4CZYA

Complex of neurospora crassa pan2 (wd40-cs1) with pan3 (pseudokinase and c-term)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
323
structure length
323
Chain Sequence
HMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Gene regulation
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
total genus 80
structure length 323
sequence length 323
chains with identical sequence C
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czyA00
5AJAA 2HJBA 4GQ1A 4U1EI 4XEIC 3VGZA 1XKSA 4J86A 3CFSB 2BCJB 4IA9A 4XYIA 4UI9R 5FLXg 2Z2OA 3I89A 2B4EA 2H13A 2I3SA 4FAVD 4G56B 4O1QD 4A09A 2H9PA 3SFZA 5JWZA 4GGDA 3IJ0A 3PVUB 2IUPA 3MXXA 3ORVD 5IGQA 5IT9g 3J80g 3F3GA 3UKRC 1PI6A 3I7OA 1VYHC 3KRXB 3RRMC 5C9ZB 1XHMA 4JT6C 2AGYA 2XL2A 5HYNB 4J79A 3RFHA 5TDHB 1K8KC 3B7FA 5K1CC 4N14A 4ES0A 5TEFA 4U7AA 3RSEC 1FWXA 2HKMA 4J81A 4K3ID 2HESX 3I7LA 5C2VB 3KRWB 4A2MA 4JT5C 4O9DA 3FGBA 4A0AB 3BG0A 4GQ2P 4A0AA 3C9CA 4J0XA 3CIKB 5HE1B 3NVQA 3V7DB 1MG3A 4CY2A 3JPXA 1U2VC 4CI2A 4GGAA 4O45A 5TF2A 3DXKC 4A08B 2PM9A 3C5MA 4ERZA 2P9IC 2J57G 4H5IA 4X3EA 1N6EA 2AQ5A 3EI2B 2OVRB 3HFQA 4J8GA 3OKTA 4FAND 4CY1A 3I7KA 4CI8A 2YB8B 3AFCA 4L3HD 3SN6B 2UZXB 3JB9L 5EM2B 2I3TA 3PXTD 4EWRA 3A0FA 4GMBA 5GSAA 5AMSA 5EAMA 3EU7A 4CY3A 2Z2PA 1B9XA 2HXCA 1PBYB 4PXWA 2H9MA 2P9UC 4GM9A 2CN2A 2AH1A 5THAA 3RN0D 4FB1D 4CI1A 1TBGA 4H5JA 5CYKB 2GC7A 4FHLA 3SVWD 4E54A 2IWFA 2CNXA 4PSWB 4QRJA 4A09B 4J87A 2AGWA 4JSNC 2OJYA 4D0KA 1YFQA 3ULEC 3PE7A 5CXBA 1SQ9A 5IGOA 5EMKB 3SWSD 3PSLA 3JZNA 5EM2A 1JJUB 1GG2B 2YNOA 4CC9A 1NR0A 2GNQA 4J73A 4J0WA 3SBQA 2B5MA 3P4FA 1MG2A 3UKUC 5EARA 2XYIA 2P9PC 2H6KA 2CO0A 4D6VA 2OIZA 4GQBB 2H68A 2P9NC 4ERYA 4E5ZB 4PSXB 5FKQA 1ERJA 2GC4A 3UVLA 4L9OA 4JXMA 5CXCA 2W18A 3SJLD 3ZWLB 5GXHA 4X61B 5IC7A 2OVPB 5HE2B 3F3PA 4OWRA 4J82A 2CN3A 1U4CA 1S4UX 3AL8A 3UVMA 3EI3A 3OW8A 4CZYA 2TRCB 3RLMD 3IIYA 5CXBB 5B4WA 1K32A 4A08A 1R5MA 3I7NA 3W15A 3J81g 1Q47A 2P9SC 5EMJB 3MKSB 4LG9A 1N6FA 3EI4B 3E0CA 3I8CA 3UVKA 2P9LC 3C99A 3MKQA 4I79A 2XL3A 2H6NA 3F3FA 4Y7RA 2H6QA 2H9LA 4R7AB 2PM9B 2EBSA 3OL2A 2BBKH 1GP2B 3DSMA 5EMLB 4O3UB 5EALA 4BUJC 2OVQB 4FA1D 2OK6A 3EI4A 2J55H 4PC0A 2G9AA 4CY5A 4E54B 4AOWA 4X60B 3N0DA 1GXRA 4A0BA 3OKWA 5K19A 4HDJA 4J84A 3DWLC 2P9KC 2MTAH 1XIPA 3OKYA 3SMRA 4FA5D 1B9YA 3OL2B 3IIWA 3BG1A 3AL8B 3AH8B 3JZHA 4MK0B 3GFCA 2H14A 1OLZA 3N0EA 4OZUA 3UR4A 2UZYB 3VH0A 4JSPC 5KDOB 3EMHA 3UVNA 5EAPA 4CZVA 4ZOYA 3EG6A 2CE9A 5FKSA 2O9KA 5I5MA 3K27A 2OK4A 1P22A 2CO0C 5H1MA 2I0TA 4L1QD 4AEZA 3VA6A 5FXYA 2AGZA 4JD2C 4Z8LA 4XYHA 3FRXA 5HE3B 2Z2NA 4JSVC 4QL1A 3L4OD 3JRPA 4ZN4A 4J8BA 3JAMg 3OTTA 4PNKB 2H3XA 3RN1D 4ESGA 3DM0A 3EI1B 3NVNA 3SCYA 5C2WB 2PM7B 4ZOXA 3V9FA 4PBZA 5HQGA 2B5NA 2QXVA 4A7JA 3EI3B 5FQDA 1PGUA 5GXIA 4ZOVA 1N6DA 3RFGA 4A11A 2AGXA 5EMMB 4GM3A 3CFVA 3I8EA 2IURA 1RI6A 2PM6B 4BH6A 3ODTA 1SQJA 4E5ZA 4LGNA 5H14A 3UVOA 4TZ4A 4Y5RD 2I0RA 4A0BB 5I5IA 3GREA 3JZGA 2Q7QA 3RMZD 4QQEA 5IJ8E 1NEXB 3FM0A 1PEVA 5CYKA 2G99A 4X63B 2YMUA 3I7HA 2YBAA 3I2NA 3BWSA 1OMWB 3SLED 5SXMA 3EI2A 3MZLA 2B5LA 3PXWD 5I5JA 4FA9D 3V5WB 3SXTD 4FWWA 4QT8A 2XU7A 4CZXA 3L4MD 1GOTB 2H9NA 5CXCB 4CI3A 2H47A 3PSCB 2HJ4A 4GM8A 4L3GD 2I0SA 4KFMB 3MMYA 2YNNA 5FA5B 4A2LA 4O3TB 1JMZB 3OKYB 4ZOZA 4J77A 5TEEA 4ERQA 2IUQA 4K3JB 1MDAH 5FKRA 3IJ1A 3PXSD 2HYEA 5AFU3 3NVXA 1SHYB 2AGLA 5FKTA 4LG8A 4GZ8A 3K26A 1QNIA 3EWEA 2IWKA 3SBPA 4FA4D 4GGCA 3IJCA 4YVDA 4A11B 3MZKA 2AH0A 3C75H 2YNPA 5HE0B 2QC5A 4BL0A 3U4YA 5GMKn 1JMXB 4NSXA 2IAAA 4IMMA 2IUVA 3DXMC 3AL9A 4JSXC 3I7PA 2CE8A 5H17A 3EI1A 1L0QA 3IKOA 3PVWB 3SBRA 4PBYA 2HKRA 1JOFA 5IJ7E 3SHFA 1A0RB 1TYQC 5A2Qg 2J56H 3JROA 4J78A 2PBIB
