4CZYA

Complex of neurospora crassa pan2 (wd40-cs1) with pan3 (pseudokinase and c-term)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
323
structure length
323
Chain Sequence
b'HMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
molecule tags Gene regulation
source organism Neurospora crassa
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
total genus 80
structure length 323
sequence length 323
chains with identical sequence C
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czyA00
3CIKB 5HE1B 3UKUC 1PI6A 5C2WB 4ERZA 5IGOA 4J87A 4H5JA 1JOFA 3DWLC 1RI6A 3SN6B 4J0XA 2P9PC 2AGZA 2OK6A 4GM3A 1NEXB 1YFQA 4CZVA 2CN2A 4MK0B 2YNOA 3AL8A 4QL1A 2AGWA 1TYQC 3JRPA 3SLED 2H9LA 3KRWB 2H6QA 3C75H 3JAMg 3KRXB 2I0RA 2PM7B 4O9DA 4JSPC 3SCYA 1OMWB 5FXYA 3OW8A 4A0BA 2I0SA 5HYNB 4A09A 1GG2B 3SMRA 5THAA 3I7NA 5EMMB 3K26A 4LG8A 5EMKB 2CO0A 4ERYA 3UKRC 2YNPA 1SHYB 4OZUA 2Q7QA 4BL0A 1TBGA 2GC7A 2PM9B 4E5ZA 3UVMA 3EI3A 3L4OD 5FKSA 2P9NC 1GP2B 4CZYA 2EBSA 3CFVA 3OKYB 3JZNA 2IWKA 2AQ5A 3AL8B 4L1QD 4J78A 1L0QA 4ZN4A 3U4YA 3AL9A 1R5MA 3F3FA 2CNXA 3SBRA 1N6FA 3VGZA 2OJYA 3C5MA 2CE8A 3FRXA 1SQ9A 3F3GA 1N6EA 3OKWA 1GOTB 3PSCB 3V9FA 4QT8A 4PSXB 4GM9A 4Y7RA 4J73A 2G99A 3K27A 4D0KA 3ODTA 2IUPA 5C2VB 3AH8B 5AFU3 3IIWA 3PXWD 3DXMC 4H5IA 4CY5A 2IAAA 3EI4A 3SWSD 5IC7A 5FLXg 4O3TB 4XYIA 1N6DA 4QQEA 4Y5RD 5C9ZB 3BG0A 4FA9D 2H14A 5CXBA 4J84A 2HYEA 5FKQA 3P4FA 3PE7A 3J80g 3GREA 4CI3A 4FA4D 4X61B 2G9AA 3NVNA 3I7HA 4A08A 3I7LA 5FA5B 2HKMA 3JZGA 5TDHB 5GMKn 4JSXC 2I3SA 4PNKB 3EI2A 4GZ8A 2AGXA 5CXBB 3EU7A 2P9SC 1GXRA 4CI8A 3IJCA 5B4WA 4O3UB 3BWSA 2B5MA 2J55H 4UI9R 5CYKB 3JB9L 2B5LA 4CY2A 3EWEA 5IJ7E 3EMHA 4FAND 4J82A 2B4EA 3RSEC 3RRMC 2PBIB 3I7PA 4PC0A 4K3ID 4JXMA 4FA1D 4A0BB 1OLZA 4ZOXA 3EI1A 5IGQA 2HXCA 3N0DA 2H68A 5H14A 3UR4A 4A09B 2HKRA 3ULEC 1PBYB 3JZHA 4ZOYA 3PVWB 4YVDA 2QXVA 2TRCB 4J77A 4N14A 4ZOVA 2W18A 5K19A 4J79A 3UVNA 5EM2B 2J56H 4O45A 2Z2OA 3JROA 5I5JA 4L3GD 2Z2NA 1U2VC 4TZ4A 1MDAH 2H13A 1Q47A 4JT5C 2OIZA 3MKQA 2XU7A 2H6KA 3IJ0A 5EMJB 4CY3A 3FGBA 5TF2A 4J8GA 2Z2PA 3I7OA 4JSNC 2H47A 3RFGA 4OWRA 3NVQA 2PM6B 5H1MA 3V7DB 2CO0C 3MXXA 2XL2A 3I89A 3BG1A 4CC9A 4GGDA 2CN3A 5IJ8E 4A2MA 3EI1B 4L9OA 1FWXA 4EWRA 2P9IC 3I7KA 5FKTA 4A2LA 4JD2C 3PXSD 3SXTD 5KDOB 1ERJA 3SJLD 3DXKC 5CYKA 5FQDA 3A0FA 4PSWB 2AH0A 5K1CC 1K8KC 1B9YA 1XHMA 5CXCB 3NVXA 1QNIA 1XKSA 3N0EA 2H9MA 4FWWA 4JSVC 3L4MD 4G56B 2YMUA 1JMZB 4LGNA 4GQ2P 2BBKH 3B7FA 4IA9A 4K3JB 4U1EI 2PM9A 1MG3A 3EI3B 4GMBA 4BUJC 2OVPB 2H3XA 3OKTA 4AOWA 4JT6C 2XL3A 3PSLA 2HJBA 5EALA 4GGCA 2H9PA 5I5MA 5HE0B 2HESX 3PVUB 2OVQB 3IKOA 4R7AB 5SXMA 3DM0A 4HDJA 1XIPA 2O9KA 4FAVD 3RFHA 4KFMB 2B5NA 2HJ4A 3MKSB 4IMMA 2MTAH 5A2Qg 5HE2B 4E54B 3RN1D 4GGAA 5TEEA 5HQGA 1P22A 3F3PA 4GM8A 3SVWD 3UVLA 3PXTD 1A0RB 2P9KC 4A0AA 3VA6A 3C9CA 2J57G 3SBQA 3MZKA 3UVKA 3EI4B 3JPXA 5TEFA 4QRJA 5EAMA 1B9XA 3V5WB 2UZYB 2H6NA 3IJ1A 5I5IA 2IUVA 4ES0A 3RMZD 2IURA 4AEZA 5EARA 3I8EA 3EI2B 3SBPA 3EG6A 5HE3B 1PGUA 4O1QD 2OVRB 4Z8LA 3OL2A 3ZWLB 3E0CA 4CZXA 4FA5D 5EM2A 3MMYA 4LG9A 3SHFA 2GC4A 4E54A 4FHLA 4BH6A 3I2NA 2YB8B 2I3TA 4CY1A 3W15A 2H9NA 3IIYA 3OKYA 1NR0A 1JJUB 4J0WA 1SQJA 5IT9g 4X60B 4A11B 2P9UC 1MG2A 1VYHC 2CE9A 4GQ1A 3MZLA 2QC5A 5JWZA 2AGYA 1JMXB 4ZOZA 5H17A 4PBZA 3J81g 4XEIC 1PEVA 4I79A 3VH0A 4ERQA 1S4UX 3OTTA 4D6VA 4FB1D 3AFCA 2XYIA 4CI2A 4J8BA 3FM0A 3I8CA 5CXCA 2BCJB 4GQBB 3DSMA 3OL2B 4A08B 3SFZA 4CI1A 3GFCA 4ESGA 4PBYA 4J86A 3UVOA 5GSAA 2IUQA 5EAPA 5GXHA 2OK4A 3CFSB 5EMLB 2GNQA 3HFQA 1K32A 2YBAA 4L3HD 4NSXA 4A7JA 4U7AA 4X63B 2AH1A 1U4CA 2P9LC 2UZXB 5FKRA 4E5ZB 3C99A 4X3EA 2I0TA 2YNNA 5AMSA 4PXWA 3RN0D 4A0AB 5GXIA 2IWFA 4J81A 4XYHA 5AJAA 3ORVD 3RLMD 2AGLA 4A11A
