4D0GA

Structure of rab14 in complex with rab-coupling protein (rcp)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGLERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED PROTEIN RAB-14
publication title Structure-Function Analyses of the Interactions between Rab11 and Rab14 Small Gtpases with Their Shared Effector Rab Coupling Protein (Rcp).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4d0gA01
3K09C 2HXSA 1IAQA 5DGXA 1DAMA 1HTWA 3THOA 1JXOA 2QE7D 2YZ2A 3B9QA 2PEYA 1VYTA 5CITA 4W9MC 1E9DA 5FTNA 2FZLA 2VF8A 4CEJA 4HB4A 1W4AA 5E7IA 5DYIA 3TH5A 4QFMA 2W2TA 3E1SA 1M2OB 2WM9B 2WPDA 1DTSA 3IKJA 1IN6A 3ADKA 1ZM9A 3KZ1E 3ZIAA 221PA 4POAA 4AKHA 3WHLA 4JJZA 5JJKA 1YE8A 3WRXC 4BE7B 5KPJA 1N5LA 4PSAA 4UXJA 2JATA 1LF0A 4ZPXA 4FXPA 1ZRHA 1T0HB 2LWIA 4O0MA 1S9HA 2CVFA 5BXQC 4R2IA 2PJZA 2WJHA 4BUJA 5J4LA 1G8GA 3HJNA 4Q03A 3SDZA 5J4YA 2WWWA 1W36D 2GEUA 4B35A 1P7CA 1ZINA 4L8GA 4MYHA 1ZUHA 1ZU4A 1KY3A 5FL7D 4EPVA 5TDHA 1N3BA 2ANBA 4MKFA 1OW3B 3I3SR 2F6RA 2ZRDA 4ZDIA 1R8SA 3A1UA 1QVRA 3SBDA 1G7CA 3SU8A 1BYUA 2O52A 2RMKA 4EPTA 1A82A 3AKYA 4AY2A 5FUXA 5JMTA 3B1VA 2CCKA 4GT1A 2DR3A 3LW8A 4RD2A 3U3OA 4ZO4A 1IBRA 3I72A 4BLPA 1U8YA 1AM4D 2ZQ5A 1WDTA 2A5DA 5L3QA 1S8FA 3L0SA 2RGBA 2OCAA 3KUCA 1Z29A 3EG5A 4Q4HA 1KK0A 1KK3A 4HB3A 2NPFA 3QF4A 3GCGA 1NBME 4HB0A 4PC3A 1US8A 2MMCA 5HE8A 3K70C 4CEJB 2C96A 2GEDA 4DSUA 3TRFA 5FTJA 2QGZA 4TTQA 4N1AA 5L3SA 1TQ2A 1QHYA 1VYUA 2X1VA 2FJUA 3KTAA 4NCJA 3UXMA 3QXJA 1OXSC 1XCGB 1KK2A 1S0UA 2Q9AA 3R9IA 3N70A 4ZI2A 4XVRA 3LBIA 2ZROA 3PJRA 1TQDA 4KVGA 1B23P 1YZUA 3BAFA 1KI3A 2G1JA 3GFPA 1EFCA 3SFVA 3J81k 1KAGA 2VHUA 1R0WA 1VIYA 1E94E 1NG9A 3RRZA 2ZTSA 5BN4A 2PJRA 2OAP1 3KJIA 3PXGA 2C9OA 4XSHA 3B7GA 1P62B 2ORWA 3U7FB 2ZSAA 1W2GA 4J0QA 1E0AA 1NJGA 2CDNA 3UWKA 4DT1A 1ZUNB 2DWQA 1SVKA 4C3ZA 4P4TA 1UBFA 2JGNA 2JLWA 4KJZA 2KWIA 3UPUA 1UDXA 4AYTA 2AHOA 1AQUA 4JVSB 4CGZA 1Y63A 1G5RA 3SOPA 1J70A 4CYMA 4U02A 4Q9IA 3TJZA 4JKIA 4P31A 2ZITA 4URZR 5KHOC 2FU5C 1P2SA 4Q02A 3IDQA 1COWD 3ONWA 4QBFA 1UPTA 2QTHA 5FBRB 3R7WA 2EFGA 2FMXA 5H8WA 4TWZA 1FQKA 2E1RA 5JCZA 2ZR0A 4V0NA 4A9AA 3SC3A 5HKKD 5HR5A 1F6BA 1US8B 4K81B 4O3MA 4UNNA 2V1XA 2HCBA 4QOSA 3LV8A 5FOWA 3SHWA 2DY1A 1HE8B 4QGFA 4MDEA 2NG1A 1NBMA 3QEJA 4D6PA 3QXHA 4GSYA 3RWMB 1LF5A 2WJVA 2WJYA 3QY0A 4IVQA 2ZUBA 4PANA 1I4DD 3OEHD 1E96A 1IM2A 3B5JA 1GL7A 3FFBA 2YOHA 4JZKA 3N2IA 1H8HA 3EASA 2RHMA 2ZUCA 2NO0A 3TSZA 5EUMA 4JBXA 4GP6A 2GJ9A 2IYRA 2XNSA 4FMCB 2AK3A 3C41J 3FMFA 2R65A 1W5SA 5DN6D 5JWOA 2OCYC 3FWYA 3GEEA 1BS1A 1HY3A 4DLSA 2OBLA 2J41A 4Y0VA 2QT1A 2VHQA 5HCIA 1II9A 1N6NA 2IEYA 4N0DA 4KFTA 4IOLA 2Z0MA 1HT2E 1L4YA 1XD2A 3PQCA 3RRYA 3QOFA 3FMPB 1Z0KA 1ZBDA 4BEBA 4DT1B 2FGJA 2J59A 2FZ4A 2FWRA 4OQLA 3KQKA 3NBYC 5KSZA 1ZJ6A 1HUQA 2QP4A 2V6IA 2X2EA 4NL4H 1N6KA 1R2QA 3BC1A 2R62A 2V3CC 2KBEA 1RPZA 5CM8B 2QP3A 1E4VA 1YZKA 2JJ1D 2MMGA 2OAQ1 2Z6VA 4B2LA 5KPDA 4QJ4A 4BZQA 5JRZA 4HATA 4XOIA 3R7WB 1NKTA 1KSFX 4HDQB 4B3FX 2ZETA 1Q12A 1AJEA 4A82A 2GVDC 2H7VA 1LW7A 1VCOA 4ACAA 3RHFA 1KMHA 3NDPA 3OEED 2O8BA 1RKBA 1W0KA 2GAAA 3MJHA 1Q3HA 3MWKA 4WA7A 2PBRA 3IUYA 1N5IA 2GJ8A 4UJ3A 4RVCA 1JEDA 1CRQA 1KDTA 2FSFA 1TL7C 5KTYA 2VP4A 4F91B 2FSGA 3NVAA 2QPAA 4M1SA 2ZRFA 4HAZA 3AKEA 3TAUA 3AUXA 2P67A 4EKDA 1EX7A 1RIFA 2HEIA 1G8PA 4DSOA 3K53A 2G88A 1EWRA 5JBQA 1KK1A 1NKSA 1QBKC 1XD2B 521PA 2DWOA 4M21A 1F5NA 2YHSA 1SHZA 2ZI5A 4AKGA 2NGRA 4DDWA 2QMUA 1DEKA 1XTSA 3P27A 4MKGA 2H18A 4BFYA 1Q57A 5KSYA 1JEEA 3ZD6A 2XSZD 1FUUA 4XH9B 3LLMA 4B34A 3D31A 5G40A 2WJJA 4TMVA 3H84A 3FE2A 4JKYA 4BQSA 2OM2A 3B1YA 4TL8A 1WBBA 2GILA 4YMTA 1J8MF 2ZSFA 1G9XA 3BK7A 1BOFA 1W46A 3Q7QA 4DLWA 4A15A 3GMTA 4B47A 2ZRKA 2ZRGA 2IS6A 3QJYA 1JNYA 1G19A 2UKDA 3OE7D 4H1UA 4DSTA 2Q9CA 2AK2A 3U44A 2X2FA 3WNDA 3KB1A 1BO6A 4LY6A 1N6HA 4BZXA 3WXMA 2HUPA 2O8BB 4I1OA 3KX2A 5B30A 1G4UR 4IOMA 2EFDB 4HB2A 4TLBA 2JLQA 4TLCA 4ZDJA 2WMOB 3IEUA 5DSZA 1Z2CA 4A6PA 1E2KA 4LI0A 4P4SB 4RZ3A 3W8RA 1UKEA 3SJZA 4B3DA 3PUVA 1ZIPA 4DB4A 4BRWA 1MO4A 3CRVA 3AM1A 3JVUA 3IIKA 1GRNA 1OKKA 1XCPA 1TF2A 3S1AA 2O8CA 3GD7A 4B33A 1ZD9A 5JS8A 1Q20A 2ZJZA 3OHMA 5LDDC 5CLLA 2YWFA 2B92A 2KSQA 1TEVA 4YXWA 1L4UA 5J40A 1ZNWA 2FPLA 3MRSA 1QHHA 3P20A 1CJUC 1YVDA 1WB9A 3ZZUA 4OBEA 4HLUA 4FWIB 4S35A 1E98A 2EVWX 2QORA 3K0AB 621PA 2D7CA 2O0HA 1HV8A 4PX9A 4HLUC 4ZCLA 1G3UA 1PLKA 5FOSA 1N0UA 3A58B 3C5CA 5BQ5A 3LWNA 1JJVA 1U94A 3FHCB 5TV2A 4TMKA 2PL3A 3HP1A 4PSVA 4ZI3A 2ZM5A 2ZRIA 1NP6A 5CM9C 2V9PA 2JA1A 3BJIC 3R8CA 4AC9A 2JLRA 2WWXA 3L2OB 3NC1C 3AVYA 1FL9A 4DBLC 5BWMA 3NH9A 2IYTA 4KXFB 1LS1A 1EFHA 1AKYA 1NIJA 4DCUA 2DYKA 4B32A 3U44B 2GTPA 3IPYA 2CNWD 3CZQA 2ZJBA 3EPHA 2WOOA 1E1QD 4B73A 2AN9A 5KDDA 2RKOA 5BW8A 5JHGB 4QGAA 1NLZA 2QM7A 3TR0A 2QM8A 4TL7A 3AUYA 3PUWA 5GJVC 5CYPA 1XP8A 2CL7X 5IDVA 3W5IA 1HE1C 1DE0A 2QGNA 3S1AB 4NP6A 3T5GA 3EZ2A 1IXRC 1CU1A 5AK0A 2ORIA 2J9RA 4AYWA 2IXFA 2GJSA 2ZAMA 3I32A 3UKDA 4HZIA 2QQ0A 4KBGA 2V54A 5CB6A 3BB1A 3TW8B 4BLSA 3PEVA 1FMLA 1L8QA 2YNMA 3KJGA 3A4LA 4ON9A 1EESA 3RVBA 1OXTA 3LX5A 2FX3A 2ZR7A 3EZ6A 2W6JD 1G64A 2C9CA 4LYAA 3BE4A 4A2QA 1S4QA 