chains in the Genus database with same CATH superfamily
5AJAA 2HJBA 1GOGA 4GQ1A 4U1EI 4XEIC 3VGZA 1XKSA 4J86A 3CFSB 3EQ7A 2BCJB 4IA9A 2XE4A 4MMXA 4XYIA 4UI9R 1M1XA 1E5TA 1H2XA 1E8MA 5FLXg 2Z2OA 3I89A 3K72A 2B4EA 2H13A 3KCIA 1UOPA 2I3SA 3K71A 4FAVD 4Z7QA 4G56B 4O1QD 4A09A 2H9PA 3SFZA 5JWZA 3GC3B 4GGDA 3IJ0A 3PVUB 3ZE2A 2IUPA 3MXXA 3ORVD 5IGQA 5IT9g 3J80g 3F3GA 3UKRC 1C9IA 1PI6A 3I7OA 1VYHC 3KRXB 3RRMC 5C9ZB 1XHMA 1UOQA 4JT6C 2AGYA 2XL2A 5HYNB 4J79A 2VDMA 3RFHA 2HU8A 5TDHB 3NIDA 1K8KC 3B7FA 5K1CC 4N14A 4ES0A 5TEFA 4U7AA 3RSEC 1FWXA 2HKMA 4J81A 4K3ID 2HESX 3I7LA 5C2VB 3KRWB 4A2MA 1H2WA 4JT5C 4BP8A 4O9DA 3FGBA 4A0AB 3BG0A 2HU7A 4GQ2P 4A0AA 1VZ3A 3C9CA 4J0XA 3CIKB 5HE1B 3NVQA 3V7DB 1MG3A 4CY2A 3JPXA 1U2VC 4CI2A 4GGAA 4O45A 5TF2A 3DXKC 4A08B 2PM9A 1BPOA 3C5MA 4ERZA 2P9IC 2J57G 4H5IA 4X3EA 1N6EA 2AQ5A 4RE6A 1QFSA 3EI2B 2OVRB 4IRZA 3NIFA 3T3MA 3VI3A 3HFQA 4J8GA 3OKTA 4FAND 4CY1A 3I7KA 4CI8A 2YB8B 3AFCA 4L3HD 3SN6B 3ZE0A 2UZXB 5M61A 3JB9L 4JHPC 5EM2B 2I3TA 3PXTD 4EWRA 3A0FA 4GMBA 5GSAA 4G1EA 5AMSA 2JKXA 5EAMA 3EU7A 4CY3A 3K6SA 2Z2PA 2VZ3A 4QAMA 4NAAA 1B9XA 2HXCA 1PBYB 4NENA 4O2WA 4PXWA 2H9MA 3ZDYA 1O6GA 2P9UC 4GM9A 2CN2A 2AH1A 5M5RA 5THAA 3RN0D 4FB1D 4CI1A 1TBGA 4H5JA 5CYKB 2GC7A 4FHLA 3SVWD 4E54A 2IWFA 2CNXA 2VDKA 4PSWB 4QRJA 4A09B 4J87A 2AGWA 5HDBA 4JSNC 2OJYA 4D0KA 1YFQA 3ULEC 3PE7A 5CXBA 1SQ9A 4G55A 5IGOA 5EMKB 3SWSD 3PSLA 3JZNA 5EM2A 1JJUB 1GOFA 1GG2B 2YNOA 4AN1A 4CC9A 1NR0A 4BCDA 2GNQA 4J73A 4J0WA 3SBQA 2B5MA 3P4FA 1MG2A 3FCSA 3UKUC 1O6FA 5EARA 3ZE1A 2XYIA 2P9PC 5M5VA 2H6KA 3MUNA 2CO0A 3IUMA 4D6VA 2OIZA 4GQBB 2H68A 2P9NC 4ERYA 4E5ZB 4PSXB 3NIGA 5E6RA 1ERJA 2GC4A 5FKQA 3UVLA 4L9OA 1H2ZA 3ZDXA 4JXMA 5CXCA 3IUNA 2W18A 3SJLD 3ZWLB 2VDLA 3O4IA 5GXHA 4X61B 5IC7A 2OVPB 5HE2B 3F3PA 4OWRA 2EICA 4J82A 2CN3A 1U4CA 1S4UX 3AL8A 3UVMA 3EI3A 4NC4A 2VC2A 3OW8A 4CZYA 2TRCB 3RLMD 3IIYA 5CXBB 5B4WA 1K32A 1C9LA 2EIDA 4BP9A 1R5MA 3I7NA 3W15A 4A08A 3J81g 1Q47A 2P9SC 5EMJB 1UOOA 3OF7A 4RE5A 2HU5A 3MKSB 1N6FA 4LG9A 3EI4B 3E0CA 3I8CA 3UVKA 2P9LC 3C99A 3MKQA 4I79A 2XL3A 2H6NA 4O02A 3F3FA 1K3IA 4Y7RA 2H6QA 2H9LA 4D9SA 4R7AB 2PM9B 1I2MB 2EBSA 3ZDZA 3OL2A 3O4HA 3IUJA 2BBKH 1GP2B 3DSMA 5EMLB 4O3UB 5E6SA 5EALA 4BUJC 4NBMA 2OVQB 1QFMA 4FA1D 2OK6A 3EI4A 4MMYA 2J55H 4PC0A 2G9AA 4CY5A 3EQ9A 4E54B 4AOWA 2EIEA 1H2YA 4X60B 3N0DA 1L5GA 1GXRA 3IVMA 3O4GA 4UM9A 4A0BA 3OKWA 5K19A 4HDJA 4J84A 3DWLC 2P9KC 4BCCA 4AN0A 4G1MA 4WK4A 3V4PA 4AMZA 2MTAH 1XIPA 3OKYA 3SMRA 4FA5D 1B9YA 3OL2B 3IIWA 3BG1A 3AL8B 3AH8B 3JZHA 4MK0B 3GFCA 4WK2A 3FCUA 5FFOA 2H14A 1OLZA 4Z7NA 3N0EA 4OZUA 3UR4A 2UZYB 3VH0A 4JSPC 5KDOB 1JTDB 3EMHA 3UVNA 5EAPA 4CZVA 4ZOYA 3EG6A 2CE9A 5FKSA 3QI0A 2O9KA 5I5MA 3K27A 2OK4A 2VDQA 1P22A 2CO0C 5H1MA 2VDOA 2I0TA 3GD1I 4L1QD 4AEZA 3VA6A 5FXYA 2AGZA 4JD2C 2VDRA 4Z8LA 4XYHA 4DNWA 3FRXA 4Z7OA 5C92A 1E8NA 5HE3B 2Z2NA 4JSVC 4QL1A 3L4OD 3JRPA 4ZN4A 1GOHA 4J8BA 1VE7A 3JAMg 3OTTA 4PNKB 1U8CA 2H3XA 3RN1D 4ESGA 1A12A 5M5TA 3DM0A 3EI1B 3NVNA 4WJKA 3SCYA 5C2WB 2QR5A 2PM7B 4ZOXA 3V9FA 4PBZA 1TYEA 5HQGA 4DNVA 2B5NA 2QXVA 4A7JA 3EI3B 5FQDA 1PGUA 3DDUA 5GXIA 4ZOVA 1N6DA 3RFGA 4A11A 