  3JYS A;  4CRW A;  1X81 A;  3KEA A;  4NIK A;  2WXM A;  4JC8 A;  2CHW A;  3PE3 A;  2GRR B;  4H7X A;  2V4L A;  2ZGG A;  4A1S A;  4DX2 A;  4ZFH A;  1TR4 A;  3T9K A;  4U0Z A;  3NZU A;  2WXP A;  3LY7 A;  3VTX A;  4AXH A;  4B8A A;  5FTP A;  1ZB1 A;  4N5C A;  3TG5 A;  4KVO A;  2GGF A;  3PEV B;  3Q78 A;  4WNF A;  3LEW A;  3TXM A;  1EYH A;  4IRU A;  2UY1 B;  1INZ A;  1Y6I A;  3WG7 E;  1H2V C;  1MZC A;  1KZO A;  4KZC A;  3LKU A;  4AVX A;  4RLY A;  5B1A E;  1O5M A;  4ANW A;  4G24 A;  3G2W A;  2B0O E;  3HXD A;  1XNF A;  4K5C A;  4GTP A;  2X3M A;  4WND A;  3FTZ A;  1SA5 A;  2XRY A;  4J8F A;  2XZT G;  3B7R L;  4YDO A;  5AQB A;  2ZXW E;  4PUC A;  4HRL A;  4Y6C A;  4GTV A;  1JWG A;  3KS2 A;  4K03 A;  4U95 D;  2JLB A;  5M72 A;  5A6C A;  4OAU C;  3S7J A;  1OWM A;  2L6J A;  3S7F A;  2LUH A;  3HDX A;  2IF4 A;  4WNE A;  3IHY A;  4RG6 A;  3FU3 A;  4N39 A;  1NZN A;  4MRU A;  5DBK A;  2VSO E;  1K1B A;  5FT9 A;  3RRU A;  2NXP A;  3ASD A;  5HRY A;  3CHM A;  1D9S A;  3TXN A;  2OEW A;  5D0Q D;  3G2U A;  1UN9 A;  3ABM E;  2MYO A;  1JUQ A;  1KZP A;  3ASN E;  4LRZ A;  3ZGQ A;  4DI4 A;  1HFA A;  2EIL E;  1HZ4 A;  1HG5 A;  3G2V A;  3U4T A;  1S64 A;  4UQY A;  4U7E B;  2R5S A;  3ZKJ A;  2Y69 E;  4L9P A;  2CG2 A;  4XKC A;  4CZ2 D;  4LEU A;  1UOH A;  4UWH A;  4ATZ D;  2B6C A;  4GMR A;  3EIJ A;  4PDX A;  2C0L A;  4GTT A;  5FZS A;  2FBN A;  4UQZ A;  3B7S A;  4GZ5 A;  3B13 A;  2J08 A;  3CKC A;  4KZ0 A;  3E4B A;  3SGH A;  2X38 A;  3CVN A;  2H6H A;  2WMO A;  4CYM D;  3IXE A;  3AS5 A;  3PZ1 A;  1MQS A;  5DIZ A;  4YDW A;  1GW6 A;  3EJN A;  4GTQ A;  4XI0 A;  3FUN A;  4C48 B;  1Y8M A;  3PE4 A;  3FTV A;  3V30 A;  4A1G A;  3UT7 A;  2QY7 A;  4XIF A;  1LD7 A;  1DCE A;  2HE0 A;  4BFR A;  4FC8 A;  3TWX A;  2MOW A;  4CDM A;  1WM5 A;  4U0S A;  4QQI A;  4OAV B;  2WXK A;  3MKQ A;  2VGE A;  1ZU2 A;  4FHJ A;  1YMP A;  3C72 A;  4U63 A;  4B94 A;  5CMW A;  4XE0 A;  2FO7 A;  3DBS A;  1WY6 A;  3FUL A;  3Q15 A;  4O1P A;  3E30 A;  2WXN A;  1FT2 A;  2KCK A;  5KNG A;  5AQ7 A;  1H2T C;  2OVB A;  3PNT B;  4BSZ B;  3SF4 A;  2PM6 A;  5JHA A;  1NFI E;  3CVL A;  2GRM A;  3LS8 A;  3ENE A;  1BPO A;  4AEZ C;  5EIB E;  4HI8 A;  3SO8 A;  1H19 A;  3KAE A;  4GPM A;  4RVB A;  3T5V A;  1ZBP A;  3C5R A;  3EHN A;  3CV0 A;  4JEH A;  1WDY A;  3RAU A;  3BG0 B;  2VTB B;  1E7U A;  3LPZ A;  5B1B E;  3JQ1 A;  2EIM E;  3Q5M A;  2BUG A;  4TV3 A;  4KMO A;  3CHQ A;  3HRA A;  4C0E A;  4ILI A;  4HLL A;  4DX6 D;  1KLX A;  2VGX B;  4N2Q A;  4I6G A;  3ZYK A;  4PS8 A;  2Y4U A;  2XEV A;  3HXB A;  4HQD A;  5JHB A;  3D9H A;  3KSL A;  3GZ1 