chains in the Genus database with same CATH superfamily
3CIKB 5HE1B 3UKUC 3ZDZA 1PI6A 5C2WB 4ERZA 5IGOA 4J87A 4H5JA 1JOFA 5M5SA 4WK0A 3DWLC 1RI6A 3SN6B 1E5TA 4J0XA 2P9PC 3EQ8A 2AGZA 2OK6A 4GM3A 1NEXB 1YFQA 5FFOA 4CZVA 2CN2A 2EIDA 4MK0B 4BCBA 3ZDYA 2JKXA 1M1XA 2YNOA 3AL8A 4QL1A 2AGWA 1TYQC 3JRPA 4NENA 3SLED 2H9LA 4G1MA 3KRWB 5M5VA 2H6QA 3C75H 3JAMg 3KRXB 2I0RA 2PM7B 2WQ8A 4O9DA 4JSPC 3SCYA 1OMWB 4BP8A 2VDPA 5FXYA 3OW8A 4A0BA 2I0SA 5HYNB 4A09A 1GG2B 4G1EA 4DNWA 3SMRA 4MMXA 5THAA 3I7NA 4Z7OA 5EMMB 3K26A 4LG8A 5EMKB 1I2MB 2CO0A 4ERYA 3UKRC 2YNPA 1SHYB 4OZUA 2Q7QA 4BL0A 1TBGA 3ZE1A 2GC7A 2PM9B 2VDMA 4E5ZA 2EICA 2HU8A 3UVMA 3EI3A 3L4OD 5FKSA 2P9NC 1GP2B 4CZYA 2EBSA 3CFVA 3OKYB 2XZGA 3JZNA 2IWKA 2AQ5A 3AL8B 4L1QD 2EIBA 4J78A 1L0QA 4ZN4A 3U4YA 3AL9A 1R5MA 3F3FA 2CNXA 3SBRA 3ZDXA 1N6FA 3VGZA 2OJYA 3C5MA 2CE8A 3FRXA 1SQ9A 3F3GA 1N6EA 4O2WA 3OKWA 1GOTB 2VZ1A 3PSCB 3IURA 3V9FA 4QT8A 4PSXB 3O4GA 4GM9A 4Y7RA 4J73A 2G99A 3K27A 4D0KA 1TYEA 3ODTA 2IUPA 3EQ7A 5C2VB 3AH8B 5AFU3 4AMZA 3IIWA 3PXWD 3DXMC 4H5IA 3ZE0A 4CY5A 2IAAA 3EI4A 3SWSD 5IC7A 1C9IA 5FLXg 4O3TB 4XYIA 1N6DA 4QQEA 4Y5RD 5C9ZB 4UM9A 1VE6A 3BG0A 4FA9D 2H14A 1U8CA 3NIDA 5CXBA 4J84A 2HYEA 5FKQA 3P4FA 3PE7A 3J80g 3K71A 3IVMA 3GREA 4CI3A 4FA4D 1QFMA 4X61B 2G9AA 3NVNA 3I7HA 4A08A 3I7LA 2QZPA 5FA5B 4AMYA 4NBMA 2HKMA 3JZGA 5TDHB 5GMKn 4JSXC 2I3SA 4PNKB 3EI2A 4GZ8A 2AGXA 5E6SA 4WJKA 5CXBB 3EU7A 2P9SC 1GXRA 4QAMA 4CI8A 3IJCA 5B4WA 5M5TA 4O3UB 2XE4A 3BWSA 1UOPA 2B5MA 2J55H 1BPOA 4UI9R 1UOOA 3GD1I 5CYKB 2B5LA 4CY2A 3JB9L 3EWEA 5IJ7E 3EMHA 4FAND 4J82A 2B4EA 3RSEC 3RRMC 2PBIB 3I7PA 4PC0A 4K3ID 4JXMA 4FA1D 4A0BB 5HDBA 1OLZA 4ZOXA 3OF7A 3EI1A 1GOGA 5IGQA 2HXCA 3N0DA 2H68A 5H14A 4BCDA 3UR4A 4A09B 2HKRA 3ULEC 1PBYB 3JZHA 4RE5A 4ZOYA 3PVWB 2VDKA 4YVDA 2VDNA 5C92A 4L1MA 2QXVA 2TRCB 4J77A 4N14A 4ZOVA 4NAAA 2W18A 3IUMA 5K19A 1A12A 4J79A 3UVNA 3IJEA 5EM2B 3NIFA 2J56H 3QHYB 4O45A 2Z2OA 3JROA 5I5JA 4L3GD 5C86A 2Z2NA 1U2VC 4TZ4A 1MDAH 2H13A 1Q47A 4JT5C 2OIZA 3MKQA 3VI3A 3IUJA 4JHPC 2XU7A 2H6KA 3IJ0A 5EMJB 4CY3A 3FGBA 5TF2A 4Z7QA 4J8GA 2Z2PA 3I7OA 4JSNC 2H47A 2VDQA 3RFGA 4OWRA 4UM8A 3NVQA 2PM6B 2EIEA 5H1MA 3V7DB 1VZ2A 4IRZA 2CO0C 3MXXA 2XL2A 3I89A 3BG1A 1H2XA 4CC9A 4GGDA 2CN3A 5IJ8E 4A2MA 3EI1B 1JV2A 4L9OA 1FWXA 1VZ3A 4BP9A 4EWRA 1K3IA 2P9IC 3I7KA 5FKTA 4A2LA 4JD2C 3PXSD 3SXTD 5KDOB 1ERJA 3SJLD 3DXKC 5CYKA 5FQDA 3EQ9A 1H2YA 1YR2A 3A0FA 4PSWB 3O4HA 2AH0A 5K1CC 1B9YA 1K8KC 1XHMA 5CXCB 3NVXA 5E6UA 1QNIA 4NC4A 1XKSA 3N0EA 2H9MA 4FWWA 4JSVC 3L4MD 4G56B 2YMUA 1JMZB 3DDUA 4LGNA 3T3MA 4WK4A 4GQ2P 2BBKH 3B7FA 4IA9A 4K3JB 4U1EI 2PM9A 1MG3A 3EI3B 4GMBA 4BUJC 2OVPB 3FCSA 3IUQA 5FFGA 2H3XA 3OKTA 4AOWA 4JT6C 2XL3A 3PSLA 2HJBA 5EALA 4GGCA 4Z7NA 2H9PA 3ZE2A 1GOHA 5I5MA 5HE0B 1T2XA 2HESX 3PVUB 2OVQB 3IKOA 3O4JA 4R7AB 5SXMA 3DM0A 4HDJA 1XIPA 2O9KA 4FAVD 3RFHA 1C9LA 4KFMB 2B5NA 2HJ4A 2VDRA 3MKSB 4IMMA 2MTAH 5A2Qg 3K6SA 2VC2A 5HE2B 4E54B 4BCCA 3RN1D 4GGAA 5TEEA 5HQGA 1P22A 1UTCA 3F3PA 4GM8A 4AX4A 3SVWD 3UVLA 3PXTD 1A0RB 3MUOA 4G55A 2P9KC 4A0AA 3VA6A 3C9CA 2J57G 3SBQA 3V4VA 3MZKA 3UVKA 4JHNA 