2AGXA 4WK0A 5EMMB 2WQ8A 4GM3A 3CFVA 3I8EA 4AX4A 2IURA 1RI6A 1UTCA 2PM6B 4BH6A 3ODTA 1SQJA 2EIBA 4E5ZA 4LGNA 5M5SA 5H14A 4L1MA 3UVOA 4TZ4A 4Y5RD 2I0RA 4A0BB 1JV2A 5I5IA 3GREA 1VE6A 3JZGA 2Q7QA 3RMZD 4BCBA 4QQEA 3V4VA 5IJ8E 2VZ1A 1NEXB 3FM0A 4MMZA 1PEVA 5CYKA 2G99A 4X63B 5FFGA 2YMUA 3I7HA 2YBAA 3I2NA 3BWSA 1OMWB 3SLED 5SXMA 3EI2A 3MZLA 2B5LA 3PXWD 5I5JA 4FA9D 1YR2A 3V5WB 4JHNA 3SXTD 4FWWA 4QT8A 2XU7A 4CZXA 3L4MD 1GOTB 2H9NA 3IULA 5C86A 5CXCB 4CI3A 2H47A 3PSCB 2BKLA 1T2XA 2HJ4A 2XDWA 3O4JA 4GM8A 4L3GD 1VZ2A 3MUOA 2I0SA 4KFMB 3EQ8A 3MMYA 2YNNA 3VI4A 5FA5B 4A2LA 4O3TB 1JMZB 3OKYB 4ZOZA 4DNUA 4J77A 5TEEA 2VDPA 4ERQA 2IUQA 4K3JB 1MDAH 5FKRA 3IURA 3IJ1A 3PXSD 2HYEA 5AFU3 3NVXA 1SHYB 2QZPA 5M5UA 2AGLA 5FKTA 4LG8A 4GZ8A 3K26A 1QNIA 3EWEA 2IWKA 2VDNA 3SBPA 3IJEA 4FA4D 4GGCA 3IJCA 3QHYB 4YVDA 4UM8A 3MZKA 2AH0A 4A11B 3C75H 2YNPA 5HE0B 2QC5A 3T3PA 4BL0A 3U4YA 5GMKn 1JMXB 4NSXA 2IAAA 4IMMA 2IUVA 3DXMC 3AL9A 4JSXC 3I7PA 4AMYA 2CE8A 5H17A 3EI1A 1L0QA 3IKOA 2XZGA 3PVWB 3SBRA 4PBYA 2HKRA 3IUQA 1JOFA 5IJ7E 3MVDK 3SHFA 1A0RB 1TYQC 5A2Qg 2J56H 3JROA 4J78A 2PBIB 5E6UA
chains in the Genus database with same CATH topology
5AJAA 2HJBA 4GQ1A 4U1EI 4XEIC 3VGZA 1XKSA 4J86A 3CFSB 2BCJB 4IA9A 4XYIA 4UI9R 5FLXg 2Z2OA 3I89A 2B4EA 2H13A 2I3SA 4FAVD 4G56B 4O1QD 4A09A 2H9PA 3SFZA 5JWZA 4GGDA 3IJ0A 3PVUB 2IUPA 3MXXA 3ORVD 5IGQA 5IT9g 3J80g 3F3GA 3UKRC 1PI6A 3I7OA 1VYHC 3KRXB 3RRMC 5C9ZB 1XHMA 4JT6C 2AGYA 2XL2A 5HYNB 4J79A 3RFHA 5TDHB 1K8KC 3B7FA 5K1CC 4N14A 4ES0A 5TEFA 4U7AA 3RSEC 1FWXA 2HKMA 4J81A 4K3ID 2HESX 3I7LA 5C2VB 3KRWB 4A2MA 4JT5C 4O9DA 3FGBA 4A0AB 3BG0A 4GQ2P 4A0AA 3C9CA 4J0XA 3CIKB 5HE1B 3NVQA 3V7DB 1MG3A 4CY2A 3JPXA 1U2VC 4CI2A 4GGAA 4O45A 5TF2A 3DXKC 4A08B 2PM9A 3C5MA 4ERZA 2P9IC 2J57G 4H5IA 4X3EA 1N6EA 2AQ5A 3EI2B 2OVRB 3HFQA 4J8GA 3OKTA 4FAND 4CY1A 3I7KA 4CI8A 2YB8B 3AFCA 4L3HD 3SN6B 2UZXB 3JB9L 5EM2B 2I3TA 3PXTD 4EWRA 3A0FA 4GMBA 5GSAA 5AMSA 5EAMA 3EU7A 4CY3A 2Z2PA 1B9XA 2HXCA 1PBYB 4PXWA 2H9MA 2P9UC 4GM9A 2CN2A 2AH1A 5THAA 3RN0D 4FB1D 4CI1A 1TBGA 4H5JA 5CYKB 2GC7A 4FHLA 3SVWD 4E54A 2IWFA 2CNXA 4PSWB 4QRJA 4A09B 4J87A 2AGWA 4JSNC 2OJYA 4D0KA 1YFQA 3ULEC 3PE7A 5CXBA 1SQ9A 5IGOA 5EMKB 3SWSD 3PSLA 3JZNA 5EM2A 1JJUB 1GG2B 2YNOA 4CC9A 1NR0A 2GNQA 4J73A 4J0WA 3SBQA 2B5MA 3P4FA 1MG2A 3UKUC 5EARA 2XYIA 2P9PC 2H6KA 2CO0A 4D6VA 2OIZA 4GQBB 2H68A 2P9NC 4ERYA 4E5ZB 4PSXB 5FKQA 1ERJA 2GC4A 3UVLA 4L9OA 4JXMA 5CXCA 2W18A 3SJLD 3ZWLB 5GXHA 4X61B 5IC7A 2OVPB 5HE2B 3F3PA 4OWRA 4J82A 2CN3A 1U4CA 1S4UX 3AL8A 3UVMA 3EI3A 3OW8A 4CZYA 2TRCB 3RLMD 3IIYA 5CXBB 5B4WA 1K32A 4A08A 1R5MA 3I7NA 3W15A 3J81g 1Q47A 2P9SC 5EMJB 3MKSB 4LG9A 1N6FA 3EI4B 3E0CA 3I8CA 3UVKA 2P9LC 3C99A 3MKQA 4I79A 2XL3A 2H6NA 3F3FA 4Y7RA 2H6QA 2H9LA 4R7AB 2PM9B 2EBSA 3OL2A 2BBKH 1GP2B 3DSMA 5EMLB 4O3UB 5EALA 4BUJC 2OVQB 4FA1D 2OK6A 3EI4A 2J55H 4PC0A 2G9AA 4CY5A 4E54B 4AOWA 4X60B 3N0DA 1GXRA 4A0BA 3OKWA 5K19A 4HDJA 4J84A 3DWLC 2P9KC 2MTAH 1XIPA 3OKYA 3SMRA 4FA5D 1B9YA 3OL2B 3IIWA 3BG1A 3AL8B 3AH8B 3JZHA 4MK0B 3GFCA 2H14A 1OLZA 3N0EA 4OZUA 3UR4A 2UZYB 3VH0A 4JSPC 5KDOB 3EMHA 3UVNA 5EAPA 4CZVA 4ZOYA 3EG6A 2CE9A 5FKSA 2O9KA 5I5MA 3K27A 2OK4A 1P22A 2CO0C 5H1MA 2I0TA 4L1QD 4AEZA 3VA6A 5FXYA 2AGZA 4JD2C 4Z8LA 4XYHA 3FRXA 5HE3B 2Z2NA 4JSVC 4QL1A 3L4OD 3JRPA 4ZN4A 4J8BA 3JAMg 3OTTA 4PNKB 2H3XA 3RN1D 4ESGA 3DM0A 3EI1B 3NVNA 3SCYA 5C2WB 2PM7B 4ZOXA 