4D0GA

Structure of rab14 in complex with rab-coupling protein (rcp)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGLERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of the Interactions between Rab11 and Rab14 Small Gtpases with Their Shared Effector Rab Coupling Protein (Rcp).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords RAS-RELATED PROTEIN RAB-14
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4d0gA01
1OFHA 1YZKA 5H70A 3AH8A 3BH7A 4AY2A 1COWA 3VFDA 2BBOA 3KFXA 3A6PC 1NN0A 5K8LA 4DZZA 4QFMA 1IN5A 1G1MA 3G82C 1YRAA 4MQBA 4BEJA 2QM7A 3LXRA 2SHKA 3W6OA 2G88A 1MABB 3EASA 3WNCA 2ZJBA 1CJVC 1NY6A 1U99A 1W4BA 2ZROA 2A9KA 1E2IA 4EFLA 1RPZA 1FZQA 1MR3F 2QP9X 4TN1A 1JR6A 2GJAA 4EQ6A 3QKTA 5FUVA 3PEYA 4MA4A 3A58B 5GADl 1ETUA 2DCUA 4V03A 1NIJA 1AK2A 4HAUA 3A4MA 2RGBA 3UG7A 4RCYA 5FOUA 4Q9LA 1JNYA 3BH0A 1P4SA 2G9NA 2IYZA 3CRRA 4Q5IA 4NONA 3RDPA 3ZVNA 1H8ED 3KJIA 2QRZA 5CJPA 1MKYA 2NTYC 3R9XA 2GA8A 4Q7JB 3ZD7A 1FNNA 1Q3TA 5JFGA 3WBKA 4LC0A 4Q03A 1CR2A 1DAKA 1XEFA 2ORIA 4Q1EA 1OYYA 4IDOA 5DHAA 2ZRKA 2OM2A 4LK2A 1F2UA 1E9DA 2DWQA 4Q18A 1WA5A 2WSSA 4A92A 2IYUA 1EK0A 3RWOA 4M22A 3I61A 1CXZA 1XJ0A 3H1TA 2QGNA 1Q21A 4OK5A 1M8PA 2YNMA 1BKDR 2GCOA 4QGFA 2FU5C 4D80A 3LWNA 2FA9A 4M1WA 4TL7A 3T5DA 4LC1A 4LBZA 4Q48A 1DG1G 1HQYE 2J7PD 2WMOB 4DT1B 5DLQC 4C7OB 1E0SA 2F7SA 2QSYA 2FMXA 3BFXA 3GEIA 4LV5B 4FN5A 4KLZA 1UDXA 1N5LA 1FUUA 2RGNC 2ZRAA 3K9HA 5FPYA 4Q66C 3WYFA 4M1SA 2ZE6A 2B7BA 3VTKA 3EXAA 3HU1A 3ND8A 4OQMA 3LRPA 4DDTA 3TW8B 2A3RA 1YQTA 3AKDA 1OB2A 1FOEB 2OILA 4B43A 1JAHA 1UFQA 2NO0A 2BWJA 4TL8A 4AK9A 5B57C 4TZ0A 4DCNA 2QG6A 5J4YA 4OI2A 3SBEA 4G1UC 5KUTA 3H2YA 2IT1A 5JLJA 2F43A 2ZI6A 1W0KD 4PHGA 4V0KA 1QDEA 3VNVA 1R5NA 1DAHA 2AXNA 3EC1A 3VAAA 4GFDA 1DTSA 4Q4JB 2CBZA 3DEFA 3RRYA 1KNXA 2CDNA 4BLOA 4B71A 1YZUA 3BB3A 4M1TA 1II8B 4TLCA 2ZSAA 3BWDD 5L3SA 1N6NA 1EFRA 5CK5A 2ZJZA 1XWIA 3TVDA 1DAIA 2D2FA 1IN4A 4KU4A 3AVWA 5ELXA 2ZEJA 2JASA 3MJHA 3KX2A 1L4YA 4WZ6A 1W0JA 2J59A 3T1VA 2FOLA 1NMYA 1AS2A 4NHOA 3W8NA 1KDRA 5EUQB 2D62A 5SZJA 4NCJA 1ZNXA 1E0KA 1VCNA 2VHUA 4PC7A 2WWWA 4Q19A 4ACBA 3B1ZA 3I5XA 3EA0A 5KO2A 2GF9A 5KDLA 1CJKC 3TQCA 2BMJA 2ZANA 2X2EA 3IHWA 4URUR 2IWHA 3ZS9A 5LD2B 5JCZA 2ZS8A 4IRUB 2QU8A 3WY9A 5AUOB 2FV8A 3HR7A 1TQ4A 3F3YA 1OFTA 5AK0A 4PZYA 3SDZA 1JALA 3I8XA 5AJZA 1Z0KA 4M21A 2J3EA 2VTKA 4PZLA 3LVQE 1NLFA 4NTZA 2QI9C 2FSIA 4IFEA 3KTAA 4WZBE 4GP6A 3GLFA 1XTRA 4KFRA 3K0AA 4KAXA 3B78A 1E4VA 1JXMA 1G3UA 3ZH9B 1AN0A 2ZI5A 4XSGA 2PL3A 3VX3A 1IXRC 4BFTA 2AN9A 5FPHA 5GVSA 5E7JA 4KFSA 1DOAA 4GZLA 4C0KA 1ZRHA 2CK3A 3CF2A 2ZUDA 1SVSA 3AF0A 2ZI3A 4BFVA 4I1VA 1W2GA 1JEEA 4W5HA 2KI5A 5JSZB 4NYIR 3VKHA 1YR9A 4PHFA 3SE0A 5HTKA 1GL9B 3I5YA 2P65A 2VH5R 2EWWA 3BORA 2ZSBA 2JA1A 1LY1A 3A1SA 1LVGA 3KKQA 5LB2A 4JS0A 4M1OA 1IY2A 2FNAA 4GBMA 2GEUA 1AKEA 1YR8A 3U4QA 4KJZA 1YHNA 3TUIC 1KI2A 1HT1E 3U61B 3FYHA 2ZRIA 1IQPA 3VU9A 4K81B 3GJ5A 4B75A 1S2MA 2FGJA 2JDIA 2JLYA 4L9SA 3HU2A 3S1AA 1T6NA 1PJRA 2I1VB 1Z07A 1HE1C 1MO5A 3DDCA 4ZCIA 1W36D 1GL7A 1L7VC 1E2EA 1ZNWA 2B21A 1WP9A 3OIUA 4NCIA 1E6CA 5CDFA 3C7KA 1PV4A 3OE7A 1U0HC 3TK1A 1GITA 1OH5A 5G41A 1U8AA 2ZS7A 4LJ5A 2C78A 4W7SA 1SXJA 1FUKA 1WMSA 2IYLD 5B2ZA 4BWYA 3ZVMA 2GXAA 3QSYA 2JAQA 2OXCA 3A37A 1OH6A 3OEHD 1FMJA 1BIFA 4L4UA 4QGHA 1XB2A 3QOFA 1S3SA 1QRAA 3QF4B 4Q01A 1PUJA 1E69A 3EPJA 1E98A 1IN6A 1KAGA 1KK2A 1IONA 1GZSA 4AI6A 2XNDD 1XBTA 2B6HA 1FPMA 2G1JA 3PENA 2O8FA 3UPUA 5HKKA 3VR5A 4J0QA 4Z54A 5HZKA 5JRJA 2XX3A 4YMVA 3ZQJA 4NYMR 2OBLA 1H65A 5JWRA 4G5SA 5SZIA 2XGJA 4TMKA 4D2IA 1VYUA 4ARZB 5FFMA 2J1LA 2CCKA 1L8QA 1OIXA 1U94A 3AB3A 1W5TA 1U0LA 4ZDJA 1IOZA 4E22A 1T9HA 4GI7A 3IBGA 5G40A 3L0OA 5A5GA 2VHCA 4TWZA 3AQ4A 4KXFB 3K0AB 3B8HA 3LY5A 621PA 3GLGA 1Z2AA 2GXUA 2ANCA 4OL0A 2HLDD 5L8VA 1DO0A 3ADKA 3PVSA 4N3NA 4GDFA 4ZKDA 1AM4D 4AKGA 1P2VA 1Q1EA 2JLZA 2JEOA 4X8LA 1JB1A 4B6EA 1RE0A 1P7CA 2EVWX 4URVR 2F1RA 3IPXA 1AS0A 4NZYA 3OESA 2B8TA 3Q85A 2FFBA 4EUNA 3SZRA 1VECA 4QXAA 1JECA 3UANA 2CCJA 2W2TA 5IT5A 3I73A 4PPGA 2GZDA 2GZHA 3ZZ0A 2ANBA 1MABA 4ZCMA 4DSTA 3KKMA 4GOXA 2FJUA 3RRMA 1VYVA 1HA3A 1P3JA 4S35A 2OXRA 4RZXA 4Q9KA 3C8UA 2DFLA 1U98A 3MAAC 2C9OA 4HAYA 3TSWA 3I92A 4F91B 3N5CA 1RC8A 4QNRA 3E70C 3OFND 2D74A 3CR7A 2WMNB 4JVLA 4DLRA 3RS3A 2C9CA 2ZRCA 3NKVA 1HURA 1K5DA 4OKSA 2NPFA 1M7GA 2ZI9A 3LH5A 2AX4A 2F43B 3P4XA 4D0GA 2ZYTX 1X86B 2GBLC 3C5CA 3PQCA 1LF0A 4Q02A 2GNOA 1TU4A 5AUPB 1XTJA 1UM8A 1YVDA 2R44A 3EPKA 2H7VA 1WQ1R 5AJYA 1GAJA 1EFHA 5EZ5A 4O3MA 1IBRA 3PUVA 1XTIA 5EXXA 3E2IA 4B44A 1SULA 2A5YB 2IYWA 2R6GA 3RS4A 4NPHA 4AG6A 4TMXA 721PA 2W2XA 3I4LA 2NGRA 2ZVQX 2YWFA 4PFSA 2CCGA 2ODBA 2QPTA 3BERA 1N6IA 2B8WA 2ZR9A 1ZIOA 2W0SA 4JBYA 1P6XA 2DPXA 4C0SA 3Q8XB 2BDTA 1QHSA 5ANRB 3SHWA 1CP2A 3MGCA 2OEPA 3FHTA 1NBMA 1E2JA 1E96A 4GT1A 1BO6A 2F9LA 2ZTSA 2ZYUX 1OFUX 4DSNA 2O8CB 2LKDA 5B30A 4Q1BA 1NSTA 1KAOA 1N6HA 3DL0A 2PH1A 5CITA 1UKYA 2HXSA 2D4HA 2ZYVX 1W46A 4DLSA 4IOMA 1RRGA 3JZMA 2ZIAA 2GEDA 2GF0A 1E2PA 2VA8A 5KPDA 5FBRB 5SZKB 3PEWA 1XD9A 3SC3A 4D26A 1OF1A 2R6DA 2ZJ5A 3OZXA 1G4AE 4JSTA 2XTZA 