4D0BA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
276
structure length
276
Chain Sequence
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
molecule keywords MHC CLASS I ANTIGEN
total genus 56
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d0bA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4d0bA01
4MQSB 1MJ7L 3IDUA 3MRRB 3V0VB 3V6BR 4M43L 4LHJB 3ETBF 3TV3L 1X3DA 1CFVH 1RULH 5D93B 4K71C 3IU4H 4M8VA 4I0PB 4XAWL 5BRZE 5I8OL 3PDGA 1FN4B 1T5XB 5EWIH 4YNYB 3CLFH 3DYOA 1FCGA 1HWHB 2F54B 5A2FA 3W0WB 2ICWI 2ADJB 4GW5B 3JUZA 3BZDA 4G9FA 1WWAX 3HR6A 3WUWA 3QDMA 3MRBB 1IC5L 3L3DB 4YX2L 3QNZB 1JWSA 4PV8A 4U33A 4TOYL 3QUZC 4J1UB 4Q97A 2XY2A 5L7XL 4I3SH 5I8KL 1IAII 1QRNB 3TN0A 2WWKT 1SEQL 5AZEL 3TBYA 5HTSA 2VB5A 4U1GB 5GGVH 2G60L 5D72H 4PJGF 1K3ZA 4P2QE 3WHXA 4R0LB 3TCXA 1EXUB 5IK3B 1Y0LB 2FO1A 5T3XE 3IDXH 5CP3H 4O2FA 1AR1C 1MRFL 4S11A 5FM5O 1MAKA 4HK0B 4LHUA 5DXWA 4BSWB 1VACB 4PJEF 2B1HH 1P9MA 1J1PL 3JV0A 4L9DA 3GZKA 4JG1L 1ZLVK 4FFWC 4ELKA 4L8SA 4TUOA 2EXWC 2R23B 3R0MA 1K6QH 5MI0B 4I0PA 5CD5C 4XPHH 4IRSA 4XTRD 2H8PA 3ZHDA 4JFED 5HHMD 5I1GL 2D9CA 2WV3A 3MUZ1 4HKXB 1IT9H 4R8WL 4Z7NE 5FYKD 1FGVH 3S37L 3QFJA 4HWEH 4PJXB 4XBPA 4Z7NF 1XMWA 5ADOL 4X4YA 5I16B 4H8WC 3HI6H 5E08L 4GXVH 5IHLB 2DQUH 4PJHE 5GGVL 5BV7B 4OLXH 3IDIB 2C5DC 3ZKMD 5HYSB 4JQIL 3GIVA 4HK3N 4GMSL 1LO2L 2MFNA 3M17A 32C2A 5KOVC 1LO5A 4O5LL 4GLRI 1WBZA 2ZPKL 5IFJB 1EAJA 3RWDA 4POZC 4JREB 1D5BA 1MUJA 5GGVY 3T3ME 3DO7B 3MRMB 5K9OB 2ESVE 3BPCA 3WNLA 3ZKXB 3TFKC 1HXMB 4AEHL 3VXQA 4NO2B 3A6CH 1ZLUK 3ALPA 4HGKC 4F7EB 4N8VA 2R2CA 3L5XL 3CH1B 1QBMH 4FXGB 4JZJB 4P5MB 1ONQB 3MLWL 3FT4B 3KS0J 4NQXA 3PL6A 1KF9B 1LP9F 3S3JA 3SHSA 2AK4B 3HNVL 4P2OA 5ACMA 3DGGA 2C1OA 4KJYA 3BO8A 1F6AB 3EOBA 2AV1A 3P4MA 1JN6A 4BKLB 3LN4A 4RZCA 5F9OH 2WIIB 3PGDA 3OXSA 4NUJA 4MA1B 4YHIA 2E8YA 3BWUC 4BQ9A 5I19H 1TQBC 4R96A 1JI1A 4LSRH 1RUPH 4PP1C 1CS6A 3ULSA 4ZFOB 2HN7A 2O5XL 2RBLA 1BF2A 2VZOA 3BKCH 5KSVA 3KPQB 3EO0A 3L3KB 4TN9A 2OR9H 1JRHL 1K8IA 1MFEL 2DQTH 1CK0H 2DD8H 3X3GH 4PJCA 1HXYB 5JPMB 3LIZH 3LEVH 3VRJA 3A0OA 4TVPH 4JDTH 4NCC2 4IJ3C 4NYLB 4KVCH 5EA0H 1E4WH 2BNQB 3D48R 3DMMD 1RQ5A 4JFOB 4P59L 4UT9L 4HQQH 4U6VH 5EZLB 2XYCA 5JXEA 4L9LA 5C0BD 4OI8A 1WUNT 2P8MA 1PYWB 3HMXA 5GJSH 1UH4A 2PO6C 2W9DL 4RQQB 5F7KC 5DVOA 5DMKB 4A6YA 4IM8A 1IGCL 3LZFL 3D0LA 5AEAA 5CJQL 3C87A 5ITFA 3SCMA 4XC3H 2BZDA 2FL5A 5BS0A 1NUDA 3THMH 1GVIA 1WISA 1YUHA 5FYJD 4X6EA 5DJ0A 3V5KA 3VMNA 4PRAB 3LPGA 3RTQC 1RU9H 5FF6B 1GRWA 4PRDA 1TETL 4NKIH 3B9KA 3OKMB 1S7QA 2IMMA 1CGTA 4ERSL 3PWPE 1UM6H 3IKKA 4C4KT 4WEBH 2M2DA 5C0AB 4PP2B 1M7XA 2P47B 4MCZA 4Z7WE 1V3MA 1P7QB 5L88H 4EUPG 1Z9SA 1AXSB 3LDBC 4R7DA 2BMKB 2PTTB 1OP5H 5BMFL 1RHFA 3VXUD 4MQTB 3K4AA 4F37K 3FQTB 3WXWH 4FXKA 1M05A 1AE6H 4F58H 4RWYH 3M07A 1ZHLA 1L9NA 1DQMH 1HHKA 4P4RB 2EIBA 3IAQA 1BREA 3TBSA 5HHOA 2R1XA 3GK8L 4X6DB 4HS6A 5J1AB 3OHXA 1MLCB 3ARSA 2XY1A 5C09D 4B7LA 4LSRL 2A6DB 3EOAA 1INQB 1XGPB 2EDYA 3MZTA 2GK0A 3NACL 4YHPB 1MI5A 4FG6D 5C0CD 4NOFA 3ARDB 1QSEB 3PQYA 3BGAA 3GMMA 4J3OC 4OTXH 1IILE 1S7UA 3BE1H 4CUCA 4QHMA 5D71H 3WS6A 2A9ML 4MNHB 1P4BL 3ZHLA 2XZQH 3Q6GH 3KPRA 5EBWB 2H6PB 2EZ0D 4Y16B 3KPRE 2FIKA 2XOTA 4GKNB 1QBML 1MCRA 1S7TA 1WV7T 3ARFA 4F7PB 4L3ED 3F58L 4OD3L 1FZOA 1U8HA 1J1XH 3F7RA 1KTDB 3KPSE 4J2XA 5IV2A 3FT2B 4RX4A 3QWRD 4F2MA 3HC4L 5F9OL 3QDJA 2IBZX 3WS3A 1CD8A 4CVUA 3F62A 3JWNC 4FQLH 4Y1AE 2XNAA 4G59A 3T65B 4ZFZA 4PJXF 2VDQH 2NYYD 3IJSB 1BQUA 4OD2B 4MJIA 4Y5YA 1N6QH 3EJZC 3NCCB 3AMKA 2YSSB 1AP2A 2BDNL 4RIRA 3FRUB 4X0KB 5JHLH 4K7FB 2Y5TB 3C60B 3ARGA 3A6BL 2QTEA 1C16A 4OI7A 5DMJB 2XN9E 4JFHE 2VKWA 2PW2B 2V7HB 3GSNH 1KJMB 3F12B 2ADIB 4QLRA 1NC2B 2OS7A 1OAQH 2X4SA 3EOAB 2VITB 4NRXB 5IIEA 4JKPL 4P4KB 1FC1A 4JFXA 2IANA 1FORL 4W70A 4I0PC 2QSCH 3H3PH 4OLUH 2W60A 5IV2B 5D7LE 3ESVF 4OLZH 1YEIH 1MI5D 3VGHA 2FGWL 1FZOB 1YJDC 3TIDB 3TM6A 4XVTL 2V2WA 1QSFB 2ERJC 2YC1B 1UM5L 3SOBH 1UB6A 3HN3A 2OQJB 1NEUA 1ZA3B 4R7NB 4OGYL 4Y16A 4ZO8A 4OLXL 4XHJC 2AK1H 4OBSA 4PP1D 4R0LC 4OFKA 4WUUA 1UVQB 1EDQA 2D0GA 3P2TA 4JFFE 1JHTA 1MCNA 5GSVB 2FO4B 2X7LB 2OJZH 1B0RA 1MCSA 3VFUA 2P5WD 5D7LB 1QLFB 1XGUB 5DRXB 4D8PA 1FLTX 4POZD 1TTGA 4UOJA 4PRAA 4Q0XH 5MEQA 1K6QL 2XG5A 1NFDF 4XMPH 4ODUB 3SO3B 4DTGH 2EDWA 1A3RL 1DLFL 4OQTH 3MC0A 2PYEB 5I1DB 1HHKB 2APXA 3M1BB 4KRLB 4G7YL 1URLA 3MGTA 4OGXH 1MCKA 5I8OH 4M02A 2YPKB 5T1LD 3FO9B 1ZT4A 3CCHA 4PDCE 2BMKA 1TZGH 3HMWL 5HHPA 1ZHKA 4MVBA 3V6OE 3C60D 1KULA 1CTOA 1J5OL 1NGPH 3S5LG 3CFJA 2FH6A 3ILQC 3RWIB 4M6NH 1HQRB 4LLWB 2IAND 4K7PY 3N0PB 2A2QT 5C09B 1XGRB 3P0YL 4LNRA 4AM0A 3B9AA 4HHAB 4M5ZL 3F7PC 4ODBD 5J13C 4NJAH 3PL6C 5C9JB 4I77H 4UTBL 3BMWA 4ZFOA 3KLSA 1U95B 4GAYA 3O2VL 1K2DA 3O4OC 2VJXA 3HKFA 5HDLA 3QUKB 4HT1H 1KCUL 4X5LA 3MNWA 5SV4A 1PG7H 2FWOA 3P4MB 3HLAB 4G7VL 4Y2DC 1NCAH 1BVKB 1EO5A 2Y7QB 1FV1A 1YMMB 4I3RL 4NNYA 2NY1D 3MODL 4WTXA 3BW9B 4E5XA 1T89C 1MVFA 1A7QL 1Z9LA 3MLPA 3I02A 1P4IL 1I1FA 2IG2H 3ET9F 3TO4D 3BP7B 4O2CB 4LCWA 3MLSH 1GSMA 1EEZA 3GSVA 3HB3D 4TTDD 2Q87A 1CD9B 3FB8A 5D8JH 1WAAA 4PGZA 4OZIB 