3V9FA 4PBZA 5HQGA 2B5NA 2QXVA 4A7JA 3EI3B 5FQDA 1PGUA 5GXIA 4ZOVA 1N6DA 3RFGA 4A11A 2AGXA 5EMMB 4GM3A 3CFVA 3I8EA 2IURA 1RI6A 2PM6B 4BH6A 3ODTA 1SQJA 4E5ZA 4LGNA 5H14A 3UVOA 4TZ4A 4Y5RD 2I0RA 4A0BB 5I5IA 3GREA 3JZGA 2Q7QA 3RMZD 4QQEA 5IJ8E 1NEXB 3FM0A 1PEVA 5CYKA 2G99A 4X63B 2YMUA 3I7HA 2YBAA 3I2NA 3BWSA 1OMWB 3SLED 5SXMA 3EI2A 3MZLA 2B5LA 3PXWD 5I5JA 4FA9D 3V5WB 3SXTD 4FWWA 4QT8A 2XU7A 4CZXA 3L4MD 1GOTB 2H9NA 5CXCB 4CI3A 2H47A 3PSCB 2HJ4A 4GM8A 4L3GD 2I0SA 4KFMB 3MMYA 2YNNA 5FA5B 4A2LA 4O3TB 1JMZB 3OKYB 4ZOZA 4J77A 5TEEA 4ERQA 2IUQA 4K3JB 1MDAH 5FKRA 3IJ1A 3PXSD 2HYEA 5AFU3 3NVXA 1SHYB 2AGLA 5FKTA 4LG8A 4GZ8A 3K26A 1QNIA 3EWEA 2IWKA 3SBPA 4FA4D 4GGCA 3IJCA 4YVDA 4A11B 3MZKA 2AH0A 3C75H 2YNPA 5HE0B 2QC5A 4BL0A 3U4YA 5GMKn 1JMXB 4NSXA 2IAAA 4IMMA 2IUVA 3DXMC 3AL9A 4JSXC 3I7PA 2CE8A 5H17A 3EI1A 1L0QA 3IKOA 3PVWB 3SBRA 4PBYA 2HKRA 1JOFA 5IJ7E 3SHFA 1A0RB 1TYQC 5A2Qg 2J56H 3JROA 4J78A 2PBIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJA A;  2HJB A;  4GQ1 A;  4U1E I;  4XEI C;  3VGZ A;  1XKS A;  4J86 A;  3CFS B;  2BCJ B;  4IA9 A;  4XYI A;  4UI9 R;  5FLX g;  2Z2O A;  3I89 A;  2B4E A;  2H13 A;  2I3S A;  4FAV D;  4G56 B;  4O1Q D;  4A09 A;  2H9P A;  3SFZ A;  5JWZ A;  4GGD A;  3IJ0 A;  3PVU B;  2IUP A;  3MXX A;  3ORV D;  5IGQ A;  5IT9 g;  3J80 g;  3F3G A;  3UKR C;  1PI6 A;  3I7O A;  1VYH C;  3KRX B;  3RRM C;  5C9Z B;  1XHM A;  4JT6 C;  2AGY A;  2XL2 A;  5HYN B;  4J79 A;  3RFH A;  5TDH B;  1K8K C;  3B7F A;  5K1C C;  4N14 A;  4ES0 A;  5TEF A;  4U7A A;  3RSE C;  1FWX A;  2HKM A;  4J81 A;  4K3I D;  2HES X;  3I7L A;  5C2V B;  3KRW B;  4A2M A;  4JT5 C;  4O9D A;  3FGB A;  4A0A B;  3BG0 A;  4GQ2 P;  4A0A A;  3C9C A;  4J0X A;  3CIK B;  5HE1 B;  3NVQ A;  3V7D B;  1MG3 A;  4CY2 A;  3JPX A;  1U2V C;  4CI2 A;  4GGA A;  4O45 A;  5TF2 A;  3DXK C;  4A08 B;  2PM9 A;  3C5M A;  4ERZ A;  2P9I C;  2J57 G;  4H5I A;  4X3E A;  1N6E A;  2AQ5 A;  3EI2 B;  2OVR B;  3HFQ A;  4J8G A;  3OKT A;  4FAN D;  4CY1 A;  3I7K A;  4CI8 A;  2YB8 B;  3AFC A;  4L3H D;  3SN6 B;  2UZX B;  3JB9 L;  5EM2 B;  2I3T A;  3PXT D;  4EWR A;  3A0F A;  4GMB A;  5GSA A;  5AMS A;  5EAM A;  3EU7 A;  4CY3 A;  2Z2P A;  1B9X A;  2HXC A;  1PBY B;  4PXW A;  2H9M A;  2P9U C;  4GM9 A;  2CN2 A;  2AH1 A;  5THA A;  3RN0 D;  4FB1 D;  4CI1 A;  1TBG A;  4H5J A;  5CYK B;  2GC7 A;  4FHL A;  3SVW D;  4E54 A;  2IWF A;  2CNX A;  4PSW B;  4QRJ A;  4A09 B;  4J87 A;  2AGW A;  4JSN C;  2OJY A;  4D0K A;  1YFQ A;  3ULE C;  3PE7 A;  5CXB A;  1SQ9 A;  5IGO A;  5EMK B;  3SWS D;  3PSL A;  3JZN A;  5EM2 A;  1JJU B;  1GG2 B;  2YNO A;  4CC9 A;  1NR0 A;  2GNQ A;  4J73 A;  4J0W A;  3SBQ A;  2B5M A;  3P4F A;  1MG2 A;  3UKU C;  5EAR A;  2XYI A;  2P9P C;  2H6K A;  2CO0 A;  4D6V A;  2OIZ A;  4GQB B;  2H68 A;  2P9N C;  4ERY A;  4E5Z B;  4PSX B;  5FKQ A;  1ERJ A;  2GC4 A;  3UVL A;  4L9O A;  4JXM A;  5CXC A;  2W18 A;  3SJL D;  3ZWL B;  5GXH A;  4X61 B;  5IC7 A;  2OVP B;  5HE2 B;  3F3P A;  4OWR A;  4J82 A;  2CN3 A;  1U4C A;  1S4U X;  3AL8 A;  3UVM A;  3EI3 A;  3OW8 A;  4CZY A;  2TRC B;  3RLM D;  3IIY A;  5CXB B;  5B4W A;  1K32 A;  4A08 A;  1R5M A;  3I7N A;  3W15 A;  3J81 g;  1Q47 A;  2P9S C;  5EMJ B;  3MKS B;  4LG9 A;  1N6F A;  3EI4 B;  3E0C A;  3I8C A;  3UVK A;  2P9L C;  3C99 A;  3MKQ A;  4I79 A;  2XL3 A;  2H6N A;  3F3F A;  4Y7R A;  2H6Q A;  2H9L A;  4R7A B;  2PM9 