4D0GA

Structure of rab14 in complex with rab-coupling protein (rcp)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
b'YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGLERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED PROTEIN RAB-14
publication title Structure-Function Analyses of the Interactions between Rab11 and Rab14 Small Gtpases with Their Shared Effector Rab Coupling Protein (Rcp).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4d0gA01
1XD2B 4Q4AA 1M2OB 5C18A 4WVFA 3N2EA 3K1JA 5SZHB 1LV7A 1EESA 2QL6A 2V54A 2VRWA 5FR1A 3LW7A 1AZTA 3W34A 2DFNA 1SVIA 1LFDB 2IHBA 4C4PA 1W4CA 3QXSA 1OHHA 5IHPA 2XAUA 3RS0A 2ZU0C 5FOVA 3RS2A 1P2TA 4IDQA 3OIVA 3QJYA 2AK2A 3DVLA 4DIEA 1VHLA 1VYVA 4KFSA 5A0FA 1KDRA 2VHTA 3NH6A 5FBVB 2P5SA 1X8JA 2FEOA 1TX4B 3H1TA 1TEXA 4M53A 1DAIA 2NGRA 2CNWA 1CRQA 2P65A 3EZ7A 3CPJB 4B47A 1VCIA 1E0KA 1RIFA 1N6LA 1G5TA 2B6HA 2F9MA 3Q9LA 5FI1B 1S3SA 2IWHA 3UIEA 4BFSA 3L0PA 4B34A 4B3CA 2KI5A 4V0NA 3X1YA 2C5LA 5F2EA 3VR2A 2F43A 2IYUA 3QF7A 4LC0A 1N6NA 2FPKA 1GKIA 1LVGA 3VNUA 4CVNA 2PT7A 2EQBA 4CDGA 3HJNA 3RS4A 2AFIE 1ZINA 3FYHA 1SXJE 4LGMA 4C2UA 2V7QD 1GITA 1DADA 1U99A 1T6NA 4JT4A 1TQ4A 4BFVA 2WTUA 2QGNA 5FBLB 5BN5A 5BN3A 4IEIA 1AS3A 1ZVQA 1T8UA 5KSOA 3W9YA 2GJ8A 4HAVA 4FIDA 4LCBA 2FJUA 4P4TA 4BLQA 4IDOA 3OE7D 3DDCA 2QUZA 3NBFA 3O8BA 4HSEA 1IOZA 5FTKA 1AJEA 4JL6A 1E0SA 1CLUA 1RE0A 3LBHA 1J90A 1E9SA 1KTVA 2QORA 2PLFA 3LAWA 4HAYA 3AM1A 3QQ5A 1M7HA 4LHVA 2IT1A 2O8FA 1Z83A 3TGPA 1N6RA 2AL7A 5LBIA 5LD2B 1BO6A 5FUVA 3V9PA 2FNAA 3HDTA 2E87A 1CR2A 2CHGA 1DAEA 3C14C 1KHTA 2JLQA 3FHOA 2QP9X 1IHUA 4YMSA 4AURA 3B1XA 4ACAA 1YR9A 3AVQA 1VDZA 4I81A 4TLBA 2IUUA 1KO4A 1KO8A 2V1UA 4HAXA 3TMKA 1EFHA 3B60A 4C7OB 1BYIA 2GWHA 1IM2A 2RCNA 4JZKA 1UKZA 4XSGA 4AWXA 4KYUA 1L2TA 5KDLA 3RWOA 4US2R 3MLEA 1KK3A 2C78A 1LNZA 2WJVA 5IF9A 5KPJA 1Z63A 2REBA 1NMXA 2W00A 3A1WA 3H0KA 4QXAA 2BWJA 3LLMA 2C04A 2KSQA 2LWIA 2W6JA 1Z0FA 2P6UA 3OAAA 1KI9A 1XZPA 1R5OA 4TYWA 2F7SA 1OV4A 2NO0A 4AYWA 3FHCB 5FOUA 4BFYA 2RGCA 2QMHA 2WZQA 4KFRA 4Q4JB 2UKDA 3PEWA 4RD3A 2IYSA 3VR3A 2C99A 2H57A 3RLFA 5GJBA 1NY5A 1YQTA 2BMJA 1XDBA 4G5OA 2BV3A 4EJSA 2DYKA 5A5GA 2FFQA 4MKGA 2MSCB 3P20A 1JAHA 2FGKA 2OFOA 2ZSBA 4JL8A 3FTQA 1M6NA 1YR6A 1XJCA 3LXXA 2WVJA 1Z8FA 4US0R 2ZRMA 5FTJA 4EFMA 4NBSA 4N1AA 4LYAA 4IFEA 1E6CA 3DZ8A 3QOFA 1UDWA 1E2MA 1VHTA 1PVOA 1G19A 4URXR 1B0UA 4IOKA 1G3UA 4I4LA 4JLKA 1U0HC 4GP6A 1RPZA 4P4UA 4Q4HB 2O5VA 4QGGA 2QP4A 5GVRA 4F4IA 3BXZA 2NMVA 1YVDA 1AIPA 4TMKA 5D3MA 3CNOA 1E4VA 2R9VA 3L0OA 4PTLA 3K0FA 4EIWA 3L0IB 2JA1A 4Q4HA 2YWHA 4DLUA 2IS6A 4QBHA 2JLSA 4ILEA 4DSNA 4XSHA 2CCJA 3LWNA 3SBEA 1I4LD 1FNMA 4V0ME 1E2IA 4DDWA 1A1VA 3BOSA 2JDID 4KLNA 3K70D 3QVVA 1GSIA 2WIBA 2J0QA 5CIQA 5B2ZA 2WPDD 4URWR 2RGBA 4ZDIA 4B3FX 1W5TA 3PEUA 4ESHA 4B3DA 1E9DA 1UPTA 1JB1A 3BS4A 2FSFA 3ASYA 1KDPA 1UFQA 2B92A 5FTMA 4JIMA 4PC2A 3SYNA 4WOPA 2G0NA 3L0SA 2FV8A 1XMSA 2OAQ1 2ZIAA 2ANBA 3OHMA 3NIBA 4EKDA 5EJEA 5F3WB 3MWYW 1HYQA 4XD7A 2GCOB 2OCBA 5GADl 4F4CA 2BJVA 3B78A 4QNRA 5J5CA 1H8HA 2CLCX 3HP1A 3RAPR 4E03A 1ZW6A 3GFPA 4KU4A 5K8LA 2UVQA 3ZH9B 1MO4A 3QKTA 1WF3A 5LDDC 2HEIA 1N6IA 4JJZA 1KI6B 1ETUA 1WBBA 3CPHA 2GDJA 3VAAA 4L4UA 3K9HA 2Q9CA 4AKEA 4PZZA 4DCNA 1ZM4A 3LO5A 3QIAA 4ERNA 1QG4A 3KTAB 5JSZA 1SHZA 4PHHA 1CULC 1N3BA 2XJ9A 4WZ6A 1KI6A 4V0OA 4CEIB 1N5JA 1HT2E 2SHKA 1I2MA 2E9SA 4QL3A 3Q8XB 5KDDA 2HT1A 1MO3A 1UAAA 3WYAA 4YXWD 5J4LA 5EP2A 3NTUA 2X77A 2GJKA 3HU1A 4MRSA 4MRRA 1J8YF 2GCPA 3NXSA 2B21A 2BEJA 3CRQA 4U00A 4LRWA 5BWMA 1T8TA 2A9KA 4URUR 4BQSA 2YYZA 4RD0A 3N70A 4KVGA 5CDFA 5HKKD 2Q6TA 2ZXUA 3SJBA 3IIMA 4JBWA 4L9SA 1RW4A 3SI7A 1NKSA 1GTVA 4Q18A 1TQ2A 1Z6GA 3U7HB 3ADKA 2ZAOA 3KXLA 4POAA 1N6OA 1M1YE 4Q01A 1P9WA 2VSXA 4QM6A 2FSHA 2H7VA 4JKIA 1OLOA 4LSGA 4JYCA 3EXAA 2IYTA 1QHHA 1P6XA 1XTQA 2CK3A 1G6HA 1XEWX 1G17A 2BMEA 1V43A 2WM9B 1VG1A 3SYLA 1QHXA 1OH8A 2WIAA 1IN8A 4X8HA 2MSDB 4AYTA 2H92A 1IXRC 5EXXA 1YRAA 3VR1A 4IXMA 1JR3A 2V4ZA 4HI0E 3DM9B 1HH4A 1Q3HA 1OXXK 3LW8A 1TUEA 4A2WA 4NE2A 3PUWA 3LDAA 2FA9A 4G5GA 4IJMA 4JYBA 5H68A 3C15C 4W5WA 1EFUA 1NMZA 3M6AA 3PUZA 4YDHB 5L8VA 5FL7D 4CEJA 3JVUA 3J81k 1N0VC 3FOZA 2CMKA 2GK7A 3AP2A 1F48A 3CH5A 4JSYA 2OXCA 2ORWA 3KX2A 5K8IA 4DLRA 2JLZA 2J87A 5KPDA 5AJVB 1Q1BA 3L43A 2QPOA 4J0QA 2A78A 2O0HA 2JCSA 2G0TA 3TBKA 4Z54A 3R7WB 1NVWQ 2CHVA 3W6NA 2ATVA 1EX6A 4DUGD 2VH5R 3B1VA 5P21A 3ADDA 2OSBA 1HA3A 5LD2C 1QHGA 1Z2AA 1Q57A 1U0JA 1G8YA 4H1UA 2D7DA 1G3IA 3VU9B 2F55A 4MGYR 3I61A 2D2EA 3SR0A 4IOMA 2GHIA 2W6IA 4JLDA 3ZD7A 1GL7A 1EK0A 3IO3A 2N42A 3OE7A 1ZUNB 2EYUA 1EFRA 2RAPA 4C0QC 2A2ZA 2GJAA 2WJIA 3AF4A 1AA9A 4Q03A 3REGA 1F60A 3TUJC 1MT0A 1Q3TA 1OHHD 3EWSA 1HEIA 2J9RA 4QBFA 4QG7A 4C0LA 3QVUA 1S9DA 2FH5B 1GP2A 4PO9A 2LKDA 3LQRA 4RY2A 4B74A 5C2JB 1G7CA 2FFHA 1VIYA 1F6BA 2CNWD 2D62A 1GILA 5SZKB 1UDXA 4F7WA 3AVVA 1AN0A 2CCGA 1YR7A 3HU2A 1ZUIA 4M8NE 2NOAA 4EJSC 5BQ5A 2HCJB 2IEYA 3ZYCA 3FFBA 2WMNB 5DIFA 1PLKA 1KKMA 3CH4B 1FMJA 4KI0A 3TVDA 3EZ9A 5GJCA 3EWAA 1CKEA 4LX0A 1C4OA 1XPUA 3NC1C 1X86B 4NZYA 4W5HA 4PPQA 4MA4A 2VP6A 2FMXA 2QT0A 