4D0NA

Akap13 (akap-lbc) rhogef domain in complex with rhoa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title The Crystal Structure of the Rhoa : Akap-Lbc Dh-Ph Domain Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4d0nA00
4JLDA 2NO6A 4HUQA 4URXR 3QE0A 1ZUIA 3LV8A 1II9A 2OCPA 4HZIA 3GJ0A 4D2IA 4RKFA 1EK0A 2ORVA 1W1WA 5E4FA 3U2QA 2WWGA 2P5TB 5FH9A 2A30A 3LNCA 3VAAA 1SVSA 2QP4A 4C7OA 3NC0C 1COWA 4ZI3A 1D8TA 3BH7A 3K9NA 1FNMA 1R6BX 2LCFA 4P0TA 2UKDA 3W5IA 3QBVA 3KTAA 4E07A 2WJGA 3CRQA 3PQCA 4AKEA 2H7VA 3WRYC 1RRPA 4M9XA 1MRSA 2GXQA 1N5KA 1T0HB 4Y0VA 1KNXA 2D7CA 4HAYA 2ZM5A 2OFWA 1R0YA 3I92A 1GSIA 4DZZA 2VHUA 1GTVA 1P2VA 4D4KA 2VQSA 1ZMXA 1DPFA 3NC1C 1YRBA 4RCYA 1D2NA 2WBLC 2ZJOA 2ZXUA 1XB2A 2OEPA 2QMOA 2W6IA 2ZR0A 3RC8A 5J47A 1OIXA 4PSAA 1JR3E 3RNLA 1L4UA 1XFAA 4B3BA 1N6OA 4OQMA 3EZ6A 4A8JB 3CX7A 2CJWA 3DDCA 2DPXA 4PANA 1OH8A 2IYRA 4HUQB 3KJGA 4FI3C 5JWHA 2IYVA 4KXFB 2A3RA 4TMZA 4GMXA 4L4UA 2PZGA 1P3JA 4XWOA 6Q21A 2ZR9A 2G83A 3A8TA 4TYPA 4ASUD 3OE7A 4JT2A 4C7OB 4RD3A 2VHCA 5H1YA 1W0KD 1JB1A 4C2TA 4Q00A 5E3HA 5BN4A 1RJ9A 3MRSA 4HB3A 2NPFA 3KTAB 2ODWA 4DEXA 5A0FA 4DLTA 2Z4RA 2PL3A 3LA6A 3OIVA 1ZP6A 4NMMA 3T1TA 4TYWA 1FW6A 2WMOB 4URVR 1IY1A 1QF9A 2KJQA 4R2IA 5EXXA 1P61B 4LSGA 1JJVA 2QP9X 4FWTA 4KFRA 1NG1A 4ZDJA 3SBDA 3MWLA 4I1VA 4A2PA 1CP2A 2Z83A 4DEYA 1E1RA 2ZS9A 1JR3D 1DEKA 5D3MA 2KWIA 4IDPA 1WE2A 2H57A 3K53A 5GJVC 3I61A 2RHMA 3ICEA 1E2MA 2FSIA 1NN3A 4IXMA 1IN5A 4LBZA 4DLSA 1HH4A 2XJ4A 2OXCA 1E4YA 3VR6A 2ZYTX 2W58A 1C4OA 4PPGA 2V8OA 3ADDA 1P2UA 3NBZC 4LHYA 3I62A 1AM4D 4BFWA 3LW7A 4M1MA 1E6CA 2GKSA 2ZJYA 1Q0UA 5SZIA 1Z6XA 2CJWB 2JIZD 3SDZA 4XWAA 2AK2A 4ILEA 3QXHA 3KXIA 5IDVA 1B0UA 2A2ZA 4TL8A 1N0WA 1Z63A 3AB3A 3C5HA 4LV8B 1XTSA 2ANBA 3I5XA 1KI6A 2WWFA 1G7CA 3AGQA 3O47A 3RS5A 2JEOA 1P4SA 2W0MA 1WMSA 4Z54A 3HWSA 3TUZC 4PSVA 1RJ9B 4Z1MA 4KYUA 1KYIA 2F43B 5HZKA 2CLCX 1DAFA 1G6OA 5LBIA 1GUAA 3AQ4A 4K8OA 5KDDA 3D7MA 3VX3A 1KMQA 3CR8A 1FMLA 1OXUA 1U0HC 2WV9A 4HDCA 4ESHA 1XCMA 5D3MB 2BBTA 3KKNA 4Q4AA 3HU3A 1E4VA 4CVNA 1KDPA 4PQRA 5KSPA 1QBKC 1NBMA 3FB4A 2ZUBA 1E9SA 4L9WA 4LYJA 1J8YF 121PA 2FPKA 1GDDA 3DOFA 3VMFA 4XD7A 1CTQA 1EFRD 3QKUA 5BWMA 2X1VA 5EZ6B 2FWRA 1OFIA 4BE7B 1TU3A 2ATXA 3PG5A 4HAUA 2YC2C 3NH9A 4HSEA 2XOKA 1OKKD 4FD2A 4GT1A 1XJQA 1Y3AA 3SHWA 5JWRA 2JLWA 1G16A 3CPHA 3KX2A 3EPHA 1DE0A 4RD2A 3AVPA 3FMFA 4FMDB 2OHFA 4Q19A 2NMVA 3WNCA 3HPQA 3L82B 1G7RA 1KI6B 1OT3A 5JECA 5TXGA 4CF7A 3TQFA 5JFGA 1DO2A 4ZO4A 2WJIA 4QBIA 1Q3TA 2XB4A 4TTQA 4IDQA 2F1RA 4GFDA 1NIJA 1ZD1A 3I8XA 3BD9A 2RMKA 4M2LA 3AF0A 1NRJB 2BWJA 1G8PA 3KQLA 3KB2A 2NO1A 3ZZUA 4EPTA 3BXZA 5L3QA 3WMFA 3FHTA 1OXSC 4Q4AB 2I3BA 3Q72A 4KAXA 1TUIA 3SQXA 2ZRLA 1JECA 1SVWA 2GBLA 5HCNA 3LFUA 3I3SR 3BFKA 1R5BA 3GFOA 1ZIPA 4RJLA 2W0SA 1X8JA 3DKVA 3R7WA 5HR5A 5HKKA 3ZJYA 1VMAA 1IXRC 4FINA 5DHAA 1UEIA 3THXA 1CRQA 3TSWA 4LHXA 3ZQJA 5FTMA 3TUIC 1KGDA 1GRNA 1YE8A 1DAIA 2ATVA 2C9OA 3AP3A 4DLUA 3UMFA 2SHKA 3QPVA 1N0UA 4JZKA 4YQFA 5B30A 2P2LA 4GI7A 2MMGA 2IYZA 3W3AA 3J81k 3HR7A 2F6RA 3VHXA 1NJFA 3PVSA 2BKUA 3DO6A 3EZ9A 4PC3A 1OPXA 3P4XA 3GLFA 3NDPA 2VRWA 2JAQA 4MRSA 4HDOB 1AQUA 1A1VA 2C9YA 2QT1A 3CW2A 421PA 1W7AA 2JASA 4QRHA 2XX3A 2ZU0C 2J0QA 2D06A 4C0LA 2C04A 4TQUS 2RGXA 2A5DA 3RSLA 5DYGA 4CEHA 1KI7A 2Y8EA 4QG7A 3GJXC 1I4TD 2VP5A 5JRJA 1IY2A 1KO5A 2WWXA 5L3QB 3HYRA 4KU4A 4A0GA 4U7DA 4A2QA 2PZEA 4IW3B 5IK2A 4RCZA 5AUPB 4BFZA 4D0LB 1HEIA 2BEKA 2BCJQ 1VTKA 4RFSA 3B5JA 1II0A 2WAXA 4QBGB 4QBHA 2MSCB 1UDWA 4ZKEA 4B48A 4LYAA 2IBMA 3R7WB 3AVTA 4YONB 3RVBA 1GNQA 1KZ7B 1FNNA 1E2FA 3WBKA 3PIRA 5JRZA 3THXB 2WIBA 4BLRA 3CRVA 3PUZA 1NLFA 3ZDQA 1KDOA 2JLSA 4PC1A 3W6PA 4WW0A 2C9CA 2IX3A 2YHSA 1GZSA 3EASA 3B60A 1TL7C 2JLQA 1FL9A 1W5TA 2W6JA 4HATA 1NJGA 2IYYA 4E5UA 5FFMA 2HLDD 1FFHA 4O25A 4TTPA 3GLFB 1UM8A 2EU8A 2F7SA 3CX6A 4DLXA 2Q21A 1PLKA 4I99A 1Q12A 2IUTA 1KO4A 3EZ7A 4R7ZA 3TK1A 1YR9A 3JZAA 2OO7A 4HB2A 1YZTA 2O8FA 3PXGA 1ZUNB 4IDNA 3BB4A 5EXTA 3A4LA 4TSFD 3RWOA 4CEHB 1SVOA 1XD2A 5LD2C 2OFOA 5JJIA 5DN6D 2V1UA 2CDNA 4QGAA 1E99A 2ZU6A 1NP6A 1XF9A 3QSYA 2AX4A 3PFIA 4RFSB 3QVVA 4LC1A 1J7KA 1G64A 1SVMA 1OHHA 3U3KA 2QPTA 4TL7A 5FL3A 3X1YA 3RRYA 1Q44A 3AUYA 4NYJR 1KK0A 3EPLA 2D7DA 3E70C 2J7KA 4C0HA 2QGNA 3TNFA 1AKEA 1Z0IA 2HT1A 1IN7A 3GJ8A 2OXRA 4TWZA 1Z08A 4XVQA 5H70A 2N46A 5KOYA 1ZD8A 2G77B 3AKEA 1Z3IX 2CL7X 2WSSA 1L7VC 2G1JA 2QL6A 2YYZA 4KV9A 5GJBA 3SYKA 4LBVA 2ZJ5A 3BFXA 2OFXA 1FUUA 4Q9IA 2NGRA 5GADl 2Z0MA 2ZJ8A 1OSNA 3EZ2A 1WBBA 1DAMA 4PHFA 3C15C 5CYOA 1EFCA 2R62A 3MUFA 2ZI5A 2CMKA 1ZBDA 2QMUA 1ESMA 1GRQA 2O8FB 3O8RA 1IQPA 4BRWA 3LWNA 4YXWA 1U9IC 2YJTD 4DSUA 3KQNA 2QUZA 2PZFA 1XD2B 1EFHA 4EJSC 5JWOA 3LD9A 1M7BA 2QTHA 2W83A 4Q9LA 5C46F 4CEIA 1AS3A 2OSBA 4XH9B 1GL6A 3TKLA 5HTKA 4B71A 2VPPA 2QT0A 1VCMA 4Q48A 5G3YA 3CNNA 4B73A 2BM0A 3NVAA 5TB5A 2PMDA 1ZM9A 3P32A 2QSYA 2RB4A 1GP2A 3ADBA 4Q5IA 1KK3A 1F48A 1P9RA 4AC9A 4U02A 4Q1AA 1X8KA 2FSFA 3SS8A 4D0GA 1COWD 4B47A 