B;  2EBS A;  3OL2 A;  2BBK H;  1GP2 B;  3DSM A;  5EML B;  4O3U B;  5EAL A;  4BUJ C;  2OVQ B;  4FA1 D;  2OK6 A;  3EI4 A;  2J55 H;  4PC0 A;  2G9A A;  4CY5 A;  4E54 B;  4AOW A;  4X60 B;  3N0D A;  1GXR A;  4A0B A;  3OKW A;  5K19 A;  4HDJ A;  4J84 A;  3DWL C;  2P9K C;  2MTA H;  1XIP A;  3OKY A;  3SMR A;  4FA5 D;  1B9Y A;  3OL2 B;  3IIW A;  3BG1 A;  3AL8 B;  3AH8 B;  3JZH A;  4MK0 B;  3GFC A;  2H14 A;  1OLZ A;  3N0E A;  4OZU A;  3UR4 A;  2UZY B;  3VH0 A;  4JSP C;  5KDO B;  3EMH A;  3UVN A;  5EAP A;  4CZV A;  4ZOY A;  3EG6 A;  2CE9 A;  5FKS A;  2O9K A;  5I5M A;  3K27 A;  2OK4 A;  1P22 A;  2CO0 C;  5H1M A;  2I0T A;  4L1Q D;  4AEZ A;  3VA6 A;  5FXY A;  2AGZ A;  4JD2 C;  4Z8L A;  4XYH A;  3FRX A;  5HE3 B;  2Z2N A;  4JSV C;  4QL1 A;  3L4O D;  3JRP A;  4ZN4 A;  4J8B A;  3JAM g;  3OTT A;  4PNK B;  2H3X A;  3RN1 D;  4ESG A;  3DM0 A;  3EI1 B;  3NVN A;  3SCY A;  5C2W B;  2PM7 B;  4ZOX A;  3V9F A;  4PBZ A;  5HQG A;  2B5N A;  2QXV A;  4A7J A;  3EI3 B;  5FQD A;  1PGU A;  5GXI A;  4ZOV A;  1N6D A;  3RFG A;  4A11 A;  2AGX A;  5EMM B;  4GM3 A;  3CFV A;  3I8E A;  2IUR A;  1RI6 A;  2PM6 B;  4BH6 A;  3ODT A;  1SQJ A;  4E5Z A;  4LGN A;  5H14 A;  3UVO A;  4TZ4 A;  4Y5R D;  2I0R A;  4A0B B;  5I5I A;  3GRE A;  3JZG A;  2Q7Q A;  3RMZ D;  4QQE A;  5IJ8 E;  1NEX B;  3FM0 A;  1PEV A;  5CYK A;  2G99 A;  4X63 B;  2YMU A;  3I7H A;  2YBA A;  3I2N A;  3BWS A;  1OMW B;  3SLE D;  5SXM A;  3EI2 A;  3MZL A;  2B5L A;  3PXW D;  5I5J A;  4FA9 D;  3V5W B;  3SXT D;  4FWW A;  4QT8 A;  2XU7 A;  4CZX A;  3L4M D;  1GOT B;  2H9N A;  5CXC B;  4CI3 A;  2H47 A;  3PSC B;  2HJ4 A;  4GM8 A;  4L3G D;  2I0S A;  4KFM B;  3MMY A;  2YNN A;  5FA5 B;  4A2L A;  4O3T B;  1JMZ B;  3OKY B;  4ZOZ A;  4J77 A;  5TEE A;  4ERQ A;  2IUQ A;  4K3J B;  1MDA H;  5FKR A;  3IJ1 A;  3PXS D;  2HYE A;  5AFU 3;  3NVX A;  1SHY B;  2AGL A;  5FKT A;  4LG8 A;  4GZ8 A;  3K26 A;  1QNI A;  3EWE A;  2IWK A;  3SBP A;  4FA4 D;  4GGC A;  3IJC A;  4YVD A;  4A11 B;  3MZK A;  2AH0 A;  3C75 H;  2YNP A;  5HE0 B;  2QC5 A;  4BL0 A;  3U4Y A;  5GMK n;  1JMX B;  4NSX A;  2IAA A;  4IMM A;  2IUV A;  3DXM C;  3AL9 A;  4JSX C;  3I7P A;  2CE8 A;  5H17 A;  3EI1 A;  1L0Q A;  3IKO A;  3PVW B;  3SBR A;  4PBY A;  2HKR A;  1JOF A;  5IJ7 E;  3SHF A;  1A0R B;  1TYQ C;  5A2Q g;  2J56 H;  3JRO A;  4J78 A;  2PBI B; 
#chains in the Genus database with same CATH topology
 5AJA A;  2HJB A;  1GOG A;  4GQ1 A;  4U1E I;  4XEI C;  3VGZ A;  1XKS A;  4J86 A;  3CFS B;  3EQ7 A;  2BCJ B;  4IA9 A;  2XE4 A;  4MMX A;  4XYI A;  4UI9 R;  1M1X A;  1E5T A;  1H2X A;  1E8M A;  5FLX g;  2Z2O A;  3I89 A;  3K72 A;  2B4E A;  2H13 A;  3KCI A;  1UOP A;  2I3S A;  3K71 A;  4FAV D;  4Z7Q A;  4G56 B;  4O1Q D;  4A09 A;  2H9P A;  3SFZ A;  5JWZ A;  3GC3 B;  4GGD A;  3IJ0 A;  3PVU B;  3ZE2 A;  2IUP A;  3MXX A;  3ORV D;  5IGQ A;  5IT9 g;  3J80 g;  3F3G A;  3UKR C;  1C9I A;  1PI6 A;  3I7O A;  1VYH C;  3KRX B;  3RRM C;  5C9Z B;  1XHM A;  1UOQ A;  4JT6 C;  2AGY A;  2XL2 A;  5HYN B;  4J79 A;  2VDM A;  3RFH A;  2HU8 A;  5TDH B;  3NID A;  1K8K C;  3B7F A;  5K1C C;  4N14 A;  4ES0 A;  5TEF A;  4U7A A;  3RSE C;  1FWX A;  2HKM A;  4J81 A;  4K3I D;  2HES X;  3I7L A;  5C2V B;  3KRW B;  4A2M A;  1H2W A;  4JT5 C;  4BP8 A;  4O9D A;  3FGB A;  4A0A B;  3BG0 A;  2HU7 A;  4GQ2 P;  4A0A A;  1VZ3 A;  3C9C A;  4J0X A;  3CIK B;  5HE1 B;  