4IHQA 2HXSA 4ZCIA 1OE0A 2OESA 3KQUA 2YWGA 4NDZA 4M0LA 1QF9A 1G5PA 2QA5A 1XCGB 4KAXA 4RFSA 3ZIAD 4LBWA 3SDZA 2GA8A 1X1SA 4LV8B 4PHFA 1IBRA 4GDFA 3AKYA 4G1UC 3AF3A 1E4YA 2OG2A 2VBCA 3P4YA 2CLSA 3IHWA 3KKQA 1E9BA 5KSPA 4F38A 1Z08A 4TYQA 3UK6A 1K5GA 5FTLA 4A0FA 3PV0A 3L82B 3K9NA 5JEEA 3NHAA 1FNNA 2CE7A 3QENA 1BMFD 5JCPA 3U44B 1RVDA 3HPQA 1GM5A 1O87A 4C9BA 2QGZA 3FKSA 5L3QB 5AUOB 4CT4B 1NN0A 3SQWA 1NLFA 4AKIA 1CR1A 5GVSA 2AXNA 4UJ3A 4HUQA 3GLHA 4D0NA 1J7KA 2V1XA 1D2EA 2CL6X 4DLZA 5L3QA 1M34E 2IEZA 5JJKA 4OQNA 2VO1A 4PHGA 1GVNB 3FVQA 1HY3A 2AD5A 4JLJA 1KNQA 5ELXA 4ARZA 2BEKA 4UNPA 1IY2A 3FFAA 5UKDA 1FTNA 4Q1FA 3U6BA 2CJWB 4DB2A 1XZQA 1TAGA 3VKWA 4QFMA 2W2TA 4JS0A 1G8HA 4P32A 4QM7A 2KJQA 2NZ8A 3O8RA 1ZM9A 3B7GA 1G20E 5E7MA 2CVHA 4XOIA 2D7CA 1OB2A 1NBMD 2GAAA 4LI0A 2JDIA 2CLDX 1VG9B 3GLFB 1E9EA 2WPDA 3QKRB 5HE9A 2C98A 3KB2A 3A4MA 5DN6A 2WWXA 4YONB 1CIPA 2ZJOA 1GG2A 2W58A 3M4YA 2W6JD 4QJ3A 1JBKA 5AUPB 3GLFA 2P5TB 4OHZA 1T9HA 1G4UR 2R6AA 1KKLA 5TV2A 4PQRA 1W36D 4URZR 5FBWB 1XP8A 1U2RA 2GJ9A 2GXAA 1C1YA 4JKYA 3FHTA 2GEDA 1M74A 1TU4A 2VSFA 1W4AA 3T61A 3ZJYA 1F2UA 3KKMA 1XNJA 4AYXA 4BFWA 2ZS8A 2C77A 2VHCA 5DSZA 1G64A 1OSNA 1UBEA 2V9PA 4A8JA 1G41A 4EPRA 2Y8EA 1DARA 1JQJC 4HDQB 2XB2A 1W7AA 3RS3A 2WOOA 2NPFA 3KKOA 5IK2A 4B75A 4RZXA 3KKPA 3MSXA 3GLGB 2A3RA 1I2DA 2H8KA 4OJQA 5HCNA 5FPSA 4WXPA 5C4GB 4OI1A 5AJWA 2AK3A 5IRCD 4F92B 4MYTA 3GLGA 4OQXA 3K0AB 4V0LA 5JMTA 1OPXA 4FI3C 4U02A 4NCNA 1FUUA 3BFVA 3M0EA 2KWIA 4LK2A 4A36A 4MDFA 4JLPA 2D74A 2ONJA 1W4BA 3BH7A 4GP7A 1XMJA 2MSEB 2IHYA 4LOAA 4CT5A 2RHDA 2W83A 2YWEA 4U5XA 3THXB 2R65A 3IPXA 2BDTA 2Q9AA 1CEEA 4DCUA 1YKSA 4JT2A 1Q12A 2FSIA 5HKKA 5JBQA 4TL7A 4Q1DA 2O8EA 4D81A 3THXA 4TWZA 3B1WA 3MWKA 2G6BA 1R0ZA 4B35A 1I4TD 2KBFA 4FINA 4V03A 3TSOA 1LW7A 1YZQA 1G291 2ECKA 1ELOA 2BVNA 721PA 2XZOA 3EPLA 4ITRC 1VTKA 3KQLA 1Z0AA 4Q02A 1II0A 4PC6A 4DLWA 5JHHB 2F1IA 5AWFC 1TPZA 4ZCMA 1R8SA 2DY1A 1CRPA 4MYUA 1XB2A 3SEAA 4LZZA 3ZQJA 1UKYA 4MGZR 1W46A 4M1SA 2O8BA 1XTKA 1Z28A 3RYTC 2KB0A 1P61B 5F98A 1C9KA 2IWRA 1W2GA 1N25A 2CBZA 2GXUA 4FMDB 2Z0MA 1TF5A 4ZDJA 5CM9C 3PCRB 4NPHA 5CIWA 1E32A 1NIJA 2O52A 3LX8A 3SJZA 3A1UA 1MO6A 4TSFD 3U3JA 4OHXA 4LHZA 1VECA 4R71A 4WAUA 1FZQA 1XWIA 4I1VA 4R98A 3CRMA 4Q9HA 4CZ2A 3K0EA 4GMDA 3RWMB 3DMDA 4F91B 4HDOB 5SZJA 4B3BA 2F6RA 5H8WA 5HE8A 1GRRA 1SZPA 2W0MA 5JFGA 1YZLA 4C0KA 2HXYA 3P26A 1KK2A 4R9UC 2NG1A 4BLOA 4C2TA 2OCAA 3X1WA 4AC9A 3THWB 1Z3IX 4UNQA 2ZS7A 4DUGA 3LY5A 2XSZA 2WSMA 2BKUA 3CW2A 1CR0A 2GZHA 1Z6AA 4PC1A 4Q48A 1P2VA 2P3SA 2JLYA 4P4SA 1HE1C 2D2FA 2YC2C 4LPSA 3IDQA 2ZR0A 1CJUC 3MFYA 4NONA 2QPTA 3FMIA 3FDIA 4DCVA 1P9NA 4M22A 4A4DA 5L3SA 4IVRA 4URYR 4YC7A 3GFTA 4O2LA 3VHXA 5EXSA 4OK3A 4B2IA 1E1QA 4M9QA 4JVLA 4XVQA 2J0SA 2X8AA 3WHKA 2JJ8A 4D4MA 5FR2A 2FFBA 3AF1A 4IRUB 4A6PA 1UM8A 2CK3D 4C0BA 1R0XA 5JRJA 1DS6A 1NLYA 1XEXB 2CDNA 3RRNA 2YWFA 4V02A 1T3LA 1P9RA 4HUTA 1E96A 2C9CA 2ZRNA 2RGAA 4M21A 3TW4A 4B3XA 1JR3D 4GOJA 4NL4H 4C0JA 3ZVNA 3PITA 3EA0A 1ZUHA 1XEXA 1WA5A 3BD9A 3C41J 3GJ5A 4OJKA 1GWNA 2PEYA 4A0HA 1MKYA 4UNRA 1XD8A 2R6DA 1YRBA 4PPGA 5TB5A 2F43B 1P2SA 3WNCA 1RRGA 4A6XA 2V3CC 2PCLA 2VF8A 4KBFA 5H1YA 5BXQC 3GLIB 1KDTA 2ODBA 1D2NA 2YNMA 2QSZA 4FCVA 4IW3B 1XTJA 3O8DA 1TQDA 1T5IA 3TR5A 1GOTA 1H8EA 2ZUDA 4LPKA 5C1BA 1T0HB 4QGFA 1N0UA 2R8RA 4PR0A 2GILA 2NTYC 2OEPA 4YMWA 4B2PA 3GLIA 1G6OA 3D8BA 5LB2A 5K8UA 3B1YA 3SS8A 2J46A 1ZU4A 3BJIC 4FXPA 1UEIA 1LY1A 3EC1A 3ECCA 3U3RA 2ZE6A 2ZITA 1Q21A 4ZV4A 2QMOA 4TN1A 2ZI4A 2CL7X 2ZE8A 4JLBA 2JLXA 3AUXA 3WY9A 2WJYA 4RVCA 2QT1A 2WKQA 4RSGA 3AP3A 3ZIAA 1NG1A 3T1OA 3KXKA 3GEHA 3GP8A 4CRWB 3BFKA 3N2IA 2QRNA 3CB4A 4KSBA 2W6ID 1KIMA 3BWDD 4KSCA 2WOJA 4B3GA 1KI8A 4B48A 1EFRD 1NVUQ 2V8OA 5CDFE 4QBGB 3K70C 3B2EA 3H4MA 3Q5DA 2O8FB 1BMFA 1S1CA 1GRQA 1YZGA 3KB1A 3QBVA 1QDEA 4AK9A 1S4QA 1II8A 3NBXX 3WHLA 4US1R 1CBUA 1JXMA 8OHMA 4AKGA 5DHFA 3SE0A 3B6EA 4HYYA 1FL9A 1XTRA 2GTPA 3KJHA 1E2PA 1IN7A 4G01B 1L4YA 1N5KA 1PUJA 4DLSA 5DHAA 2H18A 3Q7PA 1JXOA 2QRZA 2PMKA 4CYMA 1OXSC 2EWWA 5CLQA 2XB4A 2PZGA 4BE7B 3E2IA 4DEXA 3RC3A 1KK1A 4OKSA 1N5IA 4DJTA 1QRAA 3KXIA 121PA 5D3QA 4XIGS 2DFKB 4A8JC 2RGGA 5DISB 3AH8A 3CM0A 4A2QA 4EPYA 3AVXA 1MOZA 1NBMA 2ODEA 3ZQ6A 3O47A 2VHQA 2OE2A 3PXGA 1FTSA 1NKTA 2AKYA 2ZVQX 1Z0IA 4MKFA 2IS4A 2J59A 4WA7A 1KDOA 3VHLB 3IIJA 4QJ5A 2IS2A 1NVXQ 1OYYA 1E1RA 1SHKA 1W36B 1ONBA 2N46A 2Q3HA 1W5SA 3WBJA 2GKSA 5G3YA 4X8OA 5SZIA 3JZMA 2X2EA 1X8KA 3QI2A 3H2YA 1Z6XA 4IDNA 2BIFA 4LHWA 3FE2A 4EJSB 4G5SA 2P67A 1DAHA 4H1VA 2EFDB 1N2CE 3K53A 4TTPA 4E5UA 3OFNA 2DWOA 5EXPA 4GFDA 3LBNA 3B9QA 2ZJZA 2Z83A 3SBDA 1ZP6A 2ORIA 2DFTA 3QF4B 1NLZA 4URVR 1AK2A 1VIAA 2CEAA 3CRW1 3LVRE 4R2HA 1ZRHA 4JLNA 3I8SA 4MUBA 4PPFA 3P1JA 2IC5A 4KXFB 3FKSD 3QF4A 5E7JA 3SJAA 3LA6A 2J3EA 4D0GA 1X1RA 4S2EA 4CEHB 3WYFA 3CNNA 3MJHA 1T5LA 4O25A 1JEDA 5D3MB 3K0FB 3VR6A 1G21E 1NI3A 4M1TA 4NCJA 2XXAA 1XTIA 4N0EA 2F9LA 3SZRA 5FTNA 3E70C 4CEHA 4NYMR 4Z51A 3D31A 2EFHB 4OL0A 3FMFA 1U98A 2ZJAA 2ZR9A 4NMMA 4I99A 4TLAA 4PHTA 3TRFA 1MRNA 1T0JB 1SVWA 3TUIC 3Q5EA 2ZRAA 1IN5A 2OT3B 1NF3A 1DAMA 3C7KA 