4CZYA

Complex of neurospora crassa pan2 (wd40-cs1) with pan3 (pseudokinase and c-term)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
323
structure length
323
Chain Sequence
HMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Gene regulation
total genus 80
structure length 323
sequence length 323
chains with identical sequence C
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czyA00
1K32A 3IIYA 4ES0A 3UR4A 4A11B 2HJBA 1K8KC 3IJCA 1SQ9A 4R7AB 2CE9A 3I7HA 4CI8A 2XYIA 4JSXC 4PC0A 2PM6B 3PSCB 4IA9A 2UZXB 5EAMA 1TYQC 3RN0D 4Z8LA 5EMMB 5EM2A 3SHFA 4X60B 2H9PA 2YNPA 5FKSA 3P4FA 4UI9R 5I5MA 3EMHA 2PM7B 4HDJA 3V9FA 4GM9A 4CY3A 1N6FA 3VH0A 1GXRA 3A0FA 3I8CA 2B5MA 1SHYB 2I0TA 3JROA 3I8EA 3GREA 5C2VB 4PNKB 4BUJC 2P9SC 3SMRA 5H17A 5I5JA 3ZWLB 3JZHA 3J80g 3JZNA 3V5WB 4ESGA 5K19A 1GG2B 3PVUB 3NVXA 4GGCA 1GP2B 2HXCA 2PM9A 3CFVA 3PXWD 3KRXB 4EWRA 1Q47A 5IJ7E 3EI1A 5HE0B 2H3XA 1A0RB 2B5NA 3EU7A 5FXYA 4CC9A 1NEXB 3MKSB 4ERZA 3EI2B 1S4UX 3AH8B 3OKYA 2IUVA 2MTAH 3AFCA 4QQEA 2I0RA 4GMBA 3F3GA 3SCYA 3JRPA 2Z2PA 2P9LC 3RLMD 3PVWB 2QXVA 1B9XA 4JXMA 1JMZB 2HESX 3JAMg 4FA9D 3UVMA 2J56H 5HE1B 4ZOVA 5TEFA 2H68A 2BBKH 4LG9A 2I0SA 3SXTD 4J77A 3SBRA 3C5MA 5FKQA 3EI3B 3RMZD 2GNQA 3CIKB 2YNNA 3RSEC 3RFGA 5CXCA 4GQ1A 4CY5A 4GM8A 3V7DB 4O1QD 2CO0A 5EMJB 4CY2A 4G56B 5C2WB 4GQ2P 1PEVA 4X3EA 4A08B 4BH6A 5IGOA 5FKRA 4J8BA 5HQGA 3U4YA 4GGDA 2OVQB 3BG1A 4ERYA 3E0CA 2P9PC 3OL2A 4J79A 3EI4B 2G9AA 1TBGA 2OIZA 2OVPB 4YVDA 3JZGA 4E5ZA 2HKRA 4CZYA 5CXBB 4JSPC 1B9YA 3N0DA 5EMKB 3DM0A 1SQJA 2CN3A 4ERQA 2TRCB 4ZN4A 1U4CA 3IJ1A 4O3UB 3CFSB 1MG2A 4IMMA 1NR0A 3FM0A 3MKQA 4AEZA 4H5IA 4L3GD 2OVRB 4CZVA 4Y7RA 3I7LA 2CN2A 5EAPA 5B4WA 4O45A 4A2LA 4A0BB 5TDHB 2YBAA 2H6KA 2G99A 2H9NA 3PE7A 4A09B 3UKUC 3OW8A 4Y5RD 3JB9L 1PGUA 4OZUA 4A08A 2Z2NA 1L0QA 2OJYA 4U7AA 4CI1A 3J81g 1VYHC 1N6DA 3K26A 2IWKA 4LG8A 4FA4D 3NVNA 4OWRA 4XYHA 4FAND 4FA1D 2P9NC 3DXMC 1QNIA 3I7KA 1GOTB 5AFU3 4JT6C 4PSXB 4A11A 5IGQA 4K3ID 3MZLA 2HKMA 3SJLD 1MG3A 5H1MA 1FWXA 1PBYB 2I3SA 4XYIA 4ZOZA 2Z2OA 4A0AB 2XL3A 4FA5D 3PXSD 3ULEC 5EALA 3SLED 5FQDA 5SXMA 2CNXA 4LGNA 2H9LA 4J8GA 4QRJA 4PSWB 5JWZA 4PBZA 5CYKB 4J87A 3IIWA 5FKTA 1XIPA 2XU7A 4O9DA 2GC7A 3AL9A 2P9IC 1N6EA 5FA5B 5I5IA 2EBSA 3ORVD 2J55H 2J57G 5EARA 2CE8A 4FWWA 2I3TA 3HFQA 5EM2B 3FRXA 2HJ4A 2IUQA 2PBIB 1ERJA 4X61B 4J73A 3SWSD 4QL1A 4JSNC 4N14A 4QT8A 3EI2A 2H14A 2H6QA 3PSLA 2XL2A 2IWFA 5HE3B 4GM3A 3EWEA 4AOWA 4O3TB 3FGBA 3I7OA 3DWLC 4L9OA 5KDOB 2PM9B 2B4EA 3W15A 4A0AA 5GXIA 2CO0C 4H5JA 3OKWA 4K3JB 3SFZA 4U1EI 3L4MD 5TF2A 3EI1B 3IJ0A 3UVOA 3I89A 3I7NA 4A7JA 5A2Qg 2IUPA 3SBPA 5AMSA 5IJ8E 2IURA 3EI3A 2AH1A 3MMYA 3C9CA 5GSAA 3OKYB 3F3PA 3RRMC 2W18A 5H14A 5IC7A 3C99A 4JSVC 3PXTD 4JT5C 4J81A 3JPXA 2AH0A 4L1QD 5GMKn 1JMXB 4L3HD 2Q7QA 3NVQA 5HYNB 5FLXg 1U2VC 1R5MA 4TZ4A 4CI3A 3UKRC 1JOFA 2UZYB 3EI4A 3RN1D 5TEEA 3UVLA 3MXXA 2B5LA 3N0EA 4FAVD 3DXKC 3I2NA 3KRWB 3I7PA 5CXBA 5CXCB 4BL0A 5EMLB 4CI2A 3B7FA 2P9KC 2H47A 4FB1D 4ZOYA 3AL8B 2OK6A 1XKSA 2IAAA 2HYEA 2H9MA 4JD2C 2AGYA 3EG6A 3UVNA 3OL2B 2OK4A 3DSMA 4PXWA 5THAA 4CY1A 3VA6A 3VGZA 3UVKA 4E54B 3IKOA 2H13A 4D6VA 4A0BA 4E5ZB 5HE2B 3OTTA 4J82A 1OMWB 4A09A 4FHLA 1RI6A 2YB8B 3SBQA 2P9UC 3RFHA 2AQ5A 2AGLA 1OLZA 2AGWA 4KFMB 3ODTA 2O9KA 4A2MA 2H6NA 2YMUA 4PBYA 4D0KA 3GFCA 4J0XA 2AGZA 4X63B 4J86A 3C75H 4I79A 5GXHA 5C9ZB 1JJUB 1YFQA 3F3FA 2GC4A 3SN6B 3MZKA 1P22A 4MK0B 2QC5A 3AL8A 4J84A 3BWSA 3K27A 4XEIC 4NSXA 1MDAH 4CZXA 3SVWD 4J0WA 3BG0A 4GQBB 1XHMA 2BCJB 2AGXA 2YNOA 3OKTA 5AJAA 4J78A 1PI6A 3L4OD 4GGAA 5IT9g 4ZOXA 4E54A 5CYKA 5K1CC 4GZ8A