3EI4B 5M5RA 3JPXA 5TEFA 4QRJA 5EAMA 1B9XA 3KCIA 3V5WB 2UZYB 5M61A 2H6NA 3IJ1A 5I5IA 1JTDB 2IUVA 3RMZD 4ES0A 2VZ3A 2IURA 4AEZA 5EARA 3I8EA 3EI2B 4D9SA 1L5GA 2VDLA 3MUNA 3SBPA 5M5UA 3EG6A 5HE3B 1PGUA 4O1QD 2OVRB 1O6FA 4Z8LA 3OL2A 3ZWLB 3E0CA 4CZXA 4FA5D 5EM2A 3MMYA 3K72A 2HU7A 4LG9A 2VDOA 3SHFA 2GC4A 1H2ZA 4E54A 4FHLA 4DNUA 4BH6A 3I2NA 2YB8B 2I3TA 4CY1A 3W15A 2H9NA 3IIYA 3FCUA 3O4IA 3OKYA 1NR0A 1JJUB 4J0WA 3MVDK 1GOFA 1SQJA 5IT9g 4X60B 4A11B 2P9UC 1MG2A 4RE6A 1VYHC 2CE9A 4WK2A 4GQ1A 3MZLA 3T3PA 2QC5A 5JWZA 2AGYA 1JMXB 4ZOZA 5H17A 4PBZA 4O02A 3J81g 4XEIC 4DNVA 1PEVA 4I79A 4AN0A 3VH0A 4ERQA 1S4UX 3OTTA 2XDWA 4D6VA 4FB1D 3AFCA 2XYIA 4CI2A 4J8BA 1E8MA 1VE7A 3FM0A 1E8NA 3I8CA 3GC3B 5E6RA 5CXCA 2BCJB 4GQBB 3DSMA 3OL2B 4A08B 3SFZA 4CI1A 3GFCA 4ESGA 4PBYA 4J86A 3UVOA 5GSAA 2IUQA 5EAPA 2BKLA 1O6GA 2OK4A 5GXHA 1H2WA 1QFSA 2QR5A 3CFSB 5EMLB 3IUNA 2GNQA 3HFQA 1K32A 2YBAA 4L3HD 4NSXA 3V4PA 3VI4A 4A7JA 4U7AA 4X63B 2AH1A 1U4CA 2P9LC 2UZXB 3NIGA 5FKRA 3C99A 1UOQA 4X3EA 4E5ZB 3IULA 2I0TA 4MMZA 4MMYA 4AN1A 2HU5A 2YNNA 5AMSA 4PXWA 3RN0D 4A0AB 5GXIA 2IWFA 4J81A 4XYHA 5AJAA 3ORVD 3RLMD 2AGLA 3QI0A 4A11A
chains in the Genus database with same CATH topology
3CIKB 5HE1B 3UKUC 1PI6A 5C2WB 4ERZA 5IGOA 4J87A 4H5JA 1JOFA 3DWLC 1RI6A 3SN6B 4J0XA 2P9PC 2AGZA 2OK6A 4GM3A 1NEXB 1YFQA 4CZVA 2CN2A 4MK0B 2YNOA 3AL8A 4QL1A 2AGWA 1TYQC 3JRPA 3SLED 2H9LA 3KRWB 2H6QA 3C75H 3JAMg 3KRXB 2I0RA 2PM7B 4O9DA 4JSPC 3SCYA 1OMWB 5FXYA 3OW8A 4A0BA 2I0SA 5HYNB 4A09A 1GG2B 3SMRA 5THAA 3I7NA 5EMMB 3K26A 4LG8A 5EMKB 2CO0A 4ERYA 3UKRC 2YNPA 1SHYB 4OZUA 2Q7QA 4BL0A 1TBGA 2GC7A 2PM9B 4E5ZA 3UVMA 3EI3A 3L4OD 5FKSA 2P9NC 1GP2B 4CZYA 2EBSA 3CFVA 3OKYB 3JZNA 2IWKA 2AQ5A 3AL8B 4L1QD 4J78A 1L0QA 4ZN4A 3U4YA 3AL9A 1R5MA 3F3FA 2CNXA 3SBRA 1N6FA 3VGZA 2OJYA 3C5MA 2CE8A 3FRXA 1SQ9A 3F3GA 1N6EA 3OKWA 1GOTB 3PSCB 3V9FA 4QT8A 4PSXB 4GM9A 4Y7RA 4J73A 2G99A 3K27A 4D0KA 3ODTA 2IUPA 5C2VB 3AH8B 5AFU3 3IIWA 3PXWD 3DXMC 4H5IA 4CY5A 2IAAA 3EI4A 3SWSD 5IC7A 5FLXg 4O3TB 4XYIA 1N6DA 4QQEA 4Y5RD 5C9ZB 3BG0A 4FA9D 2H14A 5CXBA 4J84A 2HYEA 5FKQA 3P4FA 3PE7A 3J80g 3GREA 4CI3A 4FA4D 4X61B 2G9AA 3NVNA 3I7HA 4A08A 3I7LA 5FA5B 2HKMA 3JZGA 5TDHB 5GMKn 4JSXC 2I3SA 4PNKB 3EI2A 4GZ8A 2AGXA 5CXBB 3EU7A 2P9SC 1GXRA 4CI8A 3IJCA 5B4WA 4O3UB 3BWSA 2B5MA 2J55H 4UI9R 5CYKB 3JB9L 2B5LA 4CY2A 3EWEA 5IJ7E 3EMHA 4FAND 4J82A 2B4EA 3RSEC 3RRMC 2PBIB 3I7PA 4PC0A 4K3ID 4JXMA 4FA1D 4A0BB 1OLZA 4ZOXA 3EI1A 5IGQA 2HXCA 3N0DA 2H68A 5H14A 3UR4A 4A09B 2HKRA 3ULEC 1PBYB 3JZHA 4ZOYA 3PVWB 4YVDA 2QXVA 2TRCB 4J77A 4N14A 4ZOVA 2W18A 5K19A 4J79A 3UVNA 5EM2B 2J56H 4O45A 2Z2OA 3JROA 5I5JA 4L3GD 2Z2NA 1U2VC 4TZ4A 1MDAH 2H13A 1Q47A 4JT5C 2OIZA 3MKQA 2XU7A 2H6KA 3IJ0A 5EMJB 4CY3A 3FGBA 5TF2A 4J8GA 2Z2PA 3I7OA 4JSNC 2H47A 3RFGA 4OWRA 3NVQA 2PM6B 5H1MA 3V7DB 2CO0C 3MXXA 2XL2A 3I89A 3BG1A 4CC9A 4GGDA 2CN3A 5IJ8E 4A2MA 3EI1B 4L9OA 1FWXA 4EWRA 2P9IC 3I7KA 5FKTA 4A2LA 4JD2C 3PXSD 3SXTD 5KDOB 1ERJA 3SJLD 3DXKC 5CYKA 5FQDA 3A0FA 4PSWB 2AH0A 5K1CC 1K8KC 1B9YA 1XHMA 5CXCB 3NVXA 1QNIA 1XKSA 3N0EA 2H9MA 4FWWA 4JSVC 3L4MD 4G56B 2YMUA 1JMZB 4LGNA 4GQ2P 2BBKH 3B7FA 4IA9A 4K3JB 4U1EI 2PM9A 1MG3A 3EI3B 4GMBA 4BUJC 2OVPB 2H3XA 3OKTA 4AOWA 4JT6C 2XL3A 3PSLA 2HJBA 5EALA 4GGCA 2H9PA 5I5MA 5HE0B 2HESX 3PVUB 2OVQB 3IKOA 4R7AB 5SXMA 3DM0A 4HDJA 1XIPA 2O9KA 4FAVD 3RFHA 4KFMB 2B5NA 2HJ4A 3MKSB 4IMMA 2MTAH 5A2Qg 5HE2B 