5TARA 3WRYC 3B5JA 4PFSA 1KSHA 3GJ0A 2WJJA 5KO2A 2A5FA 3F8TA 5DN6D 2ZRBA 4NCHA 3BC1A 1DG1G 4LV6A 3T1TA 3T15A 2CCKA 1M7GA 3MAAC 4DEYA 4ZI3A 4Q7KA 1U8ZA 2PCJA 5TXGA 4RJLA 2XNDA 1WBDA 4TMVA 3W6OA 3N5CA 1R7RA 1YHNA 2A5YB 2GVZC 1D9XA 2D06A 5A4JA 3CIOA 1AGRA 1HUQA 2FF7A 3S1AA 4GZMA 3VR5A 1DAGA 1IJFA 4M9SA 3K0CA 2FG5A 4IVPA 5J4VA 2HDNB 3IQXA 2XTNA 4XTRA 1QVRA 5EP1A 2PL3A 1WMSA 3ZZTA 2WKRA 3AQ4A 4BFZA 5IK2D 1MO5A 2GXSA 2OO7A 1DAFA 5JWHA 1R8QA 3LVQE 5JSZB 2YZ2A 4Z8XA 3THYA 2AXPA 3CF0A 3SFZA 3LXRA 3ZGXA 2H17A 3NWJA 4WZBE 2ERYA 2QBYA 1E3MA 2IYLD 1AM4D 3WXMA 3I72A 2JJ1A 2VP4A 3AKDA 4DLXA 4TSFA 3FGNA 2W2VA 3RDPA 4DDUA 2JLWA 2P0EA 4Z1MA 1E2JA 5EQTA 3VFDA 2YV5A 4RFVA 1ZNYA 4F93B 2C8VA 1DEKA 4IOJA 4PSKA 1W0KD 5DO9A 3X2SA 3QXHA 1G7RA 1S2MA 4HZUA 1VCNA 1DTSA 4LJAA 4D6PA 3K9GA 3C5HA 1Z6TA 3IIKA 1KY2A 5FPHA 1HURA 1JAIA 4MRVA 1E0JA 1YZKA 4RZ3A 1SXJA 5FL3A 1XPOA 4HLDA 2PX0A 2O0KA 2PEZA 5IT5A 1IN4A 3EIQA 2RGNA 3K09A 3NHBA 3NEJA 4XWKA 1II9A 3VNVA 2V6IA 1QHHB 4A92A 2O8CA 2VPPA 1K6MA 1WXQA 3AEZA 2OLJA 3IQWA 2BMFA 2EYQA 2ZRPA 3R9XA 2H1LA 1G7SA 5DI3B 5E4FA 1JNYA 4TLEA 3GLFE 5DI9A 2Z5FA 5J40A 4MITA 4TT3D 3DM5A 1LF5A 2P6RA 2ZQ5A 1XJQA 1W4RA 5DI3A 2PLRA 3BB1A 4O0MA 1R0YA 3AVYA 3L8YA 4O2RA 4Q1CA 1R5NA 2ZI7A 5CB8A 4Q1EA 4CEJB 5AUQA 1UJ2A 1IXZA 4NYMQ 4L16A 1RFLA 1OH7A 5FOXA 5HR5A 2DR3A 3QPVA 3IEUA 1JQLB 3NKVA 4HAWA 4Q9JA 3UWOA 2J1LA 2ZRKA 2YINC 2QMEA 5FBRB 2BM1A 2FWRA 1X8LA 4TLCA 5FUWA 3BBPA 3PEYA 2ODWA 4KVAA 5F9HA 5EE9A 2DHRA 4KBGA 2VP0A 1GUAA 3T1QA 2IL1A 4GZLA 1Z2CA 3GLGE 5DE3A 1NNEA 3CRVA 3PUVA 5FOTA 1NY6A 1R4AA 1G7TA 1KO5A 4QJ4A 2JAQA 3KJEA 3W5JA 4ZKEA 2XSZD 2C03A 1ZNWA 2FDCA 2R62A 4HDCA 1G4AE 2YVUA 2IYVA 2AFHE 2MMCA 3I3SR 1A82A 3LV8A 1IJEA 1E9FA 3QEOA 3W90A 1NN1A 3U3OA 2A7QA 3H86A 4DIDA 3RC8A 2ASEA 2OFWA 1AQUA 1AKYA 2UZ3A 4FMCF 4TQAA 1ZCAA 821PA 3KQKA 2ZJYA 2XZLA 1X3SA 2ZTSA 1W47A 1YZTA 2GF9A 2I1VB 4TTQA 4DLTA 1E1QD 2Z6VA 3KZ1E 3Q7QA 3WYGA 1T3HA 3U7FB 3QXJA 3QKSA 4DZZA 4CIDA 1QHYA 3QKUA 4E22A 1S96A 2HJVA 3GJ4A 3WNBA 5FH9A 2FX3A 2HF8A 3GFOA 4KFUA 3U7EB 2QE7D 1RYHA 2GZDA 4MRNA 2PJZA 1W0JA 2RGDA 3VKHA 3GCGA 4EFNA 2FZ4A 3UPUA 3BGWA 2A5GA 4EFLA 4HB2A 3NEYA 5KDOA 1KZ7B 3GPLA 5EXTA 1P4SA 1TU3A 3H84A 1E9RA 1KMQA 1RKBA 4M1OA 1JJVA 1W36C 1DE0A 3FKQA 1XFAA 2FSGA 3CZQA 2FEMA 2OV2A 2WMOB 3D7MA 2ORVA 4UNSA 2DWQA 3TSWA 3A6PC 1XXHB 1I4DD 1YJ5A 1ZCBA 2VL7A 3VX4A 3ICEA 2EFCB 5E3HA 4D4KA 4TMXA 1KSJA 1H8ED 2G77B 4I1OA 4LYJA 3V4RA 1XXHA 3MUFA 3CKLA 3LD9A 3E1SA 1KZGB 5AUNB 3KKNA 4BUJA 2REOA 2VA8A 4XH9B 4EQ6A 3SQXA 3R20A 3L2OB 3IBGA 1V5WA 1A5TA 4V0MA 5EE1A 2ZRCA 1XEFA 4RFSB 1NP6A 4D82A 4HAZA 1FX0A 3U7GA 3A4NA 4D2IA 4A15A 4C0AC 4IVQA 1IY0A 4OHYA 1TNDA 1QHNA 3T06B 4G5QA 1ZU5A 1U90A 1PUIA 2E1RA 3KFXA 5HPYB 4JVSB 4A0RA 1NVVQ 1PLLA 2ZRIA 2VHJA 2FPMA 4YDSA 5BYKA 1M8PA 2HJGA 2FU5C 3QUSA 3CNLA 3MG9A 1L8QA 1GL6A 3RVBA 1GAJA 4HUQB 2NO7A 2OM2A 1NMYA 3GLHB 3TK1A 1VG8A 4I1SA 1ZNXA 1CJVC 4BLPA 1WDTA 1DAKA 1KAOA 4E09A 3WRXC 4ARZB 5FPKA 4WZAE 3NH9A 1OT3A 1ZD8A 3C8UA 3RSLA 1XEWY 4X8LA 1OFTA 1X6VA 4RD6A 2IUTA 2ZSAA 1KMHA 4WIAA 2B7BA 1FUKA 1DPFA 3IEVA 3IBYA 3MRSA 3IKJA 3Q72A 2G1JA 4IFBA 3K70B 3AKCA 3K0CC 1W2HA 2J0UA 3EASA 5JI2E 3ND9A 5FOSA 2ZPTX 2YHSA 2FOLA 1S0UA 3FMPB 3QNUA 2BJWA 3AV0B 1D6JA 4KCGA 5TMPA 1VPLA 3HPRA 4V0KA 1OXVA 4DCTA 4Q7MB 5J4HA 3KJIA 2AN9A 4NYJR 4NYIR 5H70A 1JPNA 2WHXA 1TL7C 1ZAKA 1R2QA 2H16A 1JR6A 1E1RD 2NO1A 4NH0A 4OQMA 1VCOA 3PUYA 3MJRA 1BYUA 4MYHA 4GSYA 2ZYVX 5AJZA 5JJIA 3A1VA 1J2JA 4XJXA 5F9FA 3B82A 3QG1A 3GLIE 2IF0A 1F2UB 1FQJA 1E2HA 3B9PA 1LTQA 1MABA 5JHGB 5LB4A 4Y0AA 1SQ5A 4JLAA 4M1WA 3DKVA 4A8JB 2EFEB 2BCGY 3WMFA 2QU8A 2CVFA 3OFND 3TVTA 3ZS8A 4F4JA 1P75A 5DYGA 3R8CA 1PLJA 3W6PA 1GNRA 1US8B 1XCMA 1E9CA 1ESNA 4LJ4A 2WSSD 4PC7A 3TLXA 2PBRA 3PEVA 3B13B 1IQPA 2QPAA 4RCZA 5J4YA 3A37A 1U8AA 3K9LA 1N6KA 1SXJC 2ZI6A 1OF1A 2AR7A 5JJLA 1US8A 4LJ5A 1OB5A 1R0WA 2QAGA 2ZSDA 1IXSB 1ZJ6A 3K09C 2RGNC 1GL9B 3UG6A 2J45A 5EP3A 3TJZA 5AK0A 4DSTA 1FMLA 4PC3A 4DSUA 4Q1AA 4I1UA 5CYPA 1S9HA 3SYKA 4C30A 3AGQA 3CO5A 1RYFA 3KL4A 1VG0B 2XX3A 4W7SA 1T91A 2VP9A 1W44A 1WP9A 4BGDA 1RZ3A 4GRAA 2EFGA 4MKIA 1W0KA 2WBLC 3PUXA 5TDHA 1JEEA 2EU8A 3UKDA 2PZFA 4JLOA 2QZ4A 4DXAA 1N0WA 1OKKA 4TMWA 4OBEA 2GJSA 2O8EB 1OJLA 2GRJA 2NZJA 5CYOA 2A5DA 2DBYA 3VX3A 2YKGA 5LPNA 4OK6A 1A2KC 1CJTC 2IW3A 3MWJA 1ZC4A 2IYWA 4ZCLA 1BS1A 1XTSA 4S35A 1NJGA 3OZXA 4HZIA 3V00A 4LHYA 3PENA 1E99A 1W1WA 2AD1A 3GJ3A 3UATA 5J4KA 2XNDD 2FGJA 2ZRJA 4AG5A 3CUEF 4RD1A 4PSVA 4M1YA 3U4QB 4JBYA 3LNCA 4D80A 4M1MA 1SVOA 3EIEA 3BERA 4EPTA 2O8BB 3IO5A 3C4JA 4TT3A 4QC2A 3VR4A 1CF4A 3EIHA 3BIFA 5BN4A 4YMTA 3U4QA 3A36A 4OHVA 5JCZA 2YOHA 1D2MA 1E2QA 1QBKC 4R2IA 5GJVC 4DLYA 4B33A 3ONWA 2ZEJA 5JS7A 4DT1A 4TZ6A 4O3MA 2ZYWX 1NG9A 3VKGA 3QBTA 2JJ1D 2QMUA 5L3VA 3DKPA 3T34A 2GK6A 4P3YA 2Q3FA 5BYJA 2WV9A 5ANRB 1E2GA 1N6PA 1KI3A 3KUDA 1E2FA 2GBLA 2RMKA 4Z1MD 2VLIA 2KBEA 3T5DA 4P0TA 1CP2A 2J7PA 3G0HA 1FP6A 2ZS9A 4NYJQ 4NYIQ 3LBIA 4BASA 1Z47A 2P6NA 1OIWA 3M1IA 5CJPA 4QRHA 1U81A 4P4SB 4JLMA 1GNPA 2GVDC 2IK8A 3HR7A 2QY9A 3DZDA 3EPHA 3AVUA 2BHRA 2G83A 4Q47A 3VTKA 