4A6PA 1VPLA 3ECCA 4UQOA 3DEFA 4P4UA 4QOSA 2WVJA 4DRZA 5M04A 1NKTA 4X8OA 4EKDA 1W0JA 2VF8A 3H0KA 5JS8A 2XGJA 4OI1A 3K0FA 4LC0A 2ONJA 1FQKA 4NCIA 3AF3A 1P75A 3GJ6A 1Q20A 3KXLA 2GJAA 4H1UA 4LY6A 4ZI2A 3GD7A 3B1VA 1JAHA 4AI6A 2BJWA 1G8GA 4PX9A 4C2UA 4Q1CA 2V7QA 2ZREA 5G53C 2CXXA 5KSOA 4Z51A 2IEYA 4L9SA 3AVWA 4FMDF 1P2TA 1U0LA 3RS4A 1CKEA 2O8BB 4M1SA 3PENA 4OJKA 2VEDA 2CE2X 4NCJA 2Q9AA 1Q3HA 2GA8A 3EIHA 2IT1A 4LJ4A 1NLZA 2GEDA 2XZOA 4CEIB 4QJ3A 4S2EA 3GQBA 3FVQA 3QKRA 2BIFA 2EFGA 3RANA 4TYNA 2OG2A 2V3CC 3CZPA 3B1YA 2J46A 5HE8A 2WKQA 3B9QA 5BW8A 2ZRFA 3OE7D 5FOWA 4L15A 3W90A 3QG1A 2FPMA 1A82A 2G88A 3Q8XB 1KY3A 3Q7PA 5G41A 4UNPA 1OFHA 2BBSA 1CRPA 4G5GA 4POAA 4DT1A 1ODFA 4C0BA 3AVUA 1CF4A 2JLZA 2FPLA 3KFXA 2QAGA 2GZAA 2VP2A 3FOZA 3K0FB 5CIWA 4MYCA 2HJVA 2OAP1 3HDTA 2RGBA 4PXAA 1YZQA 4QM7A 1OB2A 4RY2A 2AD1A 1AGRA 1ZCBA 1RE0A 2K5UA 2JJ2D 1EX6A 1X1SA 1X8LA 2BMJA 3HU1A 3KKOA 5L3VA 1E1RD 1IJEA 4K81B 5KNBA 2MSDB 3CUEF 4A0RA 2VA8A 4M0LA 2H8KA 3LLMA 3SZRA 1BO6A 1LV7A 4ITRC 1XEFA 1W46A 2CVFA 1W36B 3TAUA 621PA 1C9KA 3WMGA 3UXMA 2J7PD 3B1ZA 4PSKA 2FH5B 2J1LA 5KHOC 3BB1A 3U3OA 1E96A 1HV8A 5EP2A 1CULC 2Q3HA 4DLRA 1CR1A 2MMCA 2GHIA 5FI0B 2ZYVX 3VR4A 5FOVA 4JLPA 3SI7A 1KHTA 4QFMA 4JLOA 1WA5A 1FP7A 1SHKA 4BFUA 3K9GA 2YZ2A 3OF5A 3N2EA 1NBME 1KMHA 1U99A 3QKRB 5B2ZA 1WDTA 4LJ5A 4GZMA 5EXSA 3W6OA 3WYFA 4Q18A 2GVZC 1DVRA 3C7KA 1U8YA 1MO3A 1H8HD 1PLLA 1SXJC 1X1RA 1ZCAA 3P1JA 2PJZA 3GPLA 4RD0A 3ZZ0A 1NMXA 4Z8XA 4EFLA 1CU1A 4NU0A 1A2KC 4O0MA 4DT1B 1P72A 4IVRA 4ARZA 1MO5A 2A78A 3F0TA 2OT3B 4Z1MD 2QAGB 4BLSA 4TLDA 3AVYA 3KUCA 4YDHB 1UDXA 1E0SA 4QHYA 2QBYA 5FUYA 4OHZA 3DKPA 5JJKA 1Z0KA 3CH4B 2FEMA 1UBFA 2VSOA 3BK7A 2GZDA 1MO4A 1G21E 3A1WA 5LPNA 4AYXA 4NP6A 1NBMD 2ECKA 4RFVA 4WZAE 3ZLJA 1VG9B 4P33A 1G7TA 3FGNA 4WZBE 3O8BA 1NSTA 4XD7D 2QM8A 4DKXA 2ZE5A 4ACBA 4NYIR 1Z2CA 5FR2A 1Z8FA 4NYMQ 5HPYB 4JBWA 4LJ6A 3WP1B 2XOKD 1OE0A 3DMDA 5DO9A 4PZLA 1KMHB 4WVFA 3BB3A 1G5PA 3L0PA 1TQ6A 4ZIRA 2ZS7A 1IXZA 1V43A 1MV5A 3MGCA 2ZRKA 1TU4A 2YOFA 4A92A 3GEIA 2HCJB 3U3RA 4B3XA 3BRWD 3VKHA 1JNYA 1KI3A 5HCIA 1IM2A 2C77A 1U81A 1Z0DA 1ZRHA 2AKAB 3B6EA 4TYQA 3NWJA 5FL7A 2ASEA 3L43A 4RD4A 4Q01A 4ARZB 2V6JA 1DAEA 4A82A 1R5NA 2ODEA 2ERYA 3ETLA 4DUGA 3LAWA 5CB6A 1N6KA 2PLFA 4OQLA 3W3ZB 2QBYB 4CDGA 4W9MC 4MKIA 5K8UA 3GLFE 1UADA 1Z83A 2B8TA 3I73A 2IA5A 1YRAA 5KNCA 1MKYA 1OF1A 4JS0A 5ELXA 1OFUX 1NG9A 1FMJA 4R98A 3TRFA 1LW7A 5J4HA 2JATA 3EWSA 4KSBA 3UG7A 4KBGA 3CZQA 3MSXA 3L8YA 4KBFA 2EYUA 2G3YA 1XX6A 5TDHA 3DM5A 2WTUA 1BKDR 5HKKD 1RFLA 1Q1QA 4B3DA 4PHHA 2V1XA 2GEVA 1LTQA 3R9XA 4YC7A 4UXIA 1NSFA 4QJ4A 1E32A 2NQ2C 2A5FA 2ZSFA 4CZ2A 5AUOB 4MDFA 3I32A 4OHWA 1ZNZA 4MRPA 5A5GA 3NHAA 4M9ZA 2F9MA 1T3SA 4OK5A 4GOJA 3EARA 4HAVA 1AS0A 4IJMA 4JKIA 5GVRA 1XPRA 4QBFA 4II7A 4KO8A 4B35A 1LS6A 4CT4B 2P3SA 3OAAA 4NH0A 4W5WA 4Q21A 4MYHA 5EP3A 3P20A 2HXSA 2DBYA 1VCIA 3VR1A 1QG4A 1GKIA 1ZVQA 4IEEA 2XZLA 2GXSA 3MWYW 3K1JA 1N0VC 2JLUA 1HUQA 4M8NE 4OL0A 5E7IA 2OV2A 3FMOB 1IONA 3UWOA 1S1MA 1CBUA 1RC8A 3ZVNA 3A36A 4UKDA 1ZU4A 5IK2D 2WAYA 4DJTA 1CJKC 2R44A 1W4BA 1Y63A 2CCJA 1OJLA 3L0SA 1XXHB 3A1TA 2ZUCA 4NBSA 5KSZA 4P3YA 3SYNA 3QJYA 4P32A 3T34A 2J41A 5TY0A 1JPJA 3TAHA 3EA0A 2NOAA 2IXGA 4WBSA 2EWWA 1XP8A 2AFIE 2W6JD 3LY5A 4MGIR 1Q22A 5CYPA 4IVQA 4KITB 5DSZA 2XSZD 4B3FX 1U8AA 2X19A 2ZRGA 4LWZA 2DFLA 4M1YA 4DCSA 4E09A 2QGZA 1J8MF 4B33A 3NBFA 1BYUA 2P65A 2WOOA 3UANA 3F3YA 4HLCA 3BOSA 2VHQA 4BQSA 3SQWA 1GL9B 4DB4A 2KE5A 2HCBA 1TEXA 3PEVA 5FUWA 3K0CC 2P6NA 1BYIA 3SJCA 4AKIA 1F5NA 4P4TA 2AR7A 2BDTA 4Q7MB 1E0JA 2ZQ5A 5L3SA 5JLJA 1JAIA 1KI4A 1AQYA 2EW1A 4QGHA 1FUKA 4DB2A 5H68A 1D2EA 3EC2A 1KSFX 1YHNA 4F38A 2V4ZA 1M8PA 4M21A 4URWR 1SGWA 3W5JA 1DAKA 1ANKA 1OHHD 2VTKA 3CWZA 4OI2A 1IOZA 1U2RA 3WMEA 1Z47A 4DXAA 4FW9A 2CE7A 2VO1A 2X77A 3EX7C 3IGFA 1BMFA 3LRPA 3BC1A 3WBJA 2VP9A 1L4YA 1VCOA 4JL5A 1FPMA 2J9RA 3CX8A 4QXAA 5FI1B 5FUVA 3ZVRA 1LS1A 2ZE8A 2WSSD 4NYIQ 2G1KA 4M4SA 3O8DA 1GFIA 4H9GA 1XRJA 2A9KA 1M1YE 1RRCA 5GVSA 3QUSA 3EG5A 4CW7A 5LB2A 2GDJA 3L8ZA 221PA 4BLQA 5F98A 3U3MA 5L3SB 1AZTA 5KNDA 2HF8A 4RZ3A 4DVGA 2RH5A 3SN6A 2HYIC 4YXWD 1CIPA 3MFYA 3KZ1E 4TTRA 3LLUA 4IDOA 4MRVA 3A6PC 1JPNA 3NH6A 3GLIE 2AKYA 2ZYUX 4US1R 1T5LA 1XU4A 1YVDA 4W5HA 1NVUQ 1ZM4A 4Q9KA 5F9FA 1EFTA 1U94A 1GL7A 2F55A 1WP9A 2C5LA 2G0TA 1SHZA 2NG1A 3M0EA 4F4CA 3KL4A 4NCNA 2GCNA 2UVQA 3GEHA 1E2EA 3MCAA 1TF7A 3PR1A 4TN1A 3T5GA 3LBNA 1HE1C 4GL2A 1IN4A 1ONBA 3GJ7A 1W0JD 3NBYC 4QHSA 2DB3A 5FPKA 3IILA 4YMWA 4QKQA 1P5ZB 3CF6R 4ZDIA 4CIDA 4D0NA 4BLPA 5C1BA 1Q1BA 1EESA 1VECA 2HUPA 1LY1A 1MABA 2YWGA 4TYYA 4Q4LA 1G7SA 1G1MA 1GWNA 4PAMA 4JLBA 2AK3A 4NONA 2QAJA 4M1KA 4O2LA 5IT5A 3T1QA 2FNAA 3FE2A 5J40A 3OEHA 2X2EA 1KI8A 1YR8A 2ODBA 2ONKA 2QRNA 3K0EA 1AZSC 5CDFA 2VP0A 4LJ8A 4ZKDA 4GRAA 1W36D 2WOJA 1SQ5A 2ZANA 3RS7A 1XEWX 1XMSA 1CJVC 2WZQA 1UEJA 3PUWA 4OQNA 3IIMA 1N6IA 3QIAA 4LBWA 5AWFC 1HA3A 4BFVA 4V0ME 1VG1A 2DWOA 5KDOA 3VKGA 1R0ZA 4LPSA 3GJ4A 