1B23P 3NBXX 1PLJA 3EG5A 2IBMA 3EA5A 5KNBA 2JLWA 4BGDA 5EXSA 4JSYA 1SVWA 3LX5A 4Q4AB 1KSGA 1BS1A 5LDDC 1SVKA 3FWYA 4Q21A 4YDSA 5EJEA 5AJXA 2WZQA 3W90A 2OCAA 3ZVRA 2F3TA 4G3XA 1T8UA 1VG8A 1N3BA 1FP6A 5KNCA 3ZZUA 2W58A 5DI3A 221PA 2FEMA 2WWXA 4D4KA 1CU1A 1XCPA 4OQFA 2G3YA 1U0JA 2XJ4A 4OHYA 1JPJA 3M1IA 4LZZA 3ADDA 1Z47A 1N2CE 4P33A 2XTMA 4XTCS 1OH8A 3AM1A 4P4TA 1D2NA 3I3SR 5JI2E 1QHHA 3CPHA 1DAFA 1K5GA 2HJVA 4KO8A 5FL7A 2N1BA 3OAAA 3EX7C 3TRFA 4A1FA 3D7MA 2JIZA 3A4LA 4CEHB 4PQYA 4GL2A 3ONWA 5A4JA 2G77B 1JR3D 3FKSA 4V0LA 4PC1A 4EQ6B 4ZIRB 3R7WA 4OQXA 5KOYA 2G6BA 3PG5A 3Q5DA 3BRWD 4PHTA 1XEXB 3BIFA 1IJFA 1W36C 2QP4A 2PLRA 1D9XA 2XSZD 1KK0A 3FFBA 2IUUA 2GKSA 3SS8A 2OV2A 2Q0HA 4OJKA 2NIPA 1NVVQ 3L43A 4LHXA 2Z6VA 1P72A 4DVGA 3G0HA 1XD8A 3BE4A 4HUQA 5G3ZA 3O8DA 1JEDA 2ZSEA 3B2EA 3HDTA 1JPNA 2ZU6A 4HDOB 3ZS8A 5EXTA 1CEEA 2YZ2A 3GMTA 4ZCLA 2IUSA 2ZRHA 2J5XA 4CVNA 1UF9A 1NMZA 1DADA 1TEXA 1DAMA 1Q44A 2ZJOA 4XWAA 2OUKA 4HDCA 2V7QA 4FCVA 4CDGA 1A4RA 4NP6A 2FFHA 3GLGE 3TJZA 1N0WA 1TX4B 2ECKA 3CPJB 3J81k 3CBQA 3SYLA 1TQDA 1Z5ZA 1DARA 1N6PA 4QG7A 5K8TA 4HZIA 4R98A 3B85A 2NO6A 4C0HA 4I1SA 3TAUA 2GK6A 5FL3A 2PEYA 3TQFA 3B1VA 3CRVA 4MYCA 1OSNA 4ASUA 1DO2A 3GLIE 5BN5A 4EDHA 1Q1BA 1FQKA 3PV0A 3B1YA 3LX8A 1RYFA 1FNMA 4C0LA 3K70B 4TMVA 1E2QA 2FH5B 1PVOA 2WJYA 3EZ2A 2XAUA 3IO5A 5JHGB 2YOGA 3AP2A 1IHUA 3VQTA 2QPOA 4LYHA 3W6NA 2P67A 1IY1A 1C4OA 2YWEA 4C0BA 1AGPA 4FMCB 3T1TA 2DY1A 4H1VA 3FHOA 1WDTA 2YINC 1GTVA 2ATXA 3AF3A 4DLTA 1E2KA 3QPUA 4B3XA 1F48A 2O8FB 1R5OA 2IS6A 2QMHA 3IQXA 4LHVA 3DKVA 3KB2A 4N0EA 2GXSA 4TTPA 3MRSA 2ZAMA 3B82A 1FL9A 1I4LD 1S3GA 1T0JB 2QP3A 4B32A 2H1LA 2JLSA 4FMCF 4JBXA 5EQTA 1A1VA 1SGWA 2FPMA 3GLHA 3SYNA 4B3BA 4DCTA 3QY0A 1R4AA 4RKEA 2QPAA 2OT3B 3TLXA 3AVUA 3QPVA 4JLNA 1KY3A 3QKUA 1Q3HA 4HLUC 3CONA 4DEXA 3KKOA 1NY5A 3HWSA 3KJGA 1ZU4A 2BMDA 2H92A 1K6MA 1ZIPA 2EWVA 2ONJA 4HUQB 4B3DA 1VIYA 4NL4H 3QG5A 2Z5FA 4K8OA 5L3QB 2HYDA 3R20A 2WPDD 2HCJB 3UKDA 1E1RA 3FB4A 2IYTA 2CL6X 4F38A 1KO1A 1ZW6A 2NZJA 3SI7A 1G5PA 3QQ5A 2HXYA 5A0FA 2WVJA 4UNRA 4A6XA 1AKYA 1E2GA 3B1XA 4H9GA 3FDIA 4JLDA 2BM1A 4PPFA 4C0QC 3KQKA 3EWAA 2BVNA 1YR7A 2RGDA 3T15A 1E79A 3LQQA 5C4MA 2Q9BA 4V0MA 3U3OA 3AVOA 3C15C 4CEHA 2QROA 4PHHA 4XD7D 2BM0A 3IGFA 4D81A 3UMFA 1N0VC 2P0EA 4JJZA 1G17A 2GK7A 2ZITA 3E5HA 3U7FB 2WWIA 3ASZA 1W44A 4H1UA 2AWNA 1KI6B 2ZUCA 3BJIC 5JJIA 2RHMA 3CPEA 3K0SA 3CWQA 4V0ME 1TAGA 4IKEA 4YXWD 2OCPA 3U60B 4CEIB 2IXEA 3PEUA 3K9LA 1Z6XA 4Z1MA 2BEJA 5JEDA 2JLXA 1BMFA 3H84A 3UWOA 2ZI7A 1CJTC 1TEVA 2ZRNA 4BLTA 2GJ8A 5FUXA 3GLFE 4HAZA 2EFCB 1NLYA 1VYTA 5G3YA 4BZPA 2W83A 4PAQA 2VP4A 2J0UB 3Q7PA 1OXUA 4DB4A 1E9CA 4KVGA 2RAPA 1OKKA 1TQ6A 1P61B 4LHZA 3UMSA 1EXMA 3X1WA 4OJQA 4F4JA 2GETA 1Q1ZA 2HT6A 2W6ID 2ZREA 1LW7A 4B34A 2JLUA 4EPRA 2QTFA 1G7RA 2R62A 5JHHB 1RRCA 3ECCA 5AUQA 2KSQA 4AG5A 2EFDB 1RFLA 5JS7A 2GWHA 1N6KA 2MMCA 5JZVA 4US0R 1FQJA 4IDPA 2DFNA 5P21A 1JJVA 1NI3A 3U5ZB 4QJ4A 4NE2A 3RYTC 3PFIA 1RZ3A 1Z2CA 4LSGA 2DWPA 4YDHB 1SVIA 2L0XA 3CZQA 1NKSA 4FWTA 2Z43A 1GWNA 1ZM7A 1IXZA 4DJTA 1NIPA 1DEKA 2JGNA 4PQRA 2AKAB 4OQLA 2UVQA 1ZINA 4U5XA 2ZAOA 2P5SA 4DKXA 2V9PA 4R2IA 3NDPA 2XZLA 3GLIA 1CIPA 2WKPA 1ZMXA 4O25A 1E9FA 2IA5A 4PAOA 3IPYA 5FBWB 2REOA 3CW2A 4GOJA 3ZLJA 3AUYA 1OXSC 1S1CA 2J0VA 3AVYA 3QEOA 2P2LA 3TGPA 1XFAA 5AWFC 1WXQA 4LGMA 1P75A 2V55B 2ODWA 1XP8A 3BXZA 2AK3A 2OLJA 5UKDA 4EAQA 2AD1A 3RS2A 1E2FA 4A0RA 3T1QA 1UAAA 2C77A 2ERXA 4P4UA 2ZSFA 1D6JA 3BGWA 4KSBA 4RVCA 4Z8XA 2W6JA 5DN6A 2PBRA 5AJWA 2CLSA 3HJNA 2CHGA 1TF5A 4DRZA 2GBLA 3PUZA 5H68A 2IS1A 4LYJA 3PCRB 1QZXA 4TZ6A 4FCTA 2BBWA 2WV9A 4CEJA 3FPAA 3VHLB 4PAMA 4MRRA 2D06A 1MOZA 4MGIR 1DG3A 1KSFX 5HCNA 4YMTA 1FX0A 4PSVA 1XXHA 2F55A 2BBSA 4C0AC 4LRWA 1CF4A 3SJAA 2DYKA 2QRNA 5KTYA 3THYA 2RHDA 1Z22A 2YWGA 2J41A 1XPUA 1X8JA 4ESVA 2XJ9A 4BRWA 2WAYA 3H4MA 4LJ4A 4QOSA 1SKYE 1RYHA 2E87A 3AF1A 3FGNA 2WIAA 4HLDA 4TL9A 4XSHA 1R7RA 5TV2A 4F7WA 4ACAA 1G64A 1SHZA 3BS4A 1TUEA 3CRMA 4GPTA 5TARA 1JQJC 1Q12A 2WWFA 4TT3A 4ARZA 1QVAA 3TIFA 1Z06A 2CXXA 5LD2C 4FXPA 1T3HA 2QT1A 4LBYA 2DHRA 3NEYA 2GAOA 4US2R 3I62A 1JBKA 3GEEA 4R71A 3QENA 2W00A 1G18A 4D4MA 4M9QA 5C46F 3MLEA 2ZRGA 1OFIA 2ZJAA 4Y0VA 2PJRA 2VP5A 1XPOA 1NKTA 2OCYC 3NC1C 4B74A 3DO6A 1S9HA 2PMKA 1T5IA 2X2FA 1GP2A 3THXA 2Q3FA 1FTNA 2H57A 3WRYC 4DDWA 3Q5EA 2XXAB 1AQYA 3RSLA 2V8OA 521PA 2CHVA 1T0HB 4B48A 3AVXA 4DUGD 1KGDA 2P6NA 4C4PA 1B0UA 3U6BA 2WM9B 4RY2A 1GNPA 2JJ1A 2RCNA 4BASA 3M6AA 3ZIAA 6Q21A 5BW8A 3CKLA 5JJLA 1ZU5A 4EFMA 1BYUA 1X8LA 3GJXC 4UNPA 2ZE5A 1TTTA 4PX9A 1JXOA 3QJYA 4NU0A 1IY0A 4PZZA 4TLEA 3SU8A 3SN6A 4BFYA 5LBIA 3HYRA 2GDJA 2VF8A 5BYJA 5GJCA 2BCJQ 5HCIA 2Q3HA 4LBVA 4QGAA 3RAPR 2A5JA 4WBSA 3KKNA 4OHWA 5CIWA 4GMXA 3CNLA 3BC1A 2KBEA 5DHFA 3O8RA 4KYUA 4KLNA 1R0WA 1EWRA 1H8HA 2IYYA 5KPJA 1KDPA 2JJ8A 2OSBA 2WICA 3SHFA 5IK2D 1UBFA 1E2NA 1DBSA 3H86A 4LX0A 1N25A 4ZDKA 5CB6A 4MUBA 4U00A 2DBYA 3QXSA 2CLDX 3RABA 3EC2A 2C5LA 4MKIA 1HE8B 3SJBA 4XJXA 5H1YA 2Q21A 4M9SA 1ZC3A 4HYYA 3QXJA 4M2LA 1SXJC 3W5JA 4Q7LA 2XOKD 2O0KA 2V54A 4B76A 2JCSA 3SJZA 1VPLA 4HB2A 5FOVA 1EGAA 1QHXA 