4D0LB 3NC0C 5L3SB 2BC9A 3TKLA 5GJWC 1SXJD 5EZ5A 4L15A 1RJ9A 1Q1ZA 2WWIA 1YZNA 1VCMA 1ZD1A 4ZKDA 3B1ZA 2ERXA 3OEHD 4BRWA 2Z43A 3AVPA 1EFTA 1L4UA 4W9MC 1FPMA 4BPBA 2AWOA 2QENA 4LJ6A 4M4SA 1OXUA 1FQKA 1XU4A 4TTRA 1TF7A 3TIFA 3KDSE 5G3ZA 3F3YA 3PG5A 3RRYA 4EAQA 3IUYA 2RHMA 2ZI9A 2QE7A 2Z4SA 4LBYA 2QAJA 1H65A 4FCWA 4C3ZA 2R6FA 4ZO4A 5JECA 1QVAA 2OLKA 1KOFA 1GRNA 1QHSA 1R10A 4GOXA 1DO2A 4TL8A 5EE3A 1B23P 2ZANA 3SJCA 3P27A 1XD2A 5EUMA 4M1KA 1UEJA 4KLZA 1Z07A 3OESA 1KSGA 4DBLC 2ZJBA 4LJ9A 1E2LA 3ZZ0A 1ZM7A 3WNDA 4B2LA 5KUTA 4H9GA 4MH0R 2HT6A 3BORA 2FE4A 4PXAA 1G8GA 3CBQA 5KHOC 1AQYA 3P4XA 2I3BA 2JJ2A 4RZ2A 3A1SA 4BLRA 1MR3F 5EUQB 3AP1A 3RABA 4YMVA 1LF0A 4HEJA 2HV8A 2PX3A 2NPIA 3EAQA 621PA 3QXXA 4TZ0A 2BBWA 3KQNA 4TYNA 1U0LA 3B8HA 4TLDA 1QHIA 2AKAB 4E07A 4LV5B 2WAYA 1D8TA 4IOLA 2ZSFA 2ZUBA 4OQFA 1P2UA 3PJRA 3ADBA 2GEUA 2VTKA 3EZFA 2VIIA 3NBZC 1E79D 2J41A 5CB6A 1YU9A 1HQYE 2VP2A 3QY0A 3SOPA 4B6EA 1II8B 3AB3A 4MQBA 4OYHA 5TY0A 3TE6A 1A7JA 1BKDR 1COWD 1KYIA 2OBLA 1KGDA 1N5LA 2J7KA 3IPYA 1FP7A 1XMVA 1XRJA 3L8ZA 1AS2A 1OH6A 1TF2A 1GKUB 4G5RA 1W0JD 4DWJA 3WP1B 1SVLA 1BOFA 1P3JA 2ZJ5A 4ZIRB 1KI2A 1S1MA 2RB4A 5JWOA 1EFCA 1Q1QA 2QQ0A 5DGXA 5FOWA 1NL3A 1ZD9A 5CJ2A 3OIWA 1CU1A 4JBXA 5BW8A 1GZSA 3AKEA 5AR1A 3TNFA 4ZIRA 4C0SA 3GJ7A 4UXHA 3REFA 4FMBB 2DB3A 1T3SA 1FOEB 1JR3E 2XOKD 2ZE5A 4HB3A 1Z6YA 3EA5A 2Q9BA 5B30A 4PAMA 4X8MA 2B8WA 1TQ6A 3CR7A 2K5UA 2QAGC 4JVMA 4Q7JB 4MYCA 1SGWA 3HYTA 1M7BA 3U3MA 4QBIA 3PQCA 1A2BA 2CL0X 4IKEA 1UBGA 1W49A 2I4IA 4FD2A 4OHWA 1Z0KA 4NKRA 3DEFA 3RNLA 2OFXA 1Y3AA 1KK0A 3BB4A 3OEED 3WBKA 3F5FA 1ZYUA 5DYIA 3AVTA 1MRSA 2JLRA 1CJKC 3QG5A 3AUYA 4TMZA 2N1BA 6Q21A 1CR4A 2BBTA 4IEEA 4MDEA 4C7OA 1XX6A 5B57C 2ATXA 2WSSA 3DMNA 2R6CA 5EE0A 3TSZA 3W5IA 4DSOA 2O0JA 5FPYA 421PA 4JSTA 4A1FA 4CGZA 3DL0A 1EWRA 3RRZA 2ZSEA 2C2HA 2VSOA 5KNDA 2XXAB 2L0XA 1G16A 1KI1A 2G3YA 3I92A 3IHLA 4WW0A 4QNMA 1ZC3A 3EG5A 4A2PA 4WXRA 3U61B 1SKYB 2JLVA 4GPTA 3GEEA 1F5NA 4HLQB 4LBVA 3SU8A 2ZI3A 4Q4JA 2REXB 3EZ6A 1K5DA 2LCFA 1OYWA 2NO6A 1ZNZA 4TYYA 1MV5A 2G1KA 4ZI2A 1WRBA 3A8TA 1L7VC 3CX8A 1XMIA 4BZPA 3BH0A 1G8PA 1KSFX 2LKCA 3GD7A 3U60B 2DCUA 3B85A 5KOYA 3BRWD 1KAGA 4RD4A 4EUNA 5K8TA 2ZYUX 1E2EA 4M9XA 3THOA 1UKEA 4KYIB 4AD8A 4TL9A 5TVKA 4Q7LA 2D4HA 3GEIA 3T5GA 3U5ZB 1NN5A 2J5XA 1MH1A 5DNYB 2KE5A 1DO0A 4PAQA 2Z4RA 2AHOA 1P7CA 4QKQA 1FW6A 3RS7A 1IN6A 2ZROA 1XXHE 5FBQB 3S1AB 2QG6A 5JLJA 1WQ1R 1WCV1 2GBLC 1UBFA 3LQQA 4KODA 3QEJA 3W3AA 4P33A 2JLUA 1KY3A 3LH5A 3SNHA 2O8DB 3TH5A 2A5JA 5HCIA 3HYRA 3O8CA 2PH1A 2ZRFA 3G82C 4UNNA 3V4FA 1Y63A 4JMPA 3ADCA 3JZAA 3THYB 1UADA 1ODFA 4PQFA 4AI6A 2O8DA 2QBYB 3X1ZA 5KNCA 4TL6A 2DFLA 2VYFA 4ASUD 4KITB 2HLDA 1VMAA 2ODNA 4DRZA 5M04A 4JJKA 2ONKA 2VEDA 5HZHA 3LFUA 5IDVA 3T12A 2IXEA 2IUSA 3UANA 2YJTD 5C4MA 2ANCA 4Q4LA 4EPXA 1Z5ZA 4NP6A 4BFUA 3FMOB 4HZUB 4FW9A 1G1MA 3A58B 4PX9A 2OAP1 2OUKA 2QN6A 3IILA 3GLHE 3MCAA 3GJXC 5B64A 2GCOA 5DH9A 4GMXA 1E98A 4DC9A 2QP3A 2GNOA 1RC8A 4UXJA 2BKEA 1SXJB 3AVWA 1NRJB 1OKKD 2R44A 4B76A 4FWIB 5KSYA 4MGIR 1SULA 1XCPA 4LJ8A 2WWFA 1BIFA 4W5JA 4MKHA 4DDTA 5CITA 2WWHA 2O8CB 4P31A 1RRPA 3KTAA 3OEHA 3DPUA 4JLVA 2WICA 2OILA 3CZPA 4CEIA 4EDHA 2C96A 2D3WA 4HLUA 4NCIA 3DO6A 2ZM5A 2PT5A 2JASA 2RKOA 3CF2A 2QM7A 1LS1A 3MWLA 1G18A 1NVVR 521PA 2HYIC 1XJ0A 2ZU6A 4GT1A 3ND8A 1FFHA 3C16C 5AJXA 2JIZD 4BEBA 1P5ZB 5L3RA 1JJ7A 4Q9LA 5JS8A 3UG7A 2VP5A 1O3YA 5CK5A 1HQCA 4KFTA 4OK5A 3I5XA 221PA 1DBSA 1XD9A 1E2NA 2XJ4A 1EG7A 3OIUA 1J8MF 1YZUA 4B44A 1Z22A 4ABYA 2GZAA 4NTZA 2G9NA 4LHXA 4CF7A 1Q1EA 4BLTA 5EZ6B 4Q9IA 2PMDA 3PIRA 4DKXA 2BOVA 3CRRA 5JI3E 1XBTA 1RRCA 2ZYTX 3BK7A 2UZIR 4DLVA 5JWRA 2J7PD 4HLCA 1G5RA 3PR1A 2JATA 1GKYA 1DOAA 4AKHA 1DVRA 1VKJA 2JGNA 4U7DA 4IDHA 2X1VA 2ZVPX 3DOEA 4ON9A 3U2QA 4RD2A 3ETLA 1U9IA 2IYRA 5G41A 1PZNA 2Q21A 1AS0A 3I32A 3TUZC 4LY6A 4KO8A 5C46F 3UMRA 2G88A 3QKSB 1OH5A 1GIAA 1E79A 3ZLJA 1U94A 2ZREA 4Q1BA 1ZM3A 1NIPA 1COWA 2TMKA 1ESMA 3FB4A 3NDPA 1TUIA 2ZR7A 3E5HA 3I5YA 4LUCA 4M9ZA 2QTHA 5EP4A 2V7QA 3EC2A 4PZYA 4WBSA 3SFVA 4D4JA 3BAFA 3FWYA 1HE8B 4LDJA 2QI9C 4BECA 3PVSA 3RS5A 3R7WA 4BWYA 1EXMA 3K8YA 1DELA 3WMGA 2EW1A 3WP0A 2OXRA 2YOGA 3W8NA 1OXTA 2J0VA 3W3ZB 3D6TB 5CLLA 1IY1A 4K8OA 3ZDQA 1Z29A 4GNKA 1JI0A 1ZIPA 4QHSA 1E94E 3I8XA 3VU9A 4Q00A 4Q9KA 3ZVRA 1T4GA 1TEVA 5FI0B 4DDVA 4PO1A 4PQYA 2NO9A 4ESVA 1ANKA 2ZJ2A 1OIXA 1AKEA 3IGFA 3TAHA 3UMSA 2XOKA 3T35A 4EPWA 1EWQA 2NIPA 2GXQA 4EQ6B 1IONA 2WKPA 3DHWC 2JJ2D 4OI0A 5FFMA 4K46A 2ZRGA 4OQLA 1FX0B 4M2LA 4OI4A 4LWZA 5AJYA 4YQFA 2F1RA 2MMGA 1KJZA 4Y0VA 3SN6A 4A0GA 5KTYA 4TMTA 2GCNA 3QSYA 2R6GA 1P60A 4QGAA 2FFAA 2IYXA 2HCBA 2IYQA 5FUXA 3R9IA 4AG6A 1VYUA 1A4RA 2AWNA 2XTZA 5CK4A 1TTTA 1UBCA 2IF2A 4GL2A 2H5EA 4N0DA 4UJ5A 2V6JA 3X1DA 1SVKA 3OEEA 2QTVB 1QZXA 1LS6A 2WWWA 3I62A 4HB4A 1R5BA 4ZDKA 2I1QA 4UXIA 2IYYA 3CONA 4GBMA 1TADA 2IA5A 3U3KA 4NCKA 2ZRLA 3EZ2A 2YC4C 4PANA 4FMCB 3ASZA 3KFVA 3TR0A 3ICQB 3VQTA 2QNRA 4II7A 4DVGA 1CJMA 2ZE7A 1KMHB 3EPJA 1AZSC 2OBMA 3UMFA 1G3RA 1OFIA 4TYPA 1PV4A 1HTWA 3FPAA 2C95A 2OBNA 2C9YA 4JL5A 1SKQA 1CTQA 2J0UB 1TMKA 2ZI5A 4BEJA 2ZETA 