3ZKQD 1RURH 1WZ1L 1CVSC 1X6NA 3L5WA 2HFTA 1MWAL 5A2KH 1HNGA 1KJVB 5HI4D 1B0WA 2DYPD 3CXDL 4LEXH 2DQHL 4PJ5D 1Z0MA 3LS5L 1JFQL 4WHCA 3SCMC 4RBPK 1EFXB 2P1YA 3GFUA 3H8NA 5JMRA 4KY1L 1EEYB 5E7BA 5GS0D 2HT2D 4D0CA 1JGLL 5JZ7D 1KG0A 3VDAA 3DXAA 5J89A 3EOBB 3EZJB 3DMMB 2BDNH 2BY2A 4Z6AT 5IBLC 2R2HB 2HG5B 4LL9A 4R4BA 3IDMB 3GHBH 3KPOA 3KPNB 5ALCL 3FFCD 1QBLL 2FRGP 1W8OA 1I1AC 1YEFH 1CGSH 4UV7L 3ERYA 5E8NA 4AG4H 5TQ2L 5E4EB 2YS4A 1TJGL 2XZZA 4FQLL 4MB3A 3WLWD 4PJAE 1ES0A 2DBLH 4YDVB 3BGMA 4RGOH 3NIGF 5HYJA 3WIHA 3OB0H 3H0TA 4HH9A 1AGCA 3PGFL 2OBGA 4LBEA 4M62L 4KMTH 2KL6A 5FKAA 4ACPA 3SJVB 5DQ9A 3H42H 5C0RL 3W9EB 3TA3C 4WW2A 5CP7B 5ENWB 4PRBA 4BQ6A 4V3DB 2YPVH 3QIBA 4PJCB 3WKNA 1NGWA 3I50H 12E8L 1MIEH 1YNLL 3GMLA 2VABB 3QQ9C 4JRYD 4PGJA 2P24B 4WI5A 4M6ML 5HGAB 5IBUB 3ALXA 2XZQL 1Z2KA 1MCHA 4LDLB 2R8SL 1MNUH 4Z9KB 1V5JA 1XGQA 5ADPL 4BK4A 2HFEB 5ANMA 3HE6A 4LFHG 2P5EE 4YHYB 1MFEH 3EGSA 5BV7L 2OTWB 3WS6C 2P44B 5I15H 1Q0YL 2VKXA 4L8SC 4S1QL 4X6CF 5HYQB 1QFWI 3KPMB 4PGBA 4KJYB 5KJRH 4M7LL 1KIQA 4HKBA 1MWAB 1QSEE 3RWFA 4TUOB 3IGAA 1DZBA 4Z7QF 4LPCA 2R2BB 3SE9L 3G6JA 3VI3E 1FBIH 3RAJH 1RJYB 2HTLD 3X12B 2HJKA 2Z35A 3BESR 5DDHB 4F33A 2VH5L 2ADFH 4HK0A 2AK4D 1HEZB 4WW2C 1FO0B 3DTXA 1Y0LA 4PJEE 4G5ZL 4AQOA 4PGDA 1JFMA 1BZQK 4QCIA 3P40A 3OGCB 5EZOH 1G1CA 3UX9B 5LBSL 1BZ9B 1HH6A 5GS0L 4HWZB 3T4AA 5D4QA 1G6RA 4YHNA 1NCNA 1WBZB 1CG9B 3QR2A 4TRPL 3AY4A 4NC0B 1WIPA 4W6WB 3QDMB 4NQVB 1OL0A 5I1IL 1UWEH 2VXSL 2DQIH 2J8HA 2AGJL 1NGXB 2D7TL 3ILQD 5I74C 4UUJB 3I6KA 1WZMA 3JV6A 4P46B 5IW3A 3TT3L 3VXTA 4JG0H 3GHEH 5ETUB 1J87A 3GK8H 1L8JA 4RWHA 3BJ91 4HIHA 4WI6A 4PJFA 5DA4A 1FVDA 3CX2A 1HSAA 5C2UB 1AKJD 2HH0L 3MUJA 1Y18A 3CUPA 3U36B 3QFDA 3UTQB 3MRRA 2UV3A 3DTXB 3MLSL 4LLQA 3SGDI 1NCWL 3MLVH 4C56D 3RUGF 4ORZC 1RVFL 2BY3A 3D25A 5EU5A 3UTSA 1BBDH 1TPXB 2DLFH 2JELH 3RJQB 3FRPA 2B2XH 1SJHB 4XNZC 4IBLT 1CFTB 5BXFA 4ALAL 1UKSA 4MXVF 4HPYL 1R24A 4RFEB 5DD6B 2UVFA 3RGVB 2FBJL 3FAWA 5JOEA 1UXSA 2FSEB 3ZE1E 4QY8A 5B4MC 4PJ7B 1EO7A 1JGLH 4PJ9C 4JG1H 5C0GB 4Q9RL 5IMOA 4RISL 5HGGS 4MNQD 1IM9D 5H2BA 4F57H 1NC2D 3SE3A 3SPVB 4Q2ZB 1WC7B 2FJFB 1J05A 1P7KA 3MJ9A 1E27A 1FPTL 4OF7A 4S1QH 4XZUB 2ZUWA 1SEQH 4ZQKA 3TYGL 1FZJB 3I84A 5F7EH 1GZPA 4WGVB 2DQGH 3VFGH 3L5XH 4LLYA 1FN4A 4EKXA 1TZGL 3ABZA 2G5RA 3O6ML 2F74B 4JR9L 4JJHA 3KYMA 3LEVL 1IQDA 3C5ZB 3CDGB 4QRRB 2Z8SA 1K8DB 4GKSB 3Q5TA 1U3HA 1A7RL 5KN5A 1OAUH 5BJTA 1Y6NR 3ARED 1MREL 3FQXB 2VLKD 4WHTA 3BRFA 1AKJA 4ZOEA 1KGCE 4GKZB 4M4PA 5D5MB 4DFHA 2DYPB 3KPOB 2W1NA 1ZA6A 4JFQA 2R0LH 5I75C 3V4UL 3O4OB 3LQZB 4DZ8B 4MGXA 4Y2DA 1CT8A 1FNFA 5F1IB 3BEVA 2NY1C 5C09E 4RGOL 5E9DA 3ARXA 3OAUL 2VLKE 1RAMA 4KKCD 1NGQH 1SYSB 3BZFA 4D3CL 3GHBL 4IOFD 1F4WL 4X4MA 4O00A 1V7NH 3VWJC 3MRFB 1I7RB 1TQCC 1VFUA 4XP4H 2JK5B 4LU5L 1UQSB 4QXUH 5HI4C 5SWQB 1KB5L 1QG3A 1T4KB 2WAHA 5AG8A 2QSCL 3H3PL 3MLYL 3L9RB 1CD1B 4X6CB 3HC0B 4MDIA 4LCUB 1QRND 2H26B 3RGVD 4L8DB 4I2XA 2EIEA 3TJEH 3C8KB 3LQZA 5JOFB 5JORB 4M93C 5CWSB 1PLGL 1LP9B 1XF5B 3OR7B 5GS1A 5BCAA 5E95B 5D70H 4UNVA 2GTZA 1HQ4A 3GMOA 4NT6A 4PGCA 4X83A 1VERA 4KI5D 2P46B 4EUPH 2NZ9D 1L0XA 5E2WH 5HGHA 1DQJB 3BZEB 5D2LF 2CDEB 4JPWH 3EZ8A 1R24B 2EH7L 3RVVC 3NPSC 2EEDA 4Y2DD 2XWBB 1CE6A 1GJIA 2PR4H 3ULUC 2NQCA 1OGTA 4F3FB 1IAOB 1G7LA 4M5ZH 1PW3A 5IVZB 2N7AA 3Q3GA 5IIEB 4K7PL 5HVHC 1DQLH 2PO6A 1GGUA 2VZTA 4TTDC 2A74B 3QNXB 2H9GB 4U31A 4AMKL 5DWUL 3D3VB 3EFFA 3WFZA 2BNRD 5MP6L 4WHYH 3BN3B 4LSSH 3GKWH 3Q5OA 2K3TA 3N85L 1RZGA 4L4TE 3RUGB 1LK3L 5J6HA 1W8NA 4WO4B 5I74B 2OL3A 2VXUH 4KRPC 5KSUB 5IVOA 3GMPB 3TT1H 4GQ9H 4GRLC 2M26A 4I3SL 2ORBH 5EPMA 4K8RC 1DSFH 3SE4A 3OXRA 1AI1H 2XICA 5EUKA 3OJ2C 3DRTB 1OARL 3ARGC 1DBKL 1JI2A 4K2UH 1QEWA 3O0RL 4XPAH 1BOYA 5CEZD 1VGKA 5DEGB 3VA2C 4CBPA 1XZ0A 4UMGA 1X6LA 3FB7A 1SY6A 4OQTL 1NGZA 3MRQA 3FOLA 4FRWA 2WUCH 5K9KB 4YK4C 4MD4A 1WAAF 4K7PX 3UPAA 2NX5E 1HYRC 4OZ4A 5DDHA 1S7TB 5B39B 4PGEA 2X44D 5FM4A 4AYFA 1AFVL 4Y19E 4Z95H 1H3XA 2IBGA 3LQMA 5GGUA 5A1AA 4KI1A 1IFHL 3EO9H 3CMOL 1JK8A 2V5YA 3WV0A 1G84A 4PJDB 1LGVA 5FYJH 3ZLQC 4UBDD 4F7CA 4MAUH 3BDXA 5CJXA 2D7MA 5D7SH 4GG6A 1D9KC 3K74B 3GNML 1JMXA 1IM3A 1MOEA 2V7NB 3U9PL 3QQ9D 4CW1A 1VFMA 2R9HD 3FONA 3Q6FA 3O3UN 1J86A 3LHPH 1PJ9A 3HE6B 3GSUA 4IRJC 1CDJA 4OLVL 2YRZA 3RDTC 4RIRB 1DBBL 5D2NB 5IEKB 4X5XA 4PB9H 3GJEA 5DQDL 4OZGA 5FYKE 1SHMA 2R15A 3O6FA 1G6RL 4QXTA 3AY4C 5E8PB 2ERJB 1NUGA 1FL3A 4HPYH 3SKUD 1YYLH 3QUMH 4JFEE 5HHME 5CINH 3WXWL 1OAXH 2XNAB 5FOBA 9CGTA 3GSNL 2GUOA 43C9B 3RI5K 1KTKE 3IGAB 5D1XD 1AGBA 4PJ8C 3T8XA 1CK0L 2CKBH 2AXHA 1VKXA 4LBEB 4F8TA 2E9JA 1TVBA 1ZVYA 4H8WH 1CGYA 1PGRB 1CLOH 2IAMB 2XQYG 3DVNB 3WBDA 1FIEA 4NO0A 3RNKB 2NY5H 1KUMA 3JVGC 1J0IA 1O7VA 2K7PA 5DRNB 4JGUA 1F97A 3QUYB 1H3WM 1X5LA 2Q6WB 2Y9RT 1FO0L 5AG9A 5CJ8A 5EO1A 4JFEB 5HHMB 4YXKL 3CC5A 3STBA 1RK0B 5B3JF 3ZDYE 5D7SL 3CXHJ 5AWNH 3FT3A 5J1TC 3P9LA 2J4WH 5GS2D 3P0VH 2XPGB 1QSEA 3PQYB 2D7QA 3V6ZA 3MXWL 3D0LB 2VLJD 2AP2A 2XV6B 2NY0D 2BOBB 3NCEB 3MPCA 1EJOL 4GSDL 1YDPB 1HNFA 1X5XA 5EU6E 3C6LC 1HKLL 4GBXB 2PW1B 4LARL 2Z93B 4LVHC 3RRQA 