5E95A 4AKEA 3M0EA 2C95A 4DSOA 4IXMA 2VRWA 2V1XA 1ZUNB 4EJSB 1JQLB 2QAGC 3DKPA 5D3QA 5JSZA 3M4YA 3EIHA 3UXMA 1W49A 1XTQA 5M04A 4CF7A 3A1VA 2A78A 2NQ2C 3IHLA 2GJSA 4AIIA 4ON9A 1G7TA 2VSXA 1Q57A 1BYIA 2R6FA 3CRW1 4Q00A 4ZPXA 5SZHB 2JJ2A 4OK3A 4OYHA 3KDSE 4QHTA 2BKEA 5DNYB 1NBME 3A8TA 3ZGXA 2OCBA 3RRZA 2GXQA 1P9RA 2H5EA 2Q9CA 3ZDQA 1E1QD 4L15A 5BXQC 1OIWA 1GSIA 1OJLA 2MSDB 3NDBB 1KKLA 5B64A 4RD2A 4Q7KA 2B7CA 1SXJE 2ONKA 2QE7D 5KSZA 3JZAA 1G7CA 2UZ3A 1QG2A 4MGZR 3R7WB 2CLCX 2D7CA 5HR5A 5IRCD 3QBVA 2GCOB 1CJMA 3U6KA 2CNWA 3SYKA 4AD8A 5KNDA 1FX0B 1G8FA 1GUAA 1N6LA 3MWKA 4ZI2A 1W36B 4IJMA 1OHHD 2WKQA 4MUAA 1KO4A 5H8WA 3KQUA 4CEIA 1NVXQ 5KHOC 2H18A 5FTMA 3DHWC 1NJGA 4HI0E 3MSXA 5AR1A 2IYXA 5CDFE 4NYIQ 4A8JC 1US8A 4BE7B 1XRJA 1OXVA 3AGPA 3MMPA 3PITA 2I1QA 5EP2A 4DLVA 2G0TA 1XD2A 2VBCA 3FMOB 2Z83A 2Q3MA 3JVVA 1YZGA 1SKQA 4PPQA 1P2SA 1XJQA 2WJGA 3KTAB 4P31A 2ODNA 1KSJA 4PR0A 4TSFA 1A82A 1G4UR 1R0ZA 3T35A 1YRBA 1MO3A 4EPXA 1PUIA 4MGKR 4Q1AA 4QHSA 5KSYA 2EYQA 2FWRA 2V6IA 3F0TA 2HT1A 4NH0A 3V00A 1X8KA 2A30A 5IDVA 4IDHA 4ZIRA 2WWHA 5HZHA 3OEEA 1AZSC 1I2MA 2A5DA 3ZQ6A 4OI4A 3GLHB 5LB4A 3K0EA 3LXXA 4BFUA 4F4CA 1SXJB 5FTLA 3MJRA 3T12A 5D3MA 2VP0A 2ZJ8A 2RGAA 1OYWA 3NHBA 5JWHA 3PXGA 1JJ7A 4KITB 3GQBA 2BBTA 2VO1A 1R10A 1T4GA 3E1SA 1ESNA 2GILA 5JBQA 1Z6YA 2E1RA 4LHYA 2J0SA 5TXGA 2BIFA 3K70C 4JJKA 2NO7A 2PT7A 1ZNZA 2FG5A 4UJ3A 3KQHA 4MKHA 1COWD 4IDQA 2NO1A 2P5TB 4AKHA 2GESA 1DS6A 5GJVC 3K0CA 3TAHA 2XITA 3NVAA 4D4JA 3LV8A 1KMHB 4O0MA 1Q22A 2R2AA 4FCWA 3KQLA 3QG1A 4TYPA 4CGZA 2QA5A 1F5NA 5L3VA 2WIBA 4LPKA 4QC2A 4LWZA 2REXB 3CX7A 1Z83A 3GCGA 3DPUA 1Z8FA 4Q4HA 3CF6R 4DIEA 4TQ9A 2PMDA 4PSKA 1G6OA 1C1YA 1H8EA 4MDEA 4D82A 1P73A 3QXHA 4KHZA 4BPBA 3QNUA 5BYKA 3CWZA 4B3CA 4MRVA 2OO7A 1UKEA 1VMAA 1A5TA 3BB1A 2IWRA 4FMBB 1KDOA 1M34E 4GMDA 4ERNA 1E9BA 2WSSD 2EQBA 4IDNA 3KKPA 4MRPA 1XD2B 2AK2A 4PO9A 2GZAA 4LCBA 3VKWA 1ZVQA 3X1XA 4LYFA 3VU9B 4FIDA 1GOTA 1ZM3A 3U3MA 1ZBDA 2RGCA 2J7PA 1D2EA 1YZNA 2WTUA 2ZYWX 3GFTA 2IX3A 3GD7A 5EP3A 3NXSA 1CRPA 1S1MA 5FTNA 2WOOA 1R0XA 1N6RA 3P1JA 1XXHE 3RC3A 2X8AA 2QM8A 1TUIA 4QL3A 4NCHA 3VR1A 1LV7A 2ODEA 1SZPA 2YVUA 2ZUBA 4IFBA 1CR1A 2BV3A 5TMPA 4DLUA 1UDWA 2HCBA 3L0PA 3RHFA 3KZ1E 5GJBA 2OLKA 1U81A 1N5KA 4B47A 4E5UA 2FDCA 4MH0R 121PA 3L2OB 4OI0A 4EKDA 3OHMA 1W0KA 4BRUA 4IEEA 3ND9A 2C99A 4K46A 1F60A 3AVPA 3LA6A 3X1ZA 1J99A 3SQWA 4HAWA 4EIWA 1PZNA 3GPLA 3VNUA 2Q6TA 1G8HA 3LBNA 3TNFA 1TADA 3HPRA 3HYTA 1EFRD 1YZTA 2QY9A 4M9ZA 2PZGA 1Y63A 2ZR7A 4TYWA 5F9FA 2J7KA 4IEIA 4M53A 4Q4JA 1G20E 1N6OA 5E7IA 3W6PA 4B6FA 1KI7A 2VF7A 2ASEA 4IOLA 3TMKA 1W0JD 2GVZC 1YU9A 4BFZA 2VP9A 2QAGA 4C2UA 1HV8A 1P5ZB 3K09C 3CRQA 1NSFA 1CS4C 2R8RA 2FZ4A 4M8NE 1YKSA 1IJEA 2IYRA 2LCFA 4BFSA 1J90A 2O8BA 3K09A 2HDNB 3GJ0A 1I2DA 1U8ZA 2WJIA 1OXXK 2IS4A 3KL4A 1QHNA 3VR6A 1NVVR 3PUYA 4JVNA 3TR5A 1KMHA 3K9GA 4DWJA 1BOFA 4U02A 1DAEA 1ZNYA 3KQNA 5F3WB 1EWQA 5DYIA 2XZPA 1XCGB 2TMKA 1KI1A 3IDQA 5FBQB 3SNHA 3UIEA 1Z0AA 2IEYA 3MG9A 3DMNA 4JT2A 1QVRA 3KXKA 1F6BA 1KO7A 3RWMB 2XZOA 4LJ9A 2HF8A 3WMFA 5DYGA 2REBA 2N42A 3DZ8A 3QIAA 5CYOA 2KWIA 2CK3D 5F9HA 4X8MA 5G53C 3T5GA 1XPRA 1MRSA 2FFAA 3UATA 2V3CC 5E7MA 3FE2A 4KFTA 4L9WA 4JZKA 1U9IC 2QSZA 4UKDA 1VCOA 4URYR 4QBFA 3ADCA 5C4GB 4QHYA 3AVQA 1F2UB 2FPKA 4BLRA 4XIGS 2J9RA 2H16A 1XMIA 3NBYC 3BAFA 1CLUA 2WBLC 3C16C 4HZUB 4V0OA 3TSZA 1W1WA 1DAGA 3FFAA 3PUXA 4ESHA 2WHXA 3CB4A 3X1DA 4C2TA 4ZDIA 4NDZA 4P0TA 5JCPA 2QMOA 5IF9A 1TQ2A 4LPSA 3IILA 1IAQA 1AJEA 4TQAA 2I4IA 4RSGA 4WZAE 2IHYA 2ZRBA 2G1KA 1XEWX 4M1MA 3SEAA 4BLQA 5B58C 1Z28A 2GEVA 4WXPA 5EE5B 1EX6A 1N5IA 2JDID 2DFTA 5TVKA 1OIVA 2RMKA 2ZM5A 1NN5A 3WRXC 3IQWA 5EE0A 2CL0X 4I4LA 4HLQB 2OAP1 3SOPA 2ORVA 5FOWA 5FPTA 5J4VA 1WF3A 2NO9A 5HE8A 1R0YA 3U3KA 1Y3AA 3MCAA 1ZUHA 2AWOA 2WWGA 3OE7D 2ATVA 3PJRA 4G5RA 4Y0AA 4P4SA 3C4JA 4EPWA 2WJJA 2VIIA 1Z0JA 3K70D 1SXJD 4Q1CA 2GHIA 1CR4A 3THOA 4BFXA 2Z4SA 4LJ8A 4Q9IA 1VHLA 1YZQA 5FOXA 1XNJA 4A0GA 2F1IA 3CH4B 3OEHA 1OH7A 2DWOA 3QVVA 4JMPA 5CK4A 1TF7A 2RGXA 1NNEA 2ZRPA 3L8ZA 2DB3A 1NL3A 4OQNA 2C03A 4LDJA 4YMSA 1II0A 2BCGY 1S96A 2XNDA 1T5LA 5E4FA 2BC9A 1US8B 2YWHA 1TMKA 3CM0A 3LDAA 1OLOA 1XJCA 5HKKD 2MMGA 5CLQA 1SVOA 2BMFA 3A4NA 4HZUA 2MSCB 4HATA 2Y8EA 3C5HA 4B3GA 2OG2A 2C9YA 4DBLC 4CRWB 3DZDA 4BZQA 1HQCA 2A5GA 1J2JA 1Q0UA 1ZM2A 1Z29A 3W3ZB 2J45A 4M1KA 4NYJQ 4BECA 4JL6A 2D2EA 3PUWA 1AIPA 3IIJA 2IC5A 3THYB 1W4AA 5DI3B 4KYIB 4A8JB 1E3MA 1X6VA 1VG9B 4BEBA 3REFA 3QF4A 1FP7A 4M4SA 3MWLA 3MWJA 1ESMA 5CM8B 2X19A 3O8BA 3DM9B 3IEUA 2HLDA 3AP3A 4DCUA 2BMEA 5K8UA 1GRRA 4B73A 3BOSA 1M7HA 5CJ2A 1ZCAA 3SR0A 3GJ8A 4GNKA 3REGA 1KJWA 1XTKA 1NG9A 3WHKA 2ZI4A 2HJGA 2XEXA 4LV6A 5HE9A 4RFSA 3IIKA 2AL7A 5FBVB 1P62B 4GSYA 4UJ5A 4DDUA 2E9SA 4Q47A 2RGEA 4AYWA 5J4HA 5CYPA 1M7BA 1E2HA 4A8JA 3BB4A 3TH5A 4RD1A 4W5WA 3AP1A 1EFCA 2JATA 1NN3A 1U2RA 3AKEA 4F93B 2IS2A 5GJWC 2PLFA 3DMDA 3KJEA 3L0IB 1OPXA 2RKOA 3BK7A 3DOFA 1G5RA 1D9ZA 1V5WA 2YC4C 3GJ7A 2R6AA 2XTNA 1W4RA 3OFNA 3IEVA 4QBIA 3LW7A 1W48A 2VEDA 2ZPTX 1FW6A 3SFVA 1KO8A 5FTJA 1LB1B 1KKMA 3B9QA 4EFNA 4JVMA 5IHPA 3AF2A 3KXIA 