chains in the Genus database with same CATH superfamily
1K32A 1L5GA 3IIYA 4ES0A 3UR4A 1I2MB 4A11B 1YR2A 2HJBA 1K8KC 3IJCA 1SQ9A 3EQ7A 2CE9A 3I7HA 4R7AB 3VI3A 4CI8A 2XYIA 4JSXC 4PC0A 2PM6B 3PSCB 4AMYA 4IA9A 2UZXB 5EAMA 1TYQC 3RN0D 4Z8LA 5EMMB 5EM2A 3SHFA 4X60B 2H9PA 2YNPA 5FKSA 3P4FA 4UI9R 5I5MA 3EMHA 2PM7B 4HDJA 3V9FA 4GM9A 4CY3A 1N6FA 4DNWA 3VH0A 3T3PA 1GXRA 3A0FA 3I8CA 2WQ8A 3NIFA 2B5MA 1SHYB 2I0TA 3JROA 4BCCA 3I8EA 3K71A 3GREA 5C2VB 1E8NA 4PNKB 4BUJC 2P9SC 3SMRA 5H17A 1VZ2A 5I5JA 3ZDYA 1UOQA 3ZWLB 3JZHA 3J80g 3JZNA 3V5WB 4ESGA 5K19A 1GG2B 3PVUB 3NVXA 4GGCA 1GP2B 2HXCA 2PM9A 3CFVA 2VZ3A 5C86A 3PXWD 3O4HA 3KRXB 4EWRA 1Q47A 1UTCA 5FFOA 5IJ7E 3K72A 3EI1A 5HE0B 2H3XA 1A0RB 2B5NA 3EU7A 5FXYA 2VDKA 4CC9A 1NEXB 3MKSB 4ERZA 3EI2B 1S4UX 3AH8B 3OKYA 2IUVA 3EQ9A 2MTAH 1A12A 3AFCA 3IJEA 3QHYB 4NBMA 2VDRA 4QQEA 2I0RA 4GMBA 3F3GA 3SCYA 3JRPA 2Z2PA 2P9LC 3RLMD 3PVWB 2QXVA 1B9XA 4JXMA 1JMZB 2HESX 2HU8A 3JAMg 4FA9D 3UVMA 2J56H 5HE1B 4ZOVA 5TEFA 2H68A 2BBKH 4O02A 2BKLA 3FCSA 4LG9A 1GOHA 1UOOA 2I0SA 3SXTD 4J77A 3SBRA 3C5MA 2QZPA 5M5UA 5FKQA 4BP8A 3EI3B 3V4PA 3RMZD 2GNQA 3CIKB 2YNNA 3RSEC 3RFGA 5CXCA 4GQ1A 4CY5A 4GM8A 3V7DB 4O1QD 2CO0A 3T3MA 5EMJB 4CY2A 5E6UA 4G56B 5C2WB 4GQ2P 1PEVA 4X3EA 4A08B 4BH6A 5IGOA 5FKRA 1JTDB 4J8BA 5HQGA 3U4YA 4GGDA 2OVQB 3BG1A 3V4VA 4ERYA 1H2ZA 3E0CA 3MUNA 1BPOA 1UOPA 2P9PC 3MUOA 3OL2A 4J79A 2XE4A 3EI4B 2G9AA 1TBGA 2OIZA 2OVPB 4YVDA 3JZGA 3IUNA 1H2WA 4E5ZA 2HKRA 4CZYA 3NIDA 5CXBB 4JSPC 1B9YA 3N0DA 5EMKB 3DM0A 4NC4A 1SQJA 2CN3A 4ERQA 2TRCB 4ZN4A 1U4CA 3IJ1A 2VDNA 4O3UB 2JKXA 3CFSB 1MG2A 4IMMA 1NR0A 3FM0A 1GOFA 3MKQA 4AEZA 4H5IA 4L3GD 3NIGA 4JHPC 2OVRB 4CZVA 4Y7RA 3I7LA 2CN2A 5EAPA 5B4WA 4O45A 4A2LA 4A0BB 5TDHB 3MVDK 2YBAA 1VE7A 2H6KA 2G99A 2H9NA 3PE7A 4A09B 3UKUC 4WK0A 3OW8A 4Y5RD 3O4JA 3DDUA 2HU5A 5M5RA 3JB9L 1PGUA 4OZUA 4A08A 2Z2NA 1L0QA 2OJYA 4U7AA 4CI1A 3J81g 1O6FA 1VYHC 4G55A 1N6DA 3K26A 2IWKA 4D9SA 4LG8A 4FA4D 4AMZA 3NVNA 4OWRA 3FCUA 4G1EA 4WJKA 4XYHA 4FAND 1O6GA 5M5VA 1H2YA 4FA1D 2P9NC 3DXMC 1QNIA 3I7KA 1GOTB 5AFU3 4JT6C 4PSXB 4A11A 5IGQA 4K3ID 3MZLA 2HKMA 3SJLD 1MG3A 5C92A 4AX4A 1E8MA 3GD1I 5H1MA 4JHNA 1FWXA 1PBYB 2I3SA 1U8CA 3ZE1A 4XYIA 4ZOZA 2Z2OA 4A0AB 3IVMA 4Z7QA 4DNVA 2XL3A 4FA5D 3PXSD 3ULEC 5EALA 3SLED 5FQDA 5SXMA 2CNXA 4LGNA 2H9LA 5HDBA 4J8GA 4QRJA 4PSWB 5JWZA 4PBZA 5CYKB 1H2XA 4J87A 3IIWA 5FKTA 1XIPA 3ZE0A 2XU7A 4Z7OA 4O9DA 2GC7A 3AL9A 2P9IC 1N6EA 5FA5B 4BCBA 5I5IA 2EBSA 3O4IA 2J55H 3ORVD 3ZE2A 2J57G 5EARA 3ZDZA 2CE8A 4FWWA 2I3TA 3HFQA 5EM2B 3FRXA 3O4GA 2HJ4A 2IUQA 2PBIB 1ERJA 4X61B 4J73A 3SWSD 1VE6A 4QL1A 4JSNC 3GC3B 4N14A 4QT8A 3EI2A 2H14A 2H6QA 3PSLA 2XL2A 4UM8A 3ZDXA 2VDQA 2IWFA 5HE3B 4GM3A 3EWEA 2QR5A 2EIBA 4AOWA 4O3TB 1C9LA 3FGBA 3I7OA 3K6SA 1QFSA 5M5SA 3DWLC 5E6SA 4L9OA 5KDOB 2PM9B 2B4EA 3W15A 4A0AA 5GXIA 5M61A 2CO0C 4H5JA 3OKWA 4K3JB 3SFZA 4U1EI 3L4MD 4MMXA 5TF2A 3EI1B 3IJ0A 3UVOA 3IUJA 3I89A 3I7NA 3IURA 4A7JA 5A2Qg 2IUPA 3SBPA 4BP9A 5AMSA 5IJ8E 2IURA 3EI3A 2AH1A 2VDLA 3MMYA 3C9CA 2XZGA 1T2XA 3OKYB 5GSAA 2VZ1A 1C9IA 3F3PA 3RRMC 2W18A 5H14A 5IC7A 3C99A 4JSVC 4RE6A 3PXTD 4JT5C 4J81A 1E5TA 2AH0A 3JPXA 2VDPA 4L1QD 5GMKn 1JMXB 4L3HD 2Q7QA 