2IXGA 3HR8A 1UKVY 3PFIA 1AGPA 5HTKA 4BRUA 5JRZA 4UQOA 3SC3A 4D26A 2C9OA 3ZZUA 2ZRDA 4DCSA 2ZJ8A 3P32A 4KJZA 1F3OA 4Q66C 2B8TA 2A30A 2DWPA 2WJGA 1KO1A 3I73A 3VMFA 4A82A 3WMEA 3U44A 4BFTA 3C5CA 4B71A 1YE8A 1R6BX 2W2XA 4R7ZA 1J99A 1G8FA 1ZBDA 2GAOA 3MD0A 3F0TA 1S3GA 3GJ6A 3NDBB 2GETA 1MABB 2ZUCA 1S8FA 2IXFA 2VF7A 3TQFA 1KI7A 2W0SA 3R8FA 2XTMA 4NHOA 1DG3A 4TQ9A 2HYDA 2P2LA 3TQCA 3R9WA 2JEOA 4IXNA 4UKDA 1E2DA 4FN5A 4XWAA 4LC1A 4OI2A 3GJ8A 1HV8A 4QHYA 4KHZA 4BZXA 3RHFA 2XGJA 2CJWA 4HAUA 1W48A 4ZPXA 3T1VA 3A4LA 3BB3A 1WE2A 4FCTA 1CXZA 4BZQA 3AF2A 4RZUA 1NJFA 3AGPA 4NU0A 3SHWA 4B43A 1GDDA 3MGCA 3QPWA 2QAGB 3X1XA 3OAAD 1KO7A 1ZIOA 3LRPA 3TW8B 3QKRA 1Z0JA 4Q5IA 3A1TA 4ASUA 4DB4A 3AVOA 3EW9A 4CW7A 2F3RA 1BH2A 2F1JA 3ZVLA 3D3QA 2WWYA 2X2FA 4RCYA 4PSAA 4K81B 4MGKR 3CX6A 4L8GA 3CWQA 5EE5B 3GMTA 5FUYA 5KYKA 3CX7A 4HLUC 4PO8A 5KNBA 2QEQA 1E2KA 2NQ2C 3NVAA 4AIIA 3NG1A 2BMDA 1Q44A 4FMDF 2WJHA 4MRPA 1G3MA 4XTCS 5FPTA 4ACBA 1E0AA 1XPRA 1CS4C 3I4LA 2BBOA 5KU1A 1KNXA 3RRMA 2QTFA 4EPVA 4B6FA 4LBZA 3CF6R 2CE2X 4GOKA 2IX3A 1Q20A 3SHFA 1K8RA 2XEXA 4YMUA 1NSTA 4D25A 5HZKA 2F1HA 5JZVA 4B32A 4TQUS 4PPNA 3U6KA 2Q3MA 4YLGA 5J47A 1N6HA 2R2AA 4Q19A 1LB1B 1EX7A 1YR8A 3K0SA 2IS1A 3QXCA 2GESA 1NBME 2OCYC 3BH6A 5G53C 3K0AA 3QE0A 1F2TB 2XZPA 2GEVA 1JECA 1EGAA 3OF5A 4FWTA 4QHTA 2OHFA 1OFUX 4YXWA 1Z0DA 5B58C 3HWSA 1U8YA 3Q3JB 3QPUA 1WB9A 1E9AA 2VQSA 1F2TA 3GQBA 3CWZA 4RKFA 2IYZA 1NSFA 4L5BA 5G40A 4RKEA 2FZLA 4JVNA 3TAUA 3EARA 4LJYA 2JIZA 4XVRA 3RSOA 4AY2A 2HUPA 2FPLA 2YOFA 3CPEA 2BBSA 4L9WA 4PAOA 3AF0A 4DT1B 1D9ZA 2RH5A 1KJWA 1G9XA 2FN4A 1QG2A 1U9IC 4G0NA 4MUAA 3DOFA 1OFHA 3CR8A 2VHUA 3NBYC 3UXMA 5CM8B 3KQHA 1IAQA 2HLDD 3CLVA 4ZDWA 3EPKA 1HT1E 3ZVMA 1Z06A 1UF9A 3LX5A 4D4LA 2WWGA 1ZMXA 2V55B 2RGEA 4C0HA 1NN3A 4PZLA 1GNQA 3OIYA 4BFXA 4XWOA 4QOSA 3RANA 2PZEA 2XITA 2AX4A 1P73A 5JEDA 4XD7D 3Q85A 1GFIA 1P72A 3JVVA 2QSYA 2OCPA 1ZM2A 2BCJQ 3KUCA 4Z8YA 1H8HD 4BLSA 3MMPA 1SVMA 4G3XA 3ZS9A 2BM0A 2F3TA 5KSZA 1RRFA 4IDPA 4Q21A 5E95A 4HATA 1Q0UA 1XF9A 2EVWX 4N3NA 2QM8A 4LJ7A 2DPXA 2GF0A 3HU3A 5DLQC 1RJ9B 1VYTA 1D5CA 2QROA 4GI7A 1SVSA 1JPJA 3W8RA 1SKYE 2Q0HA 2X19A 3LLUA 4HB0A 5E7IA 5FL7A 2PJRA 1OW3B 2WAXA 4XVUA 4A9AA 1OIVA 4DHEA 4LYHA 3ZD6A 1PJRA 4KV9A 2XNSA 3UWKA 2RGXA 4LYFA 2HF9A 4QGHA 1JALA 3G5UA 2EWVA 1G3QA 3I1FA 1P62B 2CXXA 2QQEA 2B7CA 3BFXA 3EX7C 2IBMA 1KI4A 4Q4AB 3BE4A 2CHQA 4B73A 2ZRHA 1E69A 2ZAMA 3THWA 3KJGA 1J70A 2OZEA 1Q22A 1KJYA
chains in the Genus database with same CATH superfamily
1XD2B 1Z36A 1ICEA 3D0QA 3E7DA 2CSUA 1EESA 3N2EA 5SZHB 1LV7A 3O75A 3CXUA 4ZEWA 4TVKA 5E9AA 4TKLA 4ZZ2A 2FQWA 2DLNA 1IRIA 4B4VA 2CV0A 1SVIA 5M7EA 2GB4A 2IHBA 3A1NA 1QAQA 5I7FA 2PIAA 2ZU0C 2OBYA 1Z2OX 3M3PA 4PFQA 1BHSA 5IH7A 3RS2A 1P2TA 1P5HA 3O2NA 3TRKA 1TUBB 3DVLA 4DIEA 2NP7A 3KE9A 2X5KO 1WZNA 3Q9UA 5KYYA 5C9ZA 5A0FA 2QRVB 1I0LA 2O2YA 5FBVB 3GGPA 1X8JA 4PINA 1TKAA 2X0DA 1TX4B 1A96A 2GZ3A 3BIWA 3OLYA 5AM3A 5FUBA 4F5EA 3O0TA 3GBVA 5CH5A 3DJFA 1AQJA 2NGRA 2H9IA 1ZH0A 1V1RB 1CRQA 1UL1X 2QRVA 4P4NA 2V7WA 3KELA 1WZCA 3CPJB 4B47A 1K3FA 4ERXA 1E0KA 1RXEA 1G5TA 2IITA 1S3SA 2OZVA 2FUCA 3HFRA 2QVXX 3OBIA 5AKEA 4WX2B 5JSUA 3COSA 1U4SA 4V0NA 1V1RA 3WO1A 2XF2A 4GD3Q 5JDIA 3FLEA 1V8FA 1H6CA 4OFWA 1OBFO 3K8ZA 1ENYA 2Q5FA 5F2EA 5TQ2A 3R6DA 1WXXA 4LC0A 4X92A 1N6NA 1N33B 2WNHA 1LVGA 3A6FA 2PT7A 4WNYA 5AVKA 2OD9A 4JT8A 2ZZNA 1Q3KA 4DWWA 1K1EA 1ZINA 3REOA 1SXJE 4LGMA 3WJ7A 3EVGA 4DNOA 5BN5B 3BDIA 3QA3E 1TIKA 3NNSA 1GITA 1DADA 1S3FA 1WTCA 2GBIA 3OLXA 1WSAA 4JAVC 1WM1A 4JT4A 4NOJA 4QJBA 4R1SA 4XIIA 1T2FA 2SNIE 1Q7TA 1M2JA 2QGNA 4IR7A 4N40A 1NT2A 5JISA 1FDUA 1NQOA 1U8UA 2R60A 4Z49A 5BN5A 5BN3A 4IEIA 2DQZA 2IGBA 2Z2ZA 5LXTF 5M34A 1EVLA 3DDWA 3W9YA 4QTXA 2B3DA 3NR2A 4Q3AA 3CUUA 1RMQA 4IDOA 3ICWA 5LIRA 4HKTA 3I6IA 3O8BA 3O8OA 4HSEA 4BATA 4CTOA 1V3TA 3IJ5A 2R47A 4ID9A 1RE0A 1JLKA 2Q49A 3LBHA 3PLNA 2ORED 3IVAA 3LGSA 2ZUUA 3JTMA 2IIVA 3PXCX 4HAYA 4RNCA 4BQOA 2RGUA 1B8VA 1E3IA 1YL6A 1M7HA 2BKVA 2Z30A 1A8SA 1LPMA 3KTFA 4PS1A 3TQOA 3TGPA 4HWKA 1N6RA 2AL7A 4IEFB 4REQA 4ZEOA 2ZSKA 1BE1A 1BXGB 1MEJA 1OLUB 3LZ6A 1IPHA 2IYNA 3PXXA 4RHUA 4CKEB 4ZMBA 1KHTA 2XOEA 5BQXA 3FHOA 3PFWO 4AMUA 2QP9X 5CDTA 1IHUA 5EKDA 4N0MA 3B1XA 4LVCA 3NMUF 1QAMA 4M7RA 4KGZA 1JDVA 3DL4A 3WGZA 3I1IA 5CD9A 1NXSA 4JLWA 3CQ9A 3N6RA 3R0ZA 4HTAA 4N6NA 2YIDA 1L7OA 2GWHA 4JIGA 3H8WA 4X7MA 1UKZA 5IYZF 1EKXA 1K86A 4AWXA 1N0HA 3GNQA 3VKVA 1KH2A 1ISFA 1RPTA 3KETA 5AVTA 2OQRA 1Z63A 2UZ0A 1NMXA 1DQYA 5JMWA 2DKFA 2ZSUA 3D64A 4MK4A 3L7MA 3NFRA 1M2EA 4NCXA 4QXAA 4WKOA 1X39A 2EEPA 8ATCA 2CXNA 2P6UA 1IWPB 3RIHA 4W1SA 1QCZA 4ONEA 1W1IA 2F7SA 4QVKA 4QDOA 5HS6A 1BGWA 1O0SA 2IHVA 3PNBA 4Y8VA 3FHCB 5FOUA 4PXYA 3W6ZA 1C80A 2RGCA 1ZITA 2QMHA 2WZQA 3DKRA 3IQGX 4KC0A 4KFRA 4RD3A 5IM4A 3PEWA 1U28C 3QMPA 2C99A 1EPUA 3RFUA 2QJTA 2QPLA 2BUAA 1H0SA 1NY5A 1YQTA 2YYAA 3I0ZA 2VBIA 3ZJVA 4AZWA 1IEVA 1L5FA 4WLNA 3THSA 5HUQA 3PPIA 3GD5A 2B0CA 3P20A 2R66A 4GLLA 4QTUB 2DXIA 1JAHA 2ZFUA 2OFOA 2XCLA 1H3EA 3KO8A 5DYTA 5I7SA 1M6NA 1XJCA 2GYVA 2WM2A 3GY0A 4JXKA 1DUVG 2RIPA 3T4XA 1JWBB 5FTJA 