5I30L 2DMBA 2XACC 4MSWA 3BE1L 4LPXA 4ZUWB 2C3VA 1FE8L 2SEBB 1OSPH 5DA0B 1PFCA 4LRIC 4WI9A 4H5SB 5SWZB 2BHZA 2IQ9H 5CGYD 3NABL 2ZCLH 3TBWB 4JO1H 1YA5A 1M05B 4ZSOB 1T66C 4NFDA 2XWTA 3KPNA 5E99H 5AUMB 1F00I 2FEEI 1OT1A 3BP7A 3VXPB 3K2UL 5FEBA 1AXSA 4Q6IA 2Y5EA 3WEXB 4O51A 1CWVA 2BNRB 5IROC 3QG6B 3SJVD 4NGHL 3UTOA 1A64A 3CU7A 3H42L 5C0RH 3O3DB 4XWGL 3O3BA 5I1AA 4G8IA 2W59A 5I1KH 3G5XA 4PJCF 1R3JA 2WBJC 4JY6A 3LPWA 3UZQA 3UTZA 3QDGA 3FAXA 5FCUH 5F7LB 1P2CB 5GQBA 2OMBA 4O51B 2H1PL 3S35L 1MNUL 4DCQB 2IFFL 2IH1B 3VXPA 4OFPA 4LF3A 4M6MH 4R8WH 4OCRH 5IOPB 1XGTA 5D2LB 2DQDL 4RGNE 4OZFG 1AHWA 5I1GH 2YPVL 1FFPA 5D1ZA 4M3KB 4FZ8L 1EV2E 5JLZB 5SWZA 3ZYZA 1GOFA 4Z76A 2AABL 4M1CC 1MRDL 4WUUE 3SDAB 4G6JH 4EI6B 5B8CB 1GAFH 5IMLB 3WNKA 4XNYH 4MQ7A 3K81A 4B41A 1J0ZA 4E5XB 4YXHL 4NN6B 4YDLC 4KJWC 2BNQA 5LVEA 5EOCL 5ALBH 1YDPA 4LEXL 5ACLA 5I1CH 2VDLH 1HHGA 3V7AG 2UZYB 3WE6A 1TZIA 1KIRA 2QR0A 4WVRA 5ALCH 3IVKB 4XX1E 1LO2H 1MPAL 4H8WL 2R2HA 1RUAL 4N0FB 4HAFA 1YEHH 4RAHA 2A9NL 4JO3H 3PGCA 2Q6WA 4AM0B 1HHIB 1I7ZB 3RKDC 3MOBH 2EXYD 3CSPA 2P5WE 5DVMA 3MRJB 2ZNXA 4LLUB 2XKUA 4PRIB 3BUTA 1F42A 3RWIA 5LJYH 3REVA 1UC6A 3D6GA 1FQ9C 2NNAB 2UUDK 5EWIL 5T1LB 2IGFH 1R3IL 2QL1A 4NC2B 1E4XI 3O2VH 2QKIA 1JGDB 4R90L 3MYZA 4MJID 2VDNL 2XWTB 4XP4L 5L8KB 4EOWL 4HXAH 4DK3A 1ZANH 2YD4A 5IBUG 2C4XA 2GT9A 3GB7A 5D7JD 1ACYL 3BGFC 4LCWB 2VO5A 3P4OB 3OBAA 3L95A 1QBBA 2OI9C 2XN9B 1HWGB 1ZAGA 5E7FA 4KK9C 4QRPA 3RWHA 3GSUB 5D1QA 5E2UH 4NKDA 2EYTA 4QGTA 1C08A 3C6LB 4Y4KA 3KDMA 1NGPL 3QO0A 4X7EC 4QRTA 2VSDA 2JIXA 4YPJA 1IQWL 1QYGH 5I0DA 5EU3B 4NQDE 1AO7B 3RDTB 3F7QA 5GJTH 1QD0A 2XKNA 4WU5A 5J3HD 2ZWLT 2BNQD 3BHBB 4X4ME 3LV3A 2QSTA 4KK8D 4RX4D 3RGHA 4XXCA 3B8SA 1KB5A 4GH7B 1JHTB 3IDIA 1E4XH 3X3FH 3QFJE 4K3JL 1AGEA 1QLRB 4PJBE 5F7UA 1KPUA 4PJBA 4JFFA 4I9WD 4CVXB 3S5LB 1UB6B 5CHNA 1KPVB 3T65A 2J1KA 1INDL 2ZKHL 3KXFA 4JDZA 1RZIB 3MRQB 4GQ9L 3UBXB 1Q94A 2L0DA 2F19H 3EYVB 3TZVC 1AGBB 2F15A 3L6FB 3QJHA 4P57B 1KTDA 4APQB 4L8SB 4K3EL 1FPTH 4CN6A 5DRZB 1MY5A 1UG9A 1KJMA 4L29B 3E3QC 2CUHA 3H6JA 1NCDL 3UAJD 3QEHA 4CADB 2Y25A 2UY7A 5CJXC 3OV6A 2EDDA 1ZK9A 1UM5H 3SOBL 4LQFH 1N64L 1U92B 3PP3H 3GBLA 4X7SH 1MJJB 4W4OA 1WFNA 3CLEH 1YY8A 2VDPL 1YEIL 3HZYA 2OLDA 4HPOL 5CJOL 5D7JA 4XXCC 5FYKH 4OFDA 1FORH 1F11B 5SWSD 4JPKH 2MHAA 4YR6B 3OL2A 3UJTH 5IVXB 1IEBA 5KW9H 4OIBA 1N0XH 1IAOA 4L8BB 1UCBL 5E2WL 2G5BB 5D7KD 3UTTA 4E0RA 3QUZD 3HG1A 3X14B 1ZT1A 2HVJB 3HZVB 1BD2B 2NMSA 2Z31B 2EO1A 5I17B 4QYOB 1KN2L 1KNOA 1GH7A 2BY0A 2ATKB 4LDEB 2COQA 1YEHL 2DWDA 1IZJA 4JY5H 3LD8B 1LO3H 2OQJA 3CFEA 1R3LB 3SGEH 3BI9X 4WHYG 3DYPA 4KKNA 1B90A 3KLDA 3V0VA 3FB7B 1P4LA 2PYFB 4M7KH 2BCKB 3U1SL 3CAFA 3KYNB 1LEKA 1S9WB 1A6AA 4HF5L 3BIKB 4NO5B 4P5KB 1S7RB 3KXFD 2BNUB 3FFDA 5IT2L 4DQOH 4LGSB 1C12B 4CL7A 4R3SB 4A6YL 2NY0C 1A8JH 2CK0H 3QULA 4U1IA 4ZYKA 5IG7A 1RZ7L 2BFVL 4JKWA 1U2CA 1S9XA 5KBNC 1RSFA 3PWLB 4CDGC 2DWEA 3BFOA 1Q9WB 4MD5A 1BPVA 4HXBL 4V1DD 3V9FA 4NQEE 1D5MB 3EYSL 4Y5YB 2CK2A 4M6OH 4G8GD 4LSTH 4MB5A 4OTXL 3B2UD 3WE6B 1JPSH 1T6WA 1CYGA 3WXVL 3ULVD 1YEEH 4HWBH 2WQ8A 1ETZB 2GFBB 5F8QC 4Y2OA 3DUUB 3MFGB 4OLWH 5GSRA 5DD0L 1KV3A 1DN0A 3RWJB 4H26B 2VLLA 3NAAL 4MCZB 4L1DA 5I6XC 1G7QB 3WD5H 3ZE0E 1F90L 4PJHF 5E4IA 1IGIH 1XF2A 4NPYB 2P8PA 3B9KB 4I5BB 1TQCB 1ULVA 4OLYH 1AQDA 3PWPA 1KCSH 5AZ2H 4XVUC 1AHWB 1IAIH 4JFYA 4J3UA 1WBYB 3HG1D 5DT1H 3KNBB 2FIKB 2VDMH 1H3VA 4K8RH 4KDTC 4XNQB 4YIQA 1BQLL 2JCCA 1F3DJ 3QI9C 1Q9KA 1BJ1J 2QADD 5FYLH 3E1F1 1AKJB 1CI5A 4WHTB 1LQVA 1EO8L 3NACH 1SJEB 3U0PB 3B9KC 1UJ3B 3W5NA 3VXMD 3QPQD 3BZ4B 3MGOB 4IEFB 4N9GB 4L9LB 1P6FA 3UYRL 5HI3C 1WWWX 4G42B 3OHXB 2CO7B 3V79C 4K94H 1YY9C 1L6XA 2J4WL 4JM2D 3SDDD 3WLBB 1CR9L 4F57L 5ESVB 3QA3B 3Q2CA 4NNPL 3QHFH 1H5BC 1IGJB 4N8VB 4X5WA 4FNLH 4FQQA 4XC3L 2H2SD 3NCFB 4MA7L 3OG6B 1EUUA 4QF1A 2OK0L 2AV7B 2PTTA 2SEBA 4QO1A 4V1DA 2IPUG 1RZKH 5KSVB 4X6DE 4MSWB 5FOJA 3CFDB 4X98A 1J12A 4K9EH 4Z7OF 4O4YH 1L7TL 1VGEL 2ZG1A 1DBAH 5FGBA 3ZKSD 1QFWL 3GSOB 3WLWC 3OXSB 4NUJB 5IFJA 5HYJD 2OK0H 4HIEB 2HJLB 4QY8B 2OTUB 4MNGA 1RVFH 2AJ3A 4PD4K 2VLRD 4EI5D 2NY7L 3O2DA 4DZ8A 4X80H 3KNBA 1JRHH 3ULUL 1RK0A 1A7NL 2AK4A 3TA3D 1OD7A 4NNXA 2NCMA 4G8GE 2PXYA 4P4KD 2WBJD 3LCYA 2W9LA 1FYTD 1C8PA 4NN7C 4GXUN 1W0WB 1DEEB 4OT1L 5HDQH 2Y23A 5I66A 3LD8C 3G04A 4FTVA 1FGNL 5J12B 3WL9B 3KPSB 3MLXL 2F5AL 4U1JA 4JN1H 4XNZB 1CFSA 5KSAD 4W68A 5KVEH 1CICA 2JF1A 4JKKA 3U0WL 5K9OA 2Q76A 3OKLA 2EDLA 2ESVD 1T20B 1CIDA 4N68A 1ZGLA 1HXYA 4HKZB 1S9YA 4HUXA 4FQIL 1KJ2B 4LKCB 1K8IB 4M5YH 1FL3B 5FB8B 1IAIL 3O6FB 2VISA 4NM4L 5HYIA 5T33L 1F6LL 1IGIL 3MV7D 3IS1X 1MFDL 3FTGB 3CZFB 5JW4N 4KZEL 3TNMB 2OP4H 4JQXC 3NFSH 3HI1B 2FB4L 2LAAA 3GI9L 1OARH 3OJDA 4KJQD 2VXTL 2VN4A 1FNGB 4O2EA 2DQJL 3TEUA 2X4UA 3NIDE 3VMPA 4JY4A 2NXYB 5I8CB 2EDTA 3LKRA 3E6HB 5DJYB 1DANU 2V2TB 5EO9B 2A1WL 4NQXB 5BRZD 3UJJL 3EYUL 4P9HH 4JQIH 3V5HB 3VFOB 4QYOA 4MB4A 1KOAA 3RWFB 2GSIA 4XH2A 1U8OA 4YBLC 2WINB 5M94B 3MLRH 4EN3B 2ZUTA 6FABH 4OCXH 4LLQB 3QJFA 4AEHH 1FNGA 2R8SH 1FYTA 4NQED 1IZKA 4E9LA 3AMLA 1M1SA 3HAEB 4P2QD 2LVEA 