4Q19A 1ESMA 1MR3F 5D3MA 1FNNA 1W4BA 1SKYE 4MRNA 1E0SA 1ODFA 3QG5A 4O25A 4MRRA 5FPTA 4BFUA 2VLIA 1ZNYA 4M1OA 4AG5A 2WAXA 1K5GA 2LCFA 2QPTA 4QXAA 1Z83A 1SGWA 4OHZA 2ASEA 4D4MA 5CB8A 2A5YB 5DISB 2FNAA 2NTYC 4B3XA 4XSGA 1OH5A 2CEAA 2HLDA 3ZS9A 1OB2A 4M53A 5G41A 1TUIA 4Q7MB 4DLRA 2BIFA 2VBCA 3D3QA 3P1JA 4V0LA 2B6HA 5L3RA 5A0FA 3JVVA 4I1UA 1GNQA 3B2EA 3QXCA 3QIAA 4TLEA 4Z51A 1VG8A 4BWYA 1E1RA 4OI2A 5JCPA 3LX8A 3PUZA 3CH5A 4OHWA 3PEYA 5J4KA 2QT0A 3DZ8A 3U5ZB 2WJIA 4M9XA 2E87A 4V03A 3PIRA 4BLRA 2RGEA 2P65A 3UG6A 4AD8A 1G20E 4LV8B 1F2TA 4LPSA 3ADDA 3Q72A 2QSZA 3SJAA 5F9HA 1WBDA 5B2ZA 2BJVA 3HU3A 1W4RA 4TMXA 1W7AA 2WSSA 3U6KA 2GRJA 3QPUA 4US2R 3LFUA 4JVMA 3KJHA 3AVWA 2QAGA 4NCIA 4DZZA 1OH8A 1KDRA 3LD9A 4TSFD 1Z0AA 1YRAA 2ZANA 2GCOA 2BWJA 3PITA 2F1RA 5C18A 3X2SA 2REOA 1KJWA 2X19A 3NBXX 3BH0A 4JIMA 1DAGA 2QTVB 1E4YA 2J7PD 4JLBA 3TUIC 1SKQA 3DM5A 1AA9A 2CL0X 4KYIB 4TMWA 3UG7A 1Z0JA 2H92A 4FMDB 2XXAA 3ADCA 4TTRA 1IN8A 1EFRA 4D4KA 3K8YA 4A1FA 2FN4A 4C0AC 1CR2A 4ACBA 1KAOA 1ZD1A 2GWHA 2RGGA 1W4CA 2ZJOA 3I61A 4IJMA 4AK9A 3EC2A 1DG3A 4LYFA 1AGRA 3KKOA 3OAAA 3C8UA 5CIQA 4EFNA 1N2CE 2Q9BA 4PC7A 4RD4A 1XRJA 4JYCA 3REFA 5HE9A 2PT7A 2RAPA 4KV9A 4ABYA 2IUUA 3IIJA 3C7KA 2A78A 2AWOA 3V9PA 4BRUA 1F2TB 1QHNA 4PO9A 1PVOA 1KDOA 4XIGS 4URXR 6Q21A 4R9UC 2CHQA 3LNCA 2GNOA 2Q6TA 4JJKA 4PHGA 2Z4RA 1KYIA 1ZM7A 2GCNA 1Z22A 5C4MA 1P2TA 3H0KA 1F60A 2CK3D 3MCAA 2SHKA 2GZAA 2LKDA 4U5XA 4DIEA 4NTZA 1DAHA 5J4VA 1P60A 2H1LA 3LDAA 4LX0A 3QBVA 3KKMA 4NONA 3U7GA 3NBZC 4WXPA 1XXHE 4PXAA 2KB0A 4Q48A 3QBTA 4PPNA 2A5JA 1NIPA 4TMZA 3SI7A 4LBWA 3R8FA 2N46A 1T91A 1J90A 3GLIE 3TR5A 2XXAB 4EPRA 3VR4A 2RB4A 2WMNB 3KFXA 3B9PA 2ODWA 3CO5A 4KU4A 2GXQA 2R6CA 4WBSA 5AJWA 1CP2A 2G1KA 1OE0A 2C9YA 4L4UA 5JI3E 1XD8A 4I99A 1NMZA 4NCKA 2QNRA 3C5HA 4LJAA 4UQOA 2IEZA 2PH1A 3T1TA 1UKVY 5DH9A 2RHDA 1MOZA 4OQXA 1YZTA 5G3ZA 2Q0HA 2FFBA 2WWIA 3N5CA 3VMFA 1X8KA 1ZIOA 1ZU5A 3KFVA 1T3SA 1VHTA 1XEFA 2BBOA 1I2DA 1S3GA 4LHXA 1RJ9B 5CDFE 5FBVB 4LC0A 4MGZR 3CRMA 3QKTA 3BS4A 4NYIQ 2WKQA 2H57A 4Q9JA 1JJ7A 3THXA 2FPMA 2BM0A 2CLCX 2IK8A 4PAMA 3NEJA 1MABA 1VG1A 4D26A 3K0FA 4EIWA 1NLFA 4DIDA 2XB2A 1RFLA 2QPOA 1XEXA 4LV5B 5SZIA 2IUTA 2XTNA 1WE2A 4MRVA 1XPUA 1OF1A 5HTKA 3RWOA 3T34A 3QPWA 1XFAA 3VKHA 4JLNA 4QHTA 1D2EA 4KFSA 1G3RA 2KE5A 1ANKA 5LPNA 2J46A 1EXMA 3PR1A 4XWAA 1II8A 4RY2A 1K8RA 4IVRA 1UBCA 3F3YA 3ZDQA 1TTTA 4Q5IA 1N6PA 2OO7A 1XBTA 2RCNA 3B78A 4LJ8A 4P33A 3FKSA 2P6UA 1GP2A 2IYWA 1XXHA 5C2JB 1Z0FA 1SHKA 3VX3A 2ZUDA 3U6BA 1HH4A 2GA8A 5CJ2A 2J3EA 4CVNA 4D0LB 4RCYA 1HURA 3K9GA 1SVOA 1V43A 2I4IA 4Z1MD 1XEWY 3AVOA 4O2RA 2O0KA 2CLSA 3GLIA 4I1VA 4LJ4A 5JSZA 4TQAA 5C4GB 1N25A 5FUVA 1R0XA 3ZH9B 4DCTA 3IILA 4MRPA 3TIFA 4CT4B 1FW6A 2VHTA 1OB5A 4M1TA 3GJ0A 1KI6A 2H16A 3NG1A 2J5XA 4Q7JB 4D25A 1Z6AA 3VR5A 4F93B 4HAYA 4PZLA 2ZVPX 4ZCMA 4MGKR 4AIIA 2QMHA 3UK6A 2F7SA 3THXB 3GLHE 2MSEB 3EIQA 5CDFA 1CKEA 2CLDX 1NY6A 2R6DA 3K0FB 4PHTA 2PCLA 1JI0A 1XEXB 5BYJA 5F3WB 3GJ6A 1GL9B 4B3BA 3W6NA 3CNOA 1N6IA 4OQFA 2JDID 4P3YA 4EUNA 5DI3A 1MO5A 1Q1BA 1YR9A 1ZD8A 1TEXA 2FFHA 4NPHA 5EP3A 3DHWC 2VSFA 2NO7A 2OXRA 1II8B 1U0HC 3PCRB 3T1OA 3RS7A 1E2FA 4NE2A 1KHTA 4PPQA 1T0JB 1DARA 2ZE5A 1FZQA 3NHBA 2G77B 1TF5A 1XXHB 5DNYB 2ZI6A 4OKSA 3MJRA 2P3SA 2FFQA 4KBFA 5FI0B 4B76A 3GJ7A 1NG1A 2IS4A 4ILEA 4Z8YA 3O8DA 4A8JA 4R7ZA 3GLIB 1ZP6A 1RVDA 5JSZB 3G0HA 3O8BA 2DB3A 2NMVA 3DO6A 1E2IA 2IHBA 4JBYA 2FSHA 3KXIA 1ZAKA 3CNLA 4GOXA 4NMMA 5EXXA 4TYNA 4A8JC 2V4ZA 2Z43A 4DUGD 3VKGA 1VG9B 4TT3D 1OXVA 1UF9A 2F9MA 1KI6B 3PVSA 4WW0A 3UWOA 2CXXA 3FPAA 3WNBA 1FPMA 2OEPA 2XTMA 3Q5EA 4C0BA 5HZHA 1E9SA 3OESA 4LSGA 2HDNB 2IL1A 4AWXA 2A30A 1CR4A 4GI7A 3EA0A 3UMSA 5F98A 5TVKA 3PEUA 1RRCA 5H70A 2GKSA 1DO2A 2GXUA 3LAWA 3NH6A 3ZQ6A 1BYIA 4PSKA 2GXSA 1IOZA 2EYQA 3RC8A 4IFEA 4QJ3A 1NL3A 1S96A 3GLHA 3GLGE 4P32A 1OHHA 3W5JA 1TQ6A 2F1HA 1VTKA 1Z6TA 2J0VA 4TQUS 5DI3B 3B82A 3CZPA 3ICEA 3KKNA 2ZYUX 1FQJA 1IN7A 1GNRA 1K5DA 1Q1ZA 1UADA 1NVUQ 4A0HA 4C2UA 2HV8A 3DMDA 4JLAA 2WWYA 2VEDA 1DAFA 1Z0IA 5DLQC 3RDPA 3ZVLA 4URUR 3FTQA 3B13B 4EPWA 3V4RA 4LHWA 4MA4A 4GBMA 1GKUB 2BMFA 4LCBA 4BECA 3PEWA 2VP0A 3DOEA 1N6LA 2FG5A 1WF3A 5JI2E 2JLVA 4AKEA 1X86B 2BMEA 4NU0A 4A8JB 5J47A 2G0NA 2AWNA 2PZFA 3EW9A 4Q4AA 5L3QB 5KOYA 3PV0A 2IX3A 1JAIA 3KQHA 3U4QA 3K70B 5EUQB 1AGPA 4Q4HB 3M1IA 1MH1A 4LK2A 3QF4B 5J5CA 4MKIA 1SVLA 2Q3FA 1NSTA 4FMDF 1U8AA 1W0JD 4PQYA 3ZVMA 1D9ZA 3CF2A 5L3SB 1QHXA 1J7KA 3KTAB 2BBSA 1EGAA 5DHFA 2CMKA 3CF6R 1XZPA 2BM1A 5DIFA 2IYXA 3ICQB 1Q1QA 3LVRE 1QRAA 3Q7PA 1T9HA 1M74A 4ZDKA 1BMFA 3X1ZA 3GLHB 4L9SA 2H5EA 2XNDD 2WTUA 4HAWA 3M4YA 2W0SA 4QHYA 5CLQA 4KI0A 5BYKA 1Q44A 2QMOA 3U7EB 5FTMA 3HYTA 3VR1A 4WOPA 2N1BA 3ASZA 3GLGA 4WZBE 5IK2A 4PPFA 1FNMA 4RKFA 4Q9LA 1GIAA 3L0OA 3AVQA 4M0LA 2F3TA 4UKDA 3VAAA 2AX4A 5KYKA 2CJWA 2P2LA 1A5TA 3ASYA 4GMXA 4C30A 4X8HA 3EPKA 2O8DA 1DAEA 3IIMA 1TAGA 4MDFA 3IEVA 1UKYA 2OG2A 2QQEA 3KJEA 5B58C 2QRZA 4OHVA 1OIWA 3T61A 3U4QB 4A0FA 1NN0A 3I8XA 3ZYCA 821PA 2D2FA 4RFSA 1GM5A 4D82A 4DKXA 4OYHA 1SVMA 2AD5A 1ZC4A 4EPYA 1KJZA 1RRGA 3HPQA 1W48A 2B7BA 2XGJA 