4E54B 3RN1D 4GGAA 5TEEA 5HQGA 1P22A 3F3PA 4GM8A 3SVWD 3UVLA 3PXTD 1A0RB 2P9KC 4A0AA 3VA6A 3C9CA 2J57G 3SBQA 3MZKA 3UVKA 3EI4B 3JPXA 5TEFA 4QRJA 5EAMA 1B9XA 3V5WB 2UZYB 2H6NA 3IJ1A 5I5IA 2IUVA 4ES0A 3RMZD 2IURA 4AEZA 5EARA 3I8EA 3EI2B 3SBPA 3EG6A 5HE3B 1PGUA 4O1QD 2OVRB 4Z8LA 3OL2A 3ZWLB 3E0CA 4CZXA 4FA5D 5EM2A 3MMYA 4LG9A 3SHFA 2GC4A 4E54A 4FHLA 4BH6A 3I2NA 2YB8B 2I3TA 4CY1A 3W15A 2H9NA 3IIYA 3OKYA 1NR0A 1JJUB 4J0WA 1SQJA 5IT9g 4X60B 4A11B 2P9UC 1MG2A 1VYHC 2CE9A 4GQ1A 3MZLA 2QC5A 5JWZA 2AGYA 1JMXB 4ZOZA 5H17A 4PBZA 3J81g 4XEIC 1PEVA 4I79A 3VH0A 4ERQA 1S4UX 3OTTA 4D6VA 4FB1D 3AFCA 2XYIA 4CI2A 4J8BA 3FM0A 3I8CA 5CXCA 2BCJB 4GQBB 3DSMA 3OL2B 4A08B 3SFZA 4CI1A 3GFCA 4ESGA 4PBYA 4J86A 3UVOA 5GSAA 2IUQA 5EAPA 5GXHA 2OK4A 3CFSB 5EMLB 2GNQA 3HFQA 1K32A 2YBAA 4L3HD 4NSXA 4A7JA 4U7AA 4X63B 2AH1A 1U4CA 2P9LC 2UZXB 5FKRA 4E5ZB 3C99A 4X3EA 2I0TA 2YNNA 5AMSA 4PXWA 3RN0D 4A0AB 5GXIA 2IWFA 4J81A 4XYHA 5AJAA 3ORVD 3RLMD 2AGLA 4A11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIK B;  5HE1 B;  3UKU C;  1PI6 A;  5C2W B;  4ERZ A;  5IGO A;  4J87 A;  4H5J A;  1JOF A;  3DWL C;  1RI6 A;  3SN6 B;  4J0X A;  2P9P C;  2AGZ A;  2OK6 A;  4GM3 A;  1NEX B;  1YFQ A;  4CZV A;  2CN2 A;  4MK0 B;  2YNO A;  3AL8 A;  4QL1 A;  2AGW A;  1TYQ C;  3JRP A;  3SLE D;  2H9L A;  3KRW B;  2H6Q A;  3C75 H;  3JAM g;  3KRX B;  2I0R A;  2PM7 B;  4O9D A;  4JSP C;  3SCY A;  1OMW B;  5FXY A;  3OW8 A;  4A0B A;  2I0S A;  5HYN B;  4A09 A;  1GG2 B;  3SMR A;  5THA A;  3I7N A;  5EMM B;  3K26 A;  4LG8 A;  5EMK B;  2CO0 A;  4ERY A;  3UKR C;  2YNP A;  1SHY B;  4OZU A;  2Q7Q A;  4BL0 A;  1TBG A;  2GC7 A;  2PM9 B;  4E5Z A;  3UVM A;  3EI3 A;  3L4O D;  5FKS A;  2P9N C;  1GP2 B;  4CZY A;  2EBS A;  3CFV A;  3OKY B;  3JZN A;  2IWK A;  2AQ5 A;  3AL8 B;  4L1Q D;  4J78 A;  1L0Q A;  4ZN4 A;  3U4Y A;  3AL9 A;  1R5M A;  3F3F A;  2CNX A;  3SBR A;  1N6F A;  3VGZ A;  2OJY A;  3C5M A;  2CE8 A;  3FRX A;  1SQ9 A;  3F3G A;  1N6E A;  3OKW A;  1GOT B;  3PSC B;  3V9F A;  4QT8 A;  4PSX B;  4GM9 A;  4Y7R A;  4J73 A;  2G99 A;  3K27 A;  4D0K A;  3ODT A;  2IUP A;  5C2V B;  3AH8 B;  5AFU 3;  3IIW A;  3PXW D;  3DXM C;  4H5I A;  4CY5 A;  2IAA A;  3EI4 A;  3SWS D;  5IC7 A;  5FLX g;  4O3T B;  4XYI A;  1N6D A;  4QQE A;  4Y5R D;  5C9Z B;  3BG0 A;  4FA9 D;  2H14 A;  5CXB A;  4J84 A;  2HYE A;  5FKQ A;  3P4F A;  3PE7 A;  3J80 g;  3GRE A;  4CI3 A;  4FA4 D;  4X61 B;  2G9A A;  3NVN A;  3I7H A;  4A08 A;  3I7L A;  5FA5 B;  2HKM A;  3JZG A;  5TDH B;  5GMK n;  4JSX C;  2I3S A;  4PNK B;  3EI2 A;  4GZ8 A;  2AGX A;  5CXB B;  3EU7 A;  2P9S C;  1GXR A;  4CI8 A;  3IJC A;  5B4W A;  4O3U B;  3BWS A;  2B5M A;  2J55 H;  4UI9 R;  5CYK B;  3JB9 L;  2B5L A;  4CY2 A;  3EWE A;  5IJ7 E;  3EMH A;  4FAN D;  4J82 A;  2B4E A;  3RSE C;  3RRM C;  2PBI B;  3I7P A;  4PC0 A;  4K3I D;  4JXM A;  4FA1 D;  4A0B B;  1OLZ A;  4ZOX A;  3EI1 A;  5IGQ A;  2HXC A;  3N0D A;  2H68 A;  5H14 A;  3UR4 A;  4A09 B;  2HKR A;  3ULE C;  1PBY B;  3JZH A;  4ZOY A;  3PVW B;  4YVD A;  2QXV A;  2TRC B;  4J77 A;  4N14 A;  4ZOV A;  2W18 A;  5K19 A;  4J79 A;  3UVN A;  5EM2 B;  2J56 H;  4O45 A;  2Z2O A;  3JRO A;  5I5J A;  4L3G D;  2Z2N A;  1U2V C;  4TZ4 A;  1MDA H;  2H13 A;  1Q47 A;  4JT5 C;  2OIZ A;  3MKQ A;  2XU7 A;  2H6K A;  3IJ0 A;  5EMJ B;  4CY3 A;  3FGB A;  5TF2 A;  4J8G A;  2Z2P A;  3I7O A;  4JSN C;  2H47 A;  3RFG