A;  5ENR D;  4DLO A;  5EDS A;  3K9I A;  4U8H A;  5G2N A;  2KZT A;  2FUL A;  2NC9 A;  4DUI A;  2IO3 C;  2XHE A;  4UQX A;  5AN8 A;  2L9B A;  3ZYQ A;  3NQP A;  3TWW A;  4I2Z A;  4V3I A;  5JJ6 A;  3ZEF A;  3L82 A;  2X6H A;  3ASF A;  3FU5 A;  3SNX A;  3MYV A;  3S7D A;  1H6O A;  1K1A A;  5KJL A;  1E96 B;  1LD8 A;  2GRP B;  3MV3 B;  3HYM B;  4O6F A;  3UM3 A;  1EF1 C;  2UWJ G;  1UJJ A;  4LCT A;  1X5B A;  4XZ4 A;  1N11 A;  3B7B A;  5CED B;  2RFA A;  2KCL A;  3C3O A;  3DEO A;  3BU8 A;  1HXI A;  1G3N B;  5LFA A;  1OCZ E;  1OUV A;  2LAI A;  4WWP A;  3TWR A;  2EIJ E;  4JVS A;  3DXM G;  2EQX A;  2CHX A;  3UX4 A;  2AXU A;  1OCO E;  2FEZ A;  3S2A A;  3PS6 A;  3TJP A;  1N4P A;  3JQ0 A;  4F3V A;  5KJK A;  2VJ8 A;  2XEH A;  4HFG A;  4LNG A;  1JPL A;  4CGW A;  2LSU A;  3EU5 A;  4HLE A;  1HX8 A;  3CKB A;  2LXM A;  3IEG A;  3V79 K;  3CK9 A;  5BNW A;  2LSV A;  3QNK A;  4N2S A;  1OT8 A;  3W9F A;  2I1J A;  5KNH D;  4GA1 A;  4BER A;  2KXP C;  2PQN A;  2E2E A;  4PS3 A;  4BWR A;  2MHK A;  4CGV A;  3UKR G;  3P1U A;  3FUK A;  3SQV A;  1L5J A;  3UMV A;  5FQ6 A;  4HOR A;  4OVV A;  4FUL A;  5FIN A;  1OWP A;  3DEP A;  3DRA A;  4GML A;  1SVX A;  3PZ2 A;  1RW2 A;  3AJI A;  3IHV A;  4HOQ A;  2WQH A;  4GYY A;  3TWQ A;  3CGH A;  4DLQ A;  2CFZ A;  2IOL A;  1O1S A;  5A7D B;  2WXJ A;  2ZU6 B;  2QC9 A;  4ANX A;  2P9P G;  4HI9 A;  1NP7 A;  3IBE A;  2I9C A;  4J0U A;  2VYI A;  2Y4T A;  3RSE G;  1A17 A;  4AV7 A;  3ZHE B;  1O1R A;  3JUE A;  1B89 A;  4K0R A;  1IKN D;  1Z5S C;  1BI7 B;  4GA2 A;  3FHE A;  3PH0 C;  3APC A;  2RKK A;  1OWL A;  2GRQ B;  3CVP A;  4O60 A;  1E8Z A;  5FQ7 A;  3FTU A;  3DSS A;  3L13 A;  3WXX A;  3SFZ A;  4KYO B;  2IU1 A;  4I17 A;  2EIK E;  4I9E A;  3F6Q A;  2BKG A;  3EDT B;  4WAF A;  5EYL A;  1OWO A;  4AP2 A;  2XRZ A;  2X6K A;  3JXJ A;  1NA0 A;  2RD0 A;  5G04 J;  1IXV A;  5FZQ A;  4LER A;  2V8S E;  4XKB A;  5HQ8 A;  3ONK A;  3UIN C;  4G25 A;  5JJT A;  2CHZ A;  5LCW J;  2DIW A;  3TWV A;  1Z3Y A;  2IY0 C;  1QBQ A;  3ESK A;  3MZL B;  5J90 A;  3QAR A;  4FP7 A;  1QNF A;  4GTM A;  2XGO A;  3LYA A;  3I4R B;  3LJ3 A;  5LP0 A;  5CBN A;  5BW8 C;  1SZA A;  4Q69 A;  3D3M A;  4HRN A;  3FUD A;  3E33 A;  4DPR A;  2DBA A;  3CQG B;  4I6E A;  3CHP A;  4BTA A;  1JCR A;  4HOU A;  2V5Q C;  1AWC B;  3S7B A;  2P9I G;  4J6I A;  1DC2 A;  3GYZ A;  4BSX A;  5EX0 A;  4N5Q A;  2UY1 A;  3FUF A;  3TG4 A;  4J7W A;  1TJF A;  3BEE A;  3TGO A;  3PZ3 A;  2IFU A;  4BX8 A;  2VGY A;  4ACK A;  4U04 A;  1IQU A;  3FUE A;  2J9Q A;  3ZRH A;  4DX5 D;  4EHM A;  4GTO A;  3ZU7 B;  4LG6 A;  5ENQ D;  4UWL A;  4EBA G;  5G05 C;  2LAH A;  3FTW A;  1FVF A;  1HO8 A;  5KCM A;  1YCS B;  3CIA A;  1QQE A;  2QZA A;  4D10 C;  3UIO C;  3AAA C;  3UUX A;  2WVI A;  4PS7 A;  3V2X A;  3HXF A;  1HU3 A;  1TNO A;  4JHJ A;  3HVE B;  4R7L A;  2YQ8 A;  4GCN A;  4G1T A; 