3NVQ A;  3V7D B;  1MG3 A;  4CY2 A;  3JPX A;  1U2V C;  4CI2 A;  4GGA A;  4O45 A;  5TF2 A;  3DXK C;  4A08 B;  2PM9 A;  1BPO A;  3C5M A;  4ERZ A;  2P9I C;  2J57 G;  4H5I A;  4X3E A;  1N6E A;  2AQ5 A;  4RE6 A;  1QFS A;  3EI2 B;  2OVR B;  4IRZ A;  3NIF A;  3T3M A;  3VI3 A;  3HFQ A;  4J8G A;  3OKT A;  4FAN D;  4CY1 A;  3I7K A;  4CI8 A;  2YB8 B;  3AFC A;  4L3H D;  3SN6 B;  3ZE0 A;  2UZX B;  5M61 A;  3JB9 L;  4JHP C;  5EM2 B;  2I3T A;  3PXT D;  4EWR A;  3A0F A;  4GMB A;  5GSA A;  4G1E A;  5AMS A;  2JKX A;  5EAM A;  3EU7 A;  4CY3 A;  3K6S A;  2Z2P A;  2VZ3 A;  4QAM A;  4NAA A;  1B9X A;  2HXC A;  1PBY B;  4NEN A;  4O2W A;  4PXW A;  2H9M A;  3ZDY A;  1O6G A;  2P9U C;  4GM9 A;  2CN2 A;  2AH1 A;  5M5R A;  5THA A;  3RN0 D;  4FB1 D;  4CI1 A;  1TBG A;  4H5J A;  5CYK B;  2GC7 A;  4FHL A;  3SVW D;  4E54 A;  2IWF A;  2CNX A;  2VDK A;  4PSW B;  4QRJ A;  4A09 B;  4J87 A;  2AGW A;  5HDB A;  4JSN C;  2OJY A;  4D0K A;  1YFQ A;  3ULE C;  3PE7 A;  5CXB A;  1SQ9 A;  4G55 A;  5IGO A;  5EMK B;  3SWS D;  3PSL A;  3JZN A;  5EM2 A;  1JJU B;  1GOF A;  1GG2 B;  2YNO A;  4AN1 A;  4CC9 A;  1NR0 A;  4BCD A;  2GNQ A;  4J73 A;  4J0W A;  3SBQ A;  2B5M A;  3P4F A;  1MG2 A;  3FCS A;  3UKU C;  1O6F A;  5EAR A;  3ZE1 A;  2XYI A;  2P9P C;  5M5V A;  2H6K A;  3MUN A;  2CO0 A;  3IUM A;  4D6V A;  2OIZ A;  4GQB B;  2H68 A;  2P9N C;  4ERY A;  4E5Z B;  4PSX B;  3NIG A;  5E6R A;  1ERJ A;  2GC4 A;  5FKQ A;  3UVL A;  4L9O A;  1H2Z A;  3ZDX A;  4JXM A;  5CXC A;  3IUN A;  2W18 A;  3SJL D;  3ZWL B;  2VDL A;  3O4I A;  5GXH A;  4X61 B;  5IC7 A;  2OVP B;  5HE2 B;  3F3P A;  4OWR A;  2EIC A;  4J82 A;  2CN3 A;  1U4C A;  1S4U X;  3AL8 A;  3UVM A;  3EI3 A;  4NC4 A;  2VC2 A;  3OW8 A;  4CZY A;  2TRC B;  3RLM D;  3IIY A;  5CXB B;  5B4W A;  1K32 A;  1C9L A;  2EID A;  4BP9 A;  1R5M A;  3I7N A;  3W15 A;  4A08 A;  3J81 g;  1Q47 A;  2P9S C;  5EMJ B;  1UOO A;  3OF7 A;  4RE5 A;  2HU5 A;  3MKS B;  1N6F A;  4LG9 A;  3EI4 B;  3E0C A;  3I8C A;  3UVK A;  2P9L C;  3C99 A;  3MKQ A;  4I79 A;  2XL3 A;  2H6N A;  4O02 A;  3F3F A;  1K3I A;  4Y7R A;  2H6Q A;  2H9L A;  4D9S A;  4R7A B;  2PM9 B;  1I2M B;  2EBS A;  3ZDZ A;  3OL2 A;  3O4H A;  3IUJ A;  2BBK H;  1GP2 B;  3DSM A;  5EML B;  4O3U B;  5E6S A;  5EAL A;  4BUJ C;  4NBM A;  2OVQ B;  1QFM A;  4FA1 D;  2OK6 A;  3EI4 A;  4MMY A;  2J55 H;  4PC0 A;  2G9A A;  4CY5 A;  3EQ9 A;  4E54 B;  4AOW A;  2EIE A;  1H2Y A;  4X60 B;  3N0D A;  1L5G A;  1GXR A;  3IVM A;  3O4G A;  4UM9 A;  4A0B A;  3OKW A;  5K19 A;  4HDJ A;  4J84 A;  3DWL C;  2P9K C;  4BCC A;  4AN0 A;  4G1M A;  4WK4 A;  3V4P A;  4AMZ A;  2MTA H;  1XIP A;  3OKY A;  3SMR A;  4FA5 D;  1B9Y A;  3OL2 B;  3IIW A;  3BG1 A;  3AL8 B;  3AH8 B;  3JZH A;  4MK0 B;  3GFC A;  4WK2 A;  3FCU A;  5FFO A;  2H14 A;  1OLZ A;  4Z7N A;  3N0E A;  4OZU A;  3UR4 A;  2UZY B;  3VH0 A;  4JSP C;  5KDO B;  1JTD B;  3EMH A;  3UVN A;  5EAP A;  4CZV A;  4ZOY A;  3EG6 A;  2CE9 A;  5FKS A;  3QI0 A;  2O9K A;  5I5M A;  3K27 A;  2OK4 A;  2VDQ A;  1P22 A;  2CO0 C;  5H1M A;  2VDO A;  2I0T A;  3GD1 I;  4L1Q D;  4AEZ A;  3VA6 A;  5FXY A;  2AGZ A;  4JD2 C;  2VDR A;  4Z8L A;  4XYH A;  4DNW A;  3FRX A;  4Z7O A;  5C92 A;  1E8N A;  5HE3 B;  2Z2N A;  4JSV C;  4QL1 A;  3L4O D;  3JRP A;  4ZN4 A;  1GOH A;  4J8B A;  1VE7 A;  3JAM g;  3OTT A;  4PNK B;  1U8C A;  2H3X A;  3RN1 D;  4ESG A;  1A12 A;  5M5T A;  