3B1XA 3QG5A 2H16A 4DSNA 3D31A 3DVLA 4AKHA 3T12A 4Q1BA 4KFUA 4Q7LA 2QG6A 4LJ9A 3WRXC 4ACAA 1CR2A 3EWAA 5C4GB 2BCGY 1A4RA 1IHUA 1T5IA 1TADA 2XZPA 1I4DD 4LYFA 4M1WA 4TL9A 1Z06A 4U5XA 5UKDA 4B2IA 2G6BA 1SKYB 2OBLA 4JT4A 1GKYA 2DCUA 1YKSA 4LHWA 2FMXA 3WXMA 4TMKA 1HURA 4AKGA 2YOGA 3M4YA 3CRW1 2C03A 1YU9A 2RHDA 1K6MA 3C5CA 3PV0A 3A58B 4DWJA 1YZKA 1LFDB 2FOLA 3KJEA 1MABB 4XTCS 3SJBA 5H8WA 1CEEA 5CJPA 1YZNA 1KJYA 1W4CA 3K70B 1RRGA 2C2HA 2FE4A 2JJ1A 1W5SA 4R71A 1GILA 1NVWQ 4A1FA 1VYVA 1EWQA 2ZSBA 4OHXA 2QZ4A 2QP3A 1EX7A 3HJNA 5G40A 5C4MA 1S9HA 3U4QA 2XNSA 4WXPA 4US0R 3REFA 4DDVA 3K09A 1X3SA 2PMKA 1E2NA 1LB1B 1E1QA 1Z6YA 3KUDA 4YMUA 2OZEA 4G5SA 2J0VA 1NLYA 2CCKA 4HAXA 1T8UA 4JLMA 2KB0A 2IHYA 4OI0A 4MKHA 4L8GA 3B2EA 2ORIA 3PITA 2P67A 5EUQB 2D2FA 4IEIA 4HDQB 3LXRA 1A7JA 2KSQA 4DIEA 2GJKA 2EFHB 3Q85A 1F2UA 2YWHA 3AF1A 2NO0A 4HLUA 3RS0A 5IRCD 2RGNC 3SJAA 1E2JA 3D8BA 3QPWA 3BWDD 2WKPA 2W2XA 3WHKA 1DS6A 2QNRA 3KB1A 1XDBA 1D2MA 2HXYA 2J59A 1RIFA 2IW3A 2XEXA 4GMDA 4NCKA 4C30A 1M2OB 3TE6A 2B8WA 2FGKA 1CJUC 1NMZA 2UZIR 1KK1A 4AK9A 4TMWA 1OYWA 1DAGA 3FKQA 4U00A 3W9YA 4RD1A 1N3BA 1W48A 3FKSD 2W00A 4HYYA 5SZJA 1TF2A 2IUSA 1J70A 2H92A 3X1ZA 2N42A 4Q9JA 4WZ6A 4UNNA 3U4QB 4G01B 1KKLA 1Z0FA 4A8JC 2TMKA 4PC6A 2WSMA 2IWRA 4AWXA 3JZMA 4BPBA 4B32A 4BECA 1XXHE 1DADA 3U7FB 5JHGB 5B57C 1ZAKA 2HJGA 2VHTA 3OIUA 3U44A 3CPEA 3SHFA 5KYKA 2GXAA 2OM2A 5EE1A 1Z22A 1F2UB 3BORA 1GOTA 1TQDA 2WKRA 4V02A 5FOUA 3K8YA 1DG3A 1EG7A 4Q7KA 2GK7A 2WJJA 5FL7D 4LJ7A 2RGGA 1G17A 4A0FA 4DUGD 1VHLA 1W0KA 5JS7A 5LDDC 4HZUA 4FN5A 1XEXA 2QTVB 3SJZA 1OIWA 4PHTA 1G9XA 4IOKA 4EAQA 3GJ5A 2QRZA 3BIFA 4B2PA 4D4MA 1XTJA 4B6EA 4KFSA 5FPSA 3R8CA 4O2RA 3TJZA 1L8QA 3TW4A 1PLJA 3KKQA 3AF4A 1UAAA 1S4QA 1XJ0A 2YC4C 4X8HA 3OZXA 4N0EA 3RC3A 2QPAA 2BEJA 2IF0A 3TSZA 2IS1A 721PA 2ZS8A 1W4RA 3QVUA 4NYMR 1O87A 5TARA 4C9BA 3I5YA 3QY0A 4WAUA 3U7EB 4I1OA 4OQFA 3QF7A 5AUNB 5DGXA 3CBQA 3FWYA 2NZ8A 4F7WA 3CF0A 2Z5FA 3B7GA 2ZI3A 1UJ2A 3W34A 1E9EA 3KFVA 2ZUDA 2C98A 2CNWD 3DHWC 2IS4A 4IOJA 5BYJA 1VDZA 3Q3JB 4MH0R 2CHVA 4GP7A 3L0IB 2OILA 4ON9A 4YMSA 3OAAD 3NTUA 1AKYA 3CB4A 3TSOA 4JBYA 4JJZA 3IPXA 2CHQA 3N2IA 2CLSA 4N3NA 3GLGA 2X2FA 4DDWA 1G19A 3WP0A 2IXEA 3BE4A 1E2QA 1ZYUA 1HQCA 4HZUB 4I1SA 1XEXB 3EW9A 4B75A 2GESA 4LZZA 4I4LA 3SYLA 2QY9A 2QROA 4EFMA 3EPKA 2BMDA 5P21A 4TQAA 1JI0A 3H86A 5CLLA 4Q1FA 3DPUA 1XZQA 4EDHA 2CLDX 5AJVB 5FPTA 3SBEA 2O52A 4TMVA 4D6PA 5AJYA 1US8A 4EPWA 1XBTA 4B34A 4M22A 5CK4A 1N5LA 4EUNA 5EP1A 1N2CE 3BH6A 3CNLA 4A15A 2OCYC 3U7HB 2X8AA 1S8FA 1D9ZA 4LCBA 2LWIA 1GNPA 2JCSA 1Q1EA 2O8DA 4MKGA 4FCVA 4E22A 2ZJZA 2W6ID 1RYFA 4NKRA 4PHGA 2XNDA 5F9HA 1JXMA 3TBKA 4KJZA 1E2GA 1Z2AA 1S0UA 3QI2A 2NO9A 5JI2E 1OXVA 2FFHA 1F6BA 3EIQA 1XEWY 5CLQA 3B9PA 3GFTA 3ZIAA 4BASA 1G4AE 2BKEA 5CJ2A 2PEZA 1FX0A 1QRAA 1F3OA 2QA5A 3LX8A 4Q4JA 1II8A 1PUJA 2IYLD 1HYQA 3KJHA 3M1IA 1NIPA 4MGKR 3GLGB 2JLYA 4JBXA 4IFEA 4IRUB 4NHOA 1Q57A 2WHXA 3QQ5A 4LHVA 5K8IA 2HF9A 3FHCB 5KU1A 4DCVA 3JVVA 1AJEA 2FSGA 4C3ZA 4F4JA 2QENA 1JQLB 3A4MA 4B3GA 4M1TA 3MAAC 4RKEA 1EFUA 1SKQA 1ZJ6A 4DBLC 3IHWA 4OHYA 1US8B 1BOFA 1IY0A 3B1WA 2FGJA 4TZ6A 1E2HA 2IC5A 1XMIA 2IHBA 1ZM3A 2WWHA 2ANCA 4ZCMA 1R0XA 5CIQA 2WWIA 3VHLB 3LVRE 1T4GA 4PPQA 1MOZA 3K9HA 4B43A 4PC7A 5J5CA 2O8DB 2AN9A 2GF0A 1DTSA 2ORWA 3WNDA 4LV5B 4A9AA 3TW8B 1P9NA 1QHHA 5FTJA 521PA 5EUMA 3W6NA 1XPUA 3N70A 2Q9CA 4D4JA 1KY2A 1G4UR 1MR3F 1H65A 1NVVQ 4JJKA 4FIDA 5D3QA 1XTKA 2EYQA 1VIYA 2JLRA 5JSZA 4D81A 1QDEA 4Q4JB 1SKYE 1II8B 2I1VB 4C4PA 4V0KA 5JCPA 1CJMA 5L8VA 4RD6A 1E9CA 1SZPA 1SULA 2V6IA 2EFEB 4XJXA 4NDZA 1N6HA 4JKYA 1G8HA 1YZGA 4OHVA 4LHZA 4JLNA 4DIDA 3VNVA 3SNHA 3ASZA 1W2HA 3QXCA 1JEEA 5FPYA 2GBLC 5AK0A 2O0JA 1XMVA 5CDFE 4KLZA 4M9QA 2BMEA 3V9PA 3H4MA 3VFDA 4F4IA 2DYKA 3SC3A 4XVRA 1OH7A 1NVXQ 3G5UA 2AHOA 3QKTA 1MT0A 4DDUA 1XCPA 3B85A 2Z6VA 3BFVA 4B6FA 5K8LA 2JDIA 2PLRA 3C14C 4KVGA 3UPUA 3U61B 3PUVA 1KSHA 1E69A 3V4FA 3DZDA 1MO6A 3I8SA 3CNOA 4LBYA 1D9XA 1QHHB 4EPRA 3U3JA 5KUTA 5EE5B 4XIGS 2VHJA 3OIYA 1NN0A 4HLDA 4OK6A 5EXPA 5E7MA 1NY6A 1MRNA 3QXSA 2FSHA 2HV8A 3A4NA 5JSZB 2O0HA 1UKVY 4JVLA 3K70D 2RGDA 2HLDA 3OEHD 2FJUA 1F2TA 1TAGA 1OXTA 1M7HA 3R9IA 4B3CA 2BHRA 2XAUA 1WF3A 1ZM2A 2QQEA 2FG5A 3QEOA 1JEDA 2DR3A 4TLBA 4I81A 2QQ0A 1TX4B 3THYA 2P6UA 4D82A 3N5CA 2DY1A 1PVOA 1TUEA 1X86B 2QSZA 2FFBA 1OH5A 1GRRA 3SE0A 2J3EA 1ZM7A 1AGPA 1R8QA 2FF7A 1G6HA 2ZETA 2DFTA 3NIBA 1XD8A 1P62B 3ONWA 5FBVB 3M6AA 2QPOA 4URUR 4CEJB 3WHLA 1UBGA 4CT5A 2R6GA 5FUXA 1NF3A 1TQ2A 5J4LA 4FWIB 1EXMA 1IN6A 4G5OA 4PZYA 2RGAA 1Q21A 1WXQA 5BQ5A 4AIIA 4JYCA 3NDBB 5FR1A 1RRFA 4KHZA 1G5TA 4TLEA 1JBKA 1G3UA 1PUIA 2BC9A 3OIWA 4W7SA 3REGA 1KZGB 4A4DA 3FDIA 4BFXA 2CVHA 3I72A 3G82C 1T3HA 2ZSAA 4ZIRB 1N6RA 2D4HA 3ZVLA 2JJ1D 1F2TB 3VQTA 2J0UA 2ZI7A 1XWIA 4FCWA 4OBEA 5J4VA 5KTYA 1DOAA 4BZXA 1F60A 3BERA 4M1OA 4C0AC 4GBMA 3RS3A 1E94E 4PPFA 1FZQA 2CK3A 3GFPA 2PX3A 3PEUA 4GDFA 5DISB 4PC2A 1E2IA 3GEEA 1JR6A 3THYB 