A;  4OWR A;  3NVQ A;  2PM6 B;  5H1M A;  3V7D B;  2CO0 C;  3MXX A;  2XL2 A;  3I89 A;  3BG1 A;  4CC9 A;  4GGD A;  2CN3 A;  5IJ8 E;  4A2M A;  3EI1 B;  4L9O A;  1FWX A;  4EWR A;  2P9I C;  3I7K A;  5FKT A;  4A2L A;  4JD2 C;  3PXS D;  3SXT D;  5KDO B;  1ERJ A;  3SJL D;  3DXK C;  5CYK A;  5FQD A;  3A0F A;  4PSW B;  2AH0 A;  5K1C C;  1K8K C;  1B9Y A;  1XHM A;  5CXC B;  3NVX A;  1QNI A;  1XKS A;  3N0E A;  2H9M A;  4FWW A;  4JSV C;  3L4M D;  4G56 B;  2YMU A;  1JMZ B;  4LGN A;  4GQ2 P;  2BBK H;  3B7F A;  4IA9 A;  4K3J B;  4U1E I;  2PM9 A;  1MG3 A;  3EI3 B;  4GMB A;  4BUJ C;  2OVP B;  2H3X A;  3OKT A;  4AOW A;  4JT6 C;  2XL3 A;  3PSL A;  2HJB A;  5EAL A;  4GGC A;  2H9P A;  5I5M A;  5HE0 B;  2HES X;  3PVU B;  2OVQ B;  3IKO A;  4R7A B;  5SXM A;  3DM0 A;  4HDJ A;  1XIP A;  2O9K A;  4FAV D;  3RFH A;  4KFM B;  2B5N A;  2HJ4 A;  3MKS B;  4IMM A;  2MTA H;  5A2Q g;  5HE2 B;  4E54 B;  3RN1 D;  4GGA A;  5TEE A;  5HQG A;  1P22 A;  3F3P A;  4GM8 A;  3SVW D;  3UVL A;  3PXT D;  1A0R B;  2P9K C;  4A0A A;  3VA6 A;  3C9C A;  2J57 G;  3SBQ A;  3MZK A;  3UVK A;  3EI4 B;  3JPX A;  5TEF A;  4QRJ A;  5EAM A;  1B9X A;  3V5W B;  2UZY B;  2H6N A;  3IJ1 A;  5I5I A;  2IUV A;  4ES0 A;  3RMZ D;  2IUR A;  4AEZ A;  5EAR A;  3I8E A;  3EI2 B;  3SBP A;  3EG6 A;  5HE3 B;  1PGU A;  4O1Q D;  2OVR B;  4Z8L A;  3OL2 A;  3ZWL B;  3E0C A;  4CZX A;  4FA5 D;  5EM2 A;  3MMY A;  4LG9 A;  3SHF A;  2GC4 A;  4E54 A;  4FHL A;  4BH6 A;  3I2N A;  2YB8 B;  2I3T A;  4CY1 A;  3W15 A;  2H9N A;  3IIY A;  3OKY A;  1NR0 A;  1JJU B;  4J0W A;  1SQJ A;  5IT9 g;  4X60 B;  4A11 B;  2P9U C;  1MG2 A;  1VYH C;  2CE9 A;  4GQ1 A;  3MZL A;  2QC5 A;  5JWZ A;  2AGY A;  1JMX B;  4ZOZ A;  5H17 A;  4PBZ A;  3J81 g;  4XEI C;  1PEV A;  4I79 A;  3VH0 A;  4ERQ A;  1S4U X;  3OTT A;  4D6V A;  4FB1 D;  3AFC A;  2XYI A;  4CI2 A;  4J8B A;  3FM0 A;  3I8C A;  5CXC A;  2BCJ B;  4GQB B;  3DSM A;  3OL2 B;  4A08 B;  3SFZ A;  4CI1 A;  3GFC A;  4ESG A;  4PBY A;  4J86 A;  3UVO A;  5GSA A;  2IUQ A;  5EAP A;  5GXH A;  2OK4 A;  3CFS B;  5EML B;  2GNQ A;  3HFQ A;  1K32 A;  2YBA A;  4L3H D;  4NSX A;  4A7J A;  4U7A A;  4X63 B;  2AH1 A;  1U4C A;  2P9L C;  2UZX B;  5FKR A;  4E5Z B;  3C99 A;  4X3E A;  2I0T A;  2YNN A;  5AMS A;  4PXW A;  3RN0 D;  4A0A B;  5GXI A;  2IWF A;  4J81 A;  4XYH A;  5AJA A;  3ORV D;  3RLM D;  2AGL A;  4A11 A; 
#chains in the Genus database with same CATH topology
 3CIK B;  5HE1 B;  3UKU C;  3ZDZ A;  1PI6 A;  5C2W B;  4ERZ A;  5IGO A;  4J87 A;  4H5J A;  1JOF A;  5M5S A;  4WK0 A;  3DWL C;  1RI6 A;  3SN6 B;  1E5T A;  4J0X A;  2P9P C;  3EQ8 A;  2AGZ A;  2OK6 A;  4GM3 A;  1NEX B;  1YFQ A;  5FFO A;  4CZV A;  2CN2 A;  2EID A;  4MK0 B;  4BCB A;  3ZDY A;  2JKX A;  1M1X A;  2YNO A;  3AL8 A;  4QL1 A;  2AGW A;  1TYQ C;  3JRP A;  4NEN A;  3SLE D;  2H9L A;  4G1M A;  3KRW B;  5M5V A;  2H6Q A;  3C75 H;  3JAM g;  3KRX B;  2I0R A;  2PM7 B;  2WQ8 A;  4O9D A;  4JSP C;  3SCY A;  1OMW B;  4BP8 A;  2VDP A;  5FXY A;  3OW8 A;  4A0B A;  2I0S A;  5HYN B;  4A09 A;  1GG2 B;  4G1E A;  4DNW A;  3SMR A;  4MMX A;  5THA A;  3I7N A;  4Z7O A;  5EMM B;  3K26 A;  4LG8 A;  5EMK B;  1I2M B;  2CO0 A;  4ERY A;  3UKR C;  2YNP A;  1SHY B;  4OZU A;  2Q7Q A;  4BL0 A;  1TBG A;  3ZE1 A;  2GC7 A;  2PM9 B;  2VDM A;  4E5Z A;  2EIC A;  2HU8 A;  3UVM A;  3EI3 A;  3L4O D;  5FKS A;  2P9N C;  1GP2 B;  4CZY A;  