5JPCA 4MGHA 3FPJA 4RH0A 3KUUA 4ZHQB 2X9NA 5IANA 4KRXA 3LLVA 1R4NA 3ZY3A 3N86A 1LVUA 1D7OA 4KLRA 5C51B 4IFEA 1WPXA 4AN0A 1XR3A 2Q0XA 5L4SA 1E2MA 5KVSA 1M1UA 2CLEB 1W8DA 4XGRA 1XAIA 4E46A 5IZCC 2HD4A 4I4LA 4JLKA 5BORA 5C3MA 1RPZA 2E49A 4P4UA 4Q7QA 2YZKA 3EEIA 5EJ2A 2HMWA 3VZCA 4HO1X 2JLCA 1Z7BA 3FWPA 2PS9A 5GONF 5D3MA 4TMKA 3BMNA 1H2RS 3CNOA 4QPJC 3ZCXA 4EI8A 5FLKA 1GZHB 4EIWA 3RSGA 4CLOB 4CKCB 2JA1A 3EFEA 4HEA1 2G04A 3OETA 4MW7A 2X7XA 4QBHA 5T4HA 1UDRA 3RFCA 3GYGA 1I3LA 3FVVA 2CCJA 3G2KA 3JASB 1ZR2A 4J91A 3RSZA 4BQIA 3IRVA 1WXFA 2JDID 4CKCA 3EMBA 2C8KA 4YAKA 3QVVA 1GSIA 5B2ZA 2WPDD 4URWR 4ZDIA 2YY7A 4EK9A 5B6IA 2CDCA 2B5WA 4V39A 3PHIA 5BVGA 4HMPA 3T7IA 4ADSG 1UPTA 1JZTA 3ND5A 2FSFA 4A10A 2FPGB 1KDPA 2B92A 3SYNA 3L06A 3O1IC 2XUGA 4RGYA 4JWTA 1H42A 4RXTA 1XZJA 4ILKA 4DBLE 1QLJA 2FV8A 3MYRA 4C7BA 3AK4A 2C4UA 5ESDA 2DH6A 1ST3A 5KNLA 5DN9A 1Q0ZA 1YL5A 4Q3EA 4AU1A 4J76A 4YDQA 3OHMA 3FNHA 5C7YA 2K6GA 2GCOB 4F4CA 4WHMA 2XMQA 3B78A 1HDRA 3SSOA 8LDHA 4GICA 3G0CA 4KN8A 3HP1A 1K7YA 1KR5A 2PKQP 1MB2A 1KP2A 3T3IA 2ZWAA 4R69A 3ZH9B 2X8BA 4L4SA 2BH2A 3SIRA 3QKTA 4YWJA 3PDWA 4QXOA 4JJZA 1KI6B 3N6VA 2WINI 1YF3A 4AKEA 2WA2A 1HEYA 1ZM4A 1X1BA 1B6GA 1QG4A 3LO5A 3CV3A 1YFKA 1SHZA 4PHHA 5JSZA 3BIJA 3D0RA 1PWEA 4WZ6A 5INTA 1CUAA 1KI6A 3JD4A 2NU6B 3DYVA 5JUWA 3MUEA 4H7PA 5HRAA 4QOJA 1H22A 1N5JA 2BFCB 2K7FA 5IJXA 4JUAA 1HT0A 3RGGA 5ED0A 3AI1A 2V9ZA 2SHKA 4YV1A 5FLXA 2O54A 4HQLA 4C0WA 4AWAA 1EX1A 4QL3A 3TG8A 5KDDA 3ZGOA 4YXWD 1KE2A 4DUZB 5EP2A 1M33A 2X77A 4LJRA 3HU1A 1P1BA 4MRSA 3AR9A 4MRRA 1N5MA 1TLFA 2MJLA 4BMXA 2FRDC 1P5RA 1J0AA 3NXSA 5AM0A 2ZJ1A 2R5WA 1YUMA 3D5EA 4X1KA 2NU9B 2BEJA 3HO6A 1Q15A 1NFRA 2NACA 2XUPA 1VKOA 4ZMRA 2VDVE 4TT8A 4BQSA 5CDFA 3WL4A 1KWKA 3ZU6A 2Q6TA 5H9VA 3K94A 4XM0A 3IIMA 3O6VA 4JBWA 1AXEA 1RW4A 3ILXA 3CVWA 3REQB 2DLDA 3K92A 1GRCA 1XNGA 2B36A 2ZAOA 3G79A 1M1YE 1YDHA 1JP7A 4Q01A 2ASVA 4QM6A 1I3OA 1SHTX 4OV6B 1SOMA 4OHPA 4ZVNA 4JYCA 4AUKA 2IYTA 5HKOA 1JHVA 2CMFA 1HE5A 1XEWX 2V0NA 1G17A 2BMEA 4RXUA 3I6QA 4CLRB 3OWXA 4JCCA 1VG1A 3PRHA 1X87A 2C2KA 1OH8A 1IN8A 2WWRA 3ZGYA 1PJ4A 4BQRA 2N0SA 2V4ZA 1DJNA 1CRWG 3AR2A 4CLRA 3DM9B 4PLZA 3ORYA 4R1MA 2ZVDA 1TUEA 3QHPA 4RTRA 4KWIA 3TF5A 3E8MA 1KEKA 3X1MA 1JHAA 3DO5A 3A6HA 2XMZA 4PTYA 1I3KA 3N76A 3EYAA 4JYBA 4EZIA 3E9YA 1NMZA 4YDHB 3LUAA 3IELA 3JVUA 2BFPA 1PR5A 3MBIA 4PBTA 2X0FA 3V46A 1F48A 3CZRA 2ORWA 3PC6A 2Q1WA 1D2AA 1HLPA 5AI6A 3KR9A 4H6PA 1B93A 1IZ7A 3USCS 1CNEA 1T5OA 1PE0A 2Z57A 4L6CA 4EELA 4EMBA 4OXRA 2M6LA 1V11B 4K6KA 2GPJA 3SOZA 3ESRA 5D84A 3TBKA 4IV8A 4Z54A 3AM3A 3R7WB 5I7UA 3SM3A 1EX6A 3F5DA 1UMDA 4MIOA 5FBHA 2NZXA 4KX5A 2Q6IA 5ALEA 1HA3A 5LD2C 4IFIA 4DMUB 5FI5A 4Z7JA 1U0JA 1G8YA 2D7DA 3WIUA 3WFZA 5JROA 3ZU3A 3SZLA 2V4UA 2O7NA 4IYRA 4BLWA 4HV4A 3ORQA 2XKKA 3RLIA 1T13A 3COYA 2XYHA 4V1CA 3IO3A 5B12A 1G21B 3SEFA 3DKKA 4PZ9A 2VJMB 4GBED 2WJIA 3AF4A 1AA9A 1Q0QA 2BRUA 1F60A 1PWXA 4PZDA 4CMEC 4J75A 3RVKA 3F97A 1OHHD 4FFPA 2J9RA 4QXMA 2HPAA 3SQMA 1F8GA 4QBTA 5FNVF 1NZJA 2YHAA 4OMUA 2JVJA 1OU0A 4R9NA 4C0LA 4KHPB 1S9DA 3ZGZA 1GP2A 4B85A 2LKDA 2YBEA 4KRYA 1WVIA 4LXXA 4M38A 4LXGA 1G8JA 4KNVA 4KN9S 4F1WA 4QPCA 5C2JB 4YMLA 2ZW9A 5CA0A 4EL0A 1F6BA 2G70A 1UDXA 1PJZA 4GI2A 5JBNA 2BSQA 1YR7A 3WYNA 1ZUIA 4GECA 4G89A 2IEYA 1XT6A 2WTBA 5CVEA 2ETXA 5J9FA 4FGLA 3IODA 3GC6A 3U7IA 3CMMA 1XZBA 2P90A 2WMNB 3AHCA 3D8TA 4C22A 4YXFA 1W87A 3AZQA 3TVDA 5FO1A 2QM0A 2CKMA 3EZ9A 4BJ1A 3ITDA 3EWAA 2I0FA 4WZZA 4LX0A 5GJCA 5HZMA 2Q1XA 4FFVA 4PICA 4NZYA 2P2YA 4YRLA 4MDYA 3HDYA 4QU0A 5EFZA 3NALA 4RMGA 2YWJA 3ZY5A 3HXPA 2QJRA 5ERXA 2A14A 2VDOB 4II3A 5KIAA 1CY6A 2HM7A 3IKVA 3STXA 1XCGB 4PNHA 3BD8A 3DDHA 3ZIAD 1YOBA 4MLDA 2GA8A 4PE5B 4EEXA 5B3JC 1FRQA 4YCNA 5TGDA 1K8XB 1WMBA 1V3UA 4ZC8A 4E2ZA 4IJQA 1Z7YA 2CLSA 1E9BA 1LWOA 1JHMA 4UZEA 2BFFA 1Z08A 4J49A 2TECE 4N5DA 1K5GA 2IGTA 4AZ0B 5FTLA 2HU8A 1IZZA 1GVHA 3K9NA 3I76A 4JC8A 1PX2A 5JCPA 4Y0NA 4L6AA 4IH1A 4B9EA 4U1RA 1O87A 2CC2A 4DKJA 1S89A 3N0VA 4C9BA 2PVPA 3PIDA 3NIGB 3O8QB 3L46A 4I50B 2NVOA 1L7PA 1JQAA 2AR0A 2ZXEA 3JRWA 4JJIA 1NN0A 2QLMA 3B9RA 5C3UA 1C7JA 5I3ZA 3LCMA 3L6CA 1RT9A 2OHIA 1ORTA 4X90A 4XJTA 3WSWA 5IU6A 1CUHA 2W6ZA 4DLZA 3H2SA 3DOUA 1DJLA 3G0OA 3MGAA 3Q3EA 5D5QA 1Y33E 2Y67A 2GYWA 4NAUA 5ELXA 1HY3A 4JLJA 1JKJA 4IX1A 1IY2A 1BMDA 3FFAA 2DBQA 4YA6A 4MRAA 5CFPA 2FUG6 4HDSB 1XZQA 3VKWA 1U65A 1Z6QA 4QFMA 3EXHB 1PVDA 5F1KA 4CNQA 2FJ0A 3HKDA 4YIHA 3BWXA 4N3BA 4QA9A 4BRZA 4DANA 5K8VA 3O8RA 3FPBA 3HXOA 1CEYA 3B7GA 4ND8A 5ECWA 1G20E 5E7MA 2CVHA 3DVQX 4LI0A 3LM8A 4PNZA 2R4TA 1B74A 3L79A 4E14A 2GLXA 4ZV7A 1VG9B 1QG6A 1HMYA 2O2CA 3IDZA 1MA3A 4M1QA 3QKRB 1ONPA 4FFNA 4R6XA 4BNHA 3KB2A 1X1DA 4ITUA 3S1LA 4UOEA 1SB8A 1E1MA 5LP6B 3SDSA 3AO0B 5DCLA 3VHQA 3VNRA 2W6JD 4EHJA 4QJ3A 5LU9A 2Q8NA 4J3FA 2A59A 3R6TA 1U5CA 3SX4A 4UOZA 1PZFA 1L5OA 4K0RA 1T9HA 4RVHA 4OHZA 1K0FA 2QD4A 3OSUA 5LP6A 1QOQB 1A8UA 1C7IA 4URZR 1JJBA 4CL2A 1C1YA 4TWIA 3FHTA 1TU4A 1B00A 1W4AA 5AVOA 4GDMA 3MA0A 1Z5WA 4O4HA 1E1CB 4OJMX 2V03A 3W8FA 9LDTA 3T4EA 2EHDA 4HN9A 4MWTA 1NYRA 3KAKA 1VJ0A 4A8JA 4Y2SA 4EPRA 1N36B 1AGYA 