1E1QD 2C96A 1G3QA 1G3MA 1Q1ZA 2E1RA 2VF7A 2ZYWX 4YMTA 1ZINA 3CLVA 1FP6A 1BS1A 2GEUA 4A36A 1XNJA 2ODNA 3QXXA 4JMPA 2FV8A 3I4LA 4UXHA 1KTVA 4A8JA 5DIFA 2WJVA 4MRNA 3LVQE 4ERNA 5ANRB 1E2KA 3RRZA 3IHLA 2OAQ1 4LJYA 2V55B 1T3LA 1S9DA 1KAGA 1X6VA 3AKCA 3DOEA 3THOA 4MGYR 2QU8A 1O3YA 4RSGA 4HEJA 1CJTC 1QZXA 2DWPA 2IK8A 3EA5A 4BUJA 4O3MA 3DM9B 3LW8A 3QOFA 5EE3A 5F2EA 4BLOA 1BIFA 1QHIA 4I1UA 3HYTA 3KJIA 4IOLA 1WQ1R 3CPJB 1M74A 3C4JA 4AYTA 1GIAA 2WPDA 4S35A 1DO0A 2NIPA 1N6NA 2ZR7A 1AN0A 2BV3A 2J0UB 5JI3E 2BBWA 3D3QA 1AS2A 3AVXA 4XTRA 2ZRMA 1RZ3A 3TR0A 4CGZA 5JMTA 1OYYA 1KJZA 2E9SA 4B76A 2IEZA 4LOAA 3RRNA 3HP1A 3UMSA 3ICQB 2JLXA 3OEEA 3KQUA 2D3WA 3VR2A 4IVPA 2E87A 4Q1DA 2OBNA 2GRJA 3AM1A 2ZAMA 2CCGA 4Q03A 3HR8A 1V5WA 4KYIB 4D26A 4BLTA 2FFQA 4E03A 2AWOA 4IKEA 3ZVMA 1KDTA 5FPHA 4V0LA 3IBGA 2WIAA 3Q5EA 3Q7QA 4QNMA 3MJRA 2XB2A 4DCNA 3P27A 5FBRB 1U9IA 1U0JA 4JVSB 2GF9A 4P4SA 4US2R 4Q02A 5LD2B 1E3MA 4AURA 1OXXK 2FFAA 4EJSA 2ZRCA 5AJZA 2N1BA 1L2TA 3SR0A 5BXQC 1SVLA 1Z6TA 3RABA 3R8FA 4AY2A 1WB9A 2W2VA 1QHXA 2HEIA 3BBPA 3UWKA 3RDPA 4AD8A 4C0KA 2H17A 1FOEB 4EQ6A 3R20A 1G41A 3A37A 2Z4SA 1RPZA 1R10A 2F43A 3RYTC 3C16C 5TV2A 2G9NA 3EC1A 3TMKA 5CB8A 1WCV1 3KKMA 5HZHA 1TTTA 4PR0A 2OCAA 1W36C 2JJ2A 4B2LA 3GLGE 4D25A 1JALA 1KOFA 1UF9A 2HYDA 8OHMA 1XTRA 1NN5A 2R6AA 3TVTA 1ZUHA 2WJHA 1N5JA 4DLYA 2OE2A 3U5ZB 4AG6A 3OFNA 3AVOA 4QGFA 4JLVA 5DNYB 3CRRA 5FBLB 4IXNA 3ADCA 1KO7A 3LH5A 3CM0A 2J7PA 4N1AA 3IO5A 3B13B 4LPKA 5JBQA 4NZYA 4A0HA 2GNOA 2REBA 3ZS8A 4TLAA 4Q7JB 3RHFA 4IFBA 2XTMA 1A2BA 1M34E 2OUKA 2WICA 4MITA 4LK2A 2ZI6A 3TQCA 1JJ7A 2R2AA 1S96A 1T8TA 2D74A 1RYHA 1DARA 3A1VA 1P73A 1D5CA 3A1UA 4JL8A 1QHYA 3IBYA 2YOHA 2KBFA 4P4SB 4OK3A 1H8HA 5SZHB 4X8LA 4EJSB 2QAGC 1FQJA 4LV6A 2NZJA 4XSHA 2ZI9A 1TEVA 4MQBA 3P26A 1BH2A 2ZE6A 4LYHA 2IF2A 3SOPA 4DCUA 2O8CA 4ABYA 2IUUA 1R7RA 4R2HA 1NMYA 2LKDA 4URYR 4EQ6B 2QM7A 2V9PA 2ERXA 3CRMA 2QORA 4YLGA 3GLHA 2NTYC 3PJRA 1OIVA 3IEVA 4AYWA 3X2SA 2WJYA 5AUQA 1DAHA 1S1CA 4B44A 1K5DA 3QEJA 1W47A 3ADKA 1G20E 1SVKA 1JQJC 2ZRNA 3AUXA 2REXB 3WYAA 4MA4A 1E2LA 2C95A 1YZLA 2V7QD 4M9SA 3CONA 1H8EA 2IYQA 1I2DA 1GM5A 1E98A 2GTPA 1KSJA 1XMJA 5C2JB 4HB4A 4TT3A 2J87A 2HDNB 2WM9B 4MUAA 4IDHA 2QE7A 4DLVA 3AH8A 1UKZA 5DHFA 4ZV4A 2IS2A 4PO1A 2XNDD 4EFNA 4LI0A 4QJ5A 1UPTA 5FBWB 2OESA 1E9RA 1KDRA 3PEWA 1D6JA 1VYUA 1KIMA 3ZIAD 2IL1A 1S3GA 1CR0A 4GSYA 5EE9A 3T15A 4D4LA 2IYWA 2RGEA 5B64A 1S3SA 3VR3A 2O8CB 4BEBA 4G3XA 1T0JB 1W49A 3CKLA 3SFZA 2P6RA 2F3RA 2JLVA 4WXRA 3THWA 1GAJA 1DBSA 5GJCA 3FHOA 2VP4A 2CL6X 1CS4C 2BJVA 1SXJA 4JLJA 4Q4HA 1E9DA 3GLHB 1E0AA 2JA1A 3E2IA 3EZFA 3DZ8A 4NL4H 1DELA 1KO8A 2JGNA 2B21A 4ZDWA 2AD5A 5JCZA 2IYSA 2GCPA 1NL3A 2ZRAA 3RRMA 3VU9A 2PJRA 2DFNA 3VNUA 1I4LD 3W8RA 3C8UA 4NE2A 4D80A 4DHEA 2FA9A 3IQWA 2D62A 1E79A 1KJWA 1VKJA 4G1UC 3UKDA 1EWRA 1LF5A 1HE8B 3H84A 1VCNA 4P31A 4HAZA 3QF4A 4FMCB 4TMTA 4WOPA 2C8VA 2VIIA 3VKWA 3X1XA 2A5YB 4BWYA 4QC2A 3A1SA 3PUXA 3WNBA 4DCTA 1E9AA 4MYUA 4R9UC 4A6XA 4MKFA 5FOTA 3LDAA 4FMBB 4C0SA 4KVAA 1IN8A 5KSYA 2YWEA 1YR7A 4PQFA 5FTKA 4EPYA 1KI1A 4QHTA 2GCOA 4MYTA 4KSCA 1YR6A 4Y0AA 3THWB 1M7GA 3TIFA 5IHPA 1SXJB 4Q4HB 1Z28A 2XTNA 2AXPA 3KXKA 1VG8A 3UATA 1UFQA 2F9LA 2MSEB 3ZYCA 5JHHB 2YINC 1QG2A 3WYGA 3WY9A 3IO3A 2J0SA 2GAOA 3EAQA 1R2QA 1QHSA 5GJWC 3VU9B 2AL7A 5E95A 1YJ5A 3X1WA 3VX4A 4F93B 3TR5A 3D6TB 3NXSA 1W4AA 2JDID 2J45A 1PZNA 4M53A 5FTLA 1XTIA 2VLIA 1NNEA 5F3WB 3CF2A 4PZZA 1TQ4A 2ZJ2A 2C78A 3LBIA 3IPYA 3EIEA 5JJLA 3U6BA 3QF4B 1N5IA 821PA 5TMPA 2PEYA 1IXSB 1KKMA 3NG1A 1AA9A 2ZE7A 1A5TA 1NVVR 4A2WA 3C41J 3QKSA 2WWYA 5CM8B 1R5OA 3P4YA 3KQKA 1MH1A 2GK6A 3PCRB 1KO1A 4LJAA 4OQXA 1HT1E 3H2YA 3RAPR 5FOXA 2XSZA 2A7QA 3IEUA 2ZRHA 3DMNA 4C0JA 3G0HA 4UJ5A 1P6XA 3IUYA 1XZPA 3LQQA 2RCNA 3BS4A 2IYTA 2BBOA 3EXAA 2GCOB 4HAWA 1PJRA 2XJ9A 1WRBA 2BM1A 4GP6A 4BFSA 1PV4A 4B74A 4IHQA 4ASUA 1ZU5A 2ZPTX 3MD0A 2NPIA 1ZC4A 3ND9A 1WBDA 1E9BA 1U98A 3SEAA 4XOIA 2LKCA 5KDLA 1IBRA 2YKGA 2R65A 4OYHA 4HLQB 3S1AA 1YZUA 4MRRA 5TVKA 4MDEA 1Z6AA 1KNQA 2W2TA 4ZCLA 3DL0A 4IOMA 3T61A 2REOA 1VHTA 1R0WA 1U8ZA 1JXOA 3HPRA 3TH5A 3UMRA 3KKPA 4EPXA 1P2SA 3MJHA 1JR3A 2Q3FA 2GVDC 1QHNA 4Q47A 1G291 1T6NA 1XCGB 1ZIOA 4Z8YA 5AJWA 3LQRA 3MWJA 5DYIA 5JEEA 4CRWB 5SZKB 2BOVA 3BAFA 2FN4A 2DHRA 3Q5DA 2YNMA 2YVUA 3TLXA 2IWHA 2ZROA 3EPJA 3AF2A 3QKSB 4XSGA 5BN5A 3KDSE 3SFVA 4JSYA 1ZD9A 3E1SA 1TNDA 2ZTSA 5J4YA 3V00A 3F8TA 3FMPB 2I4IA 3VR5A 3U44B 2JIZA 4ESVA 3TVDA 1IAQA 3AP2A 1UKEA 2EQBA 2I1QA 3CH5A 1FTSA 3K0AA 2OCBA 1LNZA 2A5JA 2GXUA 2R6DA 1OLOA 2CK3D 3T5DA 4UXJA 5CM9C 2ZRBA 1GKUB 1K8RA 1XD9A 3IKJA 5LB4A 2O8BA 1KAOA 5HE9A 5K8TA 2ZRIA 1N25A 1FTNA 3S1AB 1DG1G 5DI3A 1GNRA 3FPAA 2V54A 3K0CA 4UNQA 2FZLA 1QHGA 1Z07A 1N6PA 2GETA 1GITA 1CLUA 4W5JA 2IS6A 4UNRA 3AEZA 3MG9A 2WWWA 2ZVQX 4JVMA 1B23P 3IIKA 1ESNA 3ND8A 3LBHA 5FTNA 3NBXX 2DWQA 3AV0B 4G5QA 1TPZA 4RZUA 4GOXA 3K0SA 2VSXA 3NKVA 1OV4A 4FCTA 4URZR 4WIAA 3T06B 4QM6A 1EFRA 2F1JA 2OBMA 5FBQB 