2EBS A;  3CFV A;  3OKY B;  2XZG A;  3JZN A;  2IWK A;  2AQ5 A;  3AL8 B;  4L1Q D;  2EIB A;  4J78 A;  1L0Q A;  4ZN4 A;  3U4Y A;  3AL9 A;  1R5M A;  3F3F A;  2CNX A;  3SBR A;  3ZDX A;  1N6F A;  3VGZ A;  2OJY A;  3C5M A;  2CE8 A;  3FRX A;  1SQ9 A;  3F3G A;  1N6E A;  4O2W A;  3OKW A;  1GOT B;  2VZ1 A;  3PSC B;  3IUR A;  3V9F A;  4QT8 A;  4PSX B;  3O4G A;  4GM9 A;  4Y7R A;  4J73 A;  2G99 A;  3K27 A;  4D0K A;  1TYE A;  3ODT A;  2IUP A;  3EQ7 A;  5C2V B;  3AH8 B;  5AFU 3;  4AMZ A;  3IIW A;  3PXW D;  3DXM C;  4H5I A;  3ZE0 A;  4CY5 A;  2IAA A;  3EI4 A;  3SWS D;  5IC7 A;  1C9I A;  5FLX g;  4O3T B;  4XYI A;  1N6D A;  4QQE A;  4Y5R D;  5C9Z B;  4UM9 A;  1VE6 A;  3BG0 A;  4FA9 D;  2H14 A;  1U8C A;  3NID A;  5CXB A;  4J84 A;  2HYE A;  5FKQ A;  3P4F A;  3PE7 A;  3J80 g;  3K71 A;  3IVM A;  3GRE A;  4CI3 A;  4FA4 D;  1QFM A;  4X61 B;  2G9A A;  3NVN A;  3I7H A;  4A08 A;  3I7L A;  2QZP A;  5FA5 B;  4AMY A;  4NBM A;  2HKM A;  3JZG A;  5TDH B;  5GMK n;  4JSX C;  2I3S A;  4PNK B;  3EI2 A;  4GZ8 A;  2AGX A;  5E6S A;  4WJK A;  5CXB B;  3EU7 A;  2P9S C;  1GXR A;  4QAM A;  4CI8 A;  3IJC A;  5B4W A;  5M5T A;  4O3U B;  2XE4 A;  3BWS A;  1UOP A;  2B5M A;  2J55 H;  1BPO A;  4UI9 R;  1UOO A;  3GD1 I;  5CYK B;  2B5L A;  4CY2 A;  3JB9 L;  3EWE A;  5IJ7 E;  3EMH A;  4FAN D;  4J82 A;  2B4E A;  3RSE C;  3RRM C;  2PBI B;  3I7P A;  4PC0 A;  4K3I D;  4JXM A;  4FA1 D;  4A0B B;  5HDB A;  1OLZ A;  4ZOX A;  3OF7 A;  3EI1 A;  1GOG A;  5IGQ A;  2HXC A;  3N0D A;  2H68 A;  5H14 A;  4BCD A;  3UR4 A;  4A09 B;  2HKR A;  3ULE C;  1PBY B;  3JZH A;  4RE5 A;  4ZOY A;  3PVW B;  2VDK A;  4YVD A;  2VDN A;  5C92 A;  4L1M A;  2QXV A;  2TRC B;  4J77 A;  4N14 A;  4ZOV A;  4NAA A;  2W18 A;  3IUM A;  5K19 A;  1A12 A;  4J79 A;  3UVN A;  3IJE A;  5EM2 B;  3NIF A;  2J56 H;  3QHY B;  4O45 A;  2Z2O A;  3JRO A;  5I5J A;  4L3G D;  5C86 A;  2Z2N A;  1U2V C;  4TZ4 A;  1MDA H;  2H13 A;  1Q47 A;  4JT5 C;  2OIZ A;  3MKQ A;  3VI3 A;  3IUJ A;  4JHP C;  2XU7 A;  2H6K A;  3IJ0 A;  5EMJ B;  4CY3 A;  3FGB A;  5TF2 A;  4Z7Q A;  4J8G A;  2Z2P A;  3I7O A;  4JSN C;  2H47 A;  2VDQ A;  3RFG A;  4OWR A;  4UM8 A;  3NVQ A;  2PM6 B;  2EIE A;  5H1M A;  3V7D B;  1VZ2 A;  4IRZ A;  2CO0 C;  3MXX A;  2XL2 A;  3I89 A;  3BG1 A;  1H2X A;  4CC9 A;  4GGD A;  2CN3 A;  5IJ8 E;  4A2M A;  3EI1 B;  1JV2 A;  4L9O A;  1FWX A;  1VZ3 A;  4BP9 A;  4EWR A;  1K3I A;  2P9I C;  3I7K A;  5FKT A;  4A2L A;  4JD2 C;  3PXS D;  3SXT D;  5KDO B;  1ERJ A;  3SJL D;  3DXK C;  5CYK A;  5FQD A;  3EQ9 A;  1H2Y A;  1YR2 A;  3A0F A;  4PSW B;  3O4H A;  2AH0 A;  5K1C C;  1B9Y A;  1K8K C;  1XHM A;  5CXC B;  3NVX A;  5E6U A;  1QNI A;  4NC4 A;  1XKS A;  3N0E A;  2H9M A;  4FWW A;  4JSV C;  3L4M D;  4G56 B;  2YMU A;  1JMZ B;  3DDU A;  4LGN A;  3T3M A;  4WK4 A;  4GQ2 P;  2BBK H;  3B7F A;  4IA9 A;  4K3J B;  4U1E I;  2PM9 A;  1MG3 A;  3EI3 B;  4GMB A;  4BUJ C;  2OVP B;  3FCS A;  3IUQ A;  5FFG A;  2H3X A;  3OKT A;  4AOW A;  4JT6 C;  2XL3 A;  3PSL A;  2HJB A;  5EAL A;  4GGC A;  4Z7N A;  2H9P A;  3ZE2 A;  1GOH A;  5I5M A;  5HE0 B;  1T2X A;  2HES X;  3PVU B;  2OVQ B;  3IKO A;  3O4J A;  4R7A B;  5SXM A;  3DM0 A;  4HDJ A;  1XIP A;  2O9K A;  4FAV D;  3RFH A;  1C9L A;  4KFM B;  2B5N A;  2HJ4 A;  2VDR A;  3MKS B;  4IMM A;  2MTA H;  5A2Q g;  3K6S A;  2VC2 A;  5HE2 B;  4E54 B;  4BCC A;  3RN1 D;  4GGA A;  5TEE A;  5HQG