2EIEA 3NVQA 5M5TA 5HYNB 5FLXg 1U2VC 1R5MA 4TZ4A 4CI3A 5E6RA 2EIDA 3IUMA 3UKRC 1JOFA 2VDMA 3IULA 2UZYB 3EI4A 3IUQA 3RN1D 5TEEA 3UVLA 3MXXA 2B5LA 3N0EA 3KCIA 4FAVD 3DXKC 2VC2A 3I2NA 3KRWB 3I7PA 5CXBA 4UM9A 5CXCB 4O2WA 4BL0A 5EMLB 4CI2A 3B7FA 2P9KC 4G1MA 3OF7A 4IRZA 2H47A 4FB1D 4ZOYA 3AL8B 4WK2A 2OK6A 1XKSA 1GOGA 2IAAA 2HYEA 2H9MA 4JD2C 2AGYA 3VI4A 3EG6A 3UVNA 4DNUA 3OL2B 4Z7NA 2OK4A 3DSMA 4PXWA 5THAA 4CY1A 3VA6A 3QI0A 3VGZA 3UVKA 4E54B 3IKOA 2H13A 4NENA 4D6VA 4A0BA 4E5ZB 5HE2B 3OTTA 4QAMA 4J82A 5FFGA 1OMWB 4A09A 4FHLA 1RI6A 1TYEA 2YB8B 3SBQA 1K3IA 2P9UC 3RFHA 2AQ5A 2AGLA 1OLZA 2AGWA 4BCDA 1M1XA 4KFMB 4AN1A 4MMYA 3ODTA 2O9KA 4A2MA 4RE5A 4NAAA 2H6NA 2VDOA 4WK4A 2YMUA 4PBYA 4D0KA 3GFCA 1QFMA 4J0XA 2AGZA 1VZ3A 4X63B 4J86A 3C75H 4I79A 5GXHA 4AN0A 5C9ZB 1JJUB 1YFQA 3F3FA 2GC4A 3SN6B 3MZKA 1P22A 4MK0B 2QC5A 2HU7A 3AL8A 4J84A 3BWSA 2EICA 3K27A 4XEIC 4NSXA 1MDAH 4CZXA 3SVWD 4J0WA 4MMZA 3BG0A 4GQBB 1XHMA 2BCJB 2AGXA 2XDWA 2YNOA 3OKTA 5AJAA 4J78A 1JV2A 3EQ8A 1PI6A 3L4OD 4GGAA 5IT9g 4ZOXA 4E54A 5CYKA 5K1CC 4GZ8A 4L1MA
chains in the Genus database with same CATH topology
1K32A 3IIYA 4ES0A 3UR4A 4A11B 2HJBA 1K8KC 3IJCA 1SQ9A 4R7AB 2CE9A 3I7HA 4CI8A 2XYIA 4JSXC 4PC0A 2PM6B 3PSCB 4IA9A 2UZXB 5EAMA 1TYQC 3RN0D 4Z8LA 5EMMB 5EM2A 3SHFA 4X60B 2H9PA 2YNPA 5FKSA 3P4FA 4UI9R 5I5MA 3EMHA 2PM7B 4HDJA 3V9FA 4GM9A 4CY3A 1N6FA 3VH0A 1GXRA 3A0FA 3I8CA 2B5MA 1SHYB 2I0TA 3JROA 3I8EA 3GREA 5C2VB 4PNKB 4BUJC 2P9SC 3SMRA 5H17A 5I5JA 3ZWLB 3JZHA 3J80g 3JZNA 3V5WB 4ESGA 5K19A 1GG2B 3PVUB 3NVXA 4GGCA 1GP2B 2HXCA 2PM9A 3CFVA 3PXWD 3KRXB 4EWRA 1Q47A 5IJ7E 3EI1A 5HE0B 2H3XA 1A0RB 2B5NA 3EU7A 5FXYA 4CC9A 1NEXB 3MKSB 4ERZA 3EI2B 1S4UX 3AH8B 3OKYA 2IUVA 2MTAH 3AFCA 4QQEA 2I0RA 4GMBA 3F3GA 3SCYA 3JRPA 2Z2PA 2P9LC 3RLMD 3PVWB 2QXVA 1B9XA 4JXMA 1JMZB 2HESX 3JAMg 4FA9D 3UVMA 2J56H 5HE1B 4ZOVA 5TEFA 2H68A 2BBKH 4LG9A 2I0SA 3SXTD 4J77A 3SBRA 3C5MA 5FKQA 3EI3B 3RMZD 2GNQA 3CIKB 2YNNA 3RSEC 3RFGA 5CXCA 4GQ1A 4CY5A 4GM8A 3V7DB 4O1QD 2CO0A 5EMJB 4CY2A 4G56B 5C2WB 4GQ2P 1PEVA 4X3EA 4A08B 4BH6A 5IGOA 5FKRA 4J8BA 5HQGA 3U4YA 4GGDA 2OVQB 3BG1A 4ERYA 3E0CA 2P9PC 3OL2A 4J79A 3EI4B 2G9AA 1TBGA 2OIZA 2OVPB 4YVDA 3JZGA 4E5ZA 2HKRA 4CZYA 5CXBB 4JSPC 1B9YA 3N0DA 5EMKB 3DM0A 1SQJA 2CN3A 4ERQA 2TRCB 4ZN4A 1U4CA 3IJ1A 4O3UB 3CFSB 1MG2A 4IMMA 1NR0A 3FM0A 3MKQA 4AEZA 4H5IA 4L3GD 2OVRB 4CZVA 4Y7RA 3I7LA 2CN2A 5EAPA 5B4WA 4O45A 4A2LA 4A0BB 5TDHB 2YBAA 2H6KA 2G99A 2H9NA 3PE7A 4A09B 3UKUC 3OW8A 4Y5RD 3JB9L 1PGUA 4OZUA 4A08A 2Z2NA 1L0QA 2OJYA 4U7AA 4CI1A 3J81g 1VYHC 1N6DA 3K26A 2IWKA 4LG8A 4FA4D 3NVNA 4OWRA 4XYHA 4FAND 4FA1D 2P9NC 3DXMC 1QNIA 3I7KA 1GOTB 5AFU3 4JT6C 4PSXB 4A11A 5IGQA 4K3ID 3MZLA 2HKMA 3SJLD 1MG3A 5H1MA 1FWXA 1PBYB 2I3SA 4XYIA 4ZOZA 2Z2OA 4A0AB 2XL3A 4FA5D 3PXSD 3ULEC 5EALA 3SLED 5FQDA 5SXMA 2CNXA 4LGNA 2H9LA 4J8GA 4QRJA 4PSWB 5JWZA 4PBZA 5CYKB 4J87A 3IIWA 5FKTA 1XIPA 2XU7A 4O9DA 2GC7A 3AL9A 2P9IC 1N6EA 5FA5B 5I5IA 2EBSA 3ORVD 2J55H 2J57G 5EARA 2CE8A 4FWWA 2I3TA 3HFQA 5EM2B 3FRXA 2HJ4A 2IUQA 2PBIB 1ERJA 4X61B 4J73A 3SWSD 4QL1A 4JSNC 4N14A 4QT8A 3EI2A 2H14A 2H6QA 3PSLA 2XL2A 2IWFA 5HE3B 4GM3A 3EWEA 4AOWA 4O3TB 3FGBA 3I7OA 3DWLC 4L9OA 5KDOB 2PM9B 2B4EA 3W15A 4A0AA 5GXIA 2CO0C 4H5JA 3OKWA 4K3JB 3SFZA 4U1EI 3L4MD 5TF2A 3EI1B 3IJ0A 3UVOA 3I89A 3I7NA 4A7JA 5A2Qg 2IUPA 3SBPA 5AMSA 5IJ8E 2IURA 3EI3A 2AH1A 3MMYA 3C9CA 5GSAA 