3M45A 4DTGL 4U6HB 3MYJB 3BPNC 2UYLB 4Y19D 3F6IA 2EIDA 4RAUB 3V6OA 1CDGA 5CBAB 3VGEA 3K2MC 3IFNH 4U1MA 5KG9B 1H8NA 3KYOA 5E1AA 1NH6A 1LQSR 1ORSA 1D5IH 5CGMA 2X89A 5J6HB 1QBAA 4HKZA 1SBSH 5JTWA 1YN6A 3K8MA 5ID1B 3N1PC 3QJHB 3L6FA 2QHRL 2NXZC 3DROB 4DEPC 3S37H 3ULVL 5T1KA 2VERN 5TJWK 5AZEH 2GJ6D 1KJ2L 2HFFB 1XGYL 5GGQL 3O9WC 3BAEH 4TUJA 5E4EC 5I66B 1L9MA 4OZHE 3CH8A 2FLRT 1ZVSA 3HI5H 5FXCH 3O3AB 4U7MA 3U4EB 1HE7A 4R6UA 3O45B 4LQ1A 4R4BB 4DGIH 1EK3A 4PBWD 1RZ8B 3ZO0A 1B0GA 3T0ED 5I8CA 2NY4D 3RTQB 1RUQL 2DDQL 5ISZD 4XAWH 2FX7H 2EIZA 1U8JA 3RL2B 4QXUL 4KHXH 4YHZL 4D0DB 3OB0K 4Y1AB 1OQOA 3VH8G 2H3NB 1J0HA 3JWDL 5A2LH 3OKKA 5KVGH 5DUML 3EYQC 1Z9OA 4WFHD 1ZOXA 3H9ZA 3VE0B 4NQSB 4NHCH 1NGQL 4TOYH 5LGJA 4KROD 1X44A 3L5WB 4F37F 4YEEA 3O11B 2F54E 3GO1L 4X7CC 2OP4L 4XAKD 4KI5E 1KJ2A 2UY6A 4LKCA 2ADJA 4GW5A 4M1DH 4PRID 4IJ3B 1FLRL 4HS8H 3FQWA 4Y4FD 2F5BH 3GGWA 1U6AL 4OD3H 4NDMB 3I02B 3K0WA 2AQ3A 4LFHD 4D9LH 3TVMB 2X89D 2H32B 5T3XH 5FGCB 3TPUA 3MACH 4FQJL 4NM4H 4NJAL 4BK5A 4HH9B 4GRWH 3SGEI 5I2IA 4DGYH 3TF7C 2CKBA 3RNQB 3V5DA 1PKQE 1DUZA 2JTDA 2R29L 4H20L 1HYSD 1U0QA 1I9IH 4JPIA 4QOKE 1GIGL 3VFTB 4HK3J 4L4TB 1M7DB 4IOFC 4Z18A 2PXYB 2J8UA 3LQAH 1H0DB 2DB8A 3LKPA 2F5AH 1WTGT 3IFLL 3VG0L 1G6VK 3DX6A 4D9QD 5IQ7H 3VJ6B 2OZ4L 3WIHH 3T0AA 3CPLA 4GBXD 5TGBA 2NTFB 4XT1C 1EVUA 3OPZL 1FZMB 5J13B 2AJYL 1EERB 2YN3A 1KLGB 1TCRA 4YFDB 4MMZC 5JW5A 3GSOA 1FVEA 2OL3H 2D2OA 3QCVH 4JANB 4JDVA 1G9NL 1NFKA 4AL8L 3MROB 3I6LD 3WN5A 4N8PA 5IMLA 1UM4L 1MHCB 5E8OB 4I4WA 3VGAB 3OF6D 2J2ZA 3J8F7 1U2HA 5IR1B 1NUNB 3QUYD 1ZLUH 5IUSA 4LEOB 4FQQB 1AH1A 1EMTL 1IARB 2GEEA 2YA1A 5L2KA 3SDCD 2C3GA 1FFOB 4WEBL 1TZHB 1E4KA 4PLJD 5I1DA 3T0EB 3N06B 5ESVA 4ERSH 4CNIA 3TF7A 1MCOL 4ELMB 2HT2C 1DLHA 3VD3A 5INCA 3BW9A 3MRPA 5MEQB 1MCIA 2VL5A 5EOTB 4YHLH 3UPRB 4X4XA 1RIHH 4Y4FA 1FJ1A 2FR4A 1R3JB 3NA4A 4BSVA 1NL0L 1SJEA 2YPLA 1VFAB 5C0JB 4NBXB 1JUFA 1GAFL 1YEKH 5F96H 1A3LL 3RVWC 5JA8B 3DHMA 4OAWB 1IGCH 2Q86A 3LZFH 1NGYB 3R1GH 4GOSA 3S7GA 1JYNA 4XNQA 1EHAA 4XP5H 4KHTL 5LGHH 1IGYB 1SVZA 4OCRL 1B6UA 3EW3B 5MENA 2CIKB 3CD4A 5I1LA 4UT6L 3JBG7 1CU4H 1IBGH 2CSPA 1GYAA 1C7SA 2VQUA 1OWRM 4UQ2B 1NBQA 5IMMB 5HHVH 4KRNA 1J0KA 2W60B 3IFPA 1J8HB 3BT2H 2CIIA 2LFGA 5DJXA 5E6ID 1OGAA 2PTUA 4H26A 1DN0B 2X41A 2VLRB 4U1KA 4P4KC 3GJFA 4XWGH 3HB3C 2BOBA 1XT5A 5AZ2L 3IDGA 4U3XA 2X4RB 1MHEA 3H7BB 4TVPE 1WEJH 5A40E 4G9FE 5ISZB 3LN5B 3U7YL 5I19L 1CFBA 3MLTA 5E99L 1MJJA 3PDOB 1FBIL 3RAJL 4Y4HA 4PJ7F 5IM7B 2YXFA 2E7MA 1S7XA 4LHUG 4NM8H 2DQEH 4LSQL 4Y5XC 4ZG1A 1QSZA 2HRLA 2W0FB 1NMBL 5CKGA 4I8DA 2OM5A 4X6FA 1IMHC 1U42A 4JGJA 4GRLA 5A2JH 5C0FA 2ICCA 1WZKA 1EGJL 5C86A 4XP6H 3M8OL 4XCEA 2B0SH 1PBYA 3GSQA 5JQ6L 5JHDD 2VXVL 4KUZH 1TDQA 3QEQB 1SJXA 3MV11 1WCBB 3MV9D 3FN3A 4LSDA 2BCKA 1M7IA 2ICWJ 3BYYA 3BT2L 4EJ1C 1I1CA 5E00A 4KPHH 4UILL 5H94B 1HSBB 2ZUUA 2MQCA 1G9MH 2NY6D 4F33B 3S5LA 4CVXA 5DHVA 1OCWL 3VGFA 4LKXA 3B6SB 3CDYA 3EJYD 1XCTA 5CSZB 5KSAC 3PE9A 4IRJB 4TUKH 3VGDA 3VFPA 2ATPA 3HE6C 2NZIA 4LOUC 4R4ND 5IW1A 3BRGC 3O9WD 3Q5YA 5I9QC 1DVFD 4HD9A 5CZXD 1KPRB 3B4NA 4PR5B 1N5YH 1VFAA 5DFWH 4LK4A 1EHXA 3JTCA 3F12A 1EJ6A 1KXVC 1G9MC 3JXAA 3QEQD 3UPRA 1T5WB 4GXVL 5T5NG 3MRPB 1J8HD 2IALB 3EJYC 4HKJB 4HFWB 2EDKA 3JWOH 1JHLH 1U8MA 1U92A 3KGRA 5IEHA 4G9FD 4LSVL 3MUGA 4TVPD 3BGFB 4YUEL 3N50A 2QBWA 4OD2A 4KHTH 5LGHL 2NTSP 1HYSC 2BOCA 4L29A 1RZKL 5ILTL 1PEWA 3VXRB 2F58L 4PRPB 5FUOH 4NQUA 1A7BA 3ZDXE 1CFQB 3WNPA 5HYSG 1KCVL 2NY2D 1NDMB 4WGWB 4GXUM 5F3HA 1BZ7A 2XXMB 1B9ZA 3MLZH 2JCCE 1TCRB 1U58A 3RKPA 3GI8H 2DQFA 4JRXA 4HGWA 4P99A 3Q1SL 1E6OL 4MJ6A 1KPUB 1N6VA 4KRPB 3JVGA 5J11B 5EFIA 1IC4L 1IKNA 3INUH 4N5ED 2OL3B 5CD3A 4JLRA 3MOAL 2HAZA 4FQPA 4GFTB 4YHOH 4F9PC 2DAVA 4P59H 4I0PD 2CRZA 3RPIA 5BVJA 4LGPB 2RR3A 4K3DH 3BHBA 4YDIL 1Z9MA 3L3JA 2BVQA 1KCRH 1IC5H 1ED3B 1KIRB 3JV4A 2EDJA 3LIZL 1UGNA 3G5ZA 3GIZH 4I1NB 4RQQA 3ZDZF 3KWWB 5J0BA 4K8RL 5BVPH 3DX7B 4MA8L 1EH9A 3B9DA 4KU1A 5I71C 5CIPB 4G43B 2X4NA 5DJXB 5LG1A 4OLYL 4NN6C 4K3HA 4JFZL 4OJFH 3P4NA 3RIAK 3DO3A 1DSFL 1QNZH 4NYLA 4J3XA 4TULH 4UQ2A 5JO5B 5I1EL 2MKLC 4Q58C 3ZL4L 5A43C 3D69B 3LKSB 2IPTH 2IEPA 1VPOL 5FGBC 3IFLH 2EDOA 5E2JA 2E9WA 3FN9A 5KVDL 1U3JA 5GXBB 5MEOB 3N85H 3C6SB 3ME0A 5GGSA 3WXVH 1JPSL 4NQCE 1XR8B 2OSLA 2IBBA 3QPXH 1IGFL 1BEYL 1N5AA 3HAEG 2JJTA 3UTZB 3VXNB 4JPVL 1BIIB 4WTWA 3JWDH 1HH9B 1T83C 3LSOA 2NW2A 2YPLB 2Y36L 3GMQB 5I75B 4HXAL 4NQDB 4L8CB 4G8IB 3T2NH 2NLJB 4BSVB 5FF6A 1QSFD 1QNZL 4KTDL 3BO8B 3VJ6A 1XIWA 1RZJH 4EZMA 1A2YB 1T2JA 2BNRE 2YHGA 3KPPA 5HYFA 5L0QC 3QUXA 2B20A 3I9GL 3L9RA 1SY6L 4OQTA 3ES6B 3ARBD 1XFPA 1TLKA 4MJ5B 4C55A 4ODXB 3F6LA 5D7IE 5IR1A 1WT5C 4Y4KD 4N0UB 4MAYD 4MJ2A 1FFRA 2E3VA 3DI2B 1E4KC 2JK5A 1ODAA 2DM3A 3KG5A 4RSVA 3VXSA 4EIGB 2C3VB 3DURA 1IKFL 2VC2H 4TNVK 4ZUVB 4P2QB 5EH1A 1KC5H 3T1FA 2BSSA 4UIKH 1YN6B 3P30H 4RMQA 4XCFL 3FB5B 3ES6A 3VG9C 1I3GL 4EN3D 1VFBB 1ZV5A 4GRWF 1T83A 5C3LD 4Y2DB 1Z3GH 5J6GB 4F9LC 5C0AE 3KPQA 1AXIB 43CAA 3FL7A 1QR1A 2JB6A 5CJOH 3OR6B 4OV6F 2R69L 1KJ3L 2AXJA 1JTPA 1T2QH 1UFUA 1N64H 4MAYB 1J1PH 