1GILA 2QE7A 1DOAA 1XCMA 2IYVA 2VO1A 3ADBA 2CE7A 2DCUA 4DCSA 4TLAA 3THYA 4LV6A 1NVWQ 3UATA 4BZPA 1MV5A 1OYWA 2R6AA 1OFIA 2YWEA 1JR3D 3EWAA 3PUXA 3ZJYA 4TQ9A 2BEKA 2QEQA 1TUEA 1S3SA 3VU9A 2CHGA 3T5DA 1OIXA 2AR7A 2J0UA 3RS3A 1VIAA 1OFHA 3TUJC 1Z47A 1C1YA 4YMVA 4WZ6A 1NY5A 2IW3A 1OXXK 1UFQA 5FFMA 3QKUA 3FB4A 5FPSA 4DJTA 5HZKA 1A2BA 2NZ8A 3GLGB 1W49A 4GZMA 2P0EA 1U2RA 4GMDA 4H1VA 3W34A 5CIWA 3IGFA 3LQQA 3U3RA 2IYUA 1OH7A 2ORVA 3NC0C 4AG6A 3I62A 1XNJA 4ZV4A 1TF7A 1W5TA 3AF0A 5KSPA 4JMPA 2J87A 1QG4A 2O8DB 1G7TA 4ERNA 2VA8A 4V02A 1W36C 2F3RA 4XJXA 2JJ2D 4TYYA 4FN5A 3VTKA 4JSTA 5FL7A 2BKUA 2WWHA 4B6FA 1YKSA 1M7BA 1C9KA 1YR6A 2GJKA 5IT5A 4RFSB 3ND8A 3O47A 2IXGA 1D6JA 5F9FA 5CYOA 2JIZD 2W58A 2V7QD 4HLDA 2AKYA 3HR8A 3P32A 4QNMA 1E6CA 1KMHB 3HPRA 3SS8A 3QXSA 2DHRA 2BBTA 2HT6A 4URWR 2XZPA 4XWKA 3CPHA 5M04A 3A8TA 3AF3A 4GPTA 1GFIA 2GZDA 3EZ9A 4PC2A 2NZJA 2OE2A 1JXMA 2ZYVX 3Q85A 2NO1A 3ND9A 3QSYA 3AGPA 5FI1B 5DHAA 1FUKA 1QG2A 1UM8A 3EAQA 3L0PA 3RAPR 1XMSA 3KL4A 5KDLA 4BLTA 2QMEA 1GZSA 3VU9B 2CCJA 1SXJD 2OSBA 4US1R 4DCNA 1GSIA 2CCGA 4ESVA 5JWRA 1GAJA 3A36A 5KDOA 4M22A 5LD2C 1BIFA 2W6ID 2B7CA 2XB4A 1AS0A 1L7VC 4EDHA 5JZVA 1OT3A 4M2LA 5GVSA 3VKWA 2DFNA 1G4AE 1E2EA 1FP7A 2WAYA 3BORA 3WY9A 4NZYA 5IHPA 1IXSB 1W36B 1NVVR 2QROA 2OV2A 3ZVRA 5HPYB 1Z5ZA 3KB2A 4CZ2A 2RGCA 3CBQA 2A3RA 4U00A 3R20A 3OIWA 5UKDA 1SVSA 2OFXA 3M6AA 4BFXA 4DSNA 2PEZA 4UXHA 4OQMA 5GJBA 2FOLA 1YU9A 4BASA 2D06A 1KI7A 1P2VA 2WJGA 4Y0AA 3REGA 1TU3A 2WKRA 1KO1A 2X77A 1XWIA 3AF4A 4O2LA 4M9SA 4W5HA 3U3MA 2FV8A 5P21A 3TVTA 1IN4A 4Q4LA 1COWA 3AP2A 4ARZA 1D8TA 4E09A 1JQLB 3K1JA 2VPPA 1GUAA 3HR7A 4F38A 1UAAA 2G9NA 4I81A 4ASUD 1DO0A 1G8FA 4C0JA 5FPKA 2Q21A 3WRYC 1OXUA 4B75A 4V0KA 5HKKA 3HWSA 4Q1BA 421PA 2BDTA 2QUZA 3AP1A 2BBWA 1HT1E 1U99A 5EE5B 4PZZA 3P4YA 1RW4A 2BC9A 3SFZA 5FTLA 3ZLJA 1W47A 2XOKD 3DEFA 2YWHA 2O8CB 4HLQB 5LD2B 1KZ7B 4RD1A 4IHQA 3T15A 3W6PA 3CX6A 3OEHA 1P73A 1MO3A 3V00A 1DAIA 1CXZA 1P4SA 4F4JA 2V8OA 1KO8A 4CDGA 1QHHB 3U3KA 4XWOA 1UKZA 2IUSA 5DN6A 3B1WA 1E79D 2IA5A 1IY0A 1YZQA 2Z5FA 4HLCA 1HYQA 3TK1A 1QHGA 1R4AA 3VR3A 3SR0A 1E9FA 1R0YA 3QNUA 1AQYA 4C0KA 1RE0A 1N6RA 4C9BA 4E22A 1ZM3A 1RC8A 4FINA 4LBYA 1ETUA 2IHYA 5EJEA 2ZEJA 3EARA 1Q3TA 4DHEA 1CJMA 2IYYA 4Q1FA 4HAVA 1UEIA 1X6VA 2QU8A 4IEIA 4A6XA 1BH2A 1NF3A 2BV3A 2ZPTX 2TMKA 1V5WA 1X1RA 3V4FA 3WBKA 4NYMR 1CEEA 4HZUA 3GJ4A 2JJ1A 3O8CA 3ZQJA 2BCJQ 1MKYA 4LJ5A 2WICA 4ARZB 5KSOA 1M34E 4QL3A 4DLTA 3GLFE 4G5RA 4M1MA 4ZKEA 1VDZA 3LH5A 1ZNXA 4BLQA 2RGDA 2VRWA 2NOAA 2NPIA 2DPXA 2J0SA 3EZFA 2H8KA 3MWJA 4US0R 4A2WA 4Q1AA 4LDJA 5EXTA 1WRBA 4CW7A 3OEEA 5CK5A 4D0GA 1YZGA 3A6PC 3HU2A 1WQ1R 3LBNA 2KJQA 3FVQA 1R8QA 4TL6A 2EWVA 4DLYA 3ZZTA 3FKQA 4CIDA 4E5UA 1XTKA 5EP4A 1DELA 1S2MA 2FGKA 4KITB 1H8ED 2C78A 4JLVA 5AUOB 1E0JA 1G1MA 2ZE6A 3OIYA 1E9RA 1LTQA 4N3NA 4LJ9A 2WPDD 4UJ5A 3E70C 5EZ5A 1E9BA 2Z4SA 3ZIAD 5EE0A 3VHXA 1WCV1 2OCPA 3OFND 5G53C 2WKPA 1P5ZB 2QENA 3CR7A 4FIDA 1G291 1XZQA 4ESHA 4FMCF 1DBSA 1KSHA 5D3MB 2ONJA 4PHFA 4JS0A 3TBKA 2GVZC 2ZYWX 1ZW6A 1AZSC 2QAGC 3A4NA 2OLKA 4NDZA 5AJXA 1A7JA 2OFOA 1M7GA 4KYUA 2XEXA 2XSZA 3SE0A 2OBMA 3SBEA 5JLJA 4ZIRA 4P4UA 2FF7A 2YC2C 2WSMA 3DM9B 2ZIAA 3QENA 3TVDA 3C4JA 2JJ2A 1XB2A 2JLSA 4HZUB 4BPBA 1XEWX 2RH5A 3AH8A 1AKEA 1KZGB 2ODBA 4YDSA 4HEJA 3BB4A 3LRPA 3NIBA 1UDWA 1N6OA 3BXZA 4PO1A 3Q3JB 1G3IA 5FBWB 4ZDWA 3OE7A 2A9KA 4U7DA 2P6RA 1GG2A 2JIZA 4JLJA 2FA9A 1T8UA 3GLFA 2F1IA 3SYKA 4RKEA 2WV9A 1MRSA 4IDQA 4RFVA 1M1YE 4II7A 3K70D 3N2EA 3QPVA 3SQWA 1EG7A 2ZI3A 4N0EA 3TKLA 3SYLA 3EX7C 4QJ5A 4PQRA 1W1WA 4Q4JA 2HYDA 1XMJA 4KSBA 1D2MA 4Q18A 3DVLA 2IS1A 1IXZA 3LA6A 1RZ3A 3RABA 1OYYA 2QL6A 1SULA 3A1TA 4PC1A 3SN6A 1OJLA 4OHXA 3UMRA 4TMTA 1GTVA 4JLPA 5FPYA 1NSFA 2BHRA 4HAUA 5JRJA 3HDTA 2QAGB 3FGNA 3FOZA 3L8YA 4DDTA 2ZRHA 1T4GA 3CLVA 2W2VA 1ZC3A 1JALA 5KU1A 2GCOB 5FBQB 4YMUA 3MAAC 4B43A 2AD1A 4RD3A 1IN5A 4XTRA 4ZIRB 2PLFA 3OIUA 1E9EA 1U81A 4NKRA 1SKYB 1FP6A 4EQ6A 4JLKA 2NIPA 1TX4B 1ZCBA 1NN5A 1QVAA 2X8AA 4CEHA 2VH5R 4QBIA 4PR0A 4OQNA 1Q0UA 1QHSA 3NDBB 1NVVQ 3A1VA 1YHNA 3K0CA 3CPEA 4R98A 1G6OA 2PZGA 2VP9A 4LJ7A 5EE1A 3C14C 3U3JA 2IWHA 2CNWA 2B21A 3MGCA 1NRJB 1X8JA 4A36A 2G6BA 3VFDA 3SJCA 2O8FA 4LOAA 1E1QA 2QA5A 3L0IB 1XPOA 5TXGA 5E7MA 2ZRLA 2GESA 4A2PA 2EQBA 2ODEA 2V6JA 3MSXA 4FD2A 1MT0A 1NN1A 2H17A 2IYLD 3T06B 4DLZA 3LLUA 4JSYA 3ZGXA 4LPKA 4NCNA 5EP2A 3U2QA 4FCVA 3CW2A 1LFDB 3LXXA 4JL5A 1R6BX 3ZD7A 3JZAA 3MWLA 1XTRA 2ZI9A 1P61B 1GNPA 1P9NA 1GVNB 5HCNA 4IW3B 4DEYA 3CKLA 1NBMD 3CH4B 3K0SA 2ZREA 4LBVA 3EA5A 4W5WA 2G0TA 2YV5A 1XJQA 4KCGA 1PJRA 4URYR 3RSOA 1A1VA 4KAXA 3VR6A 3BD9A 1H8HD 1EFTA 1UEJA 3HYRA 2J7KA 4DCVA 4B74A 2QRNA 5TB5A 3X1XA 3BH7A 4L5BA 4LWZA 4XVQA 2J45A 2HXYA 1XTJA 2W6JA 1JR6A 2EYUA 3NKVA 2GBLA 3LY5A 2ZRJA 2XAUA 4OI4A 2MSCB 4EQ6B 1N0VC 3GJXC 1XMVA 2GBLC 2R44A 3KQUA 2ZSDA 4CEHB 1KKMA 1Q22A 3KUDA 1XD9A 2FEMA 4K46A 3THWA 3MUFA 1G3MA 1R0ZA 1TADA 2ZS9A 3X1YA 4AI6A 4G1UC 3I4LA 2YVUA 1KI4A 3H86A 3R9XA 2DFKB 4EFMA 5FH9A 1W44A 2R6GA 4OI0A 4QC2A 4EJSA 1OSNA 2ZYTX 2V1UA 4PZYA 4C4PA 4TYQA 4NYMQ 1AZTA 5ELXA 4EFLA 