3OKYB 3F3PA 3RRMC 2W18A 5H14A 5IC7A 3C99A 4JSVC 3PXTD 4JT5C 4J81A 3JPXA 2AH0A 4L1QD 5GMKn 1JMXB 4L3HD 2Q7QA 3NVQA 5HYNB 5FLXg 1U2VC 1R5MA 4TZ4A 4CI3A 3UKRC 1JOFA 2UZYB 3EI4A 3RN1D 5TEEA 3UVLA 3MXXA 2B5LA 3N0EA 4FAVD 3DXKC 3I2NA 3KRWB 3I7PA 5CXBA 5CXCB 4BL0A 5EMLB 4CI2A 3B7FA 2P9KC 2H47A 4FB1D 4ZOYA 3AL8B 2OK6A 1XKSA 2IAAA 2HYEA 2H9MA 4JD2C 2AGYA 3EG6A 3UVNA 3OL2B 2OK4A 3DSMA 4PXWA 5THAA 4CY1A 3VA6A 3VGZA 3UVKA 4E54B 3IKOA 2H13A 4D6VA 4A0BA 4E5ZB 5HE2B 3OTTA 4J82A 1OMWB 4A09A 4FHLA 1RI6A 2YB8B 3SBQA 2P9UC 3RFHA 2AQ5A 2AGLA 1OLZA 2AGWA 4KFMB 3ODTA 2O9KA 4A2MA 2H6NA 2YMUA 4PBYA 4D0KA 3GFCA 4J0XA 2AGZA 4X63B 4J86A 3C75H 4I79A 5GXHA 5C9ZB 1JJUB 1YFQA 3F3FA 2GC4A 3SN6B 3MZKA 1P22A 4MK0B 2QC5A 3AL8A 4J84A 3BWSA 3K27A 4XEIC 4NSXA 1MDAH 4CZXA 3SVWD 4J0WA 3BG0A 4GQBB 1XHMA 2BCJB 2AGXA 2YNOA 3OKTA 5AJAA 4J78A 1PI6A 3L4OD 4GGAA 5IT9g 4ZOXA 4E54A 5CYKA 5K1CC 4GZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K32 A;  3IIY A;  4ES0 A;  3UR4 A;  4A11 B;  2HJB A;  1K8K C;  3IJC A;  1SQ9 A;  4R7A B;  2CE9 A;  3I7H A;  4CI8 A;  2XYI A;  4JSX C;  4PC0 A;  2PM6 B;  3PSC B;  4IA9 A;  2UZX B;  5EAM A;  1TYQ C;  3RN0 D;  4Z8L A;  5EMM B;  5EM2 A;  3SHF A;  4X60 B;  2H9P A;  2YNP A;  5FKS A;  3P4F A;  4UI9 R;  5I5M A;  3EMH A;  2PM7 B;  4HDJ A;  3V9F A;  4GM9 A;  4CY3 A;  1N6F A;  3VH0 A;  1GXR A;  3A0F A;  3I8C A;  2B5M A;  1SHY B;  2I0T A;  3JRO A;  3I8E A;  3GRE A;  5C2V B;  4PNK B;  4BUJ C;  2P9S C;  3SMR A;  5H17 A;  5I5J A;  3ZWL B;  3JZH A;  3J80 g;  3JZN A;  3V5W B;  4ESG A;  5K19 A;  1GG2 B;  3PVU B;  3NVX A;  4GGC A;  1GP2 B;  2HXC A;  2PM9 A;  3CFV A;  3PXW D;  3KRX B;  4EWR A;  1Q47 A;  5IJ7 E;  3EI1 A;  5HE0 B;  2H3X A;  1A0R B;  2B5N A;  3EU7 A;  5FXY A;  4CC9 A;  1NEX B;  3MKS B;  4ERZ A;  3EI2 B;  1S4U X;  3AH8 B;  3OKY A;  2IUV A;  2MTA H;  3AFC A;  4QQE A;  2I0R A;  4GMB A;  3F3G A;  3SCY A;  3JRP A;  2Z2P A;  2P9L C;  3RLM D;  3PVW B;  2QXV A;  1B9X A;  4JXM A;  1JMZ B;  2HES X;  3JAM g;  4FA9 D;  3UVM A;  2J56 H;  5HE1 B;  4ZOV A;  5TEF A;  2H68 A;  2BBK H;  4LG9 A;  2I0S A;  3SXT D;  4J77 A;  3SBR A;  3C5M A;  5FKQ A;  3EI3 B;  3RMZ D;  2GNQ A;  3CIK B;  2YNN A;  3RSE C;  3RFG A;  5CXC A;  4GQ1 A;  4CY5 A;  4GM8 A;  3V7D B;  4O1Q D;  2CO0 A;  5EMJ B;  4CY2 A;  4G56 B;  5C2W B;  4GQ2 P;  1PEV A;  4X3E A;  4A08 B;  4BH6 A;  5IGO A;  5FKR A;  4J8B A;  5HQG A;  3U4Y A;  4GGD A;  2OVQ B;  3BG1 A;  4ERY A;  3E0C A;  2P9P C;  3OL2 A;  4J79 A;  3EI4 B;  2G9A A;  1TBG A;  2OIZ A;  2OVP B;  4YVD A;  3JZG A;  4E5Z A;  2HKR A;  4CZY A;  5CXB B;  4JSP C;  1B9Y A;  3N0D A;  5EMK B;  3DM0 A;  1SQJ A;  2CN3 A;  4ERQ A;  2TRC B;  4ZN4 A;  1U4C A;  3IJ1 A;  4O3U B;  3CFS B;  1MG2 A;  4IMM A;  1NR0 A;  3FM0 A;  3MKQ A;  4AEZ A;  4H5I A;  4L3G D;  2OVR B;  4CZV A;  4Y7R A;  3I7L A;  2CN2 A;  5EAP A;  5B4W A;  4O45 A;  4A2L A;  4A0B B;  5TDH B;  2YBA A;  2H6K A;  2G99 A;  2H9N A;  3PE7 A;  4A09 B;  3UKU C;  3OW8 A;  4Y5R D;  3JB9 L;  1PGU A;  4OZU A;  4A08 A;  2Z2N A;  1L0Q A;  2OJY A;  4U7A A;  4CI1 A;  3J81 g;  1VYH C;  1N6D A;  3K26 A;  2IWK A;  4LG8 A;  4FA4 D;  3NVN A;  4OWR A;  4XYH A;  4FAN D;  4FA1 D;  2P9N C;  3DXM C;  1QNI A;  3I7K A;  1GOT B;  5AFU 3;  4JT6 C;  4PSX B;  4A11 A;  5IGQ A;  4K3I D;  3MZL A;  2HKM A;  3SJL D;  1MG3 A;  5H1M A;  1FWX A;  1PBY B;  2I3S