4O2LA 2QUZA 2K5UA 4MYUA 2BJVA 3LBIA 1F3OA 4LI0A 4DIDA 1SHKA 2QQEA 1HEIA 4PO8A 1E32A 2O8BB 3B1WA 1ZM4A 1X1RA 1O3YA 4DCVA 3EPHA 3GP8A 1LF5A 3THXB 2O52A 1GKUB 2OZEA 1G5TA 3CF0A 4HAXA 2QZ4A 1ZC4A 2BKUA 4NMMA 3NG1A 4WOPA 4RFVA 4UQOA 3TVTA 2B92A 2PEZA 1XTSA 2FSGA 1I4DD 3ZD6A 4G0NA 2F1HA 4EPVA 3A1UA 1GNQA 4P32A 4XOIA 1W7AA 5BQ5A 2IYSA 1E9AA 2WJHA 1WE2A 2C96A 3GJ3A 2PCJA 1NG1A 4XWOA 4NYJR 4V0NA 1A2BA 1G8YA 4OK6A 1NBMD 2EFGA 3AF4A 3ETLA 3PEVA 1XZQA 4R2HA 2IW3A 5KU1A 4HSEA 4JL5A 1KO5A 3I32A 3GEHA 4KI0A 4WW0A 1OB5A 3CO5A 1Q1QA 5DE3A 5LPNA 1XMVA 3WP0A 1X1SA 3OIVA 4RZ3A 3LLMA 4IW3B 4TLDA 1XCMA 4TYQA 2VYFA 3SBDA 2QBYA 2WWYA 1VHTA 3ICQB 3Q3JB 3MUFA 4TLBA 1E2DA 5GVRA 2UZIR 3NH9A 5KSPA 2ZRFA 3B5JA 3W34A 3W9YA 4UXJA 1YJ5A 1OE0A 1KI4A 4NYMQ 2WKRA 4AYTA 3QKRA 2FGKA 2W0MA 3D6TB 3AKYA 4FW9A 5CM9C 4BLSA 1LNZA 3NC0C 4KBGA 5F98A 1GIAA 2ZJYA 1R8QA 4POAA 3AUXA 4RD6A 3I8SA 4F92B 4Q4HB 3Q7QA 5FBLB 3U3JA 2PX3A 2NZ8A 4TMZA 4LJAA 5FUWA 1OV4A 2BEKA 1N0UA 4JT4A 3WMEA 2MSEB 3QVUA 4AWXA 3AKCA 2P3SA 1ZAKA 1ZJ6A 1GNRA 2ZJ2A 2QQ0A 4URZR 5DGXA 4DXAA 1P9WA 3NH6A 2BOVA 3QF7A 3VKGA 2NOAA 1YR6A 4KCGA 4AURA 3C14C 1GRQA 4B3FX 3U7EB 4YQFA 3IUYA 4MYHA 3SQXA 2FN4A 4JYBA 3I1FA 2PZEA 1OT3A 4PSAA 1NMXA 5J40A 1LS1A 1DVRA 2FF7A 3GJ4A 2ZU0C 5FL7D 2JLRA 3QXXA 4Q4LA 3OAAD 1HH4A 3W5IA 2JIZD 2RGNA 2V4ZA 1RJ9A 1T8TA 3OIYA 3DVLA 1ZYUA 3F8TA 1F2TA 1KOFA 2ZSDA 4UNSA 5FTKA 1JR3A 2H8KA 3FKSD 4NBSA 4A2QA 2J0QA 1LTQA 1HUQA 3KFVA 1QHYA 4D4LA 2IEZA 4DCSA 1IXSB 1MO4A 421PA 4TYYA 3EIEA 1UBCA 2JLQA 3K8YA 2UKDA 3DM5A 3THWB 1WBBA 2XSZA 3U7GA 3U7HB 1T91A 2ZE7A 3U4QB 1ZCBA 1XF9A 3CNNA 3BFVA 4JKIA 1VCIA 1SQ5A 1KZGB 3CX6A 2VL7A 4YMUA 1V43A 3EIQA 1E2LA 2CL7X 3WNBA 1KY2A 3L82B 1E9EA 4JLAA 4QKQA 4URWR 1AZTA 2DR3A 4G5OA 3U44B 4AYXA 1GKYA 4XVRA 4M1YA 2YKGA 2KE5A 2HV8A 1J8MF 4NKRA 3QE0A 1NN1A 4DEYA 1K8RA 3B7GA 2V7QD 2IL1A 2ZQ5A 4IOJA 4IOKA 4JLOA 3R9WA 4UXIA 1R5BA 2KBFA 2IF2A 4ZV4A 2IXFA 1MV5A 2PX0A 4GP7A 3ICEA 2O8DA 3O8CA 4QM6A 1WBDA 1M1YE 1CJUC 4Z8YA 1XDBA 2OBMA 5D3MB 3U2QA 4MDFA 2RB4A 1KMQA 4TYNA 2ZRLA 1CULC 2XNSA 4LUCA 2O5VA 4C9BA 4ASUD 3P4YA 4G5GA 4N1AA 2WSMA 4DT1A 2QEQA 2A2ZA 1M2OB 4I1OA 4A0HA 3QBTA 1ZM9A 3NIBA 5JEEA 2HYIC 4A36A 1ONBA 2VHQA 1R2QA 1KTVA 3A1WA 3K0FB 2YV5A 4PC6A 3TR0A 2DFKB 2CJWB 1UADA 4LOAA 3ZZTA 3NWJA 2VSOA 4L5BA 1UEIA 4PPNA 1UBEA 3QXCA 1D8TA 1GKIA 5EE1A 5KDOA 2YHSA 3LAWA 4HB0A 3IIMA 1GG2A 2WAXA 4TTRA 3ZYCA 1Z0IA 1VCMA 2A5FA 3DOEA 2YYZA 1G291 1DPFA 4GOKA 1SVMA 3KUCA 2X1VA 4OBEA 1JAIA 2WJVA 3A1TA 1LS6A 2R6CA 1E94E 1JR3E 4R9UC 2O8DB 1UBGA 5FI1B 5FR2A 4C3ZA 3JVUA 4TL6A 3W3AA 1QHGA 1AGRA 5EXPA 3OF5A 4AKIA 1GRNA 3EAQA 4YMWA 1L4UA 3QKRB 1HY3A 1MRNA 1P9NA 3LBHA 4RCZA 3GLFB 2I3BA 1UPTA 1CKEA 2QGZA 1R6BX 3LW8A 4HLUA 4TTQA 2BHRA 4WVFA 3QKSA 3T61A 4RD3A 3RC8A 2PJZA 4FI3C 4BUJA 2QBYB 2R65A 3RLFA 1IN7A 1UKVY 1P60A 2Q9AA 2VP6A 5DI9A 1GFIA 1EFUA 1KI3A 3K9NA 3LVRE 1SKYB 1PLKA 1XXHB 1G3QA 3KUDA 2ERYA 3PIRA 4X8HA 4Q7MB 1G19A 4PANA 4A9AA 2WPDA 2IUTA 3MD0A 3RS7A 1E1RD 4C0JA 1PLLA 4HUTA 4PQFA 4D0NA 5EE3A 4YC7A 1KJYA 4TMTA 4KODA 2AXPA 4B33A 4US1R 3KB1A 4CYMA 1E79D 1G3IA 3GFOA 2XB2A 1KDTA 4JIMA 1CRQA 5J4LA 1QG4A 1RJ9B 4D0LB 4C7OA 4XD7A 2VHTA 3L8YA 2GCNA 3TE6A 4EJSA 3CNOA 4HAVA 4A15A 1TPZA 4B35A 3WMGA 4WAUA 1KIMA 3L0SA 4EJSC 4YONB 5DIFA 2VP2A 5JS8A 1KI8A 1T3LA 1R8SA 2JLVA 4QJ5A 3BD9A 5FPSA 4JVSB 2KB0A 3R8CA 1KHTA 2CMKA 4YXWA 1I4TD 2EU8A 4ZKEA 1RRPA 2X77A 1KI9A 5TB5A 1W5SA 5JECA 4Z1MD 1F2TB 1BMFD 3B9PA 3C41J 3V9PA 1AQUA 1Q20A 1GL6A 4FD2A 4JLVA 1IN8A 1DE0A 2GCPA 4NCKA 4O2RA 5JI3E 3Q72A 1E9RA 2VSFA 4JYCA 1OW3B 1EG7A 8OHMA 3V4FA 1OKKD 5FOSA 1TNDA 1WB9A 1GVNB 2O8CA 1S4QA 3R9IA 4B2LA 3BBPA 3TBKA 5CIQA 2W6IA 4W5JA 3NEJA 4ILEA 3B6EA 4OHVA 3BFKA 2QENA 1SVLA 3W8RA 2XXAA 2XB4A 3TUJC 2OE2A 2GRJA 4F4IA 1XMSA 3P20A 1G9XA 4FWIB 2EW1A 4UNQA 1KNQA 3D31A 2FE4A 1VDZA 3LNCA 1ZUIA 2F3RA 4N0DA 3RRNA 3WNDA 1XU4A 4I99A 3LO5A 4G5QA 1EESA 3CLVA 2OFWA 1E0AA 1ZP6A 3QPWA 3TW4A 2HF9A 3LD9A 3MFYA 3WP1B 1BH2A 1ELOA 2EFHB 4X8OA 4DB2A 2FX3A 1KJZA 5C18A 1E4YA 1UJ2A 4CT4B 2CJWA 2NMVA 2CVHA 1O87A 4XVQA 5KYKA 1ZD1A 3GJ6A 4Z51A 5AJVB 3IBYA 2J0UA 3WYAA 1LFDB 2RGGA 1GDDA 4P4SB 2Z4RA 2IYVA 1XMJA 3HR8A 4OHZA 1KK1A 2OESA 5FR1A 3GLGB 4XWKA 1T3SA 3AGQA 5FUYA 5J5CA 4ABYA 4Q1FA 2CHQA 5DO9A 2J46A 4LBWA 3K53A 1Z6GA 4A6PA 4CT5A 2O8EA 2FFQA 2G0NA 4A4DA 5HPYB 1IM2A 1EX7A 4MGYR 3WHLA 4E07A 3FOZA 2C04A 2O0JA 2WOJA 3FTQA 2C98A 1QF9A 3UG6A 2G83A 4MRSA 2ZETA 1FTSA 2VQSA 3RS0A 5L3SB 4PXAA 3T1OA 2YOFA 3NBFA 4RJLA 2HEIA 2QL6A 4QRHA 1HTWA 4Q4AA 3AV0B 3HPQA 4I1UA 4DLXA 2ZRMA 2PZFA 2W6JD 5DN6D 5JWOA 1G3RA 1MO6A 1ODFA 5L3RA 1XEXA 3TSOA 1NVWQ 4LY6A 4IVPA 3EPLA 1EFTA 4JLKA 5DISB 1HT2E 5KDDA 5KSOA 1VG1A 1E99A 2F9MA 1X3SA 2Z0MA 4KV9A 2ZRJA 3NBZC 2AFHE 4DHEA 5EP1A 3EZ7A 3THWA 1QHHB 3FHCB 3G5UA 4TLAA 3N70A 5F2EA 5JRZA 4PC2A 3EWSA 1M74A 1W4CA 3EW9A 4IVRA 1N5JA 1E9SA 3K0CC 3KXLA 4UXHA 3P32A 4PO1A 1D5CA 4JL8A 1RKBA 1Z6TA 1UEJA 4RZ2A 1G21E 4UNNA 4HLCA 3V4RA 4A0FA 2C2HA 2NG1A 4QGGA 4DLYA 1II8A 1XZPA 3FKQA 4E09A 3SJCA 4EPYA 4KFUA 4QJ3A 2FSFA 4WIAA 2ORWA 3GLHE 1D2MA 4DDVA 1QHIA 