2GAAA 2Q0HA 5G3ZA 1VYTA 2DFKB 2VYFA 1AK2A 2WPDD 3FFBA 3MMPA 2R6CA 1OKKA 4BFYA 1G3IA 4PAOA 4JYBA 4K46A 4PO8A 3AKDA 4X8MA 1NN1A 2B92A 3GLIA 3K0AB 5DLQC 2QTFA 1I2MA 3I1FA 4PAQA 4EIWA 3E5HA 1J99A 3TUJC 2AXNA 4HUTA 2GILA 1E0KA 1SVIA 2FEOA 3GMTA 3OEED 2GJSA 2O0KA 4V0OA 2ZITA 2Q6TA 3ASYA 4QNRA 4V03A 4JL6A 2KI5A 1IJFA 2ZRDA 1ELOA 1Z29A 5DI3B 4LUCA 3FFAA 1LF0A 2H18A 1K5GA 1Z6GA 3AKYA 5EZ5A 3CR7A 4ZDKA 4BEJA 2JJ8A 4TMXA 1N6LA 2ZIAA 4DC9A 1W2GA 2ZI4A 2Q9BA 3CIOA 1TF5A 3GJ3A 3BH0A 1XPOA 4BZPA 2ZSEA 3T1OA 1NY5A 2Z43A 4XVUA 5JZVA 2P5SA 1HY3A 2L0XA 1R4AA 4OKSA 4PQYA 5EE0A 1UBEA 4EPVA 4LDJA 3GP8A 1HQYE 2ZRPA 1BMFD 1UBCA 1P9WA 3K70C 5EQTA 1NI3A 2R8RA 1KK2A 1J90A 2B7BA 1G18A 4HB0A 5B58C 4MUBA 2IYXA 1XJCA 2BVNA 2PCJA 3H1TA 2ZSDA 4FMCF 3UK6A 2FDCA 3ZGXA 2EFDB 4Q66C 2KBEA 4PFSA 2AFHE 2CL0X 4KFTA 2J5XA 2EVWX 3B8HA 1U90A 2R6FA 3CO5A 2D2EA 1ZC3A 4V0MA 3GLIB 3UIEA 3OFND 3ZD7A 3OHMA 1P7CA 1FX0B 4DSOA 3GCGA 4DLWA 1Z0AA 4PPNA 4QGGA 5BYKA 4Q9HA 3GLHE 1HTWA 1T9HA 2B7CA 2FX3A 3MLEA 1C1YA 4GOKA 2XXAA 4RVCA 2H1LA 4BGDA 3RLFA 2UZ3A 3RWMB 5JEDA 3AGPA 4N0DA 2WMNB 3RS2A 1KI9A 2QN6A 1NKSA 2EWVA 1OB5A 1M6NA 1RVDA 5DI9A 1W44A 2RAPA 1GG2A 1VIAA 4NPHA 2C99A 2O5VA 2F3TA 3ZQ6A 5KO2A 2ZJBA 3LXXA 2QMEA 4JLKA 1RKBA 2RKOA 1E2DA 4JLAA 1J2JA 4DLZA 2IXFA 4MGZR 3K9LA 3SU8A 3QNUA 1E2PA 3LX5A 2H5EA 2HT6A 3CWQA 3B82A 2CHGA 5DH9A 1AIPA 3JVUA 1E9FA 3ZZTA 3PEYA 1G5RA 1HT2E 4L5BA 1T91A 3BJIC 2RGCA 4AG5A 3V4RA 4GPTA 3OESA 2PT5A 3NEYA 4H1VA 5IF9A 3TGPA 2ZEJA 3T1VA 4NYJQ 3U7GA 1QVAA 1LVGA 2B6HA 2GZHA 2ZVPX 2YV5A 2FZ4A 3QXJA 4JSTA 4L16A 1Z0JA 5EJEA 2GJ8A 3QBTA 3BGWA 2O8EA 4BZQA 3AVVA 2FU5C 4KCGA 3UG6A 2QEQA 4G5RA 4RZXA 5KPDA 4CEJA 4PO9A 3K09C 1H8ED 1P60A 4QL3A 3FKSA 1EGAA 3HU2A 1SXJE 5J4KA 5CITA 4DDTA 4GNKA 3O8CA 5E7JA 2XXAB 4TT3D 3IDQA 3FTQA 2CBZA 1CXZA 2VP6A 2QE7D 2ZRJA 1G8YA 3AVQA 4KODA 4LRWA 4UNSA 3Q9LA 4WA7A 2PH1A 5AJXA 3X1DA 3ZS9A 4TLCA 4F91B 3U60B 3QENA 4ZCIA 4TQ9A 4YMVA 2F1HA 2VH5R 2OLKA 3QPUA 4RZ2A 4J0QA 4GZLA 1TMKA 1OH6A 4TSFA 3MWKA 4DSTA 2XITA 1QVRA 4HLUC 1ZNXA 4YDSA 5DN6A 3PUYA 1GVNB 5C18A 4TZ0A 3NEJA 5AR1A 1OFTA 2VL7A 1G8FA 4NCHA 3LO5A 1ETUA 5EP4A 4JIMA 3NHBA 2ZAOA 2PBRA 3VTKA 4HI0E 4BRUA 4F92B 4TL6A 3IIJA 1ZNYA 1UKYA 4JVNA 1KI2A 4KI0A 3FYHA 2IYUA 3L2OB 2QI9C 2BMFA 1SXJD 1R8SA 1XTQA 2PX0A 1G3RA 4Q1EA 4V0NA 2XTZA 2G0NA 2EFCB 3B78A 1S2MA 4UJ3A 2NO7A 4KLNA 3R9WA 3F5FA 4PTLA 4ZPXA 2O8EB 4FXPA 4XWKA 4G0NA 2F1IA 2A5GA 2RGNA 1VG0B 2ZJAA 3IQXA 5DE3A 3RSOA 2QMHA 2AWNA 2CEAA 1OW3B 1ZNWA 1Z5ZA 3ZD6A 3T35A 1E79D 2OLJA 2VSFA 3AP1A 1XXHA 2PCLA 5FOSA 2GWHA 3W8NA 5CK5A 2VBCA 3U6KA 2GJ9A 4OI4A 2YWFA 5A4JA 3ZH9B 2PT7A 1KSGA 4BFTA 1RW4A 2Q3MA 4LX0A 2R9VA 4NTZA 3FMIA 5L3RA 3KQHA 4CYMA 3L0OA 4OJQA 1ZW6A 4C0QC 2P0EA 1YQTA 5KPJA 2CNWA 4LGMA 1CR4A 5BN3A
chains in the Genus database with same CATH superfamily
3AINA 3UT0A 5A03A 1O94D 3R24A 3PD0A 4MV4A 4CV1A 2DT5A 4JEIA 1HNWB 2IHZA 3ZKAA 4RKFA 1CDOA 1W1WA 4MKZA 1EI9A 2NT4A 3U2QA 3CUKA 3IV9A 3RW9A 3LNCA 5FH9A 1SVSA 1GR0A 2I4LA 1IWBB 3D5TA 1T8SA 3KOOA 4UDNA 3KJNA 3W7VA 3WLRA 5ITZB 1COWA 2XBMA 4ZI3A 5KKAA 3ZLVA 3K9NA 4CIDA 2WRZA 2QTMA 4PBRA 4UBJA 1OGIA 4MVXA 5SY6A 3SM3A 3KTAA 2NVBA 5ED0A 1XZKA 5CT5A 3PQCA 1UBMS 4AKEA 1IUOA 4BNFA 1QP4A 1BXGB 1IZ8A 2H52A 3D3NA 3FNEA 4RPKA 1BMDA 3LQ1A 4M9XA 2Y2UA 2AXQA 4XAQA 4ZC8A 4GVXA 1QDLB 1CNEA 4ID3A 3B3GA 3STXA 3WA6A 4Y0VA 4HAYA 1U8FO 4Q4DA 1VFNA 2B69A 5E1OA 1GTVA 1Q7BA 3MGAA 4GDMA 4KQCA 7MDHA 2PMCA 2LNDA 3OE5A 1SOWA 5JXGA 4HL6A 1LJLA 1PEDA 5KWIA 1OLUA 4RCYA 1XZNA 2QD2A 4KYVA 1ECGA 2ZJOA 4M83A 1TVKA 3AIIA 3CNEA 2QMOA 3DVQX 2P90A 4H35A 4NFSA 1M1UA 2W6IA 3A1FA 4P8RA 2X7JA 4FZRA 4UQLA 5J47A 5JQGB 3EIXA 3RC8A 1NQVA 1OIXA 4RK4A 4URFA 4UU7A 5L7WA 1UK6A 4OQMA 4ZVSA 3CX4A 4A8JB 4LTDA 3DE3X 3DUFA 5HS6A 1FSSA 3KYBA 1WXGA 4B6JA 4PANA 2QMQA 4N5DA 1OH8A 3CXRA 3KJGA 2X5OA 5JWHA 3REQB 2B9EA 3S8YA 4X3OA 4H7PA 2BFCB 1XRMA 2G83A 3MTEA 3C3MA 1CPYA 3DQQA 5AKEA 4C7OB 5ALOA 1ND6A 4I55F 4C2TA 3ZN2A 1ABBA 4KSYA 1NE2A 3LVFO 2AW3A 1CZLA 4FKMA 3MRSA 4AJIA 2HWUA 2NPFA 5BN4A 5TR9A 2ODWA 5MN4A 1J20A 5A0FA 2H07A 2PL3A 3LA6A 1GV1A 2JZCA 2YFHA 4N5MA 4URVR 4IIJA 5F1KA 1IY1A 2KJQA 3PJEA 2C0PA 5DMXA 2JIMA 2XA2A 4ID9A 1O7JA 1D03A 3ZJTA 3MWLA 3R40A 4QTZA 3SYMA 1EJ0A 1DEKA 4G26A 1JYSA 2KWIA 3CZ4A 4L8FA 4MJ3A 2H57A 1E77A 4WN3A 5GJVC 2NU7B 3ROFA 4QTXA 3U37A 3VZPA 3X3HA 1E2MA 3NBMA 4QO7A 5CD1A 2Q5FA 3OHSX 2DETA 5EOVA 1C9NA 3CGWA 2JJQA 3IALA 2HIHA 4DGSA 1VJ0A 2OXCA 3CR3C 3ET4A 2PM8A 1H2BA 2DWCA 3Q7TA 1TT7A 1AHIA 4Z0PA 2P35A 2OP1A 2M6SA 2R3SA 4LHYA 3W1WA 1X15A 2PYIA 4JLWA 2OENG 5CH3A 1NW7A 1DCKA 1H0KA 2CJWB 2YHBA 2KMLA 2FG7C 1UDRA 4XWAA 4YJ2A 1WXEA 5IG2A 3ZCUA 3E9EA 3HJGA 5TJ9A 4ANFA 3QXHA 1QRRA 5HRUA 3IL2A 1GO2A 5BNZA 3UJ3X 4C29A 3KXIA 2GGSA 3BRQA 1B0UA 1S8AA 3U4AA 4QZVA 2A2ZA 3MTBA 1Z63A 1T3GA 2ANBA 1Y4DE 2N47A 2WWFA 2ZB8A 3O47A 3OY7A 3RKUA 4A23A 1JDPA 5BSRA 4CKWB 5GINE 1UPFA 1IAVA 4V2IA 3JQGA 2W0MA 3EBLA 4M7PA 5EHIA 4XSVA 