2FPKA 1JECA 4V0OA 4EJSC 2PT5A 2HF8A 4XD7D 4Z54A 1GRRA 3GFOA 1G7RA 2F43A 3AV0B 2CHVA 1PUIA 4DDUA 4K8OA 5E4FA 3DZDA 5AJYA 1VPLA 3DPUA 4PAQA 5A5GA 2IT1A 2NO9A 1XJCA 1G8YA 1E9CA 1GKYA 2A5GA 1MABB 3T1QA 1W0KD 3DL0A 4NHOA 4RJLA 1P9RA 3E2IA 3QE0A 2WVJA 5DO9A 1FFHA 1H8EA 2AKAB 4QBHA 2FEOA 3TGPA 4E07A 1IJFA 1T5LA 1NMYA 4LC1A 5FOTA 2EW1A 3HU1A 5JJLA 2EFEB 4QRHA 2DFLA 3CNNA 4HDCA 4G5QA 1VHLA 4DLXA 3OFNA 2QZ4A 4JVNA 1Z3IX 4IRUB 2XJ9A 4BFTA 5JS7A 4WVFA 1U0LA 2OBNA 1UBGA 4C0HA 2UZ3A 4GNKA 3QXXA 4TSFA 1F3OA 4LUCA 4OJKA 1DADA 5L3VA 3H4MA 3AVUA 3M0EA 3GJ5A 2C77A 3VX4A 3QG1A 4LYJA 2RGXA 4G5GA 4WAUA 5JECA 3THWB 3QI2A 1U8ZA 1CR0A 2J7PA 2ZJ2A 2GZHA 4BFVA 4DB2A 4LHVA 4RZUA 2GJAA 4KSCA 1U0JA 1VMAA 4HUTA 2VF7A 2YOFA 2FDCA 2FFAA 2J0QA 1ZMXA 2YOGA 1KTVA 4EJSB 3GFTA 3LXRA 1KDPA 3EIEA 3BWDD 3BIFA 5KNCA 1EWQA 4FMBB 4QGGA 4E03A 1S9DA 1XX6A 1L2TA 2VSXA 2D3WA 3OIVA 1D2NA 2BEJA 2F43B 1U90A 2VL7A 2WWFA 4MQBA 3U7HB 1N0WA 3QKRA 1ZM4A 3K9HA 2ATVA 1M8PA 3NTUA 4L15A 5H1YA 3D7MA 3WMEA 4B2IA 5JHHB 2OT3B 4KLZA 1HQYE 4OK3A 3TNFA 4P0TA 2VP2A 2ZRMA 3W3AA 721PA 1BKDR 2IF2A 4IDHA 3SJBA 4JVLA 1Q21A 2VQSA 4KFUA 3WNCA 4IDNA 1DVRA 3TMKA 4C0LA 1E2GA 3G82C 1E2NA 3UMFA 3TAHA 1AK2A 1ELOA 1M7HA 1VECA 1OKKD 4LJYA 1JQJC 1ZCAA 4FWTA 5EZ6B 1CBUA 4W5JA 4W7SA 2CK3A 2WBLC 3P26A 3U61B 1IY1A 4X8LA 4YMSA 2B8TA 4YXWD 1XDBA 1T6NA 1TQ4A 2OESA 1Z08A 4BFSA 2VP6A 1WP9A 5TMPA 4IVPA 2RGNA 3AVXA 4NYJR 4TN1A 2HT1A 1E3MA 1SQ5A 4UNPA 2ZU0C 3SNHA 2NQ2C 2VHJA 1FOEB 2RGNC 3FFAA 4NBSA 1SVIA 4PTLA 4F92B 3G5UA 4IEEA 4Q7KA 1CTQA 4DXAA 4MYUA 3IBGA 1RYFA 1G17A 1KY2A 1R5OA 5C1BA 3BH6A 3AF1A 1G5TA 1KI1A 1R7RA 4HSEA 1ZM2A 1Z2AA 2D7DA 4G5OA 2XZOA 2A2ZA 3QKRB 4BEJA 3TUZC 2NO6A 3KDSE 1GOTA 5DI9A 5JWHA 1HQCA 2HJGA 2ERXA 1FX0A 3TSOA 1NI3A 1ZNZA 2IBMA 4OK6A 2W00A 2ERYA 1FMJA 4GOKA 1AIPA 1YRBA 2XJ4A 4LHYA 2EFHB 1E2QA 4CF7A 4QM7A 3D8BA 2L0XA 4S2EA 2VTKA 3BOSA 4M4SA 5E95A 2C2HA 2XITA 5LB2A 2O0JA 1JB1A 2GAOA 4Q1DA 3CRQA 4G0NA 5K8IA 3SZRA 3B1XA 5JJIA 3PENA 4TL9A 4M9ZA 1OIVA 2Z83A 4KODA 4KVAA 2EWWA 4HUQA 2JLXA 2CBZA 2QSYA 2ZI4A 2GF0A 2ZRAA 3W9YA 4PQFA 1Q1EA 3T12A 3KXKA 2IYQA 2REXB 4RSGA 3NHAA 1G6HA 1E2MA 4Q4AB 4YQFA 1ZVQA 1DAKA 2EU8A 2ONKA 2ANCA 3KKPA 2MSDB 3B60A 4TTPA 3C16C 3SQXA 3W8NA 5BN5A 4Z1MA 3IO5A 4B48A 1G7SA 4DDVA 2GETA 3QEOA 2UVQA 2BMDA 5FOVA 1HA3A 5BN3A 2FSIA 1TU4A 3OF5A 2C8VA 4QGHA 4JLMA 2P6NA 2HLDD 4MYCA 5JFGA 3DKPA 1DS6A 1IQPA 3AQ4A 2J1LA 4RZ2A 1FX0B 3BGWA 1K6MA 1PZNA 4XD7A 4TZ0A 5ANRB 4MRSA 5SZKB 1LV7A 3AP3A 2JEOA 5C46F 3TQFA 4R2HA 1GDDA 1E1RD 1GKIA 2BOVA 1KO4A 1LY1A 4IOJA 4DLVA 3LW7A 1NJFA 2QTFA 5IRCD 1Z6YA 3RS0A 4D81A 2EFCB 1E32A 5EXPA 2GEVA 1G3QA 1GITA 121PA 4P4SA 3I8SA 1Y3AA 1NMXA 4AURA 3ZS8A 1KO5A 2JLUA 4Q9KA 5D3QA 4F4IA 3GPLA 1AS2A 2CJWB 4PC6A 2JDIA 3AGQA 5JEEA 2BKEA 3AKCA 1KI2A 3CONA 2QBYA 4HUQB 3B8HA 2OILA 2WSSD 5DE3A 4BFWA 1T3HA 2E9SA 1PLLA 5FR2A 2C04A 3I5XA 1KJYA 3KQLA 1OPXA 4IOKA 2OLJA 2XZLA 5TY0A 3K9LA 3WP1B 2AFIE 2W2XA 3QVUA 1ONBA 2AL7A 2GXAA 1GRQA 1RYHA 2OFWA 3MG9A 5EE3A 3Q5DA 1F48A 1KKLA 1T5IA 1OFTA 3K0AA 3MD0A 2CVHA 2R2AA 1OFUX 1IONA 2IXEA 3DMNA 4MH0R 4C0SA 3RLFA 5AJZA 1KI8A 4X8OA 1DG1G 1EFRD 4DUGA 3CB4A 3THYB 5K8TA 1NN3A 4TT3A 2W0MA 2PCJA 5KNDA 5L8VA 4PPGA 3RS2A 2D62A 3SYNA 3IQXA 4KFRA 2B8WA 2D4HA 3FMOB 4LRWA 2GCPA 4Q9HA 3NWJA 4JYBA 5FUWA 3OAAD 4DRZA 1G5PA 1ZYUA 2CL6X 3IHLA 2J0UB 2QG6A 2ZE8A 5GVRA 4A92A 3FMIA 5K8UA 4BLOA 1GWNA 2C5LA 2D74A 3FHTA 1PLJA 3C15C 1EX6A 1C4OA 3IHWA 2WZQA 3QKSA 1CULC 1VG0B 1XU4A 1Z8FA 2PX0A 2XTZA 5FL3A 4MUBA 4DC9A 3H1TA 1G21E 2QAJA 1LNZA 2ZVQX 4YONB 1JAHA 3RRMA 4C2TA 4IDPA 1O3YA 5KO2A 3WYAA 5B64A 1MRNA 3P4XA 2QBYB 3B6EA 3DDCA 4MKHA 1YZLA 2G3YA 4PFSA 5CK4A 3VQTA 1CS4C 1I4TD 2ECKA 2ZSEA 3QQ5A 4KLNA 1P6XA 2OHFA 1EFUA 2P5TB 2O5VA 5DYGA 4XVUA 2KI5A 4HDOB 4Q1CA 2F55A 4Q1EA 5K8LA 2GHIA 5CJPA 1IY2A 1AS3A 3CX7A 1J2JA 3JZMA 1XPRA 4GP7A 4WXRA 3Q9LA 4LJ6A 1E0KA 5LBIA 3RNLA 1NVXQ 3AVPA 1CF4A 1UBEA 5LB4A 3L8ZA 3BFVA 3ETLA 3IPXA 5AUQA 4JL6A 5AWFC 4CRWB 3EXAA 1R10A 4NYJQ 5FOXA 1KMQA 1J8YF 3VNVA 4HAXA 2HCJB 1F2UA 3WMFA 4PO8A 2CE2X 1A4RA 2IWRA 2C98A 1G16A 1VCMA 4PHHA 5EQTA 2GK7A 1W0JA 1JR3E 2K5UA 4NCHA 1EK0A 4YMWA 1KI9A 5FUYA 4KO8A 2IYZA 4IKEA 3ZZ0A 8OHMA 4GDFA 1FTNA 4QNRA 2I1QA 3A37A 3DOFA 4D4LA 4G5SA 4JT2A 1LVGA 4LZZA 4NYIR 1VYVA 4QG7A 4TLDA 4L9WA 1OLOA 1E9AA 3I1FA 5KUTA 3SHFA 4CEIA 3QKSB 2OXCA 4B2PA 1KNXA 2BJWA 2XNDA 3VNUA 4FW9A 4ZKDA 3TSWA 4IDOA 5TARA 2HYIC 2BCGY 4OJQA 1Z6XA 4Q7LA 2LKCA 4AYXA 5GADl 3QF7A 1VKJA 2ZJ5A 2ZR9A 4BFZA 2REBA 2ZAOA 2N42A 2QY9A 3KXLA 4DWJA 3B1ZA 1WXQA 4QM6A 4YLGA 5FTKA 3AVVA 3BBPA 3KQNA 2O8EA 4TYWA 1XTQA 2ZJAA 1JPJA 4XTCS 1X1SA 1RRFA 4KHZA 2BMJA 2ZS8A 4JLOA 1E2LA 3WYGA 1T3LA 4MUAA 2KBFA 3CR8A 4OHYA 5SZJA 1JBKA 1Z28A 3AKDA 3B85A 5SZHB 2OZEA 1S1MA 5KNBA 1YQTA 3WYFA 1IJEA 3QUSA 2PLRA 1RRPA 2YYZA 3FKSD 2AXNA 4OI1A 2ATXA 2PMKA 1F2UB 2DWPA 1OV4A 2V55B 1CIPA 1P75A 1TPZA 2ZRCA 3SEAA 4MGYR 3E5HA 3RS4A 4F7WA 4R71A 1FTSA 3A4MA 5J4HA 1QHIA 1X8LA 2GK6A 3GEHA 4Q66C 1KIMA 1YZNA 3Q8XB 1WA5A 4X8MA 3LVQE 4OK5A 1ZUIA 2RGAA 2YWGA 5JEDA 1SXJE 3NEYA 1YJ5A 1E69A 2DBYA 4M1WA 