#chains in the Genus database with same CATH homology
 3TWU A;  2ZGD A;  4JB8 P;  2QYJ A;  3HRA A;  3KEA A;  1BU9 A;  4K5B A;  4NIK A;  3TWR A;  3IXE A;  2A5E A;  3V2O A;  4BES A;  4CYM D;  5KBA A;  4HLL A;  4DX6 D;  2JAB A;  2ETC A;  4U95 D;  2NYJ A;  3NOG D;  3JXI A;  4K5A B;  2ZGG A;  2F8X K;  4YDW A;  4DX2 A;  3UI2 A;  4ZFH A;  5CBN A;  1TR4 A;  3JUE A;  3T9K A;  3ZUV B;  4HQD A;  2XEE A;  2F37 A;  3T8K A;  1IKN D;  2XEH A;  5ENS D;  1MYO A;  1N0R A;  3D9H A;  4HRN A;  4OAU C;  4C48 B;  2P2C P;  5EYP F;  5ENR D;  1BI7 B;  3EHQ A;  4B93 B;  3V30 A;  1BI8 B;  1AP7 A;  4QFV A;  5BXU A;  1SW6 A;  2PNN A;  2DWZ A;  4F1P A;  2V5Q C;  1AWC B;  4BEP A;  3V79 K;  3J5Q B;  5AAO A;  2HE0 A;  2DVW A;  1K1B A;  2XZD G;  2BKK B;  4A63 B;  4DX7 D;  4O60 A;  3TWX A;  4DUI A;  2DZO A;  3J5P A;  5HRY A;  5EID A;  1D9S A;  1DC2 A;  3HG0 D;  4QQI A;  4OAV B;  5AN8 A;  3EHR A;  3TWT A;  5CBO A;  3TWS A;  1OT8 A;  5KNH D;  3TWW A;  1BD8 A;  3W9F A;  4BER A;  2VGE A;  4HBD A;  4U8Y D;  5D66 A;  2KXP C;  3B95 A;  2F8Y A;  4N5Q A;  4U96 D;  1YMP A;  4F6R D;  5EIL A;  1DCQ A;  4U8V D;  3W9G A;  4YDY A;  2MYO A;  1K3Z D;  3F6Q A;  3Q9N C;  4J7W A;  2BKG A;  3LJN A;  3Q9U C;  1QYM A;  4O1P A;  5EYL A;  2KBX A;  5KNG A;  1K1A A;  5AQ7 A;  5FIN A;  3ZNG A;  3JXJ A;  4HNA D;  4LNU D;  5ENP D;  3DEP A;  1BLX B;  5BXO A;  5CER B;  3NBN B;  4TUM A;  5EN5 D;  1MX2 A;  4DRX E;  4ZHB A;  4DX5 D;  1SVX A;  4RLY A;  5JMN D;  4BET A;  1IXV A;  3ZU7 B;  5ENT D;  4LG6 A;  4BSZ B;  5KWD A;  3AJI A;  3NOC D;  5AAR A;  2Y1L E;  3ZKJ A;  2B0O E;  5ENQ D;  1NFI E;  4G8K A;  4K5C A;  1YYH A;  3TWQ A;  3V31 A;  5CEC B;  2V4H C;  3UTM A;  1MX6 A;  5JA4 D;  4CZ2 D;  1MX4 A;  5HKP A;  1YCS B;  1UOH A;  5ENO D;  4J8Y A;  1A5E A;  2ETA A;  2AJA A;  3UXG A;  4ATZ D;  4Z68 A;  5EIB E;  4UUC A;  4HI8 A;  3SO8 A;  4GMR A;  5AQA A;  5HS0 A;  3AAA C;  3EU9 A;  4G8L A;  2QC9 A;  4GPM A;  5AQ9 A;  2ETB A;  4O1O A;  2L6B A;  2J8S D;  4HRM B;  3TWV A;  1IHB A;  1N11 A;  3B7B A;  2XZT G;  3C5R A;  3V2X A;  4LSZ E;  5AQB A;  2DZN A;  5CEA A;  1WG0 A;  5CED B;  4HI9 A;  1OY3 D;  2RFA A;  4HB5 A;  2RFM A;  1WDY A;  4DX1 A;  1S70 B;  2FO1 E;  3DEO A;  5FIO A;  2Y0B G;  1G3N B;  2XEN A;  4HRL A;  1MJ0 A;  1N0Q A;  5ITZ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...