2YJTD 3GLIB 3U44A 4E03A 2ZR0A 3WBJA 1E0JA 1DELA 4TT3D 2YOHA 4L16A 1MH1A 1VG0B 4PC3A 3RANA 2QNRA 4MRNA 4KSCA 4XTRA 5BWMA 3T34A 3TUZC 3AEZA 1J8YF 2GTPA 2AHOA 1NJFA 3EZ9A 3O47A 4FINA 4OI1A 3EZ6A 3X2SA 2H17A 2QN6A 3LLUA 4M0LA 4TMWA 3WXMA 5FOTA 2CE7A 4G01B 1Z3IX 3N2EA 1P2TA 4V02A 2FZLA 1CTQA 2QMEA 1Z0DA 4DC9A 1TL7C 3NTUA 3QKSB 2OBNA 4D25A 1VKJA 4IHQA 3IKJA 3AVVA 4ZO4A 3FMPB 1VIAA 2QTHA 1CR0A 5CLLA 1HYQA 2QORA 2GAAA 2BJWA 4URXR 1RRFA 4DUGA 1A7JA 1C9KA 2P6RA 3UMRA 2YC2C 2CVFA 1G8GA 2D3WA 4D6PA 2JJ1D 2VLIA 4FMDB 4LJ7A 3ZIAD 3A36A 1RW4A 2AR7A 3SFZA 5EUMA 2GVDC 3RNLA 3Q9LA 4AC9A 2ZVPX 3ZJYA 4Q9JA 3QEJA 2CEAA 2J87A 2EFEB 5EZ6B 3T06B 3FVQA 2IF0A 3LFUA 3RSOA 4LJ6A 4RD4A 1YE8A 4TQUS 5FH9A 1KK3A 5JJKA 1AA9A 4DLZA 1AS3A 4FMDF 1KYIA 3D3QA 4QBGB 1JI0A 1H8HD 1U90A 3K1JA 1G8PA 3K0FA 4GZMA 1S9DA 3EZFA 3UK6A 1Z6AA 5E3HA 5IK2A 5J47A 4LHWA 2FEOA 4U7DA 2W2VA 2KJQA 1Z0FA 5L3QA 3NHAA 5TDHA 1FFHA 4CEJB 2LWIA 3CZPA 3FMIA 4JKYA 5DH9A 5FPKA 3R8FA 4HB3A 1S8FA 1S0UA 2EYUA 5J4KA 2OHFA 2OFXA 1RIFA 2XOKA 4C30A 4L8GA 3X1YA 2V1UA 1KI6A 4JLBA 1E2MA 3ZVLA 4HEJA 1FMLA 4ITRC 2FPLA 3QUSA 4HB4A 4OHXA 1NF3A 1VTKA 3EARA 3PR1A 2IXGA 4JBWA 3D8BA 4Q9HA 2GJ9A 4B2IA 2VHJA 5EE9A 5K8IA 2CE2X 2IYQA 4BLPA 3AVTA 2ZRDA 2IK8A 4WA7A 2NPIA 1G6HA 1GM5A 3VR2A 3H0KA 5BN4A 2JJ2D 4NCNA 1Z08A 1XEWY 3LQRA 4KVAA 1WRBA 1II9A 5JMTA 3RVBA 1P2UA 1G41A 4M9XA 4ZI3A 1XX6A 1J70A 4RD0A 2HUPA 3WYGA 4DLWA 3CH5A 3HP1A 4RFSB 4IXNA 4CIDA 2AFIE 1E1QA 1L2TA 1ZD9A 1G7SA 4ZDWA 3F5FA 2O0HA 4JLMA 1RVDA 3VR3A 2QE7A 4BQSA 3P26A 2F1JA 2AD5A 1TF2A 2CNWD 4S2EA 2D7DA 3FMFA 4BZXA 1KZ7B 2V6JA 1G3MA 2LKCA 1KSHA 1U8YA 5TY0A 2QAJA 3B60A 4MITA 4B2PA 1NP6A 4MKGA 4QBHA 3KJHA 3TKLA 1U9IA 4RKFA 1OHHA 3VMFA 4CW7A 2GJKA 4I81A 4WXRA 4MKFA 3ADBA 3OIWA 3P27A 3QI2A 4A82A 1W47A 1ZD8A 1OXTA 4XVUA 1WCV1 4KBFA 2RH5A 2PCLA 1MT0A 1ANKA 4GRAA 4XH9B 2OAQ1 3ASYA 3UWKA 4A2WA 1J7KA 1Z63A 2AKYA 4HDQB 1NLZA 1YZLA 1TU3A 2PT5A 4QM7A 3IO3A 4TSFD 2VPPA 4II7A 4JLJA 3I72A 4R7ZA 3VHXA 4DSUA 1G16A 3CR8A 3U3RA 1W2HA 1M6NA 4LV8B 4YLGA 4Q1DA 2QAGB 4A2PA 2ZS9A 2P6UA 3CX8A 4RZUA 1NRJB 2ZE8A 5C1BA 2QTVB 1NVUQ 3MWYW 4MYTA 821PA 3BH6A 3CUEF 2O8EB 3B13B 3CIOA 2N46A 2QMUA 5C2JB 3OEED 5BN3A 5FI0B 5CB8A 4CZ2A 5AUNB 4P3YA 2ZXUA 3GFPA 4JLPA 1A2KC 4PTLA 1CBUA 4IVQA 4LYAA 2IHBA 4BFWA 3VX4A 3VR4A 2FSHA 3S1AB 4W9MC 1UKZA 2A7QA 3N2IA 5DSZA 5EP4A 1GILA 4LJYA 3RS5A 2C8VA 2R9VA 2OFOA 2QT0A 2F6RA 4QNMA 1QBKC 3HU3A 4EPTA
chains in the Genus database with same CATH superfamily
5H70A 3M34A 1DIAA 1YZYA 3AH8A 3BH7A 4MB2A 3RYFA 3GDOA 4Q12A 1RYNA 2BBOA 3KFXA 3I5AA 1PL8A 1IPEA 1VKZA 3D3EA 3DBLA 1BXRA 4QFMA 4RVFA 5L95A 2G1AA 3G82C 2QLLA 3QUCA 4MQBA 1KY5A 2QM7A 2O0MA 2SHKA 3I23A 3W6OA 4Z9YA 1TW3A 3U7RA 4LQCA 1TLLA 3EASA 1MABB 1EP3B 4GZ3A 4ZJUA 4TXMA 5CX1A 3U4AA 4CCYB 2A9KA 4MVJH 1AB6A 5BUZA 2I33A 4Y1EA 4NY1A 3UMCA 5I4BA 2AT1A 4GI1A 4TN1A 2ZWIA 4RJIA 4RK1A 1JDZA 3PEYA 4YALA 2VG8A 2DCUA 4OMFG 3OD1A 3K6JA 1Z35A 1PS8A 4UUOA 3A4MA 2BCEA 3UG7A 3DZBA 3KWFA 4RCYA 2AEEA 1JWLA 1Y48E 3FBWA 1P4SA 3PDWA 2O2XA 4OY3A 5TS3A 1E5QA 1GU1A 3CUKA 4NONA 1H8ED 1K8ZB 1Z75A 2G6TA 3KJIA 3HTXA 4QXMA 1G4HA 4OFZA 2QZJA 4QX6A 5ALSA 3S2IA 4RTRA 3K5WA 4JVOA 2XE4A 2YJ6A 1AMUA 2AQIA 2C4NA 2AHRA 1Y5IA 2LBPA 4FX5A 4LK2A 1LSUA 2XQKA 3OJEA 3R6WA 4HNAB 3FD8A 4IDEA 4LX8A 4UBIA 4B4UA 4DR4B 1C7FA 5CT8A 2PUHA 2CDCA 2WSSA 4Y6OA 4YP7A 3V33A 1MHTA 2MOKA 1QMPA 5KOJB 2E4AA 1YBFA 4I5DA 5ARDA 3FSRA 3H9GA 4OK5A 4WK6A 3FTFA 1P0CA 2YNMA 4ZZIA 2GCOA 4Q3NA 4WCVA 2XWSA 3DVRX 3B1JA 3T3GA 4YCMA 1HORA 3W2EA 4Q48A 1I32A 1HQYE 1EBFA 3DAPA 5ERGB 5C53B 4HVTA 5ILQA 2WMOB 5I51A 3FOBA 4E0BA 3KD3A 2JH8A 3O9MA 5JCJA 4C7OB 3V4SA 3R09A 4LVOA 2BRUC 5IU6A 3DJFA 5K7SA 4FN5A 3KVYA 1ZGCA 1BD4A 1H0KA 2OORA 3EIUA 2NU8A 2LVBA 2V58A 3EXAA 5FB3A 4AY4A 4CKEA 3HU1A 1YZVA 3ND8A 4OQMA 4DDTA 3TW8B 2PXAA 4KMSA 2P4SA 4H59A 4LWOA 1O6FA 2A3RA 3ZIDA 4CKCB 1SXQA 1AVTA 1ULZA 1RWKA 3ZWNA 2OILA 1OB2A 1JJBA 4GRDA 1JAHA 1Z4KA 2X23A 1H5NA 2BWJA 1JEQA 1QOZA 3HB5X 2Q1WA 3EVCA 5J4YA 3HSYA 4R9NA 1NQUA 3G7NA 3VYWA 4G1UC 5A9SB 1RHMA 5FWAA 5JLJA 2F43A 1BX3A 3BXFA 2D1YA 3F2IA 5GV7A 4Z4GA 3F6PA 4FKMA 1PQWA 4OP2A 3T7DA 2YZKA 2DHQA 3Q2IA 4HEQA 2AXNA 4DV6B 1DIBA 1I3CA 2VTBA 3O5AA 2CBZA 3QBDA 4JENA 3RRYA 1KNXA 4MOWA 3LQ4A 1YZUA 3NNSA 3LGXA 4IVNA 4M1TA 3M6MD 4IQ8A 4EZEA 1YCFA 3FIUA 5CK5A 1EFRA 2P2CA 5LP6B 1T36B 2R84A 4TKMA 3TVDA 4O02B 2NTJA 1ISHA 3L3BA 2CNDA 4GEGA 1GQRA 2JASA 2SKEA 2KYRA 1N2GA 2Y4OA 3KX2A 4JHXA 2QTRA 3IEIA 2OMKA 4WZ6A 1NMYA 1AS2A 3W8NA 1CK4A 1V1MB 4DWVA 1KDRA 3HNRA 2POCA 1O5OA 1YIAA 1YONA 4IGAA 4DR6B 1ZNXA 2ZIGA 1RWWA 2XTJA 3I5XA 4HAOA 3QELA 4MW1A 4DDMA 3DDHA 5KO2A 4CR7A 1PJQA 2AJDA 2ZANA 4RNCA 4Y6SA 1JL3A 3DLAA 3HGMA 1B0AA 3ESDA 2J9FA 3UZUA 3PGVA 3BWYA 3VPHA 2ZJ7A 3WY9A 1SUSA 1XZIA 4LE1A 4ZYTA 1XZNA 3GMIA 1R6UA 1S7GA 2EIHA 4ARAA 4XGIA 1TQ4A 4TGLA 4XIIA 4HT3B 1Z26A 4MROA 4PZYA 2IPNA 1JALA 5AK0A 4D8WA 2QGFA 4MVCA 1Z0KA 1OT5A 2J3EA 4KQJA 1T2DA 2F3SA 2JGDB 4RQBA 2FSIA 4MYDA 3AW9A 1GXSB 1V95A 4GIBA 3D8TA 3FZGA 5FEMA 3ZHTA 1G1AA 1XVAA 2VHZA 4L8VA 3T5MA 4AICA 3NNDA 1JXMA 3GHYA 