2GOYA 1GDHA 1NJ1A 1JSRA 1PDVA 2LRHA 3ORRA 3CGGA 1QQ5A 1N34B 3KKOA 3C7CB 5IK2A 3C3KA 4WL0A 4UU8A 4GPBA 3KZNA 1I2DA 4OJQA 4YCSA 4E70A 4F85A 4HK4A 5T7BA 4OI1A 4RTLA 1XZKA 2NV2B 4F5WA 3BEDA 3P97A 5IRCD 3IDFA 5ALZA 1OPXA 3F9RA 2I4MA 4U02A 3GA5A 1TEHA 1H23A 4OA5A 5LNK6 5AOVA 1TM4E 3N0RA 4NCNA 4P5EA 5LQMA 5FV7A 4RJKA 2Y4OA 3L7NA 3UCXA 1QU2A 2GFIA 4LK2A 3GQBB 4MDFA 2FN8A 2D74A 1AZLA 1NNI1 3DWFA 4WCFA 1JJIA 5TQ0B 1W4BA 3MXTA 3BH7A 3BKXA 4MV5A 1Y1LA 1W75A 3WLMA 5KWVA 1UQUA 1ZMBA 2EJCA 2MSEB 2J9XB 4U2BA 3JWEA 2AJTA 3FBGA 2IOQA 4K87A 4CDMA 2W83A 2W2OA 1R8JA 2ZSJA 5EXDA 4EB8A 3THXB 3TB4A 2R65A 3IDOA 2VXYA 3IPXA 1KYTA 2Q9AA 2RC5A 1F20A 3G0GA 1YKSA 4B82A 1WXWA 2FSIA 3CJQA 3ZW7A 1U3UA 2OKGA 4G5FA 4ZQEA 4BMZA 3THXA 2QN7A 1GKLA 1T15A 3B1WA 4L4XA 2UXBB 3OD1A 3N5KA 1C1DB 1Z5VA 4W63A 3U4GA 4BXOB 1UMCB 2C82A 2ECKA 4ALNA 1Q1GA 2H7XA 2ZBVA 3LLSA 4G5HA 4HGYA 4KYTA 5SYMA 4AZSA 3EPLA 4Q02A 2IHKA 1C1DA 2ET6A 4PX2A 4WLEA 1DKLA 4KDFA 1II0A 3ZU4A 5EHXA 4YUAA 3E5NA 4BXOA 1MC8A 4NE7A 4OB6A 2X3YA 1PAUA 3CEPB 3SAJA 1OI4A 2DY1A 3AFMA 5IH3A 4HOYA 1LLCA 1XO1A 3GRZA 2VPZA 4R7GA 3LUKA 4TV8A 3GGJA 3MK31 3HKBB 5CLFA 1DCTA 4MGZR 4R1LA 5EKXA 3YASA 5DYWA 3F7MA 3JU3A 4WASA 2HH9A 5EZQA 4YUZA 4DR4B 2Q1TA 2Y0BA 2IWRA 3E3OA 4QEDA 4XIYA 3OM0A 2X5OA 1N25A 2CBZA 2QZPA 1A9QA 2Q7XA 3HN7A 5GOZA 1HNXB 5CDHA 2Z0MA 2R3SA 4ZDJA 1GAXA 4NPHA 5CCEA 3LX8A 3TX6A 2MSLA 2NZVG 1GPBA 3GJYA 3HS3A 1VECA 4LHZA 4R31A 4R71A 4WAUA 1XWIA 2XGGA 4I1VA 5JNSA 2L18A 1DXQA 1WAMA 3K0EA 1UFRA 5AVZA 4GMDA 5F78A 3ELYA 3UFBA 3FI9A 3GMSA 5GGXA 2R1TA 4FDLA 3JSAA 2FI1A 3EF0A 3ZZMA 5H8WA 1SZPA 1K5HA 4MYSA 2Y6VA 4P34A 5D2CA 4C0KA 2HXYA 4OG2A 4EFDA 1V4NA 2Z4TA 1C14A 4NWIA 1YR2A 5WRFA 3X1WA 2NYAA 3THWB 2I4TA 2ZS7A 3U40A 2XSZA 3FGZA 2IELA 2WSMA 3IDSA 4I19A 1VE3A 5EJ4A 3AFHA 3KEFA 1UM9A 3BTOA 4P4SA 5JR3A 2YC2C 2X3FA 5EHZA 3U9TA 2I3AA 4QPDA 3B3JA 3HA7A 5JNWA 3IDQA 4NONA 1CUFA 3ZDZB 2DF8A 1OILA 3WLAA 3R5SA 2XMRA 1U3CA 2PGLA 2HCRA 4A4DA 4N41A 4B3RB 2O59A 4IVRA 3M1YA 2VWHA 3KYDA 3KDPA 4X00A 1FFBA 1RAAA 4F71A 1JYFA 1JJAA 4IWNA 4O2LA 2EX0A 4LTDA 4B2IA 5F5XA 5ADHA 4DY6A 1HF3A 5ENZA 3VV3A 4XLLA 2JJ8A 1DG9A 2RKWA 1YVRA 4JEMA 4ARUA 4AUMA 1JDZA 4XA8A 1E3JA 5IVIA 4CMJA 4E6EA 4OGWA 1F1JA 4YUXA 2VKQA 4BYGA 4A6PA 1UM8A 1DINA 2CK3D 2B0JA 1ZI6A 1R0XA 2I33A 1TVKA 3U39A 4C0BA 4HAOA 1DS6A 2HRDA 1XLUA 4F3NA 1N77A 2M1XA 1PR3A 1Y1PA 1PEAA 1XQ1A 2WJ4A 4ALJA 3QVLA 2OKCA 1E96A 2CXPA 2RGWA 1W88A 1A9XB 4B9AA 6AT1A 3TW4A 4GOJA 4KR0A 4E94A 2PJDA 5JY6A 4LEIA 1IMJA 2XXJA 3O82A 4GAEA 5L40A 1OX5A 3QEAZ 1T34A 3IVGA 1SKUA 3C41J 3GJ5A 1GWNA 1XD8A 4I55B 1ADBA 2WEKA 1EAYA 4PV7A 5TB5A 1RRGA 1V35A 4A6XA 2V3CC 1H2HA 5E0KB 3H2BA 2BKLA 2QSZA 3JS5A 1IY8A 1BSVA 1EVKA 1XTJA 2NN3C 3KR1A 5CAEB 1EP3B 4B8ZA 4GSKA 1H8EA 2NLOA 2ZUDA 2SICE 3TM4A 4PR0A 2NTYC 4K9OA 3ZLBA 1G6OA 3D8BA 2J46A 3K31A 3RBAA 2ZBRA 3WXBA 5CU7A 1NUPA 1ZCFA 4LDRA 4N3GA 3U3RA 2ZE6A 2JKVA 3TM5A 2FVXA 1PR6A 4R8MA 4KR2A 1OZFA 3WY9A 1JDTA 2WJYA 4NY1A 1X7WB 3AP3A 5EAIA 1NG1A 3TCNA 1Y98A 1X7XA 2M9MA 4GL4A 1XTUA 4BLUA 4Z2AA 4AW9A 4CRWB 4QQRA 3GFGA 3G2JA 3UK2A 3CY6A 4LYEA 2W7TA 2OZLA 2W6ID 1JG4A 1EBBA 2GZMA 3CB4A 3NJ4A 4UUAA 3K5WA 4IMIB 5EIWA 3CUVA 4B48A 1EFRD 5HDQA 1CYDA 2GAIA 1NVUQ 4IF4A 1Y5RA 4OHCA 2F4NA 2Z2KA 4ZVRA 2RJ3A 2WYOA 5K4AA 3P71T 5CDFE 3A28A 4JBNA 4QBGB 5F35A 1G66A 1PV1A 3Q5DA 3U3DA 1BMFA 1KMCA 1J97A 1GRQA 1S1CA 3U62A 2FDXA 1S4QA 1II8A 3WIEA 2B4QA 4A16A 3ZHSA 2Y2UA 4EH1A 1NSYA 1H6AA 4EY8A 4US1R 8OHMA 1JBQA 1XRSB 5DHFA 3AF5A 3QA9A 2GTPA 5IUJC 4YJ2F 5IJ0A 1W4LA 3CE6A 5I9IA 4J7CA 4XDHA 3A25A 1IN7A 4JK3A 2GFHA 3DMTC 5BSVA 4YY3B 3KV1A 1EDDA 1E77A 2IZ7A 3OZCA 4PY2A 4HQFA 1JXOA 4M46A 3VPXA 4CL0A 4CYMA 4PLTA 1VRVA 2MHCA 2EWWA 2Z3VA 1UXOA 2VPXA 2XB4A 2PZGA 4JJFA 5CLQA 3WK9A 4BE7B 3G85A 3AXTA 1Q2UA 1POWA 1KK1A 1QFZA 2B1RA 2BFWA 4OKSA 1QRAA 3C5WP 3RM3A 3T1NA 3A27A 3HYCA 1P1CA 2OGWA 3GHYA 3MUOA 4PQEA 1RXYA 3OECA 4L73A 1MD9A 1YACA 2QKYA 2QY6A 2NZYA 1BCRA 2RGGA 1SH7A 4GOOD 5DISB 4XVHA 3U4DA 5FXMA 9GPBA 2ZM6B 1NBMA 2JI4A 2D5CA 2ODEA 5CRIA 1D8AA 2OE2A 2VHQA 3E3AA 3PXGA 1P9OA 1GZ3A 2WLSA 3C3PA 4QASA 5LNK1 4FHGA 3E9ZA 4Q16A 3NP7A 4WA7A 3SMQA 2WU8A 1AV7A 4PYLA 3VHLB 2KLHA 4MRMB 1R0KA 5L51A 4R8RA 4JEUA 2BGWA 2YXPX 3DLHA 4CF3A 2IYFA 3PD1A 5CPBA 4AECA 1HNWB 3QP9A 1J5PA 5SZIA 3MTDA 2BGRA 1V8OA 2X2EA 2K2WA 2CJPA 4MRMA 4DF3A 3C3DA 3DAGA 1Z75A 4IDNA 3RH0A 5CURA 2BIFA 3FETA 2DWUA 3IQZA 1LPAB 4EA6A 4EJSB 3QE3A 2P67A 3BREA 1DAHA 2GS9A 1ZSVA 3AM4A 3ULKA 1V8PA 4MZDA 2VCEA 4XQ9A 3EGVA 3VBEA 3H6HA 2DWOA 1JSLA 5EXPA 1D6MA 5BW5A 2HFJA 2ZJZA 4F9EA 1H4QA 1EK6A 2ZPAA 1RKQA 4ZTZB 3EZLA 1NLZA 1RC0A 4URVR 4F3YA 1CX9B 2AF3C 4RIFA 5BV1A 3JQ8B 4YV0A 1H5UA 4LXUA 5BP7A 3BK2A 4PPFA 5CA1B 1PT6A 1JAZA 1L8OA 1VHQA 2PFKA 4IHJF 4CDNA 5JSFA 5THQA 5K03A 3WIDA 3AHIA 4HMOA 3KPVA 3M70A 4IF6A 1MDFA 5THXA 1FFSA 2C4VA 1X1RA 4HG2A 2IOFA 3EVFA 1V6SA 3JQ8A 1LBTA 5AW0A 2P6MA 2Y66A 4KPEC 4O25A 4CFSA 5EJ6A 5AQEA 1EUYA 3FJYA 4AY6A 1IZ0A 3L8DA 1G21E 3NBUA 4M1TA 5JXWA 2XXAA 1TW2A 1XTIA 4N0EA 5FTNA 5KI6A 2PZMA 2DULA 3D31A 2CFSA 4HGQA 5E1OA 2EFHB 1WF6A 1W35A 3FBWA 