1RJ9B 2VNSA 3CC8A 1KYIA 5BV1A 5AW6A 2I03A 3F6CA 1VOTA 1I2BA 5LZ9A 2C0QA 2JJMA 3FHLA 1H6BA 4WKOA 1J7JA 1LLQA 1OZ0A 1RLOA 1U1EA 1YRHA 4K8OA 2JD1A 4ZVMA 4U7GA 3N2GA 5BSTA 5K01A 2X8BA 5BSHA 3B1FA 4GX5A 4HDCA 4KMSA 2R00A 3L01A 3WSTA 2XD9A 4P82A 5CMLA 5D3MB 1PFQA 1QUFA 3HU3A 4JI6B 1ZVVA 1RWMA 4J3JA 4MEJA 1QBKC 4EKIA 1SBQA 5HIMA 2XUQA 1LSUA 5EJGA 2FWMX 1LPMA 2NX2A 4HDKB 4LYJA 4NATA 3VPBA 4ATNA 2AJDA 1EDBA 1DJPA 1J0BA 1J8YF 3BWMA 5EPUA 2W6PA 4A10A 4DYVA 1HYBA 5J2TF 1CUIA 4JJGA 4XD7A 1RHKA 3EGWA 5BWMA 4BCBA 3DLTA 4KO1S 4XJTA 4J9UE 3ZX4A 4BMDA 3HXTA 4DG8A 1L5HB 4HSEA 3A6KA 1JAXA 4YH1A 4NMWA 1PG0A 1EXVA 5J23A 2ZZMA 4DPLA 3FJOA 4FD2A 4M8IA 4EHFA 2JLAA 3VJMA 1OV6A 5MN6A 1VPEA 2MSKA 4RK1A 1FVHA 2NWQA 3GB9A 2CFTA 3T0GA 4LGYA 1KRWA 1LLDA 4Q19A 1RHMA 2VF2A 3LUAA 5GP1A 4DPMA 3DOIA 1I13A 2QLFA 3L82B 3ZCQA 4BV2A 1AC5A 1ZD4A 1OT3A 1CY0A 4DCJA 1LPSA 2BFMA 1QP8A 2XD4A 3IC5A 4ZO4A 2WJIA 3HB9A 4TTVA 5B3JC 2RGWA 2WMDA 3VTFA 4H0NA 3RUIA 1NIJA 1ZD1A 1VBNA 4QTUB 5KAPA 2OO5A 3I09A 1NI5A 4QXRA 5BO5A 3WKDA 2SNIE 4EY5A 4WZAA 1KJNA 2Q1TA 5J2UA 2V0NA 1NRJB 5BURA 1G8PA 2BFWA 3JPWA 4FOSA 4NEHB 4PXSA 4WZBA 1VGQA 3KQLA 1XGKA 1F1BA 2BFOA 6GPBA 4DR3B 4G0QA 3NGMA 4FU0A 3PTLA 2YJ6A 2A9VA 2HSEA 1PI3A 3GJQA 3G7UA 3GT4A 4FQ8A 2P3OA 3S2FA 4IG9A 1L5SA 2I3BA 2RIPA 5G1NA 1NQOA 1TUIA 3H3FA 5F2NA 4HXGA 3L7LA 1CIVA 3HKBA 5CVCA 3W2EA 3HCPA 1PQYA 3S28A 3LFUA 5ER9A 2VWHA 3I3SR 1U63A 2ZTUA 3H2IA 1B73A 5DNAA 3GFOA 4U0KA 4ZAVA 5HR5A 3UJAA 4OUDB 4ZCRA 1PVDA 3QPCA 1Q7EA 1VMAA 2VNHA 1UEIA 1AGYA 1YJ8A 3G2NA 1RLJA 3SEFA 5AUPB 3M82A 3D59A 3MBOA 2O1WA 4JITA 1KH3A 2ATVA 1DAIA 4HRAA 1SAYA 1L1QA 3AHJA 3GJSA 4AVYA 1DFHA 5AIBA 2J5RA 2SHKA 1J21A 1ECCA 1V4BA 3QPVA 4JZKA 3W5SA 3WL3A 4YQFA 1N5RA 3AB7A 5AW8A 4K40A 2IP4A 2VTVA 4GECA 2MMGA 3W3AA 3NIDB 3J81k 3GY0A 5IJZA 2OD2A 5DGCA 5ICFA 3QW4B 3HJTA 3L1VA 5FX2A 1AHHA 3EZ9A 4IIVA 4I1RA 3SHVA 3GLFA 2OCXA 2VRWA 3JATB 4J0FA 1YIDA 1VJ5A 3CLHA 4YRAA 1IQRA 1EK1A 1I01A 1I4EB 2QT1A 2WG2A 3NHLA 2IU3A 1PP4A 3O3MB 2GLTA 3WFIA 1MZVA 4Z3KA 4MTLA 4H7HA 3ACDA 1I3NA 2ZU0C 5ITSA 1JDUA 2D06A 2XUAA 2C04A 3GBPA 4C0LA 4YJKA 4TQUS 2Z56A 1VE5A 3IAM1 3NJ4A 1PCXA 2RSLA 1OLXA 5SY4A 1GYPA 3QHAA 1C9YA 3ZY3A 4B79A 3B53X 5TPWB 4LGCA 3HYRA 5JYEA 4KU4A 1CQXA 1U4OA 2DOKA 1Y89A 2EL9A 1U5CA 2L18A 3W7AA 2IU4A 3UWPA 4D4GA 5LWHA 1NTRA 1SZDA 4G0XA 4RCZA 3ANTA 2R1TA 2I4NA 1OI2A 1P8AA 2ZQYA 1DQPA 1VTKA 3B5JA 4LISA 2WAXA 4C14A 5IHXA 1KVRA 4ONEA 5ICCA 1HETA 4J6FA 3DBIA 3C6KA 4IKOA 1OFVA 1R6AA 3R7WB 3GAMA 3LUHA 3RVBA 4YV7A 3GARA 4HAIA 1E2FA 1NI4B 1XVVA 2VUHB 3KC2A 3WBKA 3EHEA 5JRZA 5JH7F 1FCJA 3MRTA 3ZDQA 1RU3A 1CEXA 3C4VA 4RETA 1EFAA 3CT6A 3KLOA 1TE2A 2YHSA 1YI8A 4HNVA 3G1TA 4ZVUA 1FL9A 1W5TA 2PX4A 4RTMA 2DP4E 1NJGA 2H1WA 4BVAA 2JFFA 5B1SA 4YIKA 2EJCA 3L4EA 5AQEA 2GERA 3WYBA 4PIMA 4BP3A 3GRKA 4HPXB 2GN6A 1YS4A 4O25A 3RYCB 5ICSA 3OA0A 4IINA 2EU8A 2LUOA 2Z2JA 5F1OA 4ENUA 4DLXA 4G0UA 1L4LA 4X6YA 2PUWA 3Q9UA 5AXBA 1UUFA 2IUTA 4C08A 1BE6A 1OLSB 3AY6A 5JXIA 1VGVA 3JZAA 3MGGA 1A9OA 2OO7A 4C01A 4IDNA 4OHCA 2ODQA 3BB4A 1G0NA 1L4FA 3IE0A 3PYMA 4CEHB 5JMPA 3VR5H 1V8ZA 1Y4SA 5DK6A 5BOVA 1QLWA 3D0RA 5ITWA 5JOQA 3NYIA 1YL5A 1FFEA 3QLEA 4E1VA 3EMDA 1RJGA 2FZCA 4HN2A 1NNI1 2ZU6A 4HF7A 1EWVA 1XZFA 4AZ0B 5G0WA 1QTIA 2ZIUB 1VPVA 3BWBA 4Q6BA 4RFSB 4AMUA 4X6LA 1G64A 3T4EA 3RRXA 4MUMA 4R8SA 3RRYA 1T4DA 1VE7A 3VSEA 3FSGD 3O0DA 2D7DA 4Q9NA 4C0HA 3BDVA 5HHTA 1IDN1 4EGJA 1AUQA 3HHEA 1KEEB 1M2VA 2OXRA 4GRDA 5K0GA 2YDYA 4GD3Q 4G4IA 4XVQA 4UM5A 3ZWQA 2OHGA 5C1IA 4I9UA 4WN9B 4YRDA 2N46A 5CVUA 2X2PA 2NQTA 5KOYA 2BFFA 1MHTA 5DGTA 3AHCA 3BSSA 3HDHA 1U0RA 2YYZA 1E8MA 1JH8A 1GQQA 1YNOA 2F1OA 3IP6A 4HBGA 3SYKA 4IIGA 1COZA 1RP7A 1X7GA 1B0AA 2OFXA 3BFXA 3DBHA 2NGRA 3B5IA 3EXEA 2VRCA 4DDMA 1N9GB 3RGGA 1ZD5A 2KQUA 4UDYX 2P8JA 3C15C 4P7BA 2SBTA 3BBLA 2R62A 1A3CA 1SY7A 5F4BA 5GOTA 2W70A 1RRVA 3TTYA 4CMEA 3DFMA 2NP6A 4OQEA 4UOEA 4BRWA 4OB7A 1K3FA 3D7SA 3LWNA 2YJTD 4QQNA 2QUZA 4DNXA 2YYSA 2PZFA 3N3BC 4XFKA 1EFHA 2WUFA 3CUSA 1K68A 1M7BA 1TI7A 2IODA 1E4EB 2JFHA 3I5UA 3JYOA 4HJXA 3NI2A 2Y4NA 3OZCA 4AP5A 4CEIA 4R9NA 2PZBA 5HTKA 1EJ6A 4G85A 1O6FA 1K7EB 1ADBA 2IDJA 2QT0A 2V5VA 3D8SA 4IQGA 2R6JA 3CNNA 4R1QA 3H2ZA 4IIJF 2PMDA 3M4JA 4UTZA 3FOEC 2ISSD 3P32A 3PIDA 3WLIA 2VZ9A 1GP2A 4CCAA 4DIBA 2PR7A 2ZCUA 4KEAA 3IEPA 3EQ2A 4Q1AA 4E21A 4I9NA 1X8KA 5C7OO 1XZGA 2CXHA 2P0AA 1COWD 1DBWA 2FPPB 4UQOA 3T7AA 3D6UA 4P4UA 3KQMA 2NU9B 4DRZA 3IOBA 4LZLA 3WV5A 4YALA 3FF1A 4MV6A 5KYUA 1BDHA 4OI1A 4LC0A 1NASA 1AO3A 3WSVA 4G0YA 1L7NA 1G2OA 1YDHA 1QYRA 3MPOA 4H27A 1RHUA 1T9BA 2GJAA 2R96A 3HDVA 1ORWA 3ABRB 3M4NA 3T41A 4YREA 3B1VA 3K5PA 4DR2B 2ZIWB 2C2BA 1PQ4A 1PGJA 4Q1CA 4MLZA 2ZREA 1H1TA 5D7NA 3L0CA 4YJ2F 4TX1A 1ZMTA 3CN7A 4L4RA 5EZSA 1GHTA 1T2EA 3KYDB 4NENA 3AVWA 1U0LA 1L7AA 2DR0A 2IEIA 2WJZB 1CKEA 2A1IA 3ORFA 3W9SA 2EV9A 5IYZA 8ATCA 2BPOA 2RJNA 2VJBA 1T1SA 2GA8A 5JAPA 1NA5A 2XCIA 1UMCA 4Y2GA 4LJ4A 2O8NA 2EDAA 2XZOA 1Q7CA 2FJPA 