4IWYA 2A0UA 2PL3A 4OGWA 1BDJA 2ZQYA 5FPHA 1KQNA 2DUJA 4KFSA 3B1FA 1C3JA 2RBKA 2IQIA 2CK3A 4ZXFA 4GX2A 3CF2A 5KYNA 5ALVA 1CUVA 4OL9A 1NUQA 3C6KA 2ZI3A 4BFVA 3BSFA 3WIEA 1GPH1 1FDOA 3EPKA 2BSAA 2OKCA 3G1TA 4YBZA 4QXPA 3ZBPA 3VKHA 4PHFA 4KPUB 5HTKA 4NR0A 4K40A 3IKTA 4DDKA 1HO3A 2IUYA 3NU1A 2RHTA 1UJNA 1QHEA 2OV1A 1YB7A 1KE1A 2WJ6A 1RHRA 5CFRA 1FLDA 4UCXA 4BP3A 1M66A 2DT5A 2ZBUA 3KKQA 2EX4A 3RVSA 4G9EA 4JS0A 4M1OA 1X7YA 1R6XA 5LLTA 1IY2A 1DX9A 2APJA 1HQDA 4G1EB 2JL1A 4TOIA 1AKEA 1V2GA 2Z95A 4AJKA 1KJIA 3ESCA 3GBSA 3KO8A 4BBPA 4P3PA 2JNWA 1YHNA 3TUIC 3WDSA 4AUNA 3ZI7A 1WY5A 2EXXA 3KPWA 4PGAA 4MVJE 5J2UA 2NX2A 1LD3A 3F1KA 4B7CA 2OGTA 3KL2A 1WXXA 2C9MA 1NUPA 3GJ5A 1S2MA 4J90A 4CMGA 1DNPA 2OCDA 2Q2NA 4DAOA 1FRFS 1GPJA 2YVKA 3Q2KA 3LJKA 1ADFA 5IVKA 4L9SA 9LDBA 1HE2A 4E2YA 5JUWA 3DR3A 3HU2A 4X20A 2IZOA 1KJQA 1DG9A 4GR5A 3SBOA 1XLVA 4YCDA 1LPBB 3C3EA 3DLBA 5T3YA 4R9VA 1OX5A 1PJRA 3LOQA 3OETA 1HE1C 1MO5A 2YZNA 3AI2A 4NE7A 2QVGA 4EHJA 3COZA 1T6XA 3HO1A 3GT3A 4P8RA 2O7QA 2I8LA 1WP9A 3IVAA 5AXCA 1E6CA 2YMPA 3OE7A 3TK1A 2HBZA 5FDFA 1GITA 5C3MA 3FSEA 5IXJA 1G5HA 2ZS7A 4FIZA 4X84A 3TS1A 2C78A 4BTLA 1X92A 1NPTO 2ZBEA 3BZBA 1HTTA 4RO0A 1EMDA 1SXJA 2IGBA 4FHCA 4I14A 5E6SA 2EF1A 3VNBA 3NHPA 2NSLA 2ZCVA 4BWYA 1IC6A 4PYNA 3ZVMA 1K92A 3MBKA 2GXAA 4DIMA 1TZ2A 3DE3X 5DJ5A 2OO5A 3UQZA 3K8OE 1QVWA 1ZBQA 2H1IA 1CUAA 3LKDA 3PGMA 2CVQA 4KWIA 1J9EA 1ZD5A 1ZVJA 1TM3E 4I55B 4BYMA 4WJKB 5AM2A 3H5IA 2YVLA 1XB2A 4LNUA 1S3SA 4H3VA 1PUJA 4PYIA 3PVZA 4YWJA 3ZE8A 3WIVA 1E98A 3B8EA 2WZCA 1KK2A 2OVFA 3SJUA 4F71A 3AEKA 2J31A 1FPMA 3DGFC 5IN4A 1PP4A 3THRA 1N8KA 4LYYA 6YASA 4J91A 2BI8A 4E2XA 4UTRA 2IKQA 1TKCA 1V4BA 2FSUA 4YMVA 3ZQJA 3K4PA 2R60A 3X1KA 1ZVMA 1QE0A 1JAYA 2C4MA 2GK3A 3GEGA 1EP2B 3SIRA 3EHEA 2C0CA 1PL7A 3T7KA 4OYRA 6LDHA 3EIXA 1KU6A 1Z2NX 3H65A 2FLVA 4TMKA 3F67A 3SQOA 3WQRA 4D2IA 4ZTUB 2CCKA 3JY6A 3K6KA 4YGYA 3PFWO 1A04A 2WHQA 3DH0A 1L5KA 1J8FA 5FXMA 1J24A 1UDAA 1W5TA 4GPZA 5DN9A 1IOZA 3UMJA 2J5QA 3ZUPA 4CG3A 3IBGA 1M5RA 5BNTA 4YH1A 4LTDA 2Q5CA 3OCVA 2R00A 3R24A 2H5IA 2LDXA 4MEAA 4RV4A 4TWZA 1H4SA 1XN4A 1Z0SA 3K0AB 5CLIA 3WKAA 4DEVA 3NHWA 1RJEA 1Z2AA 3E3NA 4F3YA 2H08A 1JKJA 4OL0A 1L4MA 3QTTA 2J3LA 1DO0A 1HDZA 2W6OA 3BRQA 3LUPA 3MLAA 1KEWA 3ADKA 4K6OA 4KN9S 4N3NA 3AYZB 1EK2A 3LL7A 1AM4D 4NNOA 1X7XA 2B2XA 1L5WA 2CN1A 2BEUB 1ZDMA 3HCPA 1YJCA 3MEQA 3FLMA 4X8LA 1JB1A 1FRVA 1NPDA 3C3YA 4FYXA 4U7GA 4YHHB 2GK4A 1A5ZA 4HDRB 3S28A 1V16A 1MX5A 2XBLA 4W1SA 3RJ9A 1AS0A 3VZSA 4K9MA 3SZRA 3SF0A 1O9GA 3PQ4A 4QXAA 4QDUA 4KR9A 3O26A 3ZD9A 3UANA 2DLNA 2QJWA 1DHTA 3RAFC 5TQ2B 1J0AA 2C2BA 4BWVA 1P1FA 4DABA 1ABEA 1RYYA 1ULBA 3I6ZA 5LQJA 3FI9A 4PGMA 4G0UA 4KVZA 2I6QA 4I4NA 3RRMA 2ZKIA 4S35A 1U04A 4JLUA 1QV7A 1Y4UA 5L9AA 5ALUA 3OEWA 3MAAC 1I36A 1EEXB 1T9AA 2C9OA 1CUSA 3I92A 4ZEOA 5EYPB 1RC8A 4R05A 1EQAA 5AHOA 4J3NA 1NJSA 2WMNB 5MGNA 2C9CA 2YBDA 4BX3A 1NW5A 3NKVA 2XPCA 4Z7NB 2RI1A 2IUEA 2MYPA 1KMIY 4GUAA 1KBQA 3AEQA 1M7GA 3BFJA 2O2ZA 5FI3A 2IV2X 2ZI9A 2OLEA 2F43B 3NP7A 4QLBA 3P4XA 3ORFA 1W34A 2IHKA 1EM8A 1V3VA 1YQQA 1G2IA 1X86B 3C5CA 3VHXB 3E8XA 4Q02A 1DKPA 4P92A 4TXLA 4AXXA 4ABTA 3GAFA 4B5LA 1I4EB 1W96A 1XTJA 1M5UA 1UM8A 1YVDA 2XUAA 2Y6UA 4IYRA 4LWQA 5F9MA 1WQ1R 3UH1A 4O3MA 3HCRA 4J0JA 2LP4Y 3T7CA 3QX8A 3ZCXA 1KEUA 4BBAA 1OFVA 4QT0A 3F3KA 3NJRA 3CKMA 4BO9A 5DM1A 5BSMA 3RK1A 2V0GA 4F21A 3A31A 2ZVQX 5TC4A 5JSHA 1F1JA 3WICA 3S29A 2G80A 4BMPB 2WNHA 2CCGA 2O3RA 3H9QA 3HC7A 3V1LA 2B8WA 1DX4A 4HVAA 5ES3A 3LIIA 1P6XA 4MUXA 3WDKA 4EJMA 3NBMA 3BHIA 1KMMA 1CP2A 2CHEA 2DKNA 3MGCA 2OEPA 3PGKA 1IVYA 1CUCA 1E2JA 1E96A 4G41A 2ZTSA 1NULA 2F9LA 3AIKA 4YJFA 5D86A 1FS6A 4DSNA 3DOHA 4EECA 5AKYA 5B30A 4Q1BA 1NDHA 3N7UA 1WBJB 1VBMA 3O2NA 9ATCA 3L7NA 4YR7A 1EGMB 2IPLA 2VWGA 1G8MA 2CXNA 3A05A 1SIOA 1CNMA 5C5DA 2QKYA 2VDWB 1AY0A 1Q84A 3KDPA 4IOMA 2X0EA 3FYCA 1Q15A 1X1TA 2GEDA 1B4DA 2QG4A 4GPEA 3FMGA 1QJCA 1J5PA 2JLAA 3QUTA 4WZAA 4BO1A 1Q7BA 3SC3A 3D4NA 3OZXA 4RF5A 1PF7E 2CWWA 2VFAA 2XTZA 3IQDB 3I1YA 1IB6A 5K3EA 3M6VA 1P0QA 4X95A 3KSMA 3H2KA 3EA5A 1D2RA 3KQTA 2PUCA 1PQ4A 5EXSA 2JLWA 1ZONA 1CJSA 1SVWA 1ZD4A 3INNA 4JSYA 5DBGA 3DMHA 4TMYA 1DC6A 1A8QA 2V65A 1QIGA 2WZQA 3BXEA 3W90A 4KO4S 3E1KA 2EG9A 1P4AA 2YJZA 2ST1A 1I10A 3ZJTA 3ASUA 1L4GA 3TLBA 4P83A 2ZWVA 2IY9A 2R1VA 2FEMA 4D4KA 1Z25A 3P2MA 4JI0B 3TSYA 2A84A 1PT7A 1UINA 1XL0A 1O94A 2J48A 2XQJA 3UFXB 1JPJA 4LZZA 4LF4B 1U1DA 3PXDA 2XTMA 1FSFA 1VZ2A 4P4TA 3I3SR 3CPHA 1V2HE 1DAFA 4WCFC 4DSZA 5FL7A 1O0BA 4JI6B 4L3VA 4BVJA 3DGEC 4TLLB 4ZHQB 1YRHA 3A4LA 3X1JA 2G36A 3KYDA 3JASB 2GHQA 1Q5PA 2PKRA 2B5VA 1GYRA 4QVKA 1WMFA 4ZIRB 1K7FB 2WQ7A 4BNFA 4JOBA 1N5MA 5ECGC 4CBVA 2R8EA 5BURA 2R47A 3ET4A 4IJUA 3LPAA 2OP1A 3LOPA 1XEXB 5A3SA 4CMAA 1H3EA 1IJFA 2PG3A 1W36C 2PLRA 1EFVA 2G71A 1YHZA 2P5YA 1NZDA 4R8KA 3EVZA 4R6XA 4RHYA 4OKNA 5U4XA 3SS8A 1QUEA 3JPYA 3IBFA 2FMIA 3BD8A 2Z6VA 1P72A 1Z4NA 1ZI8A 2I78A 4LHXA 4RGQA 1C8KA 3RTGA 1V6SA 4DVGA 3PNBA 4E5KA 2DFDA 2I6FA 1MIOB 4I3FA 3HCCA 4R2WA 1O2DA 5EXTA 4J16A 1P3Y1 1QPZA 3O75A 2DOKA 5EGNA 4Z7QB 2Z1DA 1WXIA 3FHJA 2O2GA 2J4FA 2ZRHA 