1JR3A 2QP9X 3VHLB 4V0ME 2G83A 3RYTC 1IHUA 2F9LA 4FCWA 4CEIB 1R5NA 3I73A 4DLUA 4NH0A 4M1KA 3MWYW 4ITRC 4DVGA 3EPLA 1QDEA 3UIEA 4Q47A 4MYTA 4Q01A 4MITA 4TZ6A 5GJCA 3PFIA 1YR8A 4B6EA 4YDHB 2YKGA 3IQWA 3GJ3A 3IBYA 3PUYA 2R8RA 2VYFA 4MGIR 4UNQA 3CM0A 3FDIA 2WOJA 3CUEF 1U98A 3RC3A 3CF0A 1MO6A 1VCNA 2WHXA 5AJVB 2O8EB 1N5KA 3BRWD 3F8TA 2F1JA 2Q3HA 3AB3A 2C95A 3D6TB 2OCBA 3DKVA 1O87A 3LQRA 5FOUA 5AUNB 5B57C 2JASA 2JJ8A 5EP1A 4FCTA 4UNSA 4UXIA 2GF9A 2IF0A 2ZRNA 1E2JA 4L16A 5GJWC 3TQCA 4ZCIA 1KOFA 1Z06A 3FYHA 4B44A 2FH5B 2BVNA 3X1WA 4A0RA 2P5SA 2Q3MA 3QVVA 1Z0DA 2V7QA 3ZVNA 2ZRBA 4M9QA 1D5CA 3AVTA 3TW4A 2A5FA 4I1SA 3TE6A 1P2UA 3GEIA 2ZXUA 3W3ZB 4JT4A 2ZJYA 2JAQA 3VR2A 3WP0A 5E3HA 3RANA 1CRPA 1G8HA 4LGMA 1HEIA 4EAQA 3EZ7A 3W6OA 4IXMA 4M1YA 1E99A 1CLUA 1OH6A 2YC4C 3BFKA 1SXJA 4PAOA 3NXSA 4RCZA 4AKIA 2I1VB 3K0EA 1P9WA 3RSLA 4JLDA 1J99A 5E7JA 1S1CA 1NLYA 2PMDA 4V0MA 1SXJC 2VP5A 3UANA 1PV4A 2VSOA 2W6IA 3WMGA 4Q21A 1RJ9A 5A4JA 3GQBA 2IYSA 2OUKA 1B0UA 1XJ0A 1R5BA 3TLXA 1A2KC 1UJ2A 2VIIA 4RD6A 2I3BA 5H68A 1G18A 2JLZA 1OHHD 3BFXA 3NBFA 1DPFA 4EPXA 4M8NE 3RS5A 4DEXA 4C7OA 1KO7A 1YR7A 4IFBA 1P72A 3L43A 1KSGA 5EXSA 3A1WA 4D4JA 1ESNA 3T1VA 4TYPA 3RRNA 4I4LA 4B71A 5IF9A 2GDJA 3EPJA 3CX8A 4GRAA 4CT5A 2UZIR 3MFYA 3L82B 3CWQA 4BGDA 1H65A 4WIAA 4URVR 1Z63A 1KNQA 3R9WA 1E2PA 3ECCA 4B3GA 1CJVC 2DFTA 1JPNA 2D2EA 4QBGB 2W83A 2WIAA 3CPJB 4F4CA 1QF9A 3K0CC 3H2YA 2PZEA 1LB1B 2QN6A 2JCSA 1X3SA 5AUPB 2ZI7A 3T35A 1D9XA 4C0QC 3GLFB 3I5YA 3LBHA 4B3CA 3I92A 3PG5A 4OL0A 4D80A 2A7QA 2AXPA 4Q00A 1GL6A 4ASUA 4A0GA 2WWGA 4FI3C 2ZJ8A 3WHKA 4D2IA 2AFHE 2YJTD 5FPHA 3KKQA 1CJTC 2XX3A 1M6NA 4Q4JB 2VHCA 3W90A 1SZPA 4G01B 2ZRPA 2XOKA 1T8TA 1CR1A 3GJ8A 1SXJB 4GFDA 1LS6A 2Y8EA 2ZS7A 3EWSA 5F2EA 1E2DA 2PX3A 4HYYA 4LYHA 1N5JA 2HF9A 4HI0E 3AEZA 5FBLB 4GOJA 3MMPA 3F5FA 3BB3A 2JLYA 3CIOA 4IXNA 2ZU6A 1SVWA 1KGDA 4D0NA 2R9VA 4RD0A 1XTIA 3LO5A 3WBJA 1BMFD 1CJKC 1E79A 3AF2A 3CRW1 1E2HA 3F0TA 3X1DA 1VCIA 2FE4A 4G3XA 1P3JA 2IS2A 1XF9A 3A1SA 1Z07A 4UNRA 3CWZA 4C7OB 4JL8A 1Z6GA 1II0A 4QHSA 3BERA 1I4LD 1TMKA 2HJVA 4Z8XA 4GL2A 5IK2D 4WZAE 3GP8A 1U9IA 2ZSBA 1I2MA 2C03A 3FHOA 4RZXA 3MLEA 4JBWA 1XMIA 4LHZA 3IO3A 3EIHA 4LBZA 1PUJA 1U9IC 2ZE7A 4GZLA 3K9NA 4A4DA 1NNEA 2ODNA 3CRRA 2QI9C 2IC5A 4QKQA 1W2HA 1QZXA 2YINC 1G41A 3O8RA 3U60B 4YC7A 2WIBA 2O8FB 1TNDA 3K09A 4H9GA 2R6FA 1KSJA 5G3YA 5AR1A 1WMSA 5EE9A 1AN0A 5FR1A 2C99A 3EC1A 3OZXA
chains in the Genus database with same CATH superfamily
3WJ7A 2QX4A 2PS0A 2JRCA 1Z6ZA 2IQ5A 3H9GA 5ECWA 4OGFA 4RL4A 3LY9A 5D5QA 4AZ0B 1I14A 2FPIB 1HTWA 1WB5A 1WVIA 2OYSA 4OHKA 2YZ2A 3B9QA 2PEYA 1U2QA 3R5FA 3OQIA 3OQVA 3KD2A 3EULA 3OQ1A 1E9DA 2HQBA 4CQJA 3UMMA 2PFSA 5EJMA 4W9MC 4J03A 1ZH6A 4RHFA 3ZWNA 3QYAA 2EGGA 2YIMA 3G59A 1Q1NA 1W4AA 2Y6UA 3TH5A 1F0NA 1TTPB 4YQZA 3KE8A 1M2OB 1RXYA 5CBPB 1A9TA 5JXHA 5IUNC 3D5QA 3VZCA 5KJCA 1CQIB 2CF6A 3M9LA 1YE8A 1CZUA 4BE7B 1NW5A 4HQLA 5D3KA 3EGVA 2JATA 4EUEA 1C3OB 1LF0A 3OWXA 1O08A 4ZPXA 4KE8A 4MV4A 2QLLA 5E38A 3EBPA 4LRQA 4N5DA 1WXWA 3B8EA 1T0HB 3F9CA 4MZXA 2ZTUA 2NSLA 1HLFA 1YFKA 4KO3S 3SZMA 5ED4A 5J4LA 1OTHA 2PN1A 3DEIA 4Q03A 1EVLA 4MB0A 4YJ3F 2D54A 4TRNA 2PXHA 2WWWA 3CE9A 3ENNA 4E3WA 1W36D 3SSAA 2OOSA 4GXTA 1T8WA 1SQ6A 1ZINA 2N0SA 1CNFA 2EQ5A 2DQ4A 1ZUHA 2FSVA 4FOTA 3ZY6A 2JC3A 4AT1A 3KKLA 4OU4A 1GG5A 2I29A 1DKMA 1JB9A 2EX4A 2KLBA 1ID1A 1FFAA 3JAKB 3T3EA 3CEJA 2ZRDA 2GERA 3E3AA 4D0SA 3SU8A 4M9UA 3AONB 3C97A 1QPGA 5FUXA 3JQGB 1C7ZA 5T8KC 1EKXA 1T34A 2AG1A 4G56A 3G0IA 1XPJA 4OJMX 2DR3A 4UHJA 4WDQA 3OZCA 5ERXA 5H3HA 4RD2A 5U4QA 4HGQA 5L3QA 1U8FO 3T4UA 3IERA 1X9IA 2P9EA 2RGBA 2OCAA 3C3KA 4L6CA 5CGQB 4N8DA 1KK0A 3CU5A 4K6GA 2BP7B 3BMQA 5CB4F 4KOEC 5TEWA 4OIFA 1NBME 3MJEA 4PC3A 1US8A 2VF2A 2J3LA 5BSWA 4DIUA 4MVJE 4N5IX 4CEJB 1QB8A 2C96A 4Q3BA 4DSUA 1RYNA 1XHLA 5FTJA 4Z0PA 5KIAA 1U5BA 4TTQA 3SJ7A 3IFSA 1FSZA 1QIKA 1W34A 1X39A 1VYUA 3ZCSA 2G4CA 3OI7A 2PBZA 4JQCA 3AM1A 4X62B 3KTAA 4RVUA 1Q7BA 3SMQA 5A6VA 3K05A 1C3VA 1TD9A 1GPBA 1OXSC 3OOEA 1M75A 4OB6A 4ZZ3A 2WM8A 3W5AA 1S0UA 3S6JA 1F5SA 4ZI2A 2OTCA 1LDMA 3L9WA 1O8CA 3LBIA 4MNTA 1RWKA 4RXTA 1ECGA 2BGLA 1DIOB 2V6GA 2VPXA 4NBRA 4Y6RA 1HE2A 2ID9A 3DEKA 3J81k 2FZVA 1FSGA 4CLOB 2E4XA 1R0WA 2IPXA 1SUDA 2VHUA 4CM4B 3HJFA 2NU8B 1THTA 1ZN7A 2G28A 1JLRA 4O4HA 2QT9A 1NBAA 4O4JB 1H66A 3PXGA 3RRZA 1QNFA 4CMHA 3SHOA 4PGFA 4RV9A 3U31A 3MS2A 4GXNA 2H0RA 5KOJB 2VDQB 1P62B 3F5MA 2WDPA 2ZSAA 1W2GA 4OFWA 3WIDA 4ND2A 1NJGA 3IAM6 3IMGA 1LV8A 2J07A 3PYXA 3JD0A 1TK3A 1W5FA 4TWJA 4M86A 4WOBA 5IJ9A 1MZPA 4XEUA 5DBIA 5BWBA 4KJZA 4FE7A 2B61A 3UPUA 2IUEA 1ZK0A 3DT8A 1AQUA 3IP1A 3S29A 4FZ5A 1G5RA 2OECA 3IB6A 3SOPA 5LIPA 1TZKA 4Q9DA 1TYEB 3CZ5A 3Q12A 4IGEA 5KINB 1Z4LA 4JKIA 4BNNA 2FZCA 3H8JA 4S1PA 2FU5C 4CTJA 4EB6B 4YAIA 3AR7A 4O2BF 2CUKA 1NQVA 3ONWA 4H6VA 1ZCFA 3PE6A 4WNYA 1MB3A 5FBRB 2ATIA 2EFGA 5FKJA 3R7WA 2NU6B 2W6NA 1H3FA 4ER0A 3E9CA 2VRBA 4OO3A 3M6WA 2OO3A 3O1JC 2QL7A 1W52X 2PA3A 4K81B 4KQEA 4J9UE 3IUMA 4IH4A 4UNNA 5IUKC 3NX4A 2BEWA 3LV8A 2AQ8A 3EPRA 3SHWA 1SXPA 3LE8A 5DTEA 4NAUA 4EW6A 1QH1A 3GAFA 1VRWA 