A;  1P22 A;  1UTC A;  3F3P A;  4GM8 A;  4AX4 A;  3SVW D;  3UVL A;  3PXT D;  1A0R B;  3MUO A;  4G55 A;  2P9K C;  4A0A A;  3VA6 A;  3C9C A;  2J57 G;  3SBQ A;  3V4V A;  3MZK A;  3UVK A;  4JHN A;  3EI4 B;  5M5R A;  3JPX A;  5TEF A;  4QRJ A;  5EAM A;  1B9X A;  3KCI A;  3V5W B;  2UZY B;  5M61 A;  2H6N A;  3IJ1 A;  5I5I A;  1JTD B;  2IUV A;  3RMZ D;  4ES0 A;  2VZ3 A;  2IUR A;  4AEZ A;  5EAR A;  3I8E A;  3EI2 B;  4D9S A;  1L5G A;  2VDL A;  3MUN A;  3SBP A;  5M5U A;  3EG6 A;  5HE3 B;  1PGU A;  4O1Q D;  2OVR B;  1O6F A;  4Z8L A;  3OL2 A;  3ZWL B;  3E0C A;  4CZX A;  4FA5 D;  5EM2 A;  3MMY A;  3K72 A;  2HU7 A;  4LG9 A;  2VDO A;  3SHF A;  2GC4 A;  1H2Z A;  4E54 A;  4FHL A;  4DNU A;  4BH6 A;  3I2N A;  2YB8 B;  2I3T A;  4CY1 A;  3W15 A;  2H9N A;  3IIY A;  3FCU A;  3O4I A;  3OKY A;  1NR0 A;  1JJU B;  4J0W A;  3MVD K;  1GOF A;  1SQJ A;  5IT9 g;  4X60 B;  4A11 B;  2P9U C;  1MG2 A;  4RE6 A;  1VYH C;  2CE9 A;  4WK2 A;  4GQ1 A;  3MZL A;  3T3P A;  2QC5 A;  5JWZ A;  2AGY A;  1JMX B;  4ZOZ A;  5H17 A;  4PBZ A;  4O02 A;  3J81 g;  4XEI C;  4DNV A;  1PEV A;  4I79 A;  4AN0 A;  3VH0 A;  4ERQ A;  1S4U X;  3OTT A;  2XDW A;  4D6V A;  4FB1 D;  3AFC A;  2XYI A;  4CI2 A;  4J8B A;  1E8M A;  1VE7 A;  3FM0 A;  1E8N A;  3I8C A;  3GC3 B;  5E6R A;  5CXC A;  2BCJ B;  4GQB B;  3DSM A;  3OL2 B;  4A08 B;  3SFZ A;  4CI1 A;  3GFC A;  4ESG A;  4PBY A;  4J86 A;  3UVO A;  5GSA A;  2IUQ A;  5EAP A;  2BKL A;  1O6G A;  2OK4 A;  5GXH A;  1H2W A;  1QFS A;  2QR5 A;  3CFS B;  5EML B;  3IUN A;  2GNQ A;  3HFQ A;  1K32 A;  2YBA A;  4L3H D;  4NSX A;  3V4P A;  3VI4 A;  4A7J A;  4U7A A;  4X63 B;  2AH1 A;  1U4C A;  2P9L C;  2UZX B;  3NIG A;  5FKR A;  3C99 A;  1UOQ A;  4X3E A;  4E5Z B;  3IUL A;  2I0T A;  4MMZ A;  4MMY A;  4AN1 A;  2HU5 A;  2YNN A;  5AMS A;  4PXW A;  3RN0 D;  4A0A B;  5GXI A;  2IWF A;  4J81 A;  4XYH A;  5AJA A;  3ORV D;  3RLM D;  2AGL A;  3QI0 A;  4A11 A; 
#chains in the Genus database with same CATH homology
 3CIK B;  5HE1 B;  3UKU C;  1PI6 A;  5C2W B;  4ERZ A;  5IGO A;  4J87 A;  4H5J A;  1JOF A;  3DWL C;  1RI6 A;  3SN6 B;  4J0X A;  2P9P C;  2AGZ A;  2OK6 A;  4GM3 A;  1NEX B;  1YFQ A;  4CZV A;  2CN2 A;  4MK0 B;  2YNO A;  3AL8 A;  4QL1 A;  2AGW A;  1TYQ C;  3JRP A;  3SLE D;  2H9L A;  3KRW B;  2H6Q A;  3C75 H;  3JAM g;  3KRX B;  2I0R A;  2PM7 B;  4O9D A;  4JSP C;  3SCY A;  1OMW B;  5FXY A;  3OW8 A;  4A0B A;  2I0S A;  5HYN B;  4A09 A;  1GG2 B;  3SMR A;  5THA A;  3I7N A;  5EMM B;  3K26 A;  4LG8 A;  5EMK B;  2CO0 A;  4ERY A;  3UKR C;  2YNP A;  1SHY B;  4OZU A;  2Q7Q A;  4BL0 A;  1TBG A;  2GC7 A;  2PM9 B;  4E5Z A;  3UVM A;  3EI3 A;  3L4O D;  5FKS A;  2P9N C;  1GP2 B;  4CZY A;  2EBS A;  3CFV A;  3OKY B;  3JZN A;  2IWK A;  2AQ5 A;  3AL8 B;  4L1Q D;  4J78 A;  1L0Q A;  4ZN4 A;  3U4Y A;  3AL9 A;  1R5M A;  3F3F A;  2CNX A;  3SBR A;  1N6F A;  3VGZ A;  2OJY A;  3C5M A;  2CE8 A;  3FRX A;  1SQ9 A;  3F3G A;  1N6E A;  3OKW A;  1GOT B;  3PSC B;  3V9F A;  4QT8 A;  4PSX B;  4GM9 A;  4Y7R A;  4J73 A;  2G99 A;  3K27 A;  4D0K A;  3ODT A;  2IUP A;  5C2V B;  3AH8 B;  5AFU 3;  3IIW A;  3PXW D;  3DXM C;  4H5I A;  4CY5 A;  2IAA A;  3EI4 A;  3SWS D;  5IC7 A;  5FLX g;  4O3T B;  4XYI A;  1N6D A;  4QQE A;  4Y5R D;  5C9Z B;  3BG0 A;  4FA9 D;  2H14 A;  5CXB A;  4J84 A;  2HYE A;  5FKQ A;  3P4F A;  3PE7 A;  3J80 g;  3GRE A;  4CI3 A;  4FA4 D;  4X61 B;  