2ABWA 3MTIA 2J5XA 3UK0A 4G0VA 1SRRA 1U3TA 2YW9A 4UTXA 1Q44A 4II2A 4XWAA 4L27A 2G0AA 2OUKA 5BQXA 5MFZA 1NUUA 1UDCA 1GGVA 2V7QA 3F4LA 3H42B 1P9OA 3O0TA 3TL6A 4PYJA 1BHQ1 1GDTA 4P38A 2WP8J 4ENTA 1IQRA 2NV6A 3I6YA 1JA9A 3LHFA 3GLGE 2ECKA 1X1AA 2FR8A 3K4QA 1CX9B 1HDIA 4B3JA 4E32A 4YAGA 3AIMA 4QG7A 5JCOC 2GM4A 3BWBA 4S1TA 2PQ6A 2P1DA 5FI5A 2R48A 4XFDA 4C0HA 4JIGA 1W1UA 4JEUA 2YWCA 3CTPA 3QXGA 4YJKA 1SMKA 5FL3A 4AVYA 3TQFA 3JYNA 3JYOA 3VV2A 2QPLA 2QF7A 4MYCA 5DHTA 3NFRA 3OCJA 1DO2A 2BR3A 3NWEA 3TW0A 3K72B 2HHAA 1J20A 5C81A 1FQOA 4E88A 3B1YA 1XTVA 3LX8A 5F1PA 3A7DA 2KQUA 1HLGA 5LUAA 3DW3X 4XM1A 1T2UA 1JFRA 4GKVA 3KZKA 4NECA 4CLOB 1E2QA 2FH5B 1WUHS 3LCMA 2HM7A 3MOIA 2WJYA 3NRJA 3K6SB 5EMNA 3IO5A 4H35A 3W2IA 4ZU3A 2YOGA 4P08A 4NXMB 2HREA 3WL7A 1P1CA 1IHUA 2LV8A 3E9CA 4XYMA 3WSTA 2JHCA 3W6NA 4YLYA 2P67A 1M2JA 1TJNA 4YGXB 2YWEA 3NHMA 4TV8A 5LYYA 3UWPA 3WGKA 2HD4A 4CLXA 2PFKA 4UTPA 3FHOA 3C0KA 3USZA 5CEJA 2ADFA 2A0KA 4TTVA 1IB0A 1F48A 1YS6A 4D8YA 1M0TA 1X7ZA 2FMFA 2QMHA 1QK3A 2ONCA 1PFKA 4UCWA 3WKCA 4L73A 3KB2A 3TZLA 4DPKA 3IQFA 2RI6A 2RHJA 3DYIA 3DTVA 1NZJA 2ZULA 4KTTE 3Q7IA 4KYVA 4B32A 1BW9B 2H1LA 5AVOA 5EQTA 4G84A 1PEYA 2FPMA 3SYNA 4DCTA 4ARUA 4J4HA 5KX5F 4HNTA 3PXUA 3DT6A 3ZGYA 3DE2X 3QPVA 1OTYA 1L4KA 1TUBA 3A6GA 4JLNA 4MQFA 3ZPXA 2W48A 4HLUC 4YRZA 1ISMA 1GZUA 3NBAA 4J4BA 3KKOA 4WK0B 1NY5A 2EFJA 3TOCA 3KJGA 5AW5A 1E59A 1C4WA 1YDWA 1ZVVA 1WG8A 1Y8QB 1XZCA 5AW8A 1AUVA 1KZ4A 3HUUA 4CKYA 4W7HA 1USVA 2HF2A 4RIFA 4WE3A 1H1DA 1ORHA 1Z5UA 5EWJA 4EA9A 2GZ2A 1AUPA 2Y67A 5FPQA 4F38A 4NV3A 4OG2A 1ZW6A 3OX4A 3QQ5A 1HNXB 5A0FA 3EH2A 4A6XA 1H5UA 1AKYA 2PHZA 2C59A 4PICA 4H9GA 2I2WA 1U7DA 3GQBB 2BM1A 1RQXA 1N0IA 4MLDA 3EWAA 3T15A 2QYOA 3GPDG 1YOVA 5CFLA 1RAEA 4V0MA 3AVOA 3C15C 3EOZA 4GKBA 1U1EA 3UMFA 2GLUA 1N0VC 2P0EA 5L3ZA 1NBEA 3N2LA 2GK7A 3UO8B 5C35A 5JD3A 1FMTA 4P3XA 3U7FB 1W44A 3LS2A 4X9XA 3NOVA 1M2KA 5JJIA 2RHMA 4RNDB 3K0SA 1BDHA 1TJ3A 4MKRA 5IBRA 1YKFA 3D1JA 4HG2A 2YIMA 2Q62A 4YXWD 5CFOA 1HLDA 1FFYA 1JA1A 1VI6A 3K9LA 1M2OA 2E5WA 2WHRA 3QE3A 4GC5A 4MUJA 3O0DA 3H84A 2FK8A 3RHZA 4IGKA 2NADA 3WLJA 1CJTC 1XAIA 4I19A 3ER9A 3TCNA 4BP8A 1REQB 2VTEA 4UHHA 3KYJB 2EFCB 1VYTA 2QTAA 5G3YA 4PNEA 1CS0B 5BOVA 1FFXA 2J0UB 2RG1A 1V9SA 3NHKA 3Q7PA 4MWGA 3DDNA 2EP8A 4NFYA 4RJJA 3TNLA 1OKKA 1B3RA 5L7WA 1E3DA 3PFCA 2QE6A 1DU4A 1EXMA 1EGQA 3CLUD 3KQWA 6AT1A 1U8CB 4YX9A 5IAEA 4ZHQA 4EHFA 1QC5B 4MULA 1GGNA 3P5BA 2R68A 1IH8A 3JAKB 2DLDA 1DQYA 1QZZA 1RRCA 1SZDA 5EXEA 2KSQA 5DSXA 4AG5A 2EFDB 3CNHA 2EQAA 4C76A 5AVTA 3JQDA 2V6FA 5G0WA 2IFTA 2Q5OA 2A14A 1DBRA 4ONEA 3UHJA 4OB8A 2OQIA 4A8TA 1JJVA 1NI3A 3P0EA 3HB4X 4MW5A 4QJ4A 4BN4A 1Y81A 4YPOA 1IULA 5CR9A 4IJQA 1FNDA 1VJTA 1Z2CA 4UM7A 4CN9A 5KYYA 1Y6ZA 1DRJA 4M8KA 1A2OA 1EX1A 4URFA 3NIGB 5B4TA 1GR0A 3L18A 4QDTA 2GN4A 1NU6A 4QELA 3N8KA 2JGNA 1BFUA 2AKAB 1IWBB 2PFSA 4B82A 4UZEA 5DMXA 2P5SA 3MVEA 5BNFA 3AR7A 4D99A 4ZO9A 3FZEA 3L1JA 1DC7A 4HWPA 5E9AA 1U0BB 3N6XA 4MHOA 1L7RA 3M81A 3GJYA 4PZCA 4UUQA 5CUQA 2M2IA 3IVGA 1Y1LA 3RSQA 1T0PA 4DQVA 1KYVA 2H1FA 1TCCA 2EAUA 3BMOB 3L7BA 3WHPA 2WD8A 1KA9H 1L9KA 3F78A 3T54A 5I47A 3TINA 3Q6NA 2I8CA 5KQGA 3S1SA 1JKMA 4YQZA 1LPSA 1S1CA 4PBTA 2PRJA 3QWFA 3AVYA 3L7KA 5D5QA 1I13A 5AWFC 3N8IA 2DCMA 4LGMA 4AJ1A 4NX2A 5LQDA 2ODWA 4L57A 1XP8A 2FRVA 5FPPA 3BXZA 2R6JA 1MVLA 3E9QA 4J1QA 3PLNA 2VWHA 1VI2A 4ZEMA 3RS2A 2W98A 2WSIA 3AC0A 3MGGA 4LQ4A 2MU1A 3S2GA 3R0IA 3HFGA 2ERXA 3UM9A 2CXRA 4RVCA 1EHIA 5KJCA 4DJEC 2I4MA 3VH2A 1XROA 2O20A 1XNGA 5IAKA 1FXSA 1RQRA 2FB9A 2FDXA 3PEFA 3WQSB 4C22A 4F5YA 3W5CA 1D4FA 2BSXA 1YO6A 3EW7A 4PINA 3CLRC 5K3DA 4R31A 5DWVA 4CLHA 1OAKA 2FCRA 3FPAA 4QVIA 2BYTA 1SHUX 1FF9A 3G5LA 3A4VA 3IAS6 2F55A 4PSVA 4HQRA 1ORWA 4RCVA 4C0AC 1EJ6A 2QN8A 3UC5A 1VA5A 1H94A 3AHJA 4CM5A 2DYKA 4Z0NA 3THYA 2Z6QA 3MC1A 3JR7A 2GPBA 1EUQA 3JQPA 5IABA 2FW1A 1X8JA 4EFKA 2AYXA 4MV3A 2FFJA 3EGVA 3GCWA 3E5NA 5FTWA 4CM9D 2FEKA 2P0YA 3PNMA 4EH1A 1SC9A 4YV1A 5TV2A 1R7RA 4DTIA 5DM4A 2NT3A 3RRXA 1Q91A 2C8KA 1SN7A 1BXZA 1EUZA 1PT8A 2OQRA 3BS4A 3GZ4A 1NBHA 3QLUA 2CW5A 3VPFA 1VRVA 5F23A 5IF3A 3CRMA 5HSGA 1Q74A 1GQOA 1MZVA 2CLLB 3AEXA 5TARA 1JQJC 1TZBA 1Q12A 4E5DA 4JQSA 1ABBA 4GOND 4DIUA 4ARZA 4BQFA 4GLBA 1QVAA 1W5FA 2OGWA 4LNHA 3TIFA 4GVPA 2CXXA 4FXPA 3SBXA 2QT1A 5CFZA 1VKNA 4DNQA 2DHRA 1USGA 4KEAA 5D84A 1V3UA 2QN3A 1MRZA 4PIVA 2GAOA 5L6MB 4MTCA 5T8KA 3FTEA 3KRTA 4D9GA 1C3OB 2C2WA 2AUNA 3RSFA 8GPBA 4MLCA 1G18A 4HH3C 4X1OA 5ALLA 1INLA 2ZRGA 2AW5A 1JU9A 3HDVA 1NKTA 5ALOA 4BCDA 3UOAB 2D8MA 3D6NB 3HWWA 1QNLA 3O8LA 1T5IA 2X2FA 1N5DA 2V96A 2Q3FA 3WRYC 1PNQA 2XXAB 2QTLA 1DGQA 1G38A 2GTIA 3NHSA 1IPHA 1OI2A 3IXMA 3ESRA 2PUJA 3WZ2A 4ZZ0A 4L5YA 1JE1A 2P6NA 3E84A 5DNUA 3P8ZA 5M2QA 2XDYA 1KJ9A 4LJRA 1S8AA 2R5WA 1O1YA 1GNPA 1E92A 3M6AA 2G9QA 3ZIAA 4Y98A 1N5RA 4IV0A 4IUYA 1TCVA 2NSYA 1ZU5A 2QSJA 3CKLA 4AJHA 2G5PA 2Y77A 4UMFA 1M1YA 1OBVA 2XXBA 1Z0UA 1TTTA 4DM3A 1D5WA 1XU7A 3K32A 3T9AA 1IY0A 2W6PA 3HABA 1OMOA 2B1JA 3RASA 4IIDA 2EBUA 4V3CA 2GDJA 5IHXA 1MTZA 2OWEA 2Z3ZA 5KTNA 2BCJQ 5I7AA 3KHTA 4EG7A 4YDQA 1SR8A 3KKNA 2I2AA 5KKAA 