2R87A 4EA8A 4Y6PA 1QGUB 1PFGA 3DFIA 1NBMA 1IHYA 4ZQEA 3FGZA 4GSYA 5DXJA 4GQAA 4MVJA 2WJYA 4JITA 1W94A 4O2AA 4PPYA 2PSFA 3OEHD 1VJ5A 3KOUA 5KHAA 3EASA 1GLGA 2G8NA 5CIYA 4S1TA 5CB0A 1GG8A 1SXHA 4JBXA 3MJCA 2R65A 5DN6D 3ZV5A 4DRYA 3FWYA 3WBBA 5ICCA 3EGIA 3ZDFA 2PJDA 3V4ZA 2H48A 2QT1A 2XTJA 5HCIA 1N6NA 3TFWA 1D4FA 5K0BA 5BN4B 1YRWA 2WEKA 1DLIA 2JF0A 2E6UX 2ZBVA 3MRXA 4ROSA 3SZOA 3PQCA 4F86A 5L7TA 1RWVA 3AOEA 3QV2A 4RELA 1UDBA 2C2OA 3MMNA 1JVSA 3QOFA 3EC7A 4PY2A 1J2UA 4GI1A 4BDTA 4BEBA 2FGJA 2N9UA 4BDSA 2FWRA 4RDCA 1Z62A 2H2HA 2R1VB 3UCEA 3I3OA 4IINA 4IP0A 2HPAA 1EVIA 1ZJ6A 3PPIA 4L9AA 2HLPA 3G2KA 5A4KA 2X2EA 2REQA 4X85A 1BA2A 1R2QA 1PG0A 2EJUA 1BE1A 1QCZA 4YCBA 2NUBA 1XZ8A 2HH9A 4U2DA 5CM8B 5BORA 4FYIA 2QTMA 4H59A 1F7VA 1YZKA 2OCGA 2OAQ1 5KPDA 2ZBUA 5EQFA 5IAKA 5JRZA 4F56A 4HATA 4QOIA 3FKJA 1FTGA 1KSFX 1KKUA 3NIGB 5LP6C 4EJ6A 2D1QA 5FWYA 4A82A 1QJCA 2QUAA 3N76A 1IUKA 1PK7A 5DJ5A 4CNBA 5JYEA 2FZKA 3OCWA 2VXYA 1PW7A 3BK1A 5D5HA 5ALXA 4I46A 3UH1A 1PVDA 1RE1A 2WZCA 3DC2A 3GVXA 4D56A 2H1FA 3W1WA 2CBXA 1EEHA 1KXZA 1YE5A 2GAAA 2JGIA 4XPIA 4WT7A 5FV4A 1VE5A 4BV3A 1N5IA 1NZJA 1XKQA 1NFQA 2OD9A 3PXUA 4UJ3A 2C5HA 5JJ5A 5TQVA 3N59A 5DBOA 2C3MA 2Q99A 3VKVA 1RXEA 2PQ0A 3VDQA 5KTYA 2IHUA 1CRZA 3EW7A 3NVAA 3CF4A 5J1TB 4W5RA 4O1MA 2YVLA 1AMUA 2H4ZA 1CUYA 3IXQA 3VU1A 1B1CA 3ZY2A 3AUXA 7MHTA 1QDUA 2WF8A 4PW0A 1M2NA 1S2LA 1G8PA 2Q5IA 4DSOA 2G88A 3CLUC 2EGUA 1I3CA 2Z5LA 1QBKC 1A8PA 1XD2B 3G7SA 3I9LA 3L49A 5F77A 1BWRA 1IPHA 2C9ZA 1J25A 2ZI5A 3OMWA 4DDWA 3EXHC 3VGJA 1DEKA 1U7XA 3KEFA 4MKGA 1M0EA 2R66A 2HU8A 5ADUS 3B7WA 1C7QA 3M5DA 3ZD6A 2CUTA 1ARZA 1Q7EA 4DBLE 2R1UA 4L75A 4BWVA 3R7NA 1CZLA 4RV5A 5D5PA 3L9XA 1QFXA 3FE2A 3LM8A 5DM1A 5HGJA 3B1YA 4EKYA 1CHNA 3KBBA 2AJLI 5AI0A 2FTKE 2I8AA 3R6TA 4Y6GB 2ZSFA 1QWOA 2VDLB 3FYDA 4DM7A 1BOFA 1KY5A 1TUBA 1GGVA 2YJ3A 3DPSA 3GLVA 3IUNA 3T3NA 2WU0A 3ZHYA 3GMTA 4B47A 2ZRKA 1X9GA 3K94A 1DOZA 4OKNA 5JY1A 4FI3F 1EZ1A 4UUPA 3GCDA 3RPEA 4IH1A 4BFCA 3LT5A 2JNWA 1QAOA 2F59A 4X6LA 4HNUA 2X13A 1U3GA 4U2KA 1EHIA 3KB1A 3RH0A 3U3XA 3LT2A 1XQYA 2A9FA 3OTIA 1XT6A 2HJSA 4KPUA 2JHFA 5B58T 1H1LA 4BNXA 3RHSA 2HRRA 1RHKA 4IWYA 3ZIDA 3L4KA 2JLUA 2AFRA 2DBRA 3F7OA 2R8XA 2JAUA 4BRWA 1MO4A 3PFHA 5CA0F 3DV2A 1GKKA 2DERA 3IIKA 3M6MD 4FHZA 3THSA 1JPUA 4NS1A 1OKKA 4OSEA 5BV0A 1Q2UA 2K4MA 5AMXA 9ATCA 1FFEA 2CNKA 2GCGA 1DKLA 2RH9B 3E22A 4QAQA 4WKNA 4FUTA 3OHMA 5JD5A 5LDDC 3GBSA 5CLLA 1CZOA 4QYIA 2KSQA 3CNEA 4LNUA 4ZRMA 4YXWA 4MCIA 1B6TA 4CBVA 5K8JB 1ZNWA 2X0IA 3OZFA 4BO3A 4DQUA 1UC9A 2DUUA 1DC8A 5EMKA 1HETA 1CJUC 3ND7A 4YRPA 2CFIA 3LTNC 2IHZA 1A9XB 1FDOA 2XUOA 4S35A 5EGNA 3ASVA 3ZX5A 2EVWX 1WVGA 2LE0A 2QORA 2CVOA 2IYOA 3L8HA 4HDKB 4PX9A 3SYMA 5JTTA 3MCTA 4RW0A 4AKSA 3K0SA 4H6PA 4PINA 4DA9A 1QP8A 4MPPA 4YDRA 3LWNA 1NW6A 2HJ9A 5I9IA 2ZVJA 3FHCB 4K6CA 5TV2A 4RA9A 4N3GA 3HP1A 3VZBA 1NF8A 4G07A 4U1RA 1YB5A 5DXFA 4ZANA 1TVKA 3FRHA 1U65A 4TXHA 5IX8A 2V9PA 4KQGA 4QXQA 4PNPA 4EHBA 2Q3DA 2PLNA 1E5LA 2D0PB 2E3JA 3PWZA 5KAMA 3CLHA 1HG1A 3NC1C 3P94A 1U7HA 4Y2UA 3ZDRA 3NH9A 2IYTA 3OZRA 3VSAA 5BSVA 1EFHA 1T15A 4JLWA 4QD3A 4OATA 2FMHA 5I9SA 2CNWD 1TRKA 5H02A 2OGZA 2ZJBA 3SIRA 3W2EA 5IS2A 2AN9A 5IM4F 5BW8A 3WXBA 3KCQA 1SELA 4EG5A 5JHGB 4QGAA 3VO1A 2XOEA 4KIWA 1VL8A 1H2BA 1NLZA 2CVPA 2WMDA 4FYPA 4JQSA 4X5OA 5I7EA 3NDJA 3SPXA 2VDVE 5GJVC 2AUMA 2XMQA 3TQSA 1UT8A 4WQMA 1V6SA 1HE1C 4FXOA 4RGVA 3W5IA 1Z82A 2QJRA 1U80A 2Q7DA 3MILA 3X2FA 1MCZA 2BGNA 5K3OA 1SUCA 3QPCA 3L04A 4HZIA 4EJFA 1TMGE 2LW7A 1HXHA 1KYVA 4KR0A 4HYTA 4PCVA 3VR6D 3TW8B 4AUNA 4HGNA 1PQYA 2QXTA 5EHQA 2IU0A 1EESA 1I32A 1DWPA 1Q0ZA 1C7EA 2C61A 2W6JD 4N8EA 4BO8A 4XWGA 3WC4A 5C7OO 3BE4A 4ERXA 3WE7A 5JARA 1MFZA 4FSHA 4KW7A 3JQRA 3L46A 3TJRA 5D3MA 4DN6A 3DSRA 4ALNA 3M4JA 3Q1KA 2AJBA 2ETXA 2HK8A 1W4BA 3QA9A 1RBMA 1VBKA 5C7IO 3WA6A 4MRRA 4IF6A 5AH0A 2F48A 4RQUA 2VLIA 3DHVA 3T99A 4M1OA 4AG5A 3K1AA 2I2WA 2OHHA 1XWWA 3LT1A 1MP0A 3PDWA 4Q9AA 5LZ8A 2PZAA 2D6FA 2HU5A 1FF9A 3UFBA 2QTVA 3EEOA 4QXAA 1H1DA 4Y1FA 1SGWA 3KLNA 2ID7A 4LXXA 2FLWA 2VDWB 2A5YB 1DZIA 4KXXA 2I22A 1C5KA 5DISB 5B1EA 3OEYA 3REOA 4GX5A 4NENB 1OB2A 1ZD3A 3E9RA 1R4ZA 1I2BA 4LNHA 3ZS9A 1M0TA 1RYDA 4EB3A 5ITWA 1TUIA 4Q7MB 1BXRA 4X61A 4DLRA 1Q5PA 3S7ZA 4Z3OA 2BIFA 3L7AA 5A06A 2AG8A 1PGOA 1KAEA 1Z12A 4G85A 1JDZA 1K08A 2FCAA 1GNQA 3B2EA 2X42A 5TMDA 3QXCA 4DY4A 3FSJX 2UYHA 3BCUA 1KDVA 1QF6A 5EXDA 1OVGA 4BO0A 3PUZA 3CH5A 4OHWA 5IDYA 5J4KA 2QT0A 3DZ8A 2A4KA 2HI0A 2E87A 3AR8A 3K5WA 5DMXA 4I36A 3PIRA 3SZ3A 3MVEA 1R4MB 2RGEA 5FEUA 3UPTA 3CEHA 3KB8A 4QQRA 1G20E 2DQKA 1TZBA 1JBEA 2LCQA 1F2TA 1A9PA 4EELA 3ADDA 1UBMS 4B4WA 1CX9B 3F47A 1WBDA 2FHSA 3A9SA 3QVLA 1WAMA 5FLYA 1XZIA 2XPCA 2X3YA 1JDJA 1O95A 2YY5A 5EC8A 3TQQA 3WS7A 2FZWA 4RACA 3BSWA 2ZB4A 5KKNB 2GRJA 4DANA 4O08A 4US2R 4B3RB 4LTDA 3WWCA 3PZRA 4JVMA 4FQ5A 2C00A 2FEPA 1C8KA 2NUPB 1DJMA 1F8XA 2XI4A 3OQMA 5LKAA 5DX8A 4GZ5A 4UE2A 4UU1A 3LHSA 3ROKA 2GCOA 1E6UA 1YZYA 1T8RA 2D1YA 3GLTA 3X2SA 5C18A 4D9KA 1KJWA 2X19A 3O92A 3TNLA 1UXHA 3SQDA 3ZCTA 1E4YA 2J7PD 4LJSA 2VC2B 3PIDA 1AA9A 1I2AA 2CL0X 2WF5A 4EY6A 4BCCA 