1ZJWA 1FB5A 1A9QA 4UEOA 5FPQA 2LVBA 2ZPAA 3IESA 4IFTA 5A3VA 3T7CA 1TJNA 3QKRA 2F4VB 5JD3A 1DG9A 3RANA 4DWWA 1YR2A 5D1NA 4TYNA 4KQXA 2YYYA 2J3KA 2OG2A 4JJEA 4BC1A 1QYCA 2CFSA 1H0HA 1CF2O 2J46A 3EHDA 5HE8A 3B9QA 3VJKA 5BW8A 2AFRA 3HCAA 3QYFA 3W90A 2IX9A 1N7GA 2FPMA 3QG1A 4Y6LA 2G88A 3QMPA 3PFWO 4RVDA 2YV3A 2BBSA 2V3WA 4BNDB 4DT1A 1CRPA 1U1GA 2AGVA 4C0BA 2R97A 3AVUA 4Y2QA 4YR7A 4M9UA 3FOZA 2QAGA 5CRIA 4BKPA 1UXHA 1Z0ZA 4BGVA 1T4BA 2EQ5A 3E9YA 4EYSA 2H4ZA 1AGRA 1ZCBA 1RE0A 2JJ2D 5HKBA 4K2AA 3SZOA 1X1SA 3DFUA 2Q1SA 4G0ZA 4IJKA 3S2UA 1EPUA 1ADYA 1SG0A 1CB7A 5EJ7A 3UK1A 2P3LA 4K81B 5KNBA 1VLJA 2PX2A 3AFGA 4LWOA 5ALTA 2XGSA 2H8KA 1V1JA 2QZSA 1BO6A 2RIRA 2VHZA 1N2IA 4ITRC 2QRVA 1W36B 2PKCA 1RXSA 5DX0A 2R5NA 1JA1A 2HMWA 3WMGA 2OB1A 3GW8A 2J1LA 2X42A 4P93A 5U9CA 3AEXA 4F2HA 3S2IA 3WQBA 3SIRA 5G4KA 4EW2A 1L5FA 3EVFA 4MUFA 2GHIA 5FCDA 2SECE 2NMVA 3GJRA 4RXUA 4JLPA 1GPKA 2E0IA 1KHTA 2ZIZA 4KB5A 3COPA 5FOVA 4QFMA 3BKWA 4YX9A 2YVAA 2M6LA 1P7ZA 3K9GA 3OF5A 1V6AA 1NBME 4Y6QA 5HTOA 5AI5A 2AG0A 1Q0LA 1WDTA 2PAAA 2Z95A 1LC0A 1TA0A 5I9LA 4AJPA 1R88A 1EZ4A 4B4OA 2JKZA 1CUGA 3TECE 1NWHA 5B1IA 1VXRA 3CPSA 3TNJA 4C88A 1SXJC 4MEBA 4LY9A 4KQKA 3P1JA 1WCIA 2FRVA 2PJZA 1C3OA 2AE1A 3IDAA 2Y67A 1R27A 4ARVA 1Y4AE 1VP9A 1QRDA 3U9TA 4D41A 4NJEA 3WGOA 3M5CA 3PSAA 1SZCA 3IX7A 4JBGA 1P72A 4IVRA 4ARZA 1MO5A 3CW8X 3I9OA 3VDMA 1AE1A 1VFPA 5IJ9B 1GAWA 3LUGA 3OM0A 5LP1A 4BB9A 1LPPA 2O4CA 1TM4E 5BSWA 3UBTA 3A04A 1RQGA 3ENZA 3MCWA 3TEMA 2IXTA 1MJNA 3T3MB 1OB5A 3Q3VA 4YDHB 3Q87B 5F35A 1DKOA 3Q3HA 4OHZA 1JG1A 1GPNA 3R6TA 1UP7A 1YDFA 4RVUA 5ALEA 3CVWA 4WADA 5JJKA 4I50B 3HDYA 3WDKA 4DL9A 1HNXB 2PUGA 3KLMX 1KTIA 1SD2A 2PJUA 4I66A 1H66A 1A77A 1U6KA 3QJ5A 4GBGA 3QLVA 1UFVA 1J0XO 5AJUA 5AOAA 4RFVA 1DLIA 3AOEA 3H0CA 2R0QC 4J3NA 4LRTB 3ZLJA 1ZOPA 1QF7A 3O91A 2M2IA 1E1YA 4RHUA 5HGJA 1BW9B 4DJFC 2UXDB 2HBRA 3M2PA 3Q1LA 1NZDA 2J3HA 1WW8A 4XD7D 2DHQA 5KYWB 1ZQ9A 3NAMA 1W1UA 5LOVA 1OU4A 3LPLA 1IVNA 1O94C 1GXSA 3OP1A 1Z3CA 3GMIA 5AKGA 1QGUB 4U0JA 1L5LA 1M3SA 4J03A 2A1TS 3G17A 1KMHB 1WABA 2VYNA 4PZLA 3G2MA 1WZCA 3SXPA 3MJTA 4YQYA 3J7TA 4FM9A 3L7DA 3SVZA 1N92A 1CUEA 4JC8A 3OOWA 3S2EA 2ZS7A 3PX7A 4RW0A 4YP6A 1V43A 1DRVA 2ZRKA 5HRAA 1TU4A 1X80A 1SB8A 2C84A 1WU7A 3GEIA 5IDWA 3U3RA 3I1YA 3HN2A 1LBSA 2HQBA 3VKHA 5HCIA 4O4IB 2JLCA 3OPMA 2JH9A 4J3FA 3L4JA 5I7EA 3MCTA 2ASEA 3OLWA 1Y37A 1XQ1A 2QRQA 1PQPA 1R5NA 2H4YA 4LXTA 4Y3UA 4OLAA 4BNIA 3PHIA 3LL4A 5FLYA 5B2EA 5CXQA 4CTNA 2X3YA 3G9UA 3I4FA 2PLFA 3KALA 3W2GA 4DV5B 1T2FA 4DMKA 3W3ZB 2VSNA 1GEEA 3H2HA 4E15A 2P2GA 4C6TA 2G0AA 1AK9A 1I1HA 2F8LA 5FWYB 1YRAA 2B94A 2I5PO 3N2NA 4GMKA 3JR7A 4JS0A 2HWYA 3EXHC 1I3KA 2OYSA 3LQFA 4RADA 2CYBA 1OFUX 1NG9A 1VE6A 4Y2VA 3RUDA 2EARA 3DE5X 3OIFA 2QZPA 1PL6A 3C4QA 3TRFA 3ASUA 3EWSA 1PT8A 2BFBB 2ZSKA 4LRQA 3MSXA 3L8YA 3CV3A 3DMGA 2G3YA 5F77A 3DM5A 3QVTA 3A6FA 1OZHA 3ZUGA 2H1CA 2Z9DA 4RDCA 2GTHA 3M8KA 3U09A 2I2BA 4DQDA 4B3DA 3NS7A 2V1XA 3OZDA 4PHHA 2W93A 4PW0A 1BCSA 4RM2A 5EJ4A 5DM4A 2R7AA 4QJ4A 5AVSA 3OP4A 2GK3A 2A5FA 2QJTA 2BT4A 4FEAA 3OCJA 4QODA 4K86A 3NHZA 4FBMA 2VH2A 3RAFC 3W3AD 3NORA 3R3UA 1TXGA 3BEOA 1SJ9A 1T3SA 4GOJA 4HAVA 4JKIA 5HDQA 2XNHA 4L7VA 2OZPA 5I01A 2FZWA 1ITZA 1JVNA 2BKLA 1D2GA 2DE0X 3RS8A 1QQ6A 1GA4A 4Q21A 1Q84A 2O2DA 4UHBA 3VM6A 2Y76A 5EP3A 1UXIA 4FLEA 4TKMA 4F6CA 3U7IA 2DBYA 1VZ2A 1U3GA 1T5SA 4RE5A 3EMVA 2XZLA 2GXSA 4Y2JA 3HVKA 1L4BA 1C7ZA 2JLUA 1HUQA 5LLDA 2A5LA 5E7IA 2OV2A 2UU9B 2GZ3A 1BU5A 3FMOB 1MAAA 1IONA 5KJ1A 3UWOA 4HXYA 2HUNA 1INLA 1P4RA 3A36A 5DLDA 3TIIA 3DEZA 3RBVA 3RT7A 4BVHA 1CJKC 3EVDA 3L0SA 3L6CA 3EY9A 1XXHB 2V7BA 3G2HA 3SX0A 3KEFA 3FYUB 4P80A 1S3IA 5EWLA 3KCNA 1M5RA 4MV7A 2FZEA 3AI7A 4URXR 5A62A 2A84A 2BF4A 3DKIA 2GCEA 4DJEC 2Z4TA 3HVRA 3LY9A 1Z0UA 4P32A 3EFBA 3T7SA 1NR7A 1T0IA 2BRUA 4G89A 4HFMA 4IZ6A 1D0SA 3H5VA 2NOAA 2IXGA 2X4DA 5TY0A 4G81A 5LC1A 3HBNA 3GLRA 3ZY5A 5D84A 2WVGA 3PEEA 4JXZA 1P44A 3WLQA 2Y1WA 4ER5A 3ETJA 2ZR8A 4MGIR 1Q22A 3UFXA 6ABPA 2O7QA 2XSZD 3PXCX 5GM1A 2X19A 3KOXA 2ZRGA 2QRKA 2ABWA 1HDEA 2QGZA 5TIIA 3FUVA 1QZZA 2ISQA 1UZNA 4R69A 2CZQA 4WESA 3KSUA 1ICEA 5H16A 2OECA 3TL3A 1DKPA 2GK4A 3M6UA 2HLHA 3HR4A 1NW5A 3PEVA 4RNCA 3M81A 3EPRA 4MI9A 3VR6H 2NZVG 1BYIA 2DH5A 1VM6A 1F5NA 1WNFA 2JFNA 2AR7A 4Q7MB 1E0JA 5A2GA 1CQPA 1GAQA 1URPA 1Q50A 1WHSA 1KI4A 3OSZA 4BVJA 3PE6A 1JQKA 4OP3A 3CUWA 3H4VA 2H4JA 2P79A 2VNJA 3UAGA 1KQFA 1SWWA 1NM5C 4WCVA 1SCUA 2QR2A 1E3WA 1ENZA 1QNLA 4M1QA 1T24A 2HNKA 2PNFA 2V59A 2ZULA 3VR0A 4F38A 3WLHA 2NZYA 1PJ8A 1M8PA 3M3DA 3NASA 3BK1A 1H5QA 2I8LA 3W5JA 2YRWA 4M54A 3MB5A 4CGYA 1FMTA 3CLUC 3DHYA 3KG2A 2DT8A 4Z53A 1CF9A 1QGYA 2AYZA 4A5OA 1IOZA 2VBFA 1KEPA 1J56A 4XRGA 1I36A 3WKBA 1LDBA 5L40A 1YB6A 5ESWA 4XDGA 4GP9A 2QNIA 1RJDA 5K2OA 4E2YA 3IOCA 3I2JA 4OXRA 4QPDA 2JHAA 3IGFA 4QOFA 4BYMA 5EJMA 3V4PB 3BC1A 3MD9A 3EEOA 1FPMA 4NK4A 3CX8A 4GKAA 4QXAA 5FUVA 4RY9A 3W5DA 3ZVRA 4B3RB 5IYZF 3DLBA 1LS1A 1NJSA 1E1CA 5CLGA 1NDQA 5KYVA 