1KXTB 3QI9B 1MLBB 1V7NL 1JV5B 3DBXA 4JKPH 5D7LA 3TWCL 3PDDA 1YZZA 3VXNA 2X42A 5GHWH 3V0WH 4CMMA 1IGTB 3MMEA 4PS4H 2C1OB 3IXTA 5EIIA 2F74A 4GW4A 1U8OB 5GSVA 1ROWA 3JV5A 2AEPL 3VI4F 5MI0C 2K9UA 3UC0L 3UTPE 3AREC 2VLKB 5LXGL 5ACZB 2XZCH 1TJHH 4LVHB 2F9BT 5I71B 4G8FB 3VRLF 5I8KH 1TNNA 4WTZG 3VW3L 4KK8C 3B9KD 3E6FB 4HSQA 4S1DC 2VDQL 2PTVA 4KC3B 1QA9A 5GS1C 2Q7YB 5JDSB 3BP4A 4NQSA 1AQKL 3K4ZA 1MREH 5GZNC 4HFWA 4HKJA 2Z93A 4JFFD 3LMJL 3BKJL 4RFNB 1N4XH 4N1HB 4G3YH 3X3FL 1OB1A 1U93A 1GZQA 1MSPA 4ZTPH 4OQ1A 5F7NC 1Y6MR 3BRDA 3TC9A 1HN1A 3RGVC 3VRLE 1JBJA 1UXSB 4YHML 4U1GC 2BJML 4NKQB 1QFHA 2R56L 4JFDE 4DJMA 5I76B 2QQNL 3RPIB 5BVJB 1QYGL 1JIBA 3IXAA 2NY0B 2VIRB 5ISZE 4LLDA 3V52H 1A6WL 1ZHBA 2F54A 1S5HB 4GSDH 1EJOH 3K7UA 5B38G 5BXFB 5KZCD 2OXGA 3EJJX 1C1EL 1O0VA 3OB8A 1KELH 2XFXB 2YUWA 1X7QB 4ONFH 3LEYL 4TUJB 1I8MA 1MFAH 1BHGA 4ZS7H 3SKOB 1ACYH 4P23B 1E28B 2ZG2A 1AGDB 1XF1A 3ROOB 3RWCB 4FQCL 2BC4A 4HEME 5C8JA 2J6EH 3GSQB 5I1EH 3U4AA 2R23A 4P2YA 4NZRL 4R90H 1VHPA 2DOCA 2DL9A 4GUPB 1X5FA 3JV6B 4P46A 4ZXBD 4OCYL 5TF0A 4G6ML 5C70A 2HLAB 4X6FB 4YWGL 5HDBE 1W0YT 4LNVA 5E1AB 4LCIL 4NZTH 4F58L 1YQ2A 4M7LT 1CLYL 1MVUA 1NLDH 2M8XA 4MNHA 5D2NC 4AIZA 2YN5A 1A4JB 5CS7A 3PJSA 2BVOB 4YBQD 3BEWB 4JFPA 1L6ZA 1DUYA 3MYJA 1UADC 1BBJA 5DS8A 1ZMYA 1FNAA 2YEZA 3T0BA 2N7BA 3QNXA 3U0TA 2O5YH 4GAGL 4IDJL 5KSAB 2EH8H 4GS7B 5CMAA 1C5BH 3EOTL 4TVSa 1ACZA 3MRBA 5DO2C 4JO2L 1NLBL 3NZ8B 3LRSB 3CNKA 2Z35B 2C1PA 1D6VL 4KQ4L 1U8NA 3SDXA 2JCCF 3CX5J 4PUBL 1OPGL 1YEJL 1A9EB 2NXZD 2GJZA 2GYSA 2CDEA 2OJEA 4R26H 2YZ1A 5CJQH 4B0MM 2AABH 3PWUB 2XA8H 1R5IB 4U7KA 4I9WE 4U0RC 3MZGB 1GXEA 1M6OB 1A3QA 3FN0L 3SN6N 3W2DL 2V9TA 5GS0H 4PTUA 3V52L 4S1SH 1HK6A 3EGSB 5DFVD 5E2VL 4GJTB 5JNYB 1S3KH 4LSUH 4LSVH 1SEBB 3ARBC 4QRUA 3CVHH 5DD5H 3MREB 1OF2B 2VAJA 4PYHA 3PWNB 3JWOL 4JZOB 1F02I 3CU1A 1DL7L 2B1AL 2WUCL 5CWSA 5DR5H 4H25A 4M93B 4U6XA 4GG6E 3HS0B 3CXHK 1XR9B 5HGAA 4GRWE 1QHPA 3H9SD 4GRMB 1HDMB 5F97E 3UTPD 4WO4A 3QRFM 3LS4L 1D6EB 4QHKJ 3VH8A 1J0YA 3QIWA 2AW2A 4PB0L 1RZGB 3QIBB 4W81A 3P0GB 3MTRA 1TZHA 2AKRA 1BMGA 2R9HC 3AAZB 3PWPD 1WEJL 1T1XA 4NSKA 5JW3L 5HI5C 2I9TB 2QV2A 4KAQL 4LEOA 2J6EL 3V8OA 5T3ZH 4GLRH 3ULUE 2X4PA 3FQUB 1AGCB 3LRHA 3NPSB 3DUUA 2HWZH 4P3DB 4PRHA 5FA3B 5L8JB 4PJIB 3FMGL 4G80A 5KSBB 1DL7H 2B1AH 1DEEA 4QRQA 4QXGH 2FHCA 1NAMB 3SKMB 1IBGL 4FFWD 2VR5A 5DD5L 4K23H 4XNXL 3GEWB 2ZG3A 1B2WH 4KDTA 3BZEA 1NJ9B 2QQNH 2B5IC 4N9GA 4XP6L 4C83A 1UB5A 2APTA 5DTFA 3NGBC 3QAZB 2A6KB 4PRNB 5KVFL 4HS8L 1NMBH 1M7DA 3QUXC 1HINL 1WK0A 4YLQT 4OCSL 3O8XA 5DD0H 3T04D 1EBPA 3MRNA 2EDHA 2GSGB 4GW1A 4YAQB 5DLML 5ELIA 5BJTB 2YUVA 3D1MC 3MA7A 4WU7B 3OKNA 4IIQC 3VFRB 4PRPD 5TQ2H 5JOFA 2VL5B 2F8OA 5HHNA 3VW3H 1A1MB 4DVRL 4JFYB 4NKOA 2ZJSL 4Z7VE 5ID0B 4RRPG 3IKCB 3QA3A 4PJEA 1NEZA 4MCYB 2D7OA 4TPRH 4PJ7E 4U1LA 5IW6A 4WFFE 3UC0H 4YDLB 5KSBA 3BD4A 3MCLL 3QO1A 1J88A 5E08H 3E2HC 1GPOH 1SY6H 3O9WB 1MHCA 5E8OA 4LRIA 3B43A 2MHAB 4YR6A 3MXVL 5IVXA 4ZFFA 4MHHI 5EORL 5H2BB 5D6DA 5FGRA 2DJ4A 2FLBT 4M7KL 5E1HB 4P2RA 4RNRB 4WNQA 4ETYA 5IFHL 1CFNB 1FCCA 4G6AD 1A4JA 5B3JE 1YECL 4PJ7A 5FIEA 1YEKL 1LEGA 4DAGL 1NCBL 3MBEB 1OP3H 1ZSDB 5A16A 1JGUH 5F3BB 5KSBF 3QEHB 3EDJA 1KN2H 4ZUTA 3PWPB 4JZOA 3QRGH 3WIFA 4UIKL 2P8LB 2XTJE 1WFUA 1A6AB 4NO5A 5M7QA 1E6JL 1JYVA 4WJ5A 3WFBH 3U36A 3UTQA 3S34L 2ADGB 2Z92A 1NANH 4JKMA 3RL1B 2R56H 3FO9A 4X9FA 3T0VA 3RVUD 5HDOA 3S6CA 3SKJL 3IDJA 5HHQB 5TH2B 2ATKA 1OY3B 1BD2A 3RP1A 1MIMH 1KB5B 3QCVL 3MLUL 4JVUA 1RZJL 3FB6B 5JXAH 2Y1VA 1EXUA 1CG9A 4BFBD 4H1LH 3DX8B 4XMKL 4YHOL 1KIPB 4N0RA 3CMGA 1FIGL 3VCLA 2WWKO 4Z7VF 2V17H 4OCWL 5GRZA 1ZLSH 4C58B 1TJHL 3DI3B 3ARUA 1YY8B 2OTPA 3HZYB 5E6IB 3HE7C 3RY6C 1T80A 2XG4A 5KS9B 4XX1G 4WW2F 4WDIB 2ICWA 5BV7C 2AEPH 5E5MA 2MQ3A 5TDPA 3GKWL 2E7LC 4CADA 2HLAA 4HUWA 4BYHA 4P49A 1EUTA 4KZEH 4JFHD 5IB5A 4Q9RH 3BUYA 1KJ3H 5FHBL 4DZBA 1I7TB 4UDUA 5DJYA 3T0WA 4ZODA 4HJGB 3CX5K 2BC4B 5C8JB 1Z5LB 3RU8H 5LAXB 1B4RA 1U8LA 1BP3B 4JFZH 1DQQB 3DV6A 4WFED 1KJ2H 1VADB 4NQCA 2YA2A 1LK2B 3PNWB 4ZDHB 1V05A 4EDWH 2P49B 4PG9B 5IHUH 3ARDC 4E42B 4N0YH 4D0BB 1FNHA 4H0GA 4P0DA 1G0YR 4HS3A 1N59B 3I6KB 4UV4L 1S7WB 1SBBA 2D7PA 1IVLA 43CAB 3C5JB 2MCPH 5L2KE 4Z7QE 2YSSA 4FA8A 5CEYB 1BFOB 5E6IC 3UTSD 4DAGH 4MJIB 4EOWH 4X6BA 2IADA 3BXNB 2J7LA 4YHZH 1WJ3A 3VG9B 1S9YB 4HUXB 4XPFL 5IGXL 4APQC 3TYFA 2JIXB 1NMAH 3FOMB 4HLZH 5TDNB 2PNDA 4PJ8A 3WS3B 5KVMC 3N1QC 4Y4KB 5EORH 3RZCB 4PREB 1LE5A 1TENA 2ED8A 1CVRA 2RB8A 4DGIL 4CDHA 2XN9A 2X9XA 5JDSA 4JFDD 1U8HB 3OAYH 3P4OA 4KK9D 5DUBB 3D85A 3LKNA 4KPHL 3B5HA 1HHHB 4UDTA 4ODWA 2NXYC 1I8MB 4ISVA 3X12A 4JFFB 1UENA 2VZ3A 4MJIE 1RUAH 4YK4B 5ACZA 4Y8AA 3TPKA 4RRPA 5F9DC 5DJZA 3O3EA 4RMSA 3AM8C 1N8ZA 3ZT5A 2DF3A 5J3HC 2IH1A 3PWVA 2H1PH 3S35H 2DMKA 4I48B 1H15A 3LV3B 2GY5A 4XP1H 3REVB 1VEMA 1EZVX 1YY9D 2HLFD 3HPLB 1NEZG 2X1PA 4PRIA 5DEZA 3NFNB 1RPQA 3RVVD 1GZQB 1WVZA 4LSPL 1OB1B 1U93B 4QRTB 2FX9L 4NKDB 2VAAB 2R4RH 3K80A 5F7DB 4JFDB 3RY5A 1KJVA 1R3KB 5C0NC 2Z91A 4F15C 1FSKB 3NN8A 4TUKL 5D96B 2CRIA 3BPOB 2L7JA 4QF1B 4M5YL 3UZVB 3FB5A 