5JBNA 1E4EA 1GZUA 2XUHA 1SUWA 1RQXA 1Y5RA 2HAEA 2VBIA 4D4KA 1RR6A 1G8AA 5J2TB 2X0RA 1CR2A 1W5BA 3Q41A 4ACBA 4BYMA 1ZD1A 5DNDA 2O1EA 2ZJOA 6AT1A 4IJMA 3KSMA 3I61A 1FP4B 3SS9X 4RIFA 4ZWNA 4TUYF 1QSGA 3KKOA 1PRYA 1QMPA 1SC6A 2XRYA 3AIMA 2FI1A 2GN8A 5JLAA 5I8WA 4B8WA 1GO2A 3UAWA 3HFJA 1E1DA 1XRJA 4GWGA 4ARBA 3AWDA 1YJCA 5JDCC 1LLCA 2B4RO 2BFBA 3ECAA 3VO9A 3FDZB 3HB7A 4M7WA 3W3AD 1FLAA 1GA1A 2RAPA 3GJYA 4OXRA 4ABYA 4ZYVA 4ENVA 3V9PA 1SFRA 1TM3E 1MJ5A 4C0XA 3ZWBA 4MEBA 4NOMA 4B82A 1QV6A 2YTZA 1M2FA 1YBMA 4MWDA 4PO9A 5JQGA 4KLCA 4V2UA 3EEYA 3H2SA 4CMGA 4URXR 4FOPA 2EL9A 3VVLA 2XMPA 2RHTA 3C8HA 4R9UC 4EJ2A 3FPKA 3IXMA 1V45E 3CT6A 4MQ5A 1ES9A 1G20A 3HKCA 4O2AF 1GNSA 4YGXB 4FZJA 4MVJI 4F3TA 3H0KA 1DNPA 4QT0A 1F60A 3KQOA 2QVBA 5F2KA 3AHGA 1LGYA 1X2EA 3KT6A 3MCAA 5FXMA 4EPWA 3LY7A 2LKDA 2NNLD 1AZWA 4U5XA 3R3XA 5CW2A 3OFVA 4BNYA 4DIEA 2GOYA 1Z4OA 3LDAA 5AKEA 2QKYA 4HG2A 4PWYA 4CUJA 3H0EA 3U7GA 1RXSA 3C3BA 1VI5A 2PYDA 3ZWAA 1IZ9A 1A95A 4HEA1 2VF4X 4PXAA 2KB0A 1UPFA 1YOBA 2IZ5A 4Q48A 5AKHA 4PPNA 4G1EB 2A5JA 5H59A 3T94A 4KNYA 2YHIA 4LE1A 3UTCA 4LBWA 5IVKA 1EQUA 1NNUA 4DG5A 2XXAB 4U2FA 4IRMA 2D5BA 1FFSA 3IIEA 1ZSVA 3VR4A 4DTIA 5A4IS 4U6SA 4H3HB 3HMKA 3B9PA 4Y30A 2PRKA 4ZVSA 2ODWA 3QW2A 1O5OA 2ZSJA 3H0CA 2GXQA 5I01A 2DETA 2CW5A 1SN7A 4WBSA 4Y9RA 4LZPA 1YDMA 3IKVA 4FW8A 1IMOA 1RP1A 3HY4A 4H60A 4JQOA 2C9YA 4XLTA 3P0EA 1EFDN 4I99A 1NMZA 2RHBA 3DBVO 1JE1A 1V5GA 4UQOA 2UUCB 1P5JA 2HMSA 2NXJA 2JGDB 4G23A 2C4TA 4GX0A 4Z4QA 1JSRA 2H1HA 3ZY3A 1YUNA 5B1DA 2GEFA 1POXA 4W5NA 3EWNA 2FFBA 1VHJA 5ESWA 3IEPA 1RAAA 1E1MA 1PFWA 1UL1X 1Y42X 1I2DA 1T5TA 2BBOA 1VHTA 3ESQA 1RJ9B 3QYJA 4XYEA 5G2OA 4GHWA 3GQBB 5C80A 3TCKA 4DCPA 4GVXA 2QDXA 3BS4A 3RS9A 1IY9A 1CSEE 1ZRMA 2H57A 2I6GA 1U5CA 4G63A 2FDXA 1TTHA 1E63A 2FPMA 3QIVA 3LTEA 2BM0A 2CLCX 1E3JA 4C4ZA 4QU9A 2O7QA 3KHTA 4IIYA 1E8DA 1KETA 4KR2A 1MABA 4ND1A 2JGFA 1ONOA 5FRDA 2O1SA 3AR4A 4D4GA 3LLSA 1RQPA 2A9JA 1VLHA 3KPJA 2XB2A 1QYVA 3HCAA 1WE2A 4MRVA 3IS3A 1EP3B 5AHWA 5EYPA 3T34A 3TTXA 3AZPA 4TVKA 1GTMA 2QLJA 3FCAA 4LVCA 4OB8A 4KQFA 4OXIA 2KE5A 3DJFA 1CUGA 1EUDB 3PQ7A 3UJHA 5LPNA 4QUBA 1II8A 1ZMRA 2IPAB 4RY2A 1K8RA 2QD1A 3F3YA 4MWGA 2EF0A 2CLEB 3ZDQA 3W5HA 4Q5IA 1RQ7A 1TTTA 2OO7A 2RCNA 5IDQA 5CMLA 3FKSA 3BG5A 3HCWA 2P6UA 2C4VA 5CT9A 3E7DA 1MJGA 1UPUA 1HH4A 1UAGA 2ZUDA 3P2OA 3FYUB 4G1MB 4X6YA 5CJ2A 3AEYA 4DE5A 1EWTA 2FN8A 2C7OA 1JDBC 4CCYB 3K9GA 2HIGA 1SVOA 4IDBA 4PZ9A 2I4IA 1V6AA 3GEPA 2FMUA 2COUA 2Q28A 1I6KA 2X2PA 5E2IA 5NULA 2QDKA 4LJ4A 4GU5A 3U9SA 5LQAA 2G6TA 2WU4A 3L5OA 2BHNA 2FWPA 2L17A 3B5IA 4MRPA 3TIFA 1X87A 4NXMB 2Z08A 4MX8A 1KI6A 1SHUX 2H16A 1GCGA 3C3XA 3UKOA 1RI5A 3NG1A 4FR2A 3X2EA 4ZI7A 3ENZA 3DULA 1BFDA 1V4NA 3DBLA 4W8HA 1EB9A 1N2CB 2RK6A 3EMKA 4HAYA 3RYHB 4ZCMA 2WIJA 4RCVA 4MGKR 1W29A 3JQFA 5L45A 2QMHA 4XZ3A 1Q17A 2O2ZA 3BJMA 2F7SA 4L5CA 1VE1A 4RGYA 1T29A 1ZLYA 5JSUA 3DDWA 2R6DA 4MXDA 4PHTA 3TYXA 3P9ZA 3W6UA 1JIUA 3ZD9A 4BVAA 4QG3A 5K8VA 1E1YA 3CRNA 4FBMA 1R8XA 2WWRA 4F6RB 3GJ6A 3HKDA 4B3BA 3GMDA 3OZUA 2OA0A 3TNYA 1CY1A 5TS2A 2PFGA 3RAJA 4O59O 3RJTA 4MV3A 2JDID 1D4AA 4P3YA 1RT9A 4U7JA 2Y1WA 1MO5A 2CNOA 4X60A 2YFQA 4CCSA 1YR9A 1E1KA 1ZD8A 4NPHA 2I6FA 1QPZA 5B1SA 3ITEA 4FC7A 3UK0A 1ZWLA 1DB3A 2FPPB 3RUAA 3DF9A 3PCRB 5JAMA 3QBDA 5DGDA 4CM8A 4QDUA 4QXMA 4GX2A 4NE2A 3U7QA 1T0JB 4FGUA 1LJUA 1YK0A 3KHKA 3NP9A 4L76A 1OY1A 4PZAA 1H4SA 3WGOA 1XXHB 2B4KA 4B5KA 4TN5A 4BMCA 1SBTA 1YA4A 1EFPA 1BCRB 1JN0A 1K2VN 2BKVA 3N6VA 4EGQA 4PNHA 4YECA 3GJ7A 5KTOA 1S3FA 2OGWA 3GP5A 3LZ6A 4FNOA 3WDKA 4A8JA 4R7ZA 1M2JA 3S2FA 4GBGA 1YOVA 2MU1A 4B81A 4C7XA 1JTEA 3ID6C 5ALZA 4Z4FA 1E2IA 2AFHB 3KXIA 1RHRA 1UQRA 1ZAKA 4HDRA 4ZCPA 3U26A 2Q7OE 2GZMA 2FW7A 2V4ZA 2VVTA 3A9VA 2MR6A 4TT3D 3UV7A 2O0MA 1MXFA 3PTLA 4WW0A 3TLCA 2RI6A 2OEPA 3LMKA 3M6FA 5EKXA 5AQ1A 4YGYA 3RU3A 1AUVA 2IL1A 5J2UB 2PFKA 3EDCA 3MPUA 1EMDA 4GI7A 4ICIA 1I6LA 3K6SB 3AKZA 5F98A 1DIBA 4M99A 3WWOA 5C81A 3V6MA 4ZZIA 1NXQA 4NPAA 1YQUA 1P2BA 4GMGA 5FPPA 5H70A 3EJ6A 2PKQP 3ZQ6A 3NH6A 3E9QA 4X00A 1BYIA 2AZ4A 2GXSA 2Z98A 5FD8A 1IOZA 1RQRA 3EOZA 3RC8A 3N07A 3GI1A 2O3JA 2QRQA 4QJ3A 2BSQA 2G5TA 1S96A 1ZGBA 3LPLA 4K6OA 1R8YA 3UENA 1OHHA 2VNHA 5L6MB 1ZVVA 4UW9A 1G8JA 1EXWA 1U7DA 1ZRNA 4K9DA 2J0VA 3O4FA 2PGJA 1N77A 1JIKA 2JFHA 3FUCA 1PFYA 4KXYA 3ZQUA 3JPWA 1QRSA 1TZ2A 3CZCA 4WZAB 2I78A 3B82A 3OWOA 1FSSA 3D4PA 4NJOA 1VHWA 2XCTB 1FQJA 3MIZA 3ICEA 1K5DA 1GNRA 1IM5A 1J00A 3X1MA 1CD5A 1GPLA 1OT5A 2HV8A 3W04A 1V47A 3LHDA 1DDGA 3IL2A 5CFNA 2WWYA 1O9GA 3NIWA 3PLRA 1Z0IA 2JGEA 2B0JA 2BFNA 1NX6A 4URUR 5JH7A 1GPKA 2XDQB 3BHNA 5EHNA 4CIVA 4DA4A 3OA0A 1B41A 4MA4A 2J3KA 1GKUB 4RK0A 3EDMA 3GZ4A 3IJRA 4CT0A 3G0DA 5SYMA 3HTXA 2I6TA 3EXIA 3W5DA 4ZQIA 3CEPB 3UK2A 1CFZA 4HDNA 4WCDA 1O6CA 1YZVA 4NU0A 2G0NA 1LBQA 3DKKA 2IX3A 3U4QA 1XCOA 4A6DA 4QLOA 3H5LA 3JD4A 1MH1A 4LK2A 3RVQA 4KUEA 4MKIA 2BTEA 2ZBFA 5C7LO 3FDXA 4G37A 4NE9A 2LUOA 2ZOSA 4UCQA 4HAOA 2NYVA 5JD4A 3DE7X 3TLGA 4BO2A 4P6VF 1D9ZA 3DNPA 4F84A 5L3SB 1WO8A 3KT8A 4N0PA 3RTEA 1U2DA 5JYBA 1XLTC 4PRZA 3HL4A 3H11B 4R2JA 1RYEA 4A91A 5IDWA 4MUNA 