A;  4XYI A;  4ZOZ A;  2Z2O A;  4A0A B;  2XL3 A;  4FA5 D;  3PXS D;  3ULE C;  5EAL A;  3SLE D;  5FQD A;  5SXM A;  2CNX A;  4LGN A;  2H9L A;  4J8G A;  4QRJ A;  4PSW B;  5JWZ A;  4PBZ A;  5CYK B;  4J87 A;  3IIW A;  5FKT A;  1XIP A;  2XU7 A;  4O9D A;  2GC7 A;  3AL9 A;  2P9I C;  1N6E A;  5FA5 B;  5I5I A;  2EBS A;  3ORV D;  2J55 H;  2J57 G;  5EAR A;  2CE8 A;  4FWW A;  2I3T A;  3HFQ A;  5EM2 B;  3FRX A;  2HJ4 A;  2IUQ A;  2PBI B;  1ERJ A;  4X61 B;  4J73 A;  3SWS D;  4QL1 A;  4JSN C;  4N14 A;  4QT8 A;  3EI2 A;  2H14 A;  2H6Q A;  3PSL A;  2XL2 A;  2IWF A;  5HE3 B;  4GM3 A;  3EWE A;  4AOW A;  4O3T B;  3FGB A;  3I7O A;  3DWL C;  4L9O A;  5KDO B;  2PM9 B;  2B4E A;  3W15 A;  4A0A A;  5GXI A;  2CO0 C;  4H5J A;  3OKW A;  4K3J B;  3SFZ A;  4U1E I;  3L4M D;  5TF2 A;  3EI1 B;  3IJ0 A;  3UVO A;  3I89 A;  3I7N A;  4A7J A;  5A2Q g;  2IUP A;  3SBP A;  5AMS A;  5IJ8 E;  2IUR A;  3EI3 A;  2AH1 A;  3MMY A;  3C9C A;  5GSA A;  3OKY B;  3F3P A;  3RRM C;  2W18 A;  5H14 A;  5IC7 A;  3C99 A;  4JSV C;  3PXT D;  4JT5 C;  4J81 A;  3JPX A;  2AH0 A;  4L1Q D;  5GMK n;  1JMX B;  4L3H D;  2Q7Q A;  3NVQ A;  5HYN B;  5FLX g;  1U2V C;  1R5M A;  4TZ4 A;  4CI3 A;  3UKR C;  1JOF A;  2UZY B;  3EI4 A;  3RN1 D;  5TEE A;  3UVL A;  3MXX A;  2B5L A;  3N0E A;  4FAV D;  3DXK C;  3I2N A;  3KRW B;  3I7P A;  5CXB A;  5CXC B;  4BL0 A;  5EML B;  4CI2 A;  3B7F A;  2P9K C;  2H47 A;  4FB1 D;  4ZOY A;  3AL8 B;  2OK6 A;  1XKS A;  2IAA A;  2HYE A;  2H9M A;  4JD2 C;  2AGY A;  3EG6 A;  3UVN A;  3OL2 B;  2OK4 A;  3DSM A;  4PXW A;  5THA A;  4CY1 A;  3VA6 A;  3VGZ A;  3UVK A;  4E54 B;  3IKO A;  2H13 A;  4D6V A;  4A0B A;  4E5Z B;  5HE2 B;  3OTT A;  4J82 A;  1OMW B;  4A09 A;  4FHL A;  1RI6 A;  2YB8 B;  3SBQ A;  2P9U C;  3RFH A;  2AQ5 A;  2AGL A;  1OLZ A;  2AGW A;  4KFM B;  3ODT A;  2O9K A;  4A2M A;  2H6N A;  2YMU A;  4PBY A;  4D0K A;  3GFC A;  4J0X A;  2AGZ A;  4X63 B;  4J86 A;  3C75 H;  4I79 A;  5GXH A;  5C9Z B;  1JJU B;  1YFQ A;  3F3F A;  2GC4 A;  3SN6 B;  3MZK A;  1P22 A;  4MK0 B;  2QC5 A;  3AL8 A;  4J84 A;  3BWS A;  3K27 A;  4XEI C;  4NSX A;  1MDA H;  4CZX A;  3SVW D;  4J0W A;  3BG0 A;  4GQB B;  1XHM A;  2BCJ B;  2AGX A;  2YNO A;  3OKT A;  5AJA A;  4J78 A;  1PI6 A;  3L4O D;  4GGA A;  5IT9 g;  4ZOX A;  4E54 A;  5CYK A;  5K1C C;  4GZ8 A; 
#chains in the Genus database with same CATH topology
 1K32 A;  1L5G A;  3IIY A;  4ES0 A;  3UR4 A;  1I2M B;  4A11 B;  1YR2 A;  2HJB A;  1K8K C;  3IJC A;  1SQ9 A;  3EQ7 A;  2CE9 A;  3I7H A;  4R7A B;  3VI3 A;  4CI8 A;  2XYI A;  4JSX C;  4PC0 A;  2PM6 B;  3PSC B;  4AMY A;  4IA9 A;  2UZX B;  5EAM A;  1TYQ C;  3RN0 D;  4Z8L A;  5EMM B;  5EM2 A;  3SHF A;  4X60 B;  2H9P A;  2YNP A;  5FKS A;  3P4F A;  4UI9 R;  5I5M A;  3EMH A;  2PM7 B;  4HDJ A;  3V9F A;  4GM9 A;  4CY3 A;  1N6F A;  4DNW A;  3VH0 A;  3T3P A;  1GXR A;  3A0F A;  3I8C A;  2WQ8 A;  3NIF A;  2B5M A;  1SHY B;  2I0T A;  3JRO A;  4BCC A;  3I8E A;  3K71 A;  3GRE A;  5C2V B;  1E8N A;  4PNK B;  4BUJ C;  2P9S C;  3SMR A;  5H17 A;  1VZ2 A;  5I5J A;  3ZDY A;  1UOQ A;  3ZWL B;  3JZH A;  3J80 g;  3JZN A;  3V5W B;  4ESG A;  5K19 A;  1GG2 B;  3PVU B;  3NVX A;  4GGC A;  1GP2 B;  2HXC A;  2PM9 A;  3CFV A;  2VZ3 A;  5C86 A;  3PXW D;  3O4H A;  3KRX B;  4EWR A;  1Q47 A;  1UTC A;  5FFO A;  5IJ7 E;  3K72 A;  3EI1 A;  5HE0 B;  2H3X A;  1A0R B;  2B5N A;  3EU7 