5F1NB 1D9KD 3U9UB 2LU3A 3D69A 3VWJA 2EE9A 4OF6A 4OCXL 4G6AC 4EBQL 2AERT 3F5WB 4OSUH 5D5ME 5CP7A 2RGSA 2HTKD 2YOCA 5IROA 2Y4SA 4UU9A 3E2HB 1I1FB 3EJZD 3SE8H 4OZIF 1KBGH 4NBZB 3EBAA 3IDNB 3LEXB 4ELMF 5C0AA 5C0ND 4GBXA 1UZ8B 1Q0XH 4JB9H 4PFEA 4UB0H 4E41B 1TIUA 3G04B 1MHPL 3OSKA 4HFUH 1CXHA 3W2DH 4MJ5A 5HDQL 3TIEB 5E8NB 3FQRB 4IHOA 5EU6A 3RZWA 3VFNA 2F53D 3P9LB 2X1WL 2FX9H 3IDMA 3D85D 3SY0A 5EU4B 3LS4H 3VMOA 4OZHF 5HBBA 4WFFD 1JNHB 1SMOA 5JHDB 3QUYA 3AROA 4NZJA 1NUFA 5KZCB 1QKZH 3RY4A 1A6PA 1KG0B 1AC6A 4MNGB 5FA4B 1NSNL 1XF4A 5CEZH 4NWTL 2O61A 1MCJA 4ZO6A 3MCKA 2HRPL 1QBLH 4XWOD 3EOTH 1OAKL 2GAZA 3PHOB 4GMTL 3CDFA 2YA0A 3IAGC 5HHVL 4JHWL 3AVEA 1YQVH 1RU9L 3QH3A 2YKLL 1KFAH 2Q8BH 1IM9B 2HJFB 1TTUA 3WFCH 4CVWA 1EBAA 2QQLH 1N5YL 1UJ3C 3CFKA 1J10A 1D6VH 4X5XB 3PV6B 1WCQA 1MWAH 4XBGB 3UJIL 1IAIM 3DVGA 1OGAE 5FK9B 4JVPA 3LRGA 4PJIF 2VOTA 4U6VL 1YJDL 3GMQA 5C7XH 4RZCB 5TQ0L 3DWTA 1BFVH 3O3DA 1S7SB 1U3YA 4DKFL 1H15B 2V5MA 4I48A 3IF1B 5IW1B 3C8HA 5GGUB 5CBEA 4JFEA 5HHMA 5AUMA 4EDWL 3C6SA 1QFWH 3NCYS 4MXVE 1T0NB 2F53A 1C7TA 2UWEE 3OTTA 3GSNA 3M8OH 3HUJE 5C07E 1JNNL 3D85B 4FABL 5IP4A 2JKXA 2Z31A 3CFJB 2ADFL 1TJIL 1K5NB 3LEXA 3RUGE 1I9RH 3QEQA 3SE9H 2BSTA 1KTLB 3QIUB 5KOMC 4DOHE 4TYUA 4X99B 1IJ9A 5FKPB 2GFBA 4TSAH 4K94L 4AH2A 2RJMA 3LEYH 3KS0H 5FYJL 2YPKA 3RTQD 3S98A 1F4XH 3T1WA 2ESVB 3HR5B 3LKQA 4Y4KC 5KSUA 3MLWH 1Q0XL 4UB0L 4M7JL 1ADQA 3CC5B 1OTUC 2A77H 1CGUA 5DF0A 5HVGB 4KMQA 2BFVH 3KPSD 5FYLL 3QZWA 1BX2A 1GIGH 4BA8A 4QOKA 4L4VE 1MCLA 3D3VA 5MP6H 1MQ8A 2NX5B 2AQ1A 1GC1L 4PJAA 2IF7A 4V1DE 5IVZA 4QTHA 3PL6D 3BQUB 4D2NA 1OGTB 4F3FA 2UUDH 4JRXD 5J8OA 3I50L 3MACL 4FQJH 2DLEA 2R2EA 1KENL 1Q94B 1DVFA 4UBDC 3VFPB 5ITBH 2KPNA 4KTYA 3AUVA 2ORBL 2GHWB 4J3SA 4C56E 3BUYB 3GSWA 5HHXH 1I1AD 3NBNA 3RHWK 1BGXL 3SQOL 4C57C 4O9HL 5LQBH 3DX9B 4R0LA 2VN7A 1NGYA 3LB6C 2D4FA 5ICYA 1SBSL 5GHWL 4Z7UA 3NZHL 5F88A 5KW9L 4R97B 4WWKD 4HXBH 4WU5B 2NY6B 5GGTA 3DSFL 4KZDL 2X10A 1NCTA 1T3FA 2NX5A 1Q9OB 1YECH 3O41B 4PR5A 3BQUD 1J7VR 3QO0B 3KDMB 2Y07H 4ZNCD 1VENA 2X09A 2QEJA 3P77B 4J6RL 3FO2B 4L8DA 4UIMA 4S0UC 2MMXA 4AENA 3QHTC 4D94A 2EH7H 4NWUL 3SBWC 3MXVH 3IFOA 3LS5H 4Y8DC 2ZSWA 3QDMD 2DQHH 4K71B 4PGEB 3HE7D 5TPWL 5L2KB 4FXKB 3FQTA 1FRGH 1JVKA 2EE3A 5F9WB 1KC5L 4Y7MA 4H0HB 3CZJA 3GJFB 4TPRL 4GG6F 1MRCL 4APQA 2BSTB 5BS0D 2ITDA 3D3VD 4G6KH 5H35B 1QSED 4HJGA 4XCNB 1UXWA 2FECI 5CEZE 3JTTB 1EEUA 4N8CH 5HVFB 4L4JA 1I8LC 5F6HJ 3MODH 4OZGF 2BRQA 2X1XR 3CPLB 3QUXD 4PJBB 2C3WA 5T1MA 4TSCH 5CAYB 1BGXH 4L4VD 1M71A 1JWMB 1AGFA 1JTOA 1NCCL 1S7UB 1DJSA 1H0DA 3STLB 3OX8B 1OSZA 2PXYC 1FYHB 1D3CA 5FGSA 3LN5A 5CILL 3U7WL 4HDIA 4OBRA 1XH3A 3RDTA 4Z7VA 1B2WL 5DMIH 1HHGB 3D39E 4Y5VC 4FQIH 4YDJB 3SEPA 1FJ1B 1PYWA 4ZFGL 4B7IA 3C5SB 1FYTE 4X99A 2DMCA 5E2UL 5D1QB 3DJ9A 1QACA 5DJAB 3GKZA 4HS6B 3QO1B 5J1AA 2HKHL 3D0VA 3PP4L 4K3DL 1CGWA 3TN0D 1NBVH 4DUWA 3FQWB 4KKLC 3ARZA 5DJ6A 5KVGL 1HOCB 4XP9H 4P9HL 1ZANL 4ZQKB 2X9WA 5GGRA 5I1JH 1PZ5B 4QRRE 5EBMA 4J3TA 4TQEH 1W0VA 1UCTA 2Q20A 1D5ZA 2WMPA 3EO0B 2EE6A 3NCYP 1J05B 3ARTA 2J5LC 1NFIB 3FFCE 4I2XE 5ESQA 2XRAH 1JGVH 3VFSA 1QO3B 4XCYB 3IF1A 1A7NH 2VAAA 3EDKA 3GMOB 1MFNA 3FCTB 4ODSH 5F21B 4Y1AA 1OAYH 2CLZB 2X70B 2AS5M 1WITA 3RWEA 5HI5D 1I1YA 2AJZB 1UB5B 5DTFB 5HD8D 3BAEL 1NDGB 5T33H 3DGGB 1OAZH 3NTCH 4LVEA 3BVNB 4K9EL 4CNIB 3KXFE 4M8QB 1MHHB 4ALAH 5ITFB 1HIMH 3QUYC 1GGIH 2FYYA 2UZIH 3GSXA 5I1CL 1YMMD 4S1RL 1CN4A 4JQVC 1YEGH 1ND0A 2AK1L 3CUPB 1OPGH 3FQUA 4HJJL 2DLTA 5HXMA 4NCC1 3MRFA 3TPUB 3UDWC 4AEEA 1M4KA 3ZKND 5DMGC 2LABA 4JO2H 3PHOA 4NN5C 5IW6B 2YUXA 5ID1A 3F5WA 3ZTJH 5JPNA 4Z76B 5C6TL 1QFUH 2VWEC 2D3VA 5D7KE 1FFPB 1CLOL 5E9DB 1LO5B 2NW3A 1ORSB 3M17B 5SWZD 3QDJE 5GRUH 1GPOL 3EDEA 3H9HA 1LD9A 3O8XB 2UYLA 4V2BA 1S9VB 3R06B 3K4DA 1ZGLP 1FL5A 1CDHA 1VGEH 3PGDB 3V5DB 2A6KA 1FNSL 3LOWA 1MPAH 5GRVK 2AJVL 4ESKA 3OAYK 5T3ZD 1TXKA 2VE6B 5FUZH 4NQCB 2NY3C 3KYAA 1FO0A 4GKOA 4OLVH 4P3CL 4XI5C 1U8PB 5T5FH 2MKWA 1MEXH 1N3NB 1REIA 1RZJC 2GUOB 5EOCH 4CVZA 4YO0A 1V7MH 3KYKH 5DLMH 3DGCR 5DK0A 5I1IH 3V2AR 4QRQB 3PQYE 2P5WA 4HUVA 4BQCA 1YC8A 2QQKL 3T2PA 4XZUA 2HMIC 2NY4B 2A0LD 1IC7L 1CCZA 2HFFA 2KBGA 1JZ2A 3BKMH 5DJCB 2Z91B 4XB7A 4P9MH 5BQ7A 1U8IA 3W5MA 2OTWA 3Q48A 4IRZL 1HKLH 4KRPD 5DC9B 2WZPD 3MA9L 4OFIA 3BP5B 2FGZA 4P9ML 5IMOB 2BJMH 4N0CA 3VXTB 3C09B 5E2TH 3UTSE 3L7EA 1X5HA 5K9QI 1MVUB 1QP1A 32C2B 3KR3L 3IRPX 1OVZA 1EHNA 2HT4D 1Q1JL 2Z4QA 5IT2H 3GIVB 1JZ3A 3RWGB 2VABA 3TH2T 5C0EA 1NGWB 4WO4C 2DKMA 1KCSL 1KLUB 3G6DL 1BJMA 3MREA 3E0GA 5TH2A 4ZXBA 5D1QD 3BP5A 4PJXA 4XBPB 5F6HI 4KKBD 3RL1A 1U41A 4NRYA 4LSPH 2R4SL 3BGMB 4PJCE 5HVHB 1DQQA 4PJFB 4EVNB 2DQUL 4IRSC 4IOIB 4R4NC 4AG4L 3VDBA 4UDUB 1CGSL 4UV7H 3HNSH 3FOMA 3HZMB 1U8NB 2AJSL 3E6HA 3DVFA 4Y5XA 4LARH 4O4YL 3BQUC 4H1LG 4PJBF 2R69H 3WDHA 2VDPH 1LEGB 5C6TH 5TDPB 3WHXB 5D2NA 5E8EB 4HIEA 5FUCC 1YPZA 4FP8L 4XNUH 1FL5B 1G7HA 1K4DA 2B1HL 3WFHB 3WMSA 4LCWD 3QDJD 4KUCD 3C8DA 3OGCA 1LD9B 1YEGL 2H2SC 4UI2A 3V6OC 3BP4B 5EUOB 1G7IA 2V2XA 4NOBA 1QA9B 3T77B 4QTIL 3P73B 1YEFL 5FYJU 5DEFB 4YDKL 4IDLA 5CGTA 