2G9A A;  3NVN A;  3I7H A;  4A08 A;  3I7L A;  5FA5 B;  2HKM A;  3JZG A;  5TDH B;  5GMK n;  4JSX C;  2I3S A;  4PNK B;  3EI2 A;  4GZ8 A;  2AGX A;  5CXB B;  3EU7 A;  2P9S C;  1GXR A;  4CI8 A;  3IJC A;  5B4W A;  4O3U B;  3BWS A;  2B5M A;  2J55 H;  4UI9 R;  5CYK B;  3JB9 L;  2B5L A;  4CY2 A;  3EWE A;  5IJ7 E;  3EMH A;  4FAN D;  4J82 A;  2B4E A;  3RSE C;  3RRM C;  2PBI B;  3I7P A;  4PC0 A;  4K3I D;  4JXM A;  4FA1 D;  4A0B B;  1OLZ A;  4ZOX A;  3EI1 A;  5IGQ A;  2HXC A;  3N0D A;  2H68 A;  5H14 A;  3UR4 A;  4A09 B;  2HKR A;  3ULE C;  1PBY B;  3JZH A;  4ZOY A;  3PVW B;  4YVD A;  2QXV A;  2TRC B;  4J77 A;  4N14 A;  4ZOV A;  2W18 A;  5K19 A;  4J79 A;  3UVN A;  5EM2 B;  2J56 H;  4O45 A;  2Z2O A;  3JRO A;  5I5J A;  4L3G D;  2Z2N A;  1U2V C;  4TZ4 A;  1MDA H;  2H13 A;  1Q47 A;  4JT5 C;  2OIZ A;  3MKQ A;  2XU7 A;  2H6K A;  3IJ0 A;  5EMJ B;  4CY3 A;  3FGB A;  5TF2 A;  4J8G A;  2Z2P A;  3I7O A;  4JSN C;  2H47 A;  3RFG A;  4OWR A;  3NVQ A;  2PM6 B;  5H1M A;  3V7D B;  2CO0 C;  3MXX A;  2XL2 A;  3I89 A;  3BG1 A;  4CC9 A;  4GGD A;  2CN3 A;  5IJ8 E;  4A2M A;  3EI1 B;  4L9O A;  1FWX A;  4EWR A;  2P9I C;  3I7K A;  5FKT A;  4A2L A;  4JD2 C;  3PXS D;  3SXT D;  5KDO B;  1ERJ A;  3SJL D;  3DXK C;  5CYK A;  5FQD A;  3A0F A;  4PSW B;  2AH0 A;  5K1C C;  1K8K C;  1B9Y A;  1XHM A;  5CXC B;  3NVX A;  1QNI A;  1XKS A;  3N0E A;  2H9M A;  4FWW A;  4JSV C;  3L4M D;  4G56 B;  2YMU A;  1JMZ B;  4LGN A;  4GQ2 P;  2BBK H;  3B7F A;  4IA9 A;  4K3J B;  4U1E I;  2PM9 A;  1MG3 A;  3EI3 B;  4GMB A;  4BUJ C;  2OVP B;  2H3X A;  3OKT A;  4AOW A;  4JT6 C;  2XL3 A;  3PSL A;  2HJB A;  5EAL A;  4GGC A;  2H9P A;  5I5M A;  5HE0 B;  2HES X;  3PVU B;  2OVQ B;  3IKO A;  4R7A B;  5SXM A;  3DM0 A;  4HDJ A;  1XIP A;  2O9K A;  4FAV D;  3RFH A;  4KFM B;  2B5N A;  2HJ4 A;  3MKS B;  4IMM A;  2MTA H;  5A2Q g;  5HE2 B;  4E54 B;  3RN1 D;  4GGA A;  5TEE A;  5HQG A;  1P22 A;  3F3P A;  4GM8 A;  3SVW D;  3UVL A;  3PXT D;  1A0R B;  2P9K C;  4A0A A;  3VA6 A;  3C9C A;  2J57 G;  3SBQ A;  3MZK A;  3UVK A;  3EI4 B;  3JPX A;  5TEF A;  4QRJ A;  5EAM A;  1B9X A;  3V5W B;  2UZY B;  2H6N A;  3IJ1 A;  5I5I A;  2IUV A;  4ES0 A;  3RMZ D;  2IUR A;  4AEZ A;  5EAR A;  3I8E A;  3EI2 B;  3SBP A;  3EG6 A;  5HE3 B;  1PGU A;  4O1Q D;  2OVR B;  4Z8L A;  3OL2 A;  3ZWL B;  3E0C A;  4CZX A;  4FA5 D;  5EM2 A;  3MMY A;  4LG9 A;  3SHF A;  2GC4 A;  4E54 A;  4FHL A;  4BH6 A;  3I2N A;  2YB8 B;  2I3T A;  4CY1 A;  3W15 A;  2H9N A;  3IIY A;  3OKY A;  1NR0 A;  1JJU B;  4J0W A;  1SQJ A;  5IT9 g;  4X60 B;  4A11 B;  2P9U C;  1MG2 A;  1VYH C;  2CE9 A;  4GQ1 A;  3MZL A;  2QC5 A;  5JWZ A;  2AGY A;  1JMX B;  4ZOZ A;  5H17 A;  4PBZ A;  3J81 g;  4XEI C;  1PEV A;  4I79 A;  3VH0 A;  4ERQ A;  1S4U X;  3OTT A;  4D6V A;  4FB1 D;  3AFC A;  2XYI A;  4CI2 A;  4J8B A;  3FM0 A;  3I8C A;  5CXC A;  2BCJ B;  4GQB B;  3DSM A;  3OL2 B;  4A08 B;  3SFZ A;  4CI1 A;  3GFC A;  4ESG A;  4PBY A;  4J86 A;  3UVO A;  5GSA A;  2IUQ A;  5EAP A;  5GXH A;  2OK4 A;  3CFS B;  5EML B;  2GNQ A;  3HFQ A;  1K32 A;  2YBA A;  4L3H D;  4NSX A;  4A7J A;  4U7A A;  4X63 B;  2AH1 A;  1U4C A;  2P9L C;  2UZX B;  5FKR A;  4E5Z B;  3C99 A;  4X3E A;  2I0T A;  2YNN A;  5AMS A;  4PXW A;  3RN0 D;  4A0A B;  5GXI A;  2IWF A;  4J81 A;  4XYH A;  5AJA A;  3ORV D;  3RLM D;  2AGL A;  4A11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...