3CF6R 4B4KA 4V1CB 2BM1A 5DIFA 5BUQA 1JYSA 2UXDB 1QRAA 1WB6A 5EPUA 1IPFA 3IP7A 2G82A 3PYMA 5C3MA 1FTQA 1M74A 2FK7A 5M34A 1R12A 3EMBA 1C0KA 2ZG6A 2WTUA 2P0YA 1J0BA 4REQB 3RYFA 2W0SA 3HKBA 4QHYA 4OHUA 1HF3A 4PAWA 4KI0A 1P0MA 3U7EB 2JFQA 3HYTA 3VR1A 3FSRA 3RC1A 3JARB 3L8DA 1W88A 1YL5A 3WLSA 3VRHA 3ZDYB 4PPFA 2VYVD 1FNMA 2ZUTA 1G63A 3SX0A 5JXJA 1BEUB 3IDOA 2QZPA 4GMFA 1OXMA 4M0LA 3L79A 4WESB 1T1GA 3AOEC 3AUUA 4XJVA 4D02A 4BN4A 2P2LA 3ORQA 1T35A 1DQYA 4HDSA 4U2BA 4GM4A 4K9QA 5I47A 2PD6A 1PT5A 2A33A 2H1OA 1OFGA 2R1ZA 3H6KA 1VLJA 2BT4A 4FBLA 2WTNA 3DAYA 4MDFA 2QRGA 1Z13A 3SQOA 3P9IA 2OG2A 2QQEA 1TECE 1RADA 5B58C 3NFRA 1CJCA 4LN1A 4P3OA 3TTSA 3RAEC 1W1UA 1Y8RB 2Y0BA 3LP8A 5IH3A 2H51A 5EIBD 2VJNA 4IL5A 2R0QC 4DV4B 3BJZA 1JEQB 1QHEA 5KX5B 4JEHA 3ZYCA 3HO6A 5AOCA 2EZ8A 4DKXA 2H0QA 3MRVA 4KXWA 4XB2A 1VB3A 4P08A 5A9TA 5JAOA 1G59A 1KJZA 1U1CA 1N33B 1N0HA 3I9V1 2QTAA 5M5BA 1EXVA 3FVTA 4WJZA 1DOAA 4N39A 2RC5A 3E6AA 2DCUA 4FHFA 3PR2B 1TT5B 4RK4A 1LKZA 2V3WA 4F6LA 4F5ZA 2SKCA 4DIOA 4P3KA 1SOUA 1TGYA 5CEEA 1ZHHA 3C45A 3EWAA 3KZXA 4HQOA 4UBNA 5DSXA 1NDHA 3X1JA 1RYBA 4R8SA 2WTAA 1I0LA 3P9RA 1S3SA 3VU9A 3W1EA 2CHGA 1YDFA 5FWAA 3ZGOA 3W5CA 2AR7A 2P40A 3EMDA 3RS3A 1K27A 3WL6A 2W2KA 3FMVA 5JXWA 2WTXA 3TUJC 3AEKB 4Y1GA 4YMVA 4K2HA 3V8EA 3K7EA 4H18A 5DNWA 2IW3A 1YS6A 1OXXK 1UFQA 1JDVA 2BFAA 5FFMA 5HZKA 5FPSA 3CH6A 5KNBH 3DOOA 1EIWA 2W8ZA 1H5UA 1T5OA 1YR1A 2WQ7A 1XXLA 3GJTA 1DSSG 1XLWA 2WIKA 2NZYA 2ORVA 4YNBA 4AQYB 1TCBA 4XQ9A 4AG6A 3KCNA 3DMGA 1W5TA 3A9WA 5FBZA 2PG3A 2AI1A 2R1TB 2J87A 3GN2A 3ICCA 4JMPA 2OXIA 1V2HE 1G7TA 4XVCA 2VA8A 4ZAYA 3I09A 4XJXA 3ROQA 3U9TA 4Y9DA 5BN1A 1D1PA 4JSTA 5FL7A 2BKUA 4OXKA 4EG1A 5IAEA 1QG0A 5E6RA 2VHWA 1Z5UA 4YRCA 4B6FA 4NOJA 1H0KA 4ZFNA 1YKSA 1C9KA 4HRXA 3HDJA 2JCVA 3F6BX 2ONYA 2HRZA 2PV7A 3PT9A 2LIPA 4FJ2A 4RFSB 4GGMX 1QRDA 1EUCB 1WCIB 5F9FA 3LUAA 4DADA 2HPHA 1JI3A 3L1VA 2AKYA 3HR8A 5IM5A 3P32A 1KMHB 4O8CA 1UWVA 5EUBA 3M4ZA 6PFKA 4L73A 4Y1RA 3SS8A 1K8ZB 5M29A 1OLSB 2BBTA 2XZPA 3NWPA 1T2EA 5M04A 1AK9A 2GZDA 2F00A 2OC9A 5CVDA 5DXAA 4JOSA 1JXMA 3OLXA 3QSYA 1XQ9A 2IYNA 3F97A 3G7UA 5AKIA 4ZAGA 5IJAA 1UM8A 3OPQA 3G49A 4QDZA 3I39X 4NDNE 3VPAA 1XMSA 3ZJTA 4B7AA 1PSWA 1S2IA 1FYXA 1TVCA 4US1R 4BO4A 3JZDA 5JWRA 3HBFA 5BSGA 5CXQA 4N12A 5KDOA 2NU9B 3CZ9A 1KYWA 4LY9A 1BIFA 3BF7A 1T4DA 2I4LA 2XB4A 1LJ8A 4IDFA 1L7VC 5CM2Z 1UM9A 2JD2A 3DT6A 1YZ3A 1OT3A 2OKGA 4M2LA 1XE3A 5KCMA 5GVSA 2OQVA 2PXCA 1G4AE 1XHFA 1SHTX 2WAYA 4JXKA 3NHMA 3VM6A 3IKTA 3PNBA 2O1WA 5IHPA 1N3YA 1Y1SA 3BWXA 4IS3A 1NW7A 2G25A 1XNQB 1W36B 1OQAA 3PZBA 3RYCB 1PVVA 3DVAA 5L95A 4WKPA 1Y4AE 5HPYB 1LZLA 4CZ2A 2RGCA 3OP1A 3AXTA 4GKJB 1MB2A 3R20A 1EK6A 2OXFA 1PS9A 2VNJA 3BWCA 3OIWA 3REQB 2P5YA 2Q4OA 4DSNA 2CZCA 1KS9A 2BGTA 2XCLA 3IE2A 3OH8A 4FONA 4UTOA 2EZUA 4H7PA 1GTSA 2DULA 4AS3A 1SCJA 3DR3A 5LU8A 2D06A 2Z09A 4MHSA 2WJGA 1T26A 5CDSA 3VYSB 1KO1A 1TE2A 1DX4A 4ZQCB 3ZCUA 1I1HA 1LNQA 4YP6A 1SR8A 1IN4A 3OM1A 2VJLA 4Q4LA 4WN3A 3W77A 1COWA 3F3SA 4BQPA 4R7GA 1P1RA 1JQLB 2BISA 1BQEA 3CVOA 3MGKA 4HC4A 3WHIA 1WKBA 2XHZA 3HRHA 3HR7A 3OFJA 4L22A 1Y1PA 2Z4TA 1QUFA 1UZNA 3N9IA 3FSGA 2Q21A 3P2MA 3QEMA 1A71A 4JI5B 3PD7A 4V0KA 2FWAA 2VDOB 2CDCA 3KL2A 1PTKA 3V3TA 1ZOIA 5BUZA 1IEXA 4F1WA 3HH8A 3AP1A 2BBWA 5F5NA 5F33A 4PZZA 3CNBA 1RW4A 2BC9A 4V0NA 3SFZA 8LDHA 3NETA 4WPGA 5FTLA 2PKEA 3QLUC 1O6BA 4F72A 1D0VA 1T4MA 4HLQB 3UW3A 1XNHA 2F3SA 1IATA 3T15A 2WT4A 2V6BA 3CX6A 4J2HA 2VNSA 1VKNA 1Z16A 4ZC8A 2Z8YM 1MVOA 3AF6A 5GINE 1MO3A 2XODA 1Z33A 4I8XA 2ZJ1A 5ICMA 2E21A 1P4SA 1OLUB 4XWOA 3D1VA 3O3NB 4Z0TA 4Q0MA 3EGDA 3QXGA 5I9TA 4F2DA 1UMDB 2FUNB 3R09A 1R4AA 3VR3A 3HLYA 3QNUA 5A4DA 3V7WA 1RE0A 4R41A 3BSFA 2EIXA 3BZBA 1KEVA 1RC8A 1YIAA 4FINA 4LBYA 1ETUA 3IA2A 1JSZA 1NJ8A 3ETGA 5DX0A 2G9UA 4Q1FA 3QHPA 4IIDA 1Y37A 4XFKA 4DXDA 2WYHA 3M81A 3DXXA 4O4LA 2WT9A 4Q82A 1XCLA 1NF3A 1Q15A 2Z9CA 3LO8A 3WBKA 3UAZA 1R50A 4HZUA 4RJTA 1FIUA 1T1RA 5C1DA 5AVWA 2XCIA 1GXSB 1MV8A 2E1PA 3A6GA 2VPZA 3PGKA 3PC4A 4DJFC 1ILEA 4YHHB 2ATCA 3SC2A 3MK31 5KBYA 1M34E 2IH5A 4OA5A 3V7YA 2HDOA 4G5RA 3VR6H 1ZEJA 3AUTA 4UTNA 2FSUA 2FRXA 4FT2A 4BLQA 4EZEA 3QOYA 4HWTA 4LNAA 5TJ9A 4EHAA 1Z18A 2DPXA 1ZJ5A 1UEXC 3EZFA 4A2WA 1HPLA 4UC0A 4OHMA 4BLUA 4DMHA 4EVIA 5BQPA 2RHJA 3GT7A 2J4DA 3QMVA 3RIXA 3LBNA 3A6PC 5F51A 3UMVA 3FVQA 4D0RA 4KHPB 1KPIA 4UPVA 1JSLA 2J5KA 2EWVA 3COZA 2GS9A 3FKQA 5HDBB 3SR3A 4HWGA 1AY0A 2XE4A 1VLVA 4EKNB 4BKOA 4AJKA 1U3UA 3KYCA 4QLBA 1E0JA 3U62A 3HWWA 4BEWA 3L6OO 2KMLA 4N3NA 4DR3B 2IOFA 3ZBUA 2QM0A 1IVYA 4DCGA 3HDYA 4QWWA 3ZIAD 4H0CA 3VHXA 1WCV1 3D7NA 3OFND 4RAQA 2WKPA 1P5ZB 4D8VA 3ZHVA 2H7CA 2CDBA 1ST2A 2PL1A 5ALGA 3EQ7A 2ONJA 3MCVA 4JS0A 1QJ4A 3TBKA 4AL4A 4E2ZA 1ZW6A 4Z99A 1Z37A 4O4IF 1QV9A 5KREA 5DTIA 2Z95A 1A7JA 2OFOA 3ETHA 4KYUA 4YRJA 5J1SB 1WZ2A 2JIOA 4Z5XA 5JLJA 1V1MB 2DP4E 3WYEA 4IO1A 3SWWA 4J0DA 2WSMA 2Q1UA 3L8CA 2ZIAA 4G89A 3RHTA 1Q3KA 2X0EA 2W4MA 3GEGA 2BUAA 3HY3A 3MWDA 3SDBA 1V95A 4BPBA 1VRCA 1KZGB 4CQLB 2OWEA 3L41A 3DEAA 4GE0A 1ZSNA 2H4FA 4HEJA 3BB4A 5EWMB 4BKMA 1ECJA 3HLTA 4BMSA 4F4UA 1YFZA 4PO1A 5AOBA 4TSKA <