3DM0 A;  3EI1 B;  3NVN A;  4WJK A;  3SCY A;  5C2W B;  2QR5 A;  2PM7 B;  4ZOX A;  3V9F A;  4PBZ A;  1TYE A;  5HQG A;  4DNV A;  2B5N A;  2QXV A;  4A7J A;  3EI3 B;  5FQD A;  1PGU A;  3DDU A;  5GXI A;  4ZOV A;  1N6D A;  3RFG A;  4A11 A;  2AGX A;  4WK0 A;  5EMM B;  2WQ8 A;  4GM3 A;  3CFV A;  3I8E A;  4AX4 A;  2IUR A;  1RI6 A;  1UTC A;  2PM6 B;  4BH6 A;  3ODT A;  1SQJ A;  2EIB A;  4E5Z A;  4LGN A;  5M5S A;  5H14 A;  4L1M A;  3UVO A;  4TZ4 A;  4Y5R D;  2I0R A;  4A0B B;  1JV2 A;  5I5I A;  3GRE A;  1VE6 A;  3JZG A;  2Q7Q A;  3RMZ D;  4BCB A;  4QQE A;  3V4V A;  5IJ8 E;  2VZ1 A;  1NEX B;  3FM0 A;  4MMZ A;  1PEV A;  5CYK A;  2G99 A;  4X63 B;  5FFG A;  2YMU A;  3I7H A;  2YBA A;  3I2N A;  3BWS A;  1OMW B;  3SLE D;  5SXM A;  3EI2 A;  3MZL A;  2B5L A;  3PXW D;  5I5J A;  4FA9 D;  1YR2 A;  3V5W B;  4JHN A;  3SXT D;  4FWW A;  4QT8 A;  2XU7 A;  4CZX A;  3L4M D;  1GOT B;  2H9N A;  3IUL A;  5C86 A;  5CXC B;  4CI3 A;  2H47 A;  3PSC B;  2BKL A;  1T2X A;  2HJ4 A;  2XDW A;  3O4J A;  4GM8 A;  4L3G D;  1VZ2 A;  3MUO A;  2I0S A;  4KFM B;  3EQ8 A;  3MMY A;  2YNN A;  3VI4 A;  5FA5 B;  4A2L A;  4O3T B;  1JMZ B;  3OKY B;  4ZOZ A;  4DNU A;  4J77 A;  5TEE A;  2VDP A;  4ERQ A;  2IUQ A;  4K3J B;  1MDA H;  5FKR A;  3IUR A;  3IJ1 A;  3PXS D;  2HYE A;  5AFU 3;  3NVX A;  1SHY B;  2QZP A;  5M5U A;  2AGL A;  5FKT A;  4LG8 A;  4GZ8 A;  3K26 A;  1QNI A;  3EWE A;  2IWK A;  2VDN A;  3SBP A;  3IJE A;  4FA4 D;  4GGC A;  3IJC A;  3QHY B;  4YVD A;  4UM8 A;  3MZK A;  2AH0 A;  4A11 B;  3C75 H;  2YNP A;  5HE0 B;  2QC5 A;  3T3P A;  4BL0 A;  3U4Y A;  5GMK n;  1JMX B;  4NSX A;  2IAA A;  4IMM A;  2IUV A;  3DXM C;  3AL9 A;  4JSX C;  3I7P A;  4AMY A;  2CE8 A;  5H17 A;  3EI1 A;  1L0Q A;  3IKO A;  2XZG A;  3PVW B;  3SBR A;  4PBY A;  2HKR A;  3IUQ A;  1JOF A;  5IJ7 E;  3MVD K;  3SHF A;  1A0R B;  1TYQ C;  5A2Q g;  2J56 H;  3JRO A;  4J78 A;  2PBI B;  5E6U A; 
#chains in the Genus database with same CATH homology
 5AJA A;  2HJB A;  4GQ1 A;  4U1E I;  4XEI C;  3VGZ A;  1XKS A;  4J86 A;  3CFS B;  2BCJ B;  4IA9 A;  4XYI A;  4UI9 R;  5FLX g;  2Z2O A;  3I89 A;  2B4E A;  2H13 A;  2I3S A;  4FAV D;  4G56 B;  4O1Q D;  4A09 A;  2H9P A;  3SFZ A;  5JWZ A;  4GGD A;  3IJ0 A;  3PVU B;  2IUP A;  3MXX A;  3ORV D;  5IGQ A;  5IT9 g;  3J80 g;  3F3G A;  3UKR C;  1PI6 A;  3I7O A;  1VYH C;  3KRX B;  3RRM C;  5C9Z B;  1XHM A;  4JT6 C;  2AGY A;  2XL2 A;  5HYN B;  4J79 A;  3RFH A;  5TDH B;  1K8K C;  3B7F A;  5K1C C;  4N14 A;  4ES0 A;  5TEF A;  4U7A A;  3RSE C;  1FWX A;  2HKM A;  4J81 A;  4K3I D;  2HES X;  3I7L A;  5C2V B;  3KRW B;  4A2M A;  4JT5 C;  4O9D A;  3FGB A;  4A0A B;  3BG0 A;  4GQ2 P;  4A0A A;  3C9C A;  4J0X A;  3CIK B;  5HE1 B;  3NVQ A;  3V7D B;  1MG3 A;  4CY2 A;  3JPX A;  1U2V C;  4CI2 A;  4GGA A;  4O45 A;  5TF2 A;  3DXK C;  4A08 B;  2PM9 A;  3C5M A;  4ERZ A;  2P9I C;  2J57 G;  4H5I A;  4X3E A;  1N6E A;  2AQ5 A;  3EI2 B;  2OVR B;  3HFQ A;  4J8G A;  3OKT A;  4FAN D;  4CY1 A;  3I7K A;  4CI8 A;  2YB8 B;  3AFC A;  4L3H D;  3SN6 B;  2UZX B;  3JB9 L;  5EM2 B;  2I3T A;  3PXT D;  4EWR A;  3A0F A;  4GMB A;  5GSA A;  5AMS A;  5EAM A;  3EU7 A;  4CY3 A;  2Z2P A;  1B9X A;  2HXC A;  1PBY B;  4PXW A;  2H9M A;  2P9U C;  4GM9 A;  2CN2 A;  2AH1 A;  5THA A;  3RN0 D;  4FB1 D;  4CI1 A;  1TBG A;  4H5J A;  5CYK B;  2GC7 A;  4FHL A;  3SVW D;  4E54 A;  2IWF A;  2CNX A;  