3UT5A 3AL2A 3DQQA 4P98A 1AA6A 4X54A 3NIDB 3M6LA 4I99A 4PHTA 1F8FA 1AD2A 1MRNA 3V4SA 3JQFC 1YJBA 1T0JB 1XF1A 2O3QA 2WC1A 3HWRA 3TUIC 1UOPA 4BUCA 4LHEA 3H1PA 1DAMA 1EE1A 3AMVA 3EMDA 2Y1KA 1LUAA 1TMGE 1X19A 3TTWA 4ETWA 2PS0A 1U0FA 2ZIXB 3RU2A 3NOVA 5BWOA 2ZYRA 5IJ9A 1DEAA 4DA6A 1KY4A 4DEYA 2C8LA 2C4HA 3HDGA 2IHNA 1U8ZA 2FOIA 2PCJA 1T4CB 2VDPB 3A6DA 1SXIA 4L9AA 4IO1A 3GN1A 4NAVA 2HDWA 4RJLA 2XNDA 1WBDA 1E6UA 3BRCA 4TMVA 4Y2GA 5ALFA 2XUJA 3A4YA 2OL4A 1D9XA 4ZAGA 3SYMA 1H0KA 8ABPA 4UE3S 1LDYA 2C92A 1AGRA 1HUQA 1KPGA 1KYWA 3SZ3A 1T4CA 4PGAA 4GZMA 2JZOA 1CW2B 2I67A 1SBHA 4M9SA 4QPZA 3KSAC 4ISCA 5K45A 2B5OA 2V59A 1CUJA 1L8AA 3N39C 4FGJA 1HWYA 2PMBA 2XTNA 3IQXA 4YRJA 4MS3A 4D44A 5CTJA 1QZTA 2Q6KA 4WXEA 5EHNA 1DBVO 1Y3DE 4L22A 1XZNA 3V33A 2AR9A 3LVQE 1T2AA 4QX6A 4Z8XA 3ZJUA 3THYA 5TPWA 3CF0A 3DUWA 3MIZA 4FR5A 1BVUA 4UFNA 2R0QC 4AJNA 1QH9A 3NWJA 2V7XA 2IYLD 3WB2A 3UO8B 3FOCA 3I72A 5BN1A 4GX0A 1OUMA 2VP4A 4DLPA 1YA8A 3GZJA 3ID6C 3L01A 4DLXA 4PZCA 2C42A 3FGNA 2QG9A 3UJ3X 1R0CA 2PUJA 2JLWA 3OFVA 5EIEA 1WHSA 1E2JA 1N1DA 2NV6A 3F2IA 2OQIA 4D6YA 3BSSA 2YXEA 1T8RA 5HJ7A 2YV5A 3V34A 4H3VA 2XOXA 4FNMA 5GINE 1YQGA 3VYRB 1I51A 4PSKA 3HP7A 6YASA 2JH9A 3LOUA 4GO1A 3DOIA 2Y76A 1IVYA 3JQAB 4O8ZA 3K9GA 1NI4B 1LK7A 3GZTB 1T43A 3CISA 3IIKA 4WDQA 3CHYA 2ERCA 4X20A 3UUEA 5JAOA 4GR4A 4F56A 2W6PA 4IG9A 1G2PA 4L75A 4RZ3A 3AHFA 5FL3A 1IXKA 1YZKA 3B38A 3HQ4O 5EIFA 5L9AA 3SR3A 3JQAA 4YMHA 2PE5A 3WIBA 2PX0A 1I9GA 1NI4A 3I3OA 5IT5A 4L8YA 1NUQA 2RGNA 1XKTA 2O2ZA 2RH9B 1XRRA 2DU8A 3PQ3A 3QVTA 2JGMA 4HTFA 1UJCA 5CXSA 3TDMA 3B51X 4N47A 4A92A 4CKZA 4U5QA 1EWTA 1B15A 1TMOA 1SCUA 1QO0D 2A9FA 1JG1A 1JA1A 1IHPA 2OK7A 4ZQFA 5IPFA 5A5DA 5IJZA 2H1LA 5K4GA 5ER9A 1JNYA 1X8XA 1QQ6A 2Q45A 1YWGO 3WR5A 1NJ8A 4MITA 4AJHA 5GM2A 3K1AB 5LKAA 5DBHX 2O5EA 1FF9A 4KIJA 2P6RA 2Q2VA 2BSXA 2XNKA 2YCBA 4QLBA 2FZGA 4ABTA 1YGPA 3NVMB 1R0YA 1DIOB 2FG6C 4B7ZA 5JFTA 5L45A 1V7PC 3MM4A 3HJCA 3GI1A 2P75A 3Q2KA 3TR6A 4BVKA 4C88A 4NE9A 3F2VA 3T8YA 2ODQA 4KOEC 1VBMA 3GJTA 2JA2A 1RD4A 1T9KA 4G26A 4ZAFA 2IIQA 5CFMA 2PH7A 1U31A 5BSWA 1OH7A 1VA5A 3HCCA 2W90A 4CG1A 1JQLB 4QGBA 5EINA 3PGXA 4HAWA 4LZNA 1V47A 3UOAB 3HGMA 4QOGA 3UWOA 2VLBA 4J29A 3KKEA 4C05A 1ZJZA 2BM1A 4YJFA 1X8LA 4TLCA 1M73E 2WI8A 4I2VA 2FSSA 1KMIY 3D5QA 5ALVA 1D2CA 4KVAA 5DCUA 5F9HA 1FTGA 1MVOA 1YB6A 1GUFA 1I5OA 2MSWA 4GZLA 4BQEA 4ZVMA 1AU9A 2FPUA 4BBAA 1C0KA 4L8WB 4RAOA 3K8OE 3V2UA 2QN8A 5A05A 5HXAA 4YP5A 3C6MA 1KZ1A 1G7TA 4IINA 3UHJA 2XWQA 3DPSA 3W5JA 4Y2TA 4DA0A 2FDCA 1W1UA 4CQMA 4G1CA 2IYVA 1A82A 3K1YA 3LV8A 5ES3A 3RHSA 2X22A 4CPDA 1NN1A 4LGVA 3U3OA 4ENVA 4V2IA 3CT6A 1Z82A 4YQZA 5KTMA 1AKYA 2D0OB 2M6RA 1ZCAA 2BI4A 821PA 1ISIA 2ZJYA 1QYCA 1FYDA 4LNAA 1T6YA 3FPFA 1K6IA 3QBEA 4TTQA 1E1QD 2WIDA 1X1QA 1DC3A 4YB8A 1H3FA 1T3HA 3WYGA 4D9KA 3QKSA 1QC5B 2X9GA 2V7EA 3DXXA 4HX2A 3ORFA 2BPOA 1ADYA 3WYBA 1UK8A 2ZUTA 2IP2A 4Z4HA 3HJRA 1RYHA 3TMYA 1EVZA 2G5PA 1JF8A 5JO9A 1JLLB 3NWEA 3WNZA 4ARSA 2FZ4A 4BU0A 4EMTA 3K05A 3ROFA 4UFPA 2COEA 4EFLA 5NULA 1TCVA 5KDOA 4PZAA 2WF9A 1KZ7B 1I4EB 2UUOA 5EXTA 5JG7A 1RZUA 3LXMA 3WLJA 4P83A 5J1SB 1WKCA 4M1OA 1E9RA 3TKAA 3UA3A 2AG8A 1KPHA 3SC2B 3ZBUA 4PSCA 4CTMA 1XFAA 4Z99A 1Q7GA 1GARA 1FW8A 4Y7DA 4CF6A 1YE3A 3OFSA 4CQLA 3R0VA 3AIKA 1E7RA 2HJWA 3TSWA 1PP4A 2QB5A 1XXHB 1I4DD 2C58A 3AOEA 3E84A 3MCZA 4GMFA 5HDBB 3VX4A 2EFCB 1ODCA 2H1CA 2ISQA 2RJOA 4J7AA 2HJ9A 1QZZA 5AK6A 1C2YA 2PPLA 3F9IA 5ALMA 4A0SA 2PN1A 1B43A 2R8EA 4LYJA 2ZUVA 3FAZA 2XCSB 1XXHA 2P1DA 3CH7A 3MUFA 4DR1B 1MAWA 5T64A 1IJBA 3DSRA 4IWYA 5FWXA 5TSDA 5AUNB 1RLIA 1EGHA 3KKNA 2F3QA 2REOA 5JPIA 3VZDA 1P4RA 4EA8A 3SQXA 1GCOA 1QH0A 5LA6B 1DRVA 3HUFA 2Q46A 4K86A 1A5TA 3OJEA 2C5HA 2CFOA 4CU2A 2IU3A 2IH2A 2VF2A 2AQKA 3SIWA 3HEMA 2HLHA 4G0MA 4MROA 2BGLA 1NRXA 1FLNA 2MT9A 3AWDA 4ENSA 1D0VA 3ZV7A 4C0AC 4ETNA 1IY0A 2J07A 1I13A 4NNPA 5BR7A 4OHYA 2E4VA 3BFPA 4G5QA 1PW5A 4MAFA 4RTPA 1U90A 2HI0A 4UTVA 4J4BA 1ZR4A 3JX9A 1DWPA 4M89A 4PX5A 4RU1A 1WB4A 1AC5A 3ZWAA 3HB4X 3DL7A 5KYWB 3SNKA 2RFLA 1PRYA 3PYMA 4N65A 5BYKA 1M8PA 1KR2A 4WACA 4TN5A 2OFFA 3OOYA 1T8WA 4G4SO 3LOQA 3TRDA 1JEOA 1C3OB 3CNLA 4ZVQA 2KX7A 3FSJX 3HKCA 4HUQB 2OM2A 2BKXA 1NMYA 3TTYA 1SK9A 3H9UA 4I1SA 1Q0HA 4LF7B 1AF7A 1CJVC 3QPDA 5B7NA 4C3VA 2C5AA 3KQPA 1KAOA 1C3OA 2PAAA 3PE6A 4H18A 5KMGB 3I2JA 4UM7A 4AJ1A 4EGJA 1IB6A 2B6NA 1CWUA 1HYGA 4O3FA 2BMAA 2P2GA 3LKBA 1SBZA 4QWWA 4EITA 2GUGA 3CSSA 1XEWY 2ZYAA 4X8LA 5HNKA 2PX4A 2B1GA 1TZ2A 1Y48E 3EUEA 4YR7A 5C8VA 1T0PA 3VOSA 1Q95A 2DPYA 3MRSA 3VDRA 1M6VA 4ND6A 2R00A 2RD2A 4QRIA 3RV4A 3K70B 5JAMA 1N2OA 3UK1A 5IMBA 3ZLTA 3HFGA 5JI2E 3JQBC 3FFWA 2NU8B 2D1FA 4YWHA 2UYCA 2FOLA 1QLHA 2RAUA 3DB2A 4WXHA 4ZJUA 3QNUA 2QYHA 1Y42X 2FW7A 3SBOA 3HPRA 3WTCA 4V0KA 5J4HA 1YK1A 2EIXA 5GQSA 1SK8A 4NYJR 5H70A 1JPNA 4FBLA 1ADFA 1TL7C 1ZAKA 2H16A 1N8TA 1E1RD 2FSUA 2NO1A 4M49A 2JIQA 1A0OA 3S2IA 3PFNA 5AJZA 1BKSB 3LI2A 3PC3A 1J2JA 1Y9EA 4WLOA 1EXNA 5LQCA 1T9ZA 2BFAA 2EGHA 3QUTA 4MIYA 1FQJA 4EBBA 5KVAA 1LTQA 5K0BA 1N7IA 3H7IA 2P6PA 1J0EA 1S4MA 4HYEA 4IIFA 3DKVA 5C7LO 2X23A 9ATCA 3KJXA 4QVGA 1KVTA 2WHRA