1QCDA 2KBEA 4N6NA 3RVKA 1BCRB 4MA0A 4KLNA 1AHNA 1I2AA 3OWOA 5BSHA 5KPJA 3OTIA 5E2AA 3AILA 1ACMA 4D8UA 2PX2A 2FP3A 2WEKA 2WICA 1GPLA 3VKFA 1UBFA 2B36A 1GTZA 1RRKA 2GPAA 2IW1A 3D81A 5DTMA 5BV7A 4ZDKA 4RK5A 1DT5A 1Q19A 4I5EA 2DBYA 4UW9A 1B93A 1FDUA 3X0DA 4G65A 3SJBA 3T7EA 2Q21A 1SEPA 4M9SA 1ZC3A 1QCYA 3QXJA 4HYYA 3W5JA 2GH1A 1PDVA 3IP1A 4HGYA 4BKRA 2O3QA 1YVRA 2R85A 2O0KA 2W8ZA 4XASA 4EJFA 5BSWA 5JR3A 3VMMA 2JCSA 5IKXA 1WO8A 4HB2A 1TUGA 3QITA 4WK2B 4DSOA 2VQDA 2GM3A 2VRWA 1P5RA 2IYEA 3BJEA 4IXMA 4ZOBA 1JQLB 1LV8A 3ENQA 3DKPA 4U7TB 5D3QA 5JSZA 2FSPA 2HJ9A 4C1BA 3WXBA 3M4YA 5HX7A 3IR6A 3WDLA 1W49A 5I01A 1EA5A 1XTQA 2PMWB 3C1TA 4FHDA 4CU5A 4CF7A 5EJ5A 3JZDA 1JUDA 3ED5A 3RIXA 2QLMA 3H4VA 2NQ2C 1GNTA 4KN6A 3W2TA 1GR1A 1Q11A 3FSGA 4ON9A 5JNUA 4I9NA 2JHGA 1BYIA 1SC3A 2QS9A 2X4IA 2JJ2A 4OK3A 1GN8A 1GGJA 4QHTA 3RUIA 5J2UB 3U9SA 2CL5A 3COJA 1W52X 3BMNB 3KTDA 3RNOA 1N8SA 2PZLA 2NU9A 3RUEA 1H9BA 3C7DB 3ZGXA 4MCAA 3Q7RA 5BN5B 2GTHA 3JYLA 1E1QD 3IERA 4L15A 3RGWS 4IHJB 1VJ0A 4QXRA 2MSDB 3AJEA 3NDBB 1DBPA 4LOJA 4RD2A 4Q7KA 1UFVA 2B7CA 1BA3A 2ONKA 3BKXA 3KB8A 5HR5A 1QIHA 2ZAYA 2JS7A 1QFYA 1G2QA 2J6IA 4WK4B 2VPXA 2VPZA 3VR6H 4AD8A 2R1TA 5KNDA 4BX8A 4W5OA 1EWVA 3NCTA 2PPLA 1G8FA 1NW7A 1CVIA 1GUAA 3MWKA 3EXEB 4P84A 1JEYB 3ZE9A 3KHKA 3EB9A 2EGUA 1JVBA 2WKQA 4U8GA 3A3NA 1EIZA 1KO4A 2L17A 1QH0A 1NVXQ 2E4UA 3T1YB 1BSVA 2ZBPA 3DTYA 3I8OA 2WJPA 3DMPA 2C2YA 3FSJX 4N47A 5CDFE 3HEAA 3SXUB 4NYIQ 5JSYA 2AZMA 4N0PA 2I1QA 3EIWA 1QPGA 1WVIA 1G8AA 3DBHA 1XD2A 3UF0A 1QG0A 1YJXA 1NJ5A 2C0PA 2Z2JA 1GSOA 3OZGA 5IFLA 4INZA 3WGHA 2Q3MA 2HU8A 4LY3A 4BATA 4Q3LA 1P2SA 1ZUNA 4CDRA 2WJGA 4DQLA 1JHUA 2JFHA 2ODNA 4QPZA 4RJ2A 3GLVA 1A82A 3DEIA 3T35A 2YJ3A 4DC1A 3B51X 5DTQA 4EPXA 4YUAA 1D1PA 4C2BA 3KETA 5KSYA 1UP7A 4OB7A 1YVPA 3C5WP 1C3VA 3MT8A 1X8KA 3LCRA 2NZUG 5IDVA 1KZHA 1KJ8A 4UAGA 1WB4A 4CG0A 2V9CA 1QOPB 1AZSC 2A5DA 2F3PA 3OEEA 2I6XA 3L7OA 3E18A 4XUCA 3FCXA 4ZQCB 3ZQ6A 5HM6A 1E1YA 1QQ7A 4EW2A 5LP6A 3GLHB 4LXIA 3U6BA 1EPUA 1DQNA 3ROZA 4OATA 4BFUA 4YQEA 3R3XA 3AUUA 3ZY4A 5F35A 1SXJB 3MJRA 1A1SA 1NZFA 5D3MA 3T12A 1Z5WA 3F7OA 1SKBA 2RGAA 1OYWA 4U7JA 1SO8A 3TPCA 2O05A 3H99A 3JQCA 3A1FA 1TMGE 1R10A 2VO1A 2CVPA 2GILA 1I4WA 2NLOA 1K7SN 2BPOA 2WUEA 1UCFA 3H2BA 2E1RA 3JPWA 3B36A 4XJSA 4ZXPA 2YYYA 2G5GX 1XZ8A 2BIFA 4BKMA 2ZXFA 3K70C 3HJGA 2PT7A 3ANYB 3IOYA 1L4HA 4HWKA 1A96A 3TNJA 1E7MA 4MKHA 1COWD 2NO1A 2VNKA 1OWOA 4AKHA 4XUDA 3ZX4A 2DUWA 1DS6A 1EDOA 1NMQA 1XVTA 5TF0A 1C7EA 3S4YA 4KQCA 1GUZA 3JWEA 1H0HA 2C5FA 3DEHA 1CEXA 4R1SA 2XITA 4UDOA 2AG5A 1R4NA 5D51S 4Y3UA 1KMHB 4O0MA 4KQMA 4C2AA 1EG2A 4QLOA 1WL8A 3B6MA 3FWPA 4EJ0A 3RT1A 4TYPA 3DNPA 1PEAA 1QGUA 4EMTA 1TYBE 4FDTA 5L3VA 2J4CA 1T9DA 2C0QA 3OX1A 4I50A 5F1OA 3MINB 4FBMA 4JI5B 4DXDA 4PBSA 5KHLB 2XMZA 4HKTA 4Y6RA 3G49A 2FX2A 1C9NA 1TD1A 1Z83A 1Z8FA 2AJ8A 3VH3A 4NCAA 2JK1A 3CF6R 2I76A 1HG1A 1NI4A 1T2VA 4Z9XA 3BUSA 4G5YA 4AX4A 3DPSA 3LZDA 2EBFX 3DP9A 3K3PA 5JNRA 3RV4A 3UCXA 1RKVA 2HDOA 4LOHA 4BPBA 3DXXA 1I7NA 4FZ3A 1VKOA 2XCLA 2P79A 3FRJA 3QNUA 4X6XA 4MS1A 2QRKA 4MRVA 3T7JA 5BYKA 1VMAA 5BQOA 1A5TA 3P2JA 2IWRA 1IBKB 4KR7A 3K15A 1UKAA 3MIZA 2WSSD 1KIFA 2GEKA 4J43A 1WAMA 1H23A 4IDNA 4IO1A 2DH6A 2ZJ3A 1K4KA 4IYJA 2I7XA 1KEEB 3LUFA 4PO9A 5EESA 4NAVA 1NYTA 2G9VA 1U5BB 4LDPA 4KUEA 1UQUA 3PC4A 4MQUA 2OO3A 4I6JA 3LPMA 1V6AA 3X1XA 4ALJA 3VU9B 4FIDA 1ZEJA 3U3MA 3O3NB 1ZBDA 3EQZA 2JVIA 3Q40A 3BE5A 1BHJA 3IHKA 2FKAA 4RHEA 1YZNA 3NTXA 3MB5A 5SYMA 3GFTA 2B6NA 4IJWA 4D9HA 4KKVA 4L4XA 2WUFA 3IAUA 4DPMA 4XQCA 1CRPA 4FE7A 2N75A 2UZAA 3P1JA 1LBHA 1FTGA 3TL2A 4FGLA 1XZFA 1A7UA 2QM8A 1XNHA 1NSYA 2X8AA 2YHAA 2Z3VA 3DOIA 1U9YA 1X7DA 3VR1A 5B3JC 4DGQA 1SD5A 1LDNA 2PGIA 1QGOA 4DLUA 2C92A 3GVCA 3GLIA 1YOBA 4GZ5A 2PM8A 2WLSA 2ZAIA 2JGLA 2AMLA 4YACA 5BVHB 4XQGA 1U81A 3L04A 4C7XA 3OTOB 2JAHA 1SUDA 4I9HA 1VXRA 3PHJA 2FDCA 3EULA 4A5OA 1R0BA 4N5IX 3OSZA 3DMFA 4FJ1A 3L2OB 5ED0A 5IC5A 4EKDA 1S89A 3KVOA 3W6ZA 5HIAA 1HE5A 2D2XA 4IEEA 1GVHA 3BE6A 3U62A 3RI3A 5DM60 1Y3FE 4KIGA 3HMKA 1F60A 1NX9A 3ZWOA 4D02A 5JXHA 2YZMA 3NR2A 2IP4A 3EUFA 4OXXA 4UMEA 1TAUA 5DHPA 4D8VA 3GPLA 1QGYA 2O06A 2OCKA 4KIUA 1G5QA 3N86A 3CWCA 4REQB 1A88A 5JYEA 2RSLA 2FZ5A 3DKKA 1EFRD 5DM0A 2QY9A 1Z38A 2PZGA 4DTCA 2ZR7A 3PDJA 3C74A 1YFKA 1SIBE 4H7PA 3DV0A 4Q4JA 4P5DA 2AZXA 2JIOA 4B6FA 1KI7A 3HJUA 2XIJA 1NUSA 1YU9A 3PGJA 4L7VA 2Z8YA 3COWA 2YN4A 2QAGA 4C2UA 5A9SA 4FPXA 1OLXA 4PYMA 2OM6A 1NSFA 5ER9A 3FNRA 4GGMX 3Q88A 4JB3A 3KYBA 3FH0A 1IJEA 3QV2A 3HJAA 3ABIA 1OGJA 3K09A 1SU8A 3EZGA 4Y6GB 5ESXA 4BJHB 2PLNA 2XRMA 1GYQA 5CFQA 4JI8B 5F4BA 1OXXK 1XFDA 1PZMA 3SHOA 3QA3E 2IS4A 1Z4QA 2CV1A 1BS9A 5BMVF 3D3WB 1AOXA 2NU8B 1KMHA 3WLHA 4DWJA 2I62A 3GI1A 1ZNYA 3PNPA 3C3MA 5CVTA 1YJAA 4KLCA 4A7PA 2G4LA 4F84A 1WDWB 4FDAA 4NZNA 1NP7A 3MINA 4J0HA 1Z62A 1QYVA 4JNKA 2HTFA 1ORVA 4YJ3B 3R77A 5FBQB 4JUAA 3SNHA 3MG9A 4MI1A 5U9CA 1QYXA 1AHPA 2Z30A 3D54D 1CD5A 1QVRA 3KXKA 4JT2A 3RWMB 2I7VA 1C9MA 4LJ9A 3HI4A 2Y1LA 5FQNA 2DVMA 1PN3A 3WGVA 5ALPA 4CQMB 4E3ZA 3GLKA 4ZEVA 1UZUA 2UYHA 4CQNA 4RIEA 5CYOA 2KWIA 4EAAA 2CK3D 2DTDA 3GDFA