2HJKB 1I8KA 5H8DA 1PAMA 2XWBA 1AO7D 1HZHH 1U8QA 4P5TD 3WSQL 3ARGD 4YE4H 1EO8H 4MA3B 4RGNB 4OFVA 5L7XH 3EKCA 1AY1H 2YK1L 3IXTB 5EIIB 1U8PA 3ROOA 3RWCA 3KPMA 4PGBB 4JEGB 1EGJA 1CFSB 1BQLH 4KJQC 2I60L 5IHUL 1NFDA 5GGTH 1I9JH 3KPRD 3MGOA 3BZ4A 1NLDL 3AREB 4ODVH 3OJDB 3TN0C 1XF3B 2ZNWA 3MNWB 3FQNB 4WJ5B 1PSKL 1VGKB 5KS9A 3UTTD 1DBKH 4NP4L 2V6HA 4ENED 3CSGA 5DQDH 3MBEC 1IL1B 5K9JH 4KH2A 3B2UC 3VFVA 2GI7A 1YMHB 4D9LL 3VWKA 4M1GL 5D6CB 4OKVB 2GTWA 4MQXD 2OZ4H 4MXWL 2OX5A 1GGYA 2R0KL 4LIQH 4LLWA 3HC0A 4MDIB 1I9IL 3X17A 3FCTA 3VFMA 5DQ9B 2FBOJ 3HNVH 3W39A 1U8IB 1DQLL 2VLLB 2WUBH 4ZFFB 2HA1A 4JRYA 3H3KA 5HGDA 2ADGA 1TFHA 4GRWB 5T3XL 2Z8VC 3ZSTA 1D5ZB 2J88L 2DI7A 2LAGB 3HMXH 4ODXA 1WFOA 1MH5B 1NC4B 4S2SA 2P5EB 5CSBA 3RIFK 3MSPA 1NEZB 4MCYA 3IJYA 2HTKC 3P9MA 1OWWA 3VXMA 2DWEB 5L6YL 4ODUA 2YMXH 5HGHB 2NY3B 1GHFL 1AI1L 2QJDA 1CDUA 2AJZA 3SDAD 2VE6A 1UJ3A 2Z0BA 3MA7B 4JFQB 4WU7A 7FABH 3MJGX 1MCPH 1XGYH 3HAEH 5F7EL 4RNRA 1IL1A 4WUUD 2ZUYA 3EYOB 3P4LA 4Q9QL 1QO3A 4XCYA 3UCRA 1QR1B 3OX8A 5JW4Q 2FX7L 2E5EA 4L3EB 5CD5D 3V0AC 1AGFB 3ARYA 2PYED 4PS4L 5DGQA 3HUJB 5C07B 2YRPA 4X6CE 1FFNA 2GJZB 5DJ8A 1PZ5A 3NIFE 2F8XC 2P8PB 4I5BA 1F4AA 3HI5L 3IKCA 4OI9A 1IRAY 3JTTA 4WCYL 1CXFA 4PLKC 1ZLVH 2GITA 3H2WA 2ITDB 3VI4E 4G43A 1T21A 4KZDH 1ZHKB 3KHQA 3DUSB 3DX7A 5MEPB 1BAFH 3R8BB 2B4CH 3SDCB 4JPWL 1GOHA 4QNPE 2AJSH 5C0BB 2OZ4A 2ADIA 1O5DT 1NCDH 1XH3B 4Z7VB 5FYLE 4KDWA 2EDQA 1KCLA 2ARJA 4JM2A 3SDDA 2I25N 1T7YA 2DN7A 1AXTH 2ZCKH 4Y4FC 1CXIA 1VESA 1DR9A 5C71A 4YIQB 1A2YA 1A7PH 1HDMA 5F1IA 2VR4A 1QZ1A 5HHXL 5C08D 4D8PB 4IS6A 3VWKB 3T3MF 2DYPA 4TSBL 3OZ9L 1I4FA 3DYMA 5CJ5A 3BIKA 4P5KA 5FO9A 4G80B 2DQIL 4XMLL 1JRHI 1OAQL 1U91B 2A83B 3QI9D 3V4PL 1MCBA 4EI5B 4TRPH 4ZUUB 1JPFA 3BN9D 3D3VE 1K8DA 4LPTA 5FM8A 4P23A 3DX9A 1BFSA 4XNMB 3VXRA 1FE8H 1NBZA 3TJHD 5E2TL 4R7NA 4HIHB 3B2VL 2J88H 5EBMB 3PWJB 5I8EA 4LPUA 2EEBA 5JHLL 4LLYB 5LCVL 3BSZH 3I3DA 3OKYA 3HTLX 2VXVH 5EZOL 2PYEA 3S35X 2BY1A 1R5WB 2WP3O 4OIAA 1FVCB 5EULV 2R2EB 3OKDB 4HWUA 4U6XB 5C0IB 1G7IB 2V2XB 1UWGH 4YQXL 1Q9OA 1WC7A 5KVDH 4PJAB 2XN9D 3QSKB 5ICZA 4RMRA 2HWZL 5CUSH 3BH8B 4O58L 3QEGH 1TJIH 1DUYB 5T3ZL 4TNWK 1J1XL 1QQDB 4Z7UB 1A6ZB 2ATPB 3QIBD 4CN1A 5IVXF 3A67L 3K1DA 4LVOB 3K2UH 4P4RA 4WENB 4PP8C 4HMDA 4MXQA 2C7UB 1R3LA 2JLLA 3MRKA 3O6FC 4MJ6B 1S5IL 3QG7L 5GISH 2VLKA 4JHAH 2R2BA 3DXAD 2BSRB 3SGKA 3SDXB 1AR2A 2JELL 1MAJA 3W9DA 3DPBA 4ZTOL 1I85A 2YD8A 2XI9A 3NA9H 4EN3C 4ZXBC 4KRMB 5DC4B 3TA3B 3CVHL 4C54A 4RBPH 3WSQH 4CMMB 2IH3B 1MQKL 2R1YB 1HHJA 1DBJL 1RUKL 4LVOC 4NRYB 1CLZH 3WNNA 2C3HA 5CMAB 3QQ3A 1T0MA 1DBBH 4R9HA 4M1CD 4LLAA 5EBWA 2OYPA 2HFGH 2W0FA 3TT3H 1U9KA 2GJ6A 5IEHB 3I2CH 3VWJD 4GAJH 2IPKA 1ZT7A 4KQ4H 5I76A 4XNYL 3HR5A 4HG4K 4M61A 4MX7A 1TZIB 5FCSH 1OP9A 3CMOH 2NY6C 1KPRA 1UZ6E 4P2QA 2EH8L 4WW2B 5HHOE 4ODHH 1DBJH 2OR7A 4KKAD 1W72B 1MLCA 5ICYB 4X6DA 1GOGA 3HNSL 3SDAC 5B8CC 3KHOA 4FFEX 3GB7B 4ZSOE 4HWNA 1BVLB 4ZPTB 2XFXA 5IOPA 5DK0B 3O0RH 1G6RH 4M8QA 3LKOB 5JHDE 1YMME 3BVNA 4DCQA 2QKIB 5B38B 4NGHH 4OAWA 3QWQB 1A6UL 1P2CA 1ZWIA 5D1XB 4DGVH 3FZUC 5F93C 4XPBL 3LHPL 3O6KH 3WCYA 1JTTA 3MRJA 4UT9H 2CLVB 3L3GB 3H9YA 1NBVL 3KR3H 4P9HC 4ZTOH 1VA9A 2V5RA 3DVGB 3JWDC 1C5CL 3WJLC 4DK6A 1XR8A 5IWLA 4NIKB 4ELMA 4U1HB 3UO1L 5EU4A 5JUEH 4JZJA 4P5MA 4KUZL 4HT1L 1YNLH 4G6FD 3KPLA 2GT9B 5ISZA 4G8FA 5EB9A 5B22A 3MRDA 3FZUD 5LCVH 2NW3B 2QR0B 3T2QA 4H1LB 2LVCA 1EGJH 2QADB 3GSVB 1RZ7H 4NO2A 4E41A 1S8DB 4ZO7A 3MXWH 3UAJC 5CKAA 3U4BH 1NCCH 4OZFA 5MHSD 2Y72A 4JAMA 4JCMA 2B8OT 4M1DL 1H3UA 5DJAA 3ZDXF 3E2HA 1JGEA 1Z6JT 3VD9A 3HLAA 4GBXC 4MDJB 3IDYC 1UWGL 3EAKA 3QUMA 1ES0B 4N8CL 5DZOA 3GSXB 4JHZA 3MRDB 2BVQB 1XGTB 1XIWC 5D2LA 1NANI 5DJDA 3QXUA 4JE4B 4LF3B 3TVMD 3ULVF 1I7UB 3S4SB 3SY0B 1CXKA 3ZYIA 3SCMB 5EFIB 4ODTL 1AXTL 4R96B 4LNRB 5A2IH 1T7ZA 4ZAKC 3ARVA 3NMEA 1MAML 1I1YB 3CFBA 5TPWH 5GRUL 3SDCC 4PRIE 4DUVA 4XBEL 5EC1A 1X5KA 5CINL 3NGBB 3QAZC 3D5OF 4XB8A 1FGVL 3UJTL 4C4KO 2W38A 1QSVA 5F9AC 1T2QL 2X4QA 3T8XB 2V9QA 3VFSB 4K3GA 1BWMA 4HAGA 1ZS8B 3PV6A 2I07A 1KB5H 3FO1B 1NKRA 3CFKB 3VXSB 1Q38A 4WY7L 3WIIH 5MEOA 5JPMA 5A3IC 1LO3L 2H2PD 4H1LA 4NZDA 5EIVA 2JB5L 3FB8B 3HRZB 1R5VA 2AAVA 2KQNA 1WZLA 3QEUA 4O2FB 1OTTD 4PJ5E 1HCVA 1X4YA 1BECA 3QIBC 3HG1E 1CXEA 4ZUWA 5LGJB 2WY3A 2UZIL 4OCLC 5KS9F 1ZTXH 2UZXB 3FO0H 1P84K 1TVHA 1NCUA 1DP0A 4LP4A 1N0XL 1B3JA 2YD6A 4NJ9L 4JM2C 5CIPA 3SDDC 5MEND 3MRMA 2Y7QA 3O6FD 4PG2C 4HIIB 5CZKA 3LPFA 4YHIB 1IT9L 3G5XB 2F19L 4XVUD 1BLNB 4KVNL 4HDIB 3VXSE 3MFFA 1EHLL 5INDA 3CLEL 2BXYA 3QNZA 5L2KD 4F7CB 4OLZL 3D2UB 5D1XA 5AYUL 3C08H 4P2CG 5C9JA 4P2OB 1T1WB 3C2SA 3C5JA 4IRJA 4KDVA 4JLRB 2P4AB 1N8ZB 3QWOA 5GGSB 4FQXD 3FT4A 4HJ0D 4OZFH 4HUNB 1DDHB 5GIRA 5HGBB 3U48A 4R4FH 6FABL 3FQRA 3KPTA 4IHOB 1KB9K 5F7HA 1P5VA 4NO0D 3TBWA 4M3JA 5E8DH 5H94A 3T3PE 2YPLD 3SDXF 2AK4E 4YC2B 3OKOA 4RCAA 3AGVA 3P4NB 4HBQA 1JZ7A 1G0XA 3X13B 2H32A 3BQUA 4JFXB 1PZUB 4NDMA 4DZBB 43C9A 2VITA 4NRXA 2QADC 1P4IH 1IEAB 4G7YH 3IETA 3BXNA 3MR9B 4H20H 1NCAL 1BX2B 5J9PB 3BIAX 3KYOB 1S7XB 2E6JA 1KCUH 4IMLB 2IPKB 1U36A 1LDPH 