A;  5FXY A;  2VDK A;  4CC9 A;  1NEX B;  3MKS B;  4ERZ A;  3EI2 B;  1S4U X;  3AH8 B;  3OKY A;  2IUV A;  3EQ9 A;  2MTA H;  1A12 A;  3AFC A;  3IJE A;  3QHY B;  4NBM A;  2VDR A;  4QQE A;  2I0R A;  4GMB A;  3F3G A;  3SCY A;  3JRP A;  2Z2P A;  2P9L C;  3RLM D;  3PVW B;  2QXV A;  1B9X A;  4JXM A;  1JMZ B;  2HES X;  2HU8 A;  3JAM g;  4FA9 D;  3UVM A;  2J56 H;  5HE1 B;  4ZOV A;  5TEF A;  2H68 A;  2BBK H;  4O02 A;  2BKL A;  3FCS A;  4LG9 A;  1GOH A;  1UOO A;  2I0S A;  3SXT D;  4J77 A;  3SBR A;  3C5M A;  2QZP A;  5M5U A;  5FKQ A;  4BP8 A;  3EI3 B;  3V4P A;  3RMZ D;  2GNQ A;  3CIK B;  2YNN A;  3RSE C;  3RFG A;  5CXC A;  4GQ1 A;  4CY5 A;  4GM8 A;  3V7D B;  4O1Q D;  2CO0 A;  3T3M A;  5EMJ B;  4CY2 A;  5E6U A;  4G56 B;  5C2W B;  4GQ2 P;  1PEV A;  4X3E A;  4A08 B;  4BH6 A;  5IGO A;  5FKR A;  1JTD B;  4J8B A;  5HQG A;  3U4Y A;  4GGD A;  2OVQ B;  3BG1 A;  3V4V A;  4ERY A;  1H2Z A;  3E0C A;  3MUN A;  1BPO A;  1UOP A;  2P9P C;  3MUO A;  3OL2 A;  4J79 A;  2XE4 A;  3EI4 B;  2G9A A;  1TBG A;  2OIZ A;  2OVP B;  4YVD A;  3JZG A;  3IUN A;  1H2W A;  4E5Z A;  2HKR A;  4CZY A;  3NID A;  5CXB B;  4JSP C;  1B9Y A;  3N0D A;  5EMK B;  3DM0 A;  4NC4 A;  1SQJ A;  2CN3 A;  4ERQ A;  2TRC B;  4ZN4 A;  1U4C A;  3IJ1 A;  2VDN A;  4O3U B;  2JKX A;  3CFS B;  1MG2 A;  4IMM A;  1NR0 A;  3FM0 A;  1GOF A;  3MKQ A;  4AEZ A;  4H5I A;  4L3G D;  3NIG A;  4JHP C;  2OVR B;  4CZV A;  4Y7R A;  3I7L A;  2CN2 A;  5EAP A;  5B4W A;  4O45 A;  4A2L A;  4A0B B;  5TDH B;  3MVD K;  2YBA A;  1VE7 A;  2H6K A;  2G99 A;  2H9N A;  3PE7 A;  4A09 B;  3UKU C;  4WK0 A;  3OW8 A;  4Y5R D;  3O4J A;  3DDU A;  2HU5 A;  5M5R A;  3JB9 L;  1PGU A;  4OZU A;  4A08 A;  2Z2N A;  1L0Q A;  2OJY A;  4U7A A;  4CI1 A;  3J81 g;  1O6F A;  1VYH C;  4G55 A;  1N6D A;  3K26 A;  2IWK A;  4D9S A;  4LG8 A;  4FA4 D;  4AMZ A;  3NVN A;  4OWR A;  3FCU A;  4G1E A;  4WJK A;  4XYH A;  4FAN D;  1O6G A;  5M5V A;  1H2Y A;  4FA1 D;  2P9N C;  3DXM C;  1QNI A;  3I7K A;  1GOT B;  5AFU 3;  4JT6 C;  4PSX B;  4A11 A;  5IGQ A;  4K3I D;  3MZL A;  2HKM A;  3SJL D;  1MG3 A;  5C92 A;  4AX4 A;  1E8M A;  3GD1 I;  5H1M A;  4JHN A;  1FWX A;  1PBY B;  2I3S A;  1U8C A;  3ZE1 A;  4XYI A;  4ZOZ A;  2Z2O A;  4A0A B;  3IVM A;  4Z7Q A;  4DNV A;  2XL3 A;  4FA5 D;  3PXS D;  3ULE C;  5EAL A;  3SLE D;  5FQD A;  5SXM A;  2CNX A;  4LGN A;  2H9L A;  5HDB A;  4J8G A;  4QRJ A;  4PSW B;  5JWZ A;  4PBZ A;  5CYK B;  1H2X A;  4J87 A;  3IIW A;  5FKT A;  1XIP A;  3ZE0 A;  2XU7 A;  4Z7O A;  4O9D A;  2GC7 A;  3AL9 A;  2P9I C;  1N6E A;  5FA5 B;  4BCB A;  5I5I A;  2EBS A;  3O4I A;  2J55 H;  3ORV D;  3ZE2 A;  2J57 G;  5EAR A;  3ZDZ A;  2CE8 A;  4FWW A;  2I3T A;  3HFQ A;  5EM2 B;  3FRX A;  3O4G A;  2HJ4 A;  2IUQ A;  2PBI B;  1ERJ A;  4X61 B;  4J73 A;  3SWS D;  1VE6 A;  4QL1 A;  4JSN C;  3GC3 B;  4N14 A;  4QT8 A;  3EI2 A;  2H14 A;  2H6Q A;  3PSL A;  2XL2 A;  4UM8 A;  3ZDX A;  2VDQ A;  2IWF A;  5HE3 B;  4GM3 A;  3EWE A;  2QR5 A;  2EIB A;  4AOW A;  4O3T B;  1C9L A;  3FGB A;  3I7O A;  3K6S A;  1QFS A;  5M5S A;  3DWL C;  5E6S A;  4L9O A;  5KDO B;  2PM9 B;  2B4E A;  3W15 A;  4A0A A;  5GXI A;  5M61 A;  2CO0 C;  4H5J A;  3OKW A;  4K3J B;  3SFZ A;  4U1E I;  3L4M D;  4MMX A;  5TF2 A;  3EI1 B;  3IJ0 A;  3UVO A;  3IUJ A;  3I89 A;  3I7N A;  3IUR A;  4A7J A;  5A2Q g;  2IUP A;  3SBP A;  4BP9 A;  5AMS A;  5IJ8 E;  2IUR