4PSW B;  4QRJ A;  4A09 B;  4J87 A;  2AGW A;  4JSN C;  2OJY A;  4D0K A;  1YFQ A;  3ULE C;  3PE7 A;  5CXB A;  1SQ9 A;  5IGO A;  5EMK B;  3SWS D;  3PSL A;  3JZN A;  5EM2 A;  1JJU B;  1GG2 B;  2YNO A;  4CC9 A;  1NR0 A;  2GNQ A;  4J73 A;  4J0W A;  3SBQ A;  2B5M A;  3P4F A;  1MG2 A;  3UKU C;  5EAR A;  2XYI A;  2P9P C;  2H6K A;  2CO0 A;  4D6V A;  2OIZ A;  4GQB B;  2H68 A;  2P9N C;  4ERY A;  4E5Z B;  4PSX B;  5FKQ A;  1ERJ A;  2GC4 A;  3UVL A;  4L9O A;  4JXM A;  5CXC A;  2W18 A;  3SJL D;  3ZWL B;  5GXH A;  4X61 B;  5IC7 A;  2OVP B;  5HE2 B;  3F3P A;  4OWR A;  4J82 A;  2CN3 A;  1U4C A;  1S4U X;  3AL8 A;  3UVM A;  3EI3 A;  3OW8 A;  4CZY A;  2TRC B;  3RLM D;  3IIY A;  5CXB B;  5B4W A;  1K32 A;  4A08 A;  1R5M A;  3I7N A;  3W15 A;  3J81 g;  1Q47 A;  2P9S C;  5EMJ B;  3MKS B;  4LG9 A;  1N6F A;  3EI4 B;  3E0C A;  3I8C A;  3UVK A;  2P9L C;  3C99 A;  3MKQ A;  4I79 A;  2XL3 A;  2H6N A;  3F3F A;  4Y7R A;  2H6Q A;  2H9L A;  4R7A B;  2PM9 B;  2EBS A;  3OL2 A;  2BBK H;  1GP2 B;  3DSM A;  5EML B;  4O3U B;  5EAL A;  4BUJ C;  2OVQ B;  4FA1 D;  2OK6 A;  3EI4 A;  2J55 H;  4PC0 A;  2G9A A;  4CY5 A;  4E54 B;  4AOW A;  4X60 B;  3N0D A;  1GXR A;  4A0B A;  3OKW A;  5K19 A;  4HDJ A;  4J84 A;  3DWL C;  2P9K C;  2MTA H;  1XIP A;  3OKY A;  3SMR A;  4FA5 D;  1B9Y A;  3OL2 B;  3IIW A;  3BG1 A;  3AL8 B;  3AH8 B;  3JZH A;  4MK0 B;  3GFC A;  2H14 A;  1OLZ A;  3N0E A;  4OZU A;  3UR4 A;  2UZY B;  3VH0 A;  4JSP C;  5KDO B;  3EMH A;  3UVN A;  5EAP A;  4CZV A;  4ZOY A;  3EG6 A;  2CE9 A;  5FKS A;  2O9K A;  5I5M A;  3K27 A;  2OK4 A;  1P22 A;  2CO0 C;  5H1M A;  2I0T A;  4L1Q D;  4AEZ A;  3VA6 A;  5FXY A;  2AGZ A;  4JD2 C;  4Z8L A;  4XYH A;  3FRX A;  5HE3 B;  2Z2N A;  4JSV C;  4QL1 A;  3L4O D;  3JRP A;  4ZN4 A;  4J8B A;  3JAM g;  3OTT A;  4PNK B;  2H3X A;  3RN1 D;  4ESG A;  3DM0 A;  3EI1 B;  3NVN A;  3SCY A;  5C2W B;  2PM7 B;  4ZOX A;  3V9F A;  4PBZ A;  5HQG A;  2B5N A;  2QXV A;  4A7J A;  3EI3 B;  5FQD A;  1PGU A;  5GXI A;  4ZOV A;  1N6D A;  3RFG A;  4A11 A;  2AGX A;  5EMM B;  4GM3 A;  3CFV A;  3I8E A;  2IUR A;  1RI6 A;  2PM6 B;  4BH6 A;  3ODT A;  1SQJ A;  4E5Z A;  4LGN A;  5H14 A;  3UVO A;  4TZ4 A;  4Y5R D;  2I0R A;  4A0B B;  5I5I A;  3GRE A;  3JZG A;  2Q7Q A;  3RMZ D;  4QQE A;  5IJ8 E;  1NEX B;  3FM0 A;  1PEV A;  5CYK A;  2G99 A;  4X63 B;  2YMU A;  3I7H A;  2YBA A;  3I2N A;  3BWS A;  1OMW B;  3SLE D;  5SXM A;  3EI2 A;  3MZL A;  2B5L A;  3PXW D;  5I5J A;  4FA9 D;  3V5W B;  3SXT D;  4FWW A;  4QT8 A;  2XU7 A;  4CZX A;  3L4M D;  1GOT B;  2H9N A;  5CXC B;  4CI3 A;  2H47 A;  3PSC B;  2HJ4 A;  4GM8 A;  4L3G D;  2I0S A;  4KFM B;  3MMY A;  2YNN A;  5FA5 B;  4A2L A;  4O3T B;  1JMZ B;  3OKY B;  4ZOZ A;  4J77 A;  5TEE A;  4ERQ A;  2IUQ A;  4K3J B;  1MDA H;  5FKR A;  3IJ1 A;  3PXS D;  2HYE A;  5AFU 3;  3NVX A;  1SHY B;  2AGL A;  5FKT A;  4LG8 A;  4GZ8 A;  3K26 A;  1QNI A;  3EWE A;  2IWK A;  3SBP A;  4FA4 D;  4GGC A;  3IJC A;  4YVD A;  4A11 B;  3MZK A;  2AH0 A;  3C75 H;  2YNP A;  5HE0 B;  2QC5 A;  4BL0 A;  3U4Y A;  5GMK n;  1JMX B;  4NSX A;  2IAA A;  4IMM A;  2IUV A;  3DXM C;  3AL9 A;  4JSX C;  3I7P A;  2CE8 A;  5H17 A;  3EI1 A;  1L0Q A;  3IKO A;  3PVW B;  3SBR A;  4PBY A;  2HKR A;  1JOF A;  5IJ7 E;  3SHF A;  1A0R B;  1TYQ C;  5A2Q g;  2J56 H;  3JRO A;  4J78 A;  2PBI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...