4U1HA 3ZL4H 5F72S 1T1YB 1U8MB 1S7WA 3WFDH 2R0LL 3E3QA 3BIBX 2IALA 1JNNH 5LWYL 5E6IA 3RPKA 3IJSA 5EZIL 1WAAE 5K9JL 4XHQA 5HY9B 1RZFH 2X4RA 3D39B 5J1SC 3QQ3B 5EN2A 1CTNA 4Q9BA 2K1MA 1JMZA 1UH2A 2Z9TA 2HT4C 4F2MB 3QJFB 4LMQE 1OGAB 4XPGL 2I60H 4MD0B 2RHEA 3U6RA 4IRSB 5FHAL 3MOBL 1RIVL 2YUZA 1CFQA 1DVFC 5CZXC 5T1DL 4WV1C 4LCWE 2YXMA 2P45B 2BSRA 2DQGL 3VFGL 2A9NH 3B5GA 2VR9A 4KXZI 3MLXH 4LKXB 3GM8A 4Z5RB 4ZPTA 4BSWA 4LP5A 2XTJB 4XPBH 1OLZA 1IC4H 3GJFK 2V2WB 1ZGLM 3MRIA 4OZGB 1OOAA 1T0NA 3Q1SH 3FOLB 5E8DL 4NQTA 1WSST 4I18B 3TBVB 3PF2A 4LMQI 3GMMB 3RZCA 3HE7A 3RY6A 5IVXE 4NWUH 4CW1B 4XCEB 5TF1H 3FTGA 3C08L 3PXHA 4G6JL 3I3BA 4U1NB 1INQA 1YQVL 1RFDL 4APQD 3FRPG 5JORA 4X4XB 3MCLH 2ZUQB 4ODTH 3QXAB 4YE4L 4GMTH 4OCMC 4OF0A 5IM7A 2R1XB 2GIYA 4AEFA 1FDLH 4RAUA 5DRWB 3AB0B 1LP9E 4X6CA 5GS0C 2FEDD 2VL4A 4XXDA 1T22A 5D93C 2HJFA 4Z0XA 4UZGA 2H9GA 2PKDA 5K9KA 1LNUA 4J7RA 2MNUA 5JIIA 1D5IL 4OGYH 3QIUA 4PV9B 7CGTA 1U91A 2A83A 5EZJA 5DEGA 2Q3ZA 5EU7C 1QR4A 1RJLB 2E6QA 1A7OL 4JDVB 2QQQA 5KJRL 2Y6SD 3CVHB 4XVSL 4J12A 3MCKB 3GRWH 4POYA 5MENB 4AQ1B 5TE7L 2H6PA 4HX1B 4OGAD 2CJUH 4NKMB 3UO1H 1PQZA 4G9DA 1HILB 3HFMH 4FFVC 2J6EA 3S3SA 1CFNA 3G9VA 4L4TA 3DIFA 3A6BH 3ARDA 3OAZK 2DD8L 2ITCA 3X3GL 5BRZB 4BELD 4L3EE 5EC2A 3TO2A 1V3LA 3BH8A 4YFLF 5TE7H 5DT1L 1P84J 4Z78A 5C0BA 2A74A 4MQXC 5MEPA 2A6DA 4KAQH 4ONGH 1UACL 5EZLA 1FAIL 1JL8A 1FVCA 2APBA 4UU9B 4TSAL 2E27L 3HC4H 3MRGA 2VNCA 3LDBB 5CUSL 5EO0B 5IESH 1H9VA 2YPLE 4JZJC 2EYRA 1YN7A 4ZD3L 3H9SB 1F5WA 3MX0A 3ULUF 5C0CB 2VDRL 4M7LH 1MY7A 3VGGA 1MFDH 4LSTL 3QH3B 4WWKB 3HCVA 2Z92B 3NN8B 1NMCC 1A1NB 5IMKA 4Q2ZA 3NH7L 3SJVE 2EYSB 2CR6A 5JIHA 1PX3A 3RVTC 4I13B 1JZ6A 5BV7H 2BVPA 3O8XC 2H2PC 1W0WA 3VFMB 2HTLC 5JW5B 4YH6A 2GJJA 2DTMH 1Q9KB 4UINL 4IS6B 2FSEA 5KVEL 3KLAA 1NC4D 4EUPA 3L3OB 5DJ0B 4UT7L 3BPLB 3QUML 1YYLL 1YJDH 5AYQA 3NVQA 4HF5H 3MBXL 2H26A 4OKVA 1MIEL 3ULVE 4WWID 2HYMA 2IQAB 1ZLWH 5SX5H 1SJHA 2RIKA 3TJHC 4JPIB 3GHEL 4DW2L 4ZOBA 3NCMA 3TVMC 2APFA 3CJJA 1A7OH 1I1RA 5KN5B 1BJ1H 4JQVA 4M9OA 3MRHB 3CSYA 2BERA 2FZ3B 4WI7A 2N4IA 4X80L 3HCVB 4LAJH 4RWYL 1ETZA 1I7RA 3GRWA 1T21B 5F6IC 5D6DC 1T89A 5C0CA 4S1RH 1PY4A 3T2OA 1INEL 4MAUL 1KFAL 2I9TA 2F53E 3HI6L 1A9EA 1GGIL 4PJ8B 1MI5E 2AXGB 4I3RH 4QRSA 5EO0A 2RAMA 5CLTA 4Y5VB 3IYLW 5L88L 2NTFA 2ENYA 5SWSA 4YWGH 5F1NA 2LU7A 2UVEA 3DOSA 4X6BB 3NH7H 4NHUB 4U1MB 1E27B 4G5ZH 4FMKA 1BD2E 4L3EA 3VFRA 1NSNH 4QRRD 4OZHA 4D9QE 4Z78B 4B53A 5I1HH 3U0PA 4HMEA 1VEOA 1GGBL 3VRIB 1OAYL 3TO2B 3ZE1F 4DVBB 5D5MA 4E42A 3BPNB 4LLMB 1FG2B 5T5NF 2OR8A 5IJVB 1JFQH 3EOYG 3P0YH 3BH9B 4QCIB 5E24E 1X5IA 3LN4B 3N1GC 2D31A 4GKSA 1LK2A 3FFCB 4KK5D 2AJYH 4J3WA 3I6GB 3O4LD 4ZAKD 4EN3A 3D39D 1G7PB 8FABB 1DCLA 4ZO9A 5FDYA 5J56B 3WIHL 5DURD 2FX8H 4PJFF 2V17L 4MYWB 4OCWH 3NTCL 1D5XA 2VXUL 1XF2B 1LMKA 4U4BA 1ZVSB 3CH1A 4OIIL 1MWAA 2VZVA 1RJLA 4DEPB 4F7MA 1INDH 1HHHA 5IB4B 5EZJB 4WIQA 4JREC 2YMXL 3HFML 3QFDB 3GBNH 3T77A 4G3YL 1PG7L 3R4DA 4KGJA 4DGYL 1F8TL 4Y19B 1JGVL 4U6YB 2MPAL 4XMPL 3WFHA 3AAZA 1KLFA 3BEWA 4JFPB 2JJVA 1BM3L 1F90H 2BVOA 4MD5B 1ZHBB 4M43H 5JXED 4GMSH 3QCTL 4X9GA 1XR9A 4KJWD 5CEYA 5CZVH 4AZ8A 5M95B 3SGJA 3IETB 3OJMB 4XVJL 1N26A 1TJGH 4ZFOL 5CEXA 1YMHA 4AT6B 5EG6C 1F3JA 3QRGL 2YD2A 3ARPA 4D0BA 4K9EC 3C9NB 2BNUA 3EUUA 5JNYA 4JO4L 1QFWM 2D4DA 5DWUH 3FJTA 3ARQA 3UTSB 2CKNA 5F1SA 3EYVA 1AGDA 4P48A 2IBZY 4MS8C 3TFKA 1NFDB 5HYJB 4FTVB 3DV6B 3HZKB 4FFZH 4Z8FH 1BWWA 2VDNH 2WINA 2VQ1B 4KKCC 1FFQA 5IHZB 4HUVB 1RJYA 3IJHB 2XA3A 3L3IA 3EIFA 5CEXB 4TNWF 1U8QB 2NY5C 3HNTL 3HG1B 3KAAA 5BOPA 1KIQB 3QHZH 3FHQA 1IGTA 3MMEB 1NMAL 3MRLA 5DO2D 2R0ZL 3L3HB 3CFCL 5EU3A 3BH9A 4G6KL 3DSFH 3GUTA 4S1DD 4ZUSB 4DVRH 5IF0A 3PABB 1MRCH 1I8IB 3MNVB 2M1KA 4PJAF 2R0ZH 5DJCA 4IMLA 4PV8B 2V5TA 5J6GA 4ONOA 2D0HA 4RFNC 5DURB 4PJDF 1P7HL 3TCLA 5SWSB 4Y89A 4AJ0A 1IEAA 3G6JB 3V4UH 2HKFH 4CKVX 3U4BL 1RZFL 5EO9A 3OKLB 1PEZA 4KKAC 1RJZB 2MWCA 2P7TB 3L7FA 1I3VA 4I0KA 1X9QA 4FZ8H 3X13A 5JOPD 2MPAH 2IWGA 5AAMA 2VQTA 4PPTA 3WL9A 4WRLA 4M03A 4H88L 4JDZB 3AM8A 3EYFA 5BZWA 2A9MH 1F45A 1K2DB 2FJHB 3IDXL 2XQBH 2FCBA 2WBJA 3BD3A 4GAYB 3MLRL 4R2GC 1UEYA 4LIQL 1AGEB 2DM4A 3RA7L 4PRNA 3S4SA 2G60H 5D72L 1EFQA 2X4OA 5IB3B 4ZOAA 5CP3A 4QKXB 2B39A 3MNZB 4OM0H 3WJJA 2NY1B 3DXAB 4LVNB 3D9AL 4CAGA 3RVUC 2HJLA 4CU6A 3WO3B 4RGND 4EDXA 4QRSB 3W82A 4HC1H 1CDCA 4KKLD 1NAMA 3SKMA 3MLUH 2VDKL 2QLVB 4OFYD 2E7BA 4PY8J 2EYTB 1N5AB 4R2GD 4MA8H 2OSLB 4FFVD 1VEPA 1TCMA 3SDAA 3GBNL 5B8CA 5CCKH 4ZPVA 5GSRB 3T0EC 2NY4C 1ND0B 5BMFH 4WUKH 1OP5K 1Q8MA 5FYJE 3HRZA 4WWKC 3RQ3A 1T1ZA 1FH5H 3B3IA 3F7VB 3U79A 3U82B 4BH7A 3B9EA 3LKSA 4EQ3A 4YO0B 1HZHL 1T0PB 3MRGB 5ID0A 3NIFF 4HZLB 3KPPB 3EDFA 1P4BH 3PUCA 1PX4A 4Y88A 2DLGA 1S9XB 1TETH 4NKIL 2EDNA 3QDGB 1BBDL 2DLFL 1BJ8A 1BVKA 5I73B 2D31B 1OW0A 1H8SA 4EQ2A 3SO5A 5L0QB 2R0KH 4JM4L 3QI9A 2QSQA 3PWNA 4GAJL 1QSFE 4PRHD 4PLNC 4FQXC 4PUBH 3PHSA 4LLMA 4P23D 4QRUB 4R2GB 4FP8H 4XNUL 3TJHA 3UYPA 1JPTL 2JJTC 2HFGL 1QVOB 1LEKB 3DIFB 4CRPA 4PJGA 5I1HL 2JB6B 3H9HB 5K59E 5ILTH 4ONHA 3UJIH 5J06A 4JG0L 1P6AB 4G9DB 1JWMA