A;  3EI3 A;  2AH1 A;  2VDL A;  3MMY A;  3C9C A;  2XZG A;  1T2X A;  3OKY B;  5GSA A;  2VZ1 A;  1C9I A;  3F3P A;  3RRM C;  2W18 A;  5H14 A;  5IC7 A;  3C99 A;  4JSV C;  4RE6 A;  3PXT D;  4JT5 C;  4J81 A;  1E5T A;  2AH0 A;  3JPX A;  2VDP A;  4L1Q D;  5GMK n;  1JMX B;  4L3H D;  2Q7Q A;  2EIE A;  3NVQ A;  5M5T A;  5HYN B;  5FLX g;  1U2V C;  1R5M A;  4TZ4 A;  4CI3 A;  5E6R A;  2EID A;  3IUM A;  3UKR C;  1JOF A;  2VDM A;  3IUL A;  2UZY B;  3EI4 A;  3IUQ A;  3RN1 D;  5TEE A;  3UVL A;  3MXX A;  2B5L A;  3N0E A;  3KCI A;  4FAV D;  3DXK C;  2VC2 A;  3I2N A;  3KRW B;  3I7P A;  5CXB A;  4UM9 A;  5CXC B;  4O2W A;  4BL0 A;  5EML B;  4CI2 A;  3B7F A;  2P9K C;  4G1M A;  3OF7 A;  4IRZ A;  2H47 A;  4FB1 D;  4ZOY A;  3AL8 B;  4WK2 A;  2OK6 A;  1XKS A;  1GOG A;  2IAA A;  2HYE A;  2H9M A;  4JD2 C;  2AGY A;  3VI4 A;  3EG6 A;  3UVN A;  4DNU A;  3OL2 B;  4Z7N A;  2OK4 A;  3DSM A;  4PXW A;  5THA A;  4CY1 A;  3VA6 A;  3QI0 A;  3VGZ A;  3UVK A;  4E54 B;  3IKO A;  2H13 A;  4NEN A;  4D6V A;  4A0B A;  4E5Z B;  5HE2 B;  3OTT A;  4QAM A;  4J82 A;  5FFG A;  1OMW B;  4A09 A;  4FHL A;  1RI6 A;  1TYE A;  2YB8 B;  3SBQ A;  1K3I A;  2P9U C;  3RFH A;  2AQ5 A;  2AGL A;  1OLZ A;  2AGW A;  4BCD A;  1M1X A;  4KFM B;  4AN1 A;  4MMY A;  3ODT A;  2O9K A;  4A2M A;  4RE5 A;  4NAA A;  2H6N A;  2VDO A;  4WK4 A;  2YMU A;  4PBY A;  4D0K A;  3GFC A;  1QFM A;  4J0X A;  2AGZ A;  1VZ3 A;  4X63 B;  4J86 A;  3C75 H;  4I79 A;  5GXH A;  4AN0 A;  5C9Z B;  1JJU B;  1YFQ A;  3F3F A;  2GC4 A;  3SN6 B;  3MZK A;  1P22 A;  4MK0 B;  2QC5 A;  2HU7 A;  3AL8 A;  4J84 A;  3BWS A;  2EIC A;  3K27 A;  4XEI C;  4NSX A;  1MDA H;  4CZX A;  3SVW D;  4J0W A;  4MMZ A;  3BG0 A;  4GQB B;  1XHM A;  2BCJ B;  2AGX A;  2XDW A;  2YNO A;  3OKT A;  5AJA A;  4J78 A;  1JV2 A;  3EQ8 A;  1PI6 A;  3L4O D;  4GGA A;  5IT9 g;  4ZOX A;  4E54 A;  5CYK A;  5K1C C;  4GZ8 A;  4L1M A; 
#chains in the Genus database with same CATH homology
 1K32 A;  3IIY A;  4ES0 A;  3UR4 A;  4A11 B;  2HJB A;  1K8K C;  3IJC A;  1SQ9 A;  4R7A B;  2CE9 A;  3I7H A;  4CI8 A;  2XYI A;  4JSX C;  4PC0 A;  2PM6 B;  3PSC B;  4IA9 A;  2UZX B;  5EAM A;  1TYQ C;  3RN0 D;  4Z8L A;  5EMM B;  5EM2 A;  3SHF A;  4X60 B;  2H9P A;  2YNP A;  5FKS A;  3P4F A;  4UI9 R;  5I5M A;  3EMH A;  2PM7 B;  4HDJ A;  3V9F A;  4GM9 A;  4CY3 A;  1N6F A;  3VH0 A;  1GXR A;  3A0F A;  3I8C A;  2B5M A;  1SHY B;  2I0T A;  3JRO A;  3I8E A;  3GRE A;  5C2V B;  4PNK B;  4BUJ C;  2P9S C;  3SMR A;  5H17 A;  5I5J A;  3ZWL B;  3JZH A;  3J80 g;  3JZN A;  3V5W B;  4ESG A;  5K19 A;  1GG2 B;  3PVU B;  3NVX A;  4GGC A;  1GP2 B;  2HXC A;  2PM9 A;  3CFV A;  3PXW D;  3KRX B;  4EWR A;  1Q47 A;  5IJ7 E;  3EI1 A;  5HE0 B;  2H3X A;  1A0R B;  2B5N A;  3EU7 A;  5FXY A;  4CC9 A;  1NEX B;  3MKS B;  4ERZ A;  3EI2 B;  1S4U X;  3AH8 B;  3OKY A;  2IUV A;  2MTA H;  3AFC A;  4QQE A;  2I0R A;  4GMB A;  3F3G A;  3SCY A;  3JRP A;  2Z2P A;  2P9L C;  3RLM D;  3PVW B;  2QXV A;  1B9X A;  4JXM A;  1JMZ B;  2HES X;  3JAM g;  4FA9 D;  3UVM A;  2J56 H;  5HE1 B;  4ZOV A;  5TEF A;  2H68 A;  2BBK H;  4LG9 A;  2I0S A;  3SXT D;  4J77 A;  3SBR A;  3C5M A;  5FKQ A;  3EI3 B;  3RMZ D;  2GNQ A;  3CIK B;  2YNN A;  3RSE C;  3RFG A;  5CXC A;  4GQ1 A;  4CY5 A;  4GM8 A;  3V7D B;  4O1Q D;  2CO0 A;  5EMJ B;  4CY2 A;  4G56 B;  5C2W B;  4GQ2 P;  1PEV A;  4X3E A;  4A08 B;  4BH6 A;  5IGO A;  5FKR A;  4J8B A;  5HQG A;  3U4Y A;  4GGD A;  2OVQ B;  3BG1 A;  4ERY A;  3E0C A;  2P9P C;  3OL2 A;  4J79 A;  3EI4 B;  2G9A A;  1TBG A;  2OIZ A;  2OVP B;  4YVD A;  3JZG A;  4E5Z A;  2HKR A;  4CZY A;  5CXB B;  4JSP C;  1B9Y A;  3N0D A;  5EMK B;  3DM0 A;  1SQJ A;  2CN3 A;  4ERQ A;  2TRC B;  4ZN4 A;  1U4C A;  3IJ1 A;  4O3U B;  3CFS B;  1MG2 A;  4IMM A;  1NR0 A;  3FM0 A;  3MKQ A;  4AEZ A;  4H5I A;  4L3G D;  2OVR B;  4CZV A;  4Y7R A;  3I7L A;  2CN2 A;  5EAP A;  5B4W A;  4O45 A;  4A2L A;  4A0B B;  5TDH B;  2YBA A;  2H6K A;  2G99 A;  2H9N A;  3PE7 A;  4A09 B;  3UKU C;  3OW8 A;  4Y5R D;  3JB9 L;  1PGU A;  4OZU A;  4A08 A;  2Z2N A;  1L0Q A;  2OJY A;  4U7A A;  4CI1 A;  3J81 g;  1VYH C;  1N6D A;  3K26 A;  2IWK A;  4LG8 A;  4FA4 D;  3NVN A;  4OWR A;  4XYH A;  4FAN D;  4FA1 D;  2P9N C;  3DXM C;  1QNI A;  3I7K A;  1GOT B;  5AFU 3;  4JT6 C;  4PSX B;  4A11 A;  5IGQ A;  4K3I D;  3MZL A;  2HKM A;  3SJL D;  1MG3 A;  5H1M A;  1FWX A;  1PBY B;  2I3S A;  4XYI A;  4ZOZ A;  2Z2O A;  4A0A B;  2XL3 A;  4FA5 D;  3PXS D;  3ULE C;  5EAL A;  3SLE D;  5FQD A;  5SXM A;  2CNX A;  4LGN A;  2H9L A;  4J8G A;  4QRJ A;  4PSW B;  5JWZ A;  4PBZ A;  5CYK B;  4J87 A;  3IIW A;  5FKT A;  1XIP A;  2XU7 A;  4O9D A;  2GC7 A;  3AL9 A;  2P9I C;  1N6E A;  5FA5 B;  5I5I A;  2EBS A;  3ORV D;  2J55 H;  2J57 G;  5EAR A;  2CE8 A;  4FWW A;  2I3T A;  3HFQ A;  5EM2 B;  3FRX A;  2HJ4 A;  2IUQ A;  2PBI B;  1ERJ A;  4X61 B;  4J73 A;  3SWS D;  4QL1 A;  4JSN C;  4N14 A;  4QT8 A;  3EI2 A;  2H14 A;  2H6Q A;  3PSL A;  2XL2 A;  2IWF A;  5HE3 B;  4GM3 A;  3EWE A;  4AOW A;  4O3T B;  3FGB A;  3I7O A;  3DWL C;  4L9O A;  5KDO B;  2PM9 B;  2B4E A;  3W15 A;  4A0A A;  5GXI A;  2CO0 C;  4H5J A;  3OKW A;  4K3J B;  3SFZ A;  4U1E I;  3L4M D;  5TF2 A;  3EI1 B;  3IJ0 A;  3UVO A;  3I89 A;  3I7N A;  4A7J A;  5A2Q g;  2IUP A;  3SBP A;  5AMS A;  5IJ8 E;  2IUR A;  3EI3 A;  2AH1 A;  3MMY A;  3C9C A;  5GSA A;  3OKY B;  3F3P A;  3RRM C;  2W18 A;  5H14 A;  5IC7 A;  3C99 A;  4JSV C;  3PXT D;  4JT5 C;  4J81 A;  3JPX A;  2AH0 A;  4L1Q D;  5GMK n;  1JMX B;  4L3H D;  2Q7Q A;  3NVQ A;  5HYN B;  5FLX g;  1U2V C;  1R5M A;  4TZ4 A;  4CI3 A;  3UKR C;  1JOF A;  2UZY B;  3EI4 A;  3RN1 D;  5TEE A;  3UVL A;  3MXX A;  2B5L A;  3N0E A;  4FAV D;  3DXK C;  3I2N A;  3KRW B;  3I7P A;  5CXB A;  5CXC B;  4BL0 A;  5EML B;  4CI2 A;  3B7F A;  2P9K C;  2H47 A;  4FB1 D;  4ZOY A;  3AL8 B;  2OK6 A;  1XKS A;  2IAA A;  2HYE A;  2H9M A;  4JD2 C;  2AGY A;  3EG6 A;  3UVN A;  3OL2 B;  2OK4 A;  3DSM A;  4PXW A;  5THA A;  4CY1 A;  3VA6 A;  3VGZ A;  3UVK A;  4E54 B;  3IKO A;  2H13 A;  4D6V A;  4A0B A;  4E5Z B;  5HE2 B;  3OTT A;  4J82 A;  1OMW B;  4A09 A;  4FHL A;  1RI6 A;  2YB8 B;  3SBQ A;  2P9U C;  3RFH A;  2AQ5 A;  2AGL A;  1OLZ A;  2AGW A;  4KFM B;  3ODT A;  2O9K A;  4A2M A;  2H6N A;  2YMU A;  4PBY A;  4D0K A;  3GFC A;  4J0X A;  2AGZ A;  4X63 B;  4J86 A;  3C75 H;  4I79 A;  5GXH A;  5C9Z B;  1JJU B;  1YFQ A;  3F3F A;  2GC4 A;  3SN6 B;  3MZK A;  1P22 A;  4MK0 B;  2QC5 A;  3AL8 A;  4J84 A;  3BWS A;  3K27 A;  4XEI C;  4NSX A;  1MDA H;  4CZX A;  3SVW D;  4J0W A;  3BG0 A;  4GQB B;  1XHM A;  2BCJ B;  2AGX A;  2YNO A;  3OKT A;  5AJA A;  4J78 A;  1PI6 A;  3L4O D;  4GGA A;  5IT9 g;  4ZOX A;  4E54 A;  5CYK A;  5K1C C;  4GZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...