3V4SA 3OUTA 3LX4A 1T15A 2HA3A 3O8DA 4AMBA 1GFIA 4E7PA 3G8DA 4MRAA 1NUSA 3H9CA 5FFFA 1XRJA 2VRCD 3OZ7A 5JCJA 5C81A 4FYJA 1U2SA 3QUSA 4RACA 2ZCJA 1EX1A 2IP1A 5JCXA 2GDJA 3O2QB 5J3JA 221PA 2QRLA 3DEAA 1JZQA 4BLQA 3C5EA 5F98A 2R79A 3K1YA 5I9IA 4IDAA 3RSFA 1GKLA 2M9MA 1IM5A 2FPOA 3EZYA 4RZ3A 5L3SB 3TG2A 3NUZA 4ZJPA 1PNQA 3PYXA 1AKUA 1CIPA 1DPGA 2AA3A 3MUNA 3AEQA 1WU8A 5E1MA 3W79A 3LZ6A 3K8QA 3RRJA 3GLIE 4O6VA 4OXNA 1J9ZA 2ZYUX 3U0BA 2JIPA 3ORSA 4PYIA 1X0VA 1W6RA 3B3AA 3C3WA 3E22A 3DOOA 1XSEA 1P9LA 1P9OA 4JYPA 1TKAA 1GGFA 1QIHA 2AOVA 3LOQA 5DM2A 5H7XA 4TXNA 1FFCA 2E4YA 4EG5A 4P83A 4UHFA 4BWVA 3FWNA 3LCUA 4HDNA 3M0EA 3ZW8A 1U3TA 3QTLA 1QWSA 1WPGA 4ZOLA 3KL4A 3KPJA 3DOHA 2ARKA 3ZK9A 1MXFA 3GEHA 2B3TA 1E2EA 2Y6VA 4QBTA 4GL2A 1HE1C 3TCKA 1J33A 4YJGA 1T3ZA 3O83A 2DWUA 4M87A 5FPKA 1W9HA 3E5RA 2HU2A 1T2DA 1T25A 2W2QA 2W8BB 5CPFA 5JT1A 4V3CA 4P9NA 3UJDA 1SUIA 1Y3HA 1EWTA 2JVKA 2PUAA 1MABA 1G7SA 4O2BF 5BOSA 4KLRA 2KS6A 2QAJA 4M1KA 3GGOA 1QE5A 4PYOA 5FA6A 1JTVA 3PFFA 5IVDA 2FTKE 4B82A 2VKQA 3DD1A 3UW1A 4ZU6X 2ONKA 3BXXA 4E88A 2VP0A 4ZKDA 2WOJA 5JO9A 1SQ5A 1BA2A 1MIOA 3FTCA 3CUTA 2QJWA 2APJA 4ED9A 4QT4A 2JG3A 1EBUA 1Z34A 3UC9A 3PUWA 1A7AA 4OQNA 3CB2A 1N6IA 3U4HA 1S02A 5JDIA 5E0KB 3ZHYA 2JRLA 4K0KB 2D2IA 1I51A 5KDOA 4TKUB 1NVAA 4HNAB 3HL0A 3ZJ5A 5KOJB 3QG5A 4RKYA 2FLKA 3IQIX 3R3SA 3W8DA 3D31A 3DVLA 4DSNA 1XL1A 3BMCB 1UAYA 1WUIS 4AKHA 1G1AA 3T12A 2ATIA 1GRVA 3OU6A 2FOXA 1RQNA 2QR3A 1OTXA 3WR5A 1CR2A 1J5PA 3JYPA 4UVHA 2XYGA 4ZQFA 5C4GB 1A4RA 3IR7A 1T5IA 4LNUB 2WR8A 3TZCA 2DPHA 1XKLA 3P71T 2XZPA 4TL9A 1Z06A 3U4GA 1LSOA 4B2IA 3PGKA 2WTEA 1YVPA 3QITA 2OBLA 4JT4A 1I32A 1HKUA 2OG1A 4JP5A 4MYDA 4FYWA 5EMKA 1LDYA 3WGUA 1Y6GA 1ULUA 4EBBA 1DQSA 2NVUA 3JRWA 3PV0A 3CRW1 2C03A 2IUEA 4IH4A 3C5CA 1YQDA 4REMA 5KQMA 1YZKA 1LFDB 3SJBA 1FDIA 3KJEA 4IVNA 4S1WA 4DMCA 1CEEA 1RQRA 2WI8A 1YZNA 1ZO8A 5CJPA 5KNBD 4B3MB 4UTRA 2RJOA 3K70B 3DVSX 4FC7A 2FE4A 2OR3A 3NCHA 3G5TA 4N82A 5A1JA 3AB8A 3NVKI 1NVWQ 4Z4QA 2XV1A 1SRQA 3I0NA 4DJDC 3HJNA 3OT1A 3BMXA 5TJHA 3RK1A 4DREA 1FS6A 3CVXA 1Y3BE 2B83A 2PMKA 4RSRA 1E2NA 1LB1B 5HOEA 4YAFA 1A50B 1KFJB 3DXXA 1UQTA 4NZZA 2CXOA 1FMFA 2ACEA 4AL4A 3GT7A 4HAXA 2OBFA 4BE9A 2O3UA 5FUQA 5A2QA 1EE9A 3O9VA 1DQRA 1XZMA 4K0RA 3ZGZA 2ORIA 4XQGA 3ABZA 1LLFA 4HDQB 1MN6A 2J6BA 4MQ5A 4S2UA 5AICA 3TFQA 1XHFA 4D4IA 1A7JA 2Z2IA 2GEJA 1O6ZA 3A05A 1X74A 1JFLA 1F2UA 2H8GA 4MHSA 4JK3A 5EUBA 1CD5A 1OBHA 3HYNA 1OJ7A 1UT6A 4YJFB 4DLLA 2RGNC 2Y92A 2BH9A 5IJWA 1DJLA 1R6XA 3WL7A 5HOQA 3ER9A 5JVDA 3HRIA 1L7BA 3IIEA 3QIVA 4AUMA 3SVTA 5KEIA 5LQAA 1DS6A 3GWZA 1X92A 1XDBA 3DAPA 3KB1A 2H11A 3PDUA 4C30A 5AI9A 1M2OB 2TECE 2B8WA 3NNSA 3P9CA 1CJUC 1V4VA 4XGKA 2CC2A 1Y34E 4KMMA 3CLRD 3EGIA 2CN1A 4XWWA 1LD3A 1QKJA 2EJUA 2H1OA 2W00A 1SK8A 2CYCA 3WS7A 1B8UA 1EM6A 2QG4A 3RUFA 4E4TA 1M6EX 1FTQA 1JZTA 1MQ9A 2ZBVA 2PS0A 2Q3DA 3OF3A 2H92A 3X1ZA 3EVEA 3BCSA 1OD6A 2YICA 3OQ1A 5FI5A 3DCNA 2RHTA 4D97A 3GPDG 1H4TA 1O5TA 4F2DA 2XUPA 1U80A 4XFJA 2FPRA 1LWOA 4EL5A 5D51S 1M6YA 2AG6A 3G8BA 2C3PA 3TFOA 4QTTB 4QIHA 4HDSB 3RVSA 2JKVA 2VYND 4B32A 1O97D 5I9SA 1XXHE 1DADA 1S2OA 2A94A 4F3RA 3U7FB 4MV5A 2Y3IA 2AUTA 2VHTA 4D9BA 3OIUA 2YX1A 1Q1NA 2HO4A 2WYOA 3ZI0A 5B7PA 3HQ4O 3UK0A 4MK4A 1OAKA 3QU5A 4P38A 1P4AA 3OZAA 4V02A 5FOUA 3X1MA 4WD3A 2GK7A 4RO0A 2JI7A 3VHRA 2L82A 4NXNB 2V74B 4NWIA 4N40A 3LNTA 4DNFA 4YRRA 1W0KA 2YUTA 2I6UA 4X1YA 3PWSA 1NVTA 1HRKA 4FN5A 1CZHA 5KTSA 1W34A 4PHTA 1LJUA 1BC5A 3SAJA 3GJ5A 5I9MA 4MVCA 3D1VA 2JBAB 1O58A 1BHJA 3EFEA 2K6GA 1OASA 5FPSA 2CV2A 3LRXA 4O2RA 3ESBA 4A73A 1UC9A 3IOYA 4J1NA 2Q8QA 4K26A 2FQ1A 5ALPA 5A7GA 5KS2A 3AF4A 1UAAA 2ADMA 5EGSA 2OHJA 3OZXA 4X8HA 4N0EA 5TQVA 5CPBA 2HSWA 3RC3A 3VYWA 3TLGB 4AWBA 1BHO1 3KSMA 1PJ3A 3EFOA 3V33A 2G8NA 5E9QA 1RWNA 4Y6GB 5TARA 4CT0A 3LPAA 1U8UA 2OXTA 3U7EB 1C4XA 2VWPA 1U7XA 2Q07A 3WMRA 3TX2A 4BNTA 3IBSA 4BX8A 2V8BA 3FWYA 3SC4A 4CTOA 3L1KA 2C59A 3CEPB 3U16A 1JFSA 4AY6A 1RZUA 3B7GA 3U49A 1H6CA 3ANXA 3X2EA 1IUPA 3AV3A 1E9EA 2C98A 1NULA 2MSNA 3DHWC 4H0FA 4MMYB 2V98A 3F49S 3X1KA 2CHVA 1A9SA 4HMOA 5BYAA 1R0KA 3ISVA 1SG6A 3GRVA 3L0IB 1QAQA 2PU7A 2QVGA 5CURA 2OCLA 4YMSA 2FMUA 5EERA 1K7XB 3HABA 3IEKA 2R6HA 4ARBA 5LQDA 3GGCA 2X3UA 1KJJA 4JBYA 3TSOA 4IWNA 4J4TA 3GLGA 2CLSA 1JMKC 1PDVA 3L1HA 4DDWA 1RSZA 3BA6A 1E2QA 1ZYUA 4H6XA 2WP8J 5FADA 2WIJA 3SYLA 4BNWA 2QY9A 1FJGB 5C8VA 4C22A 1FFXA 3GC6A 5CLLA 1J2RA 4CM5A 2Q2VA 5EYPB 2A6PA 2IRWA 2FX5A 4CKEB 1J2YA 4U9IS 2Q5QA 2IH4A 1B41A 5K3CA 3G7SA 3HFJA 4C89A 2WYVA 2X8JA 3SBEA 1T9GR 3KT8A 1DIOB 3SXUB 1XBTA 4HNHA 4R81A 4B34A 4OYLA 5EEGA 3GLTA 4G23A 1RPAA 2NYRA 1RQXA 3D4IA 1DC7A 1O77A 1CUHA 1GKKA 4WBXC 4A15A 2VA9A 4KOAA 4L75A 3AUAA 2NSLA 1D9ZA 4DAOA 3FCUB 1KRHA 4HEA1 1BWRA 4X91A 4XIFA 4BMZA 4DLBA 1NOKA 4MVJG 3I1JA 4UFOA 1GPYA 4JCCA 1JXMA 3TBKA 2VJMB 1NF9A 1R9JA 4QUIA 2VXOA 5JY1A 1A9RA 1KYYA 1ODIA 1Z2AA 3G7NA 3GJZA 1K5PA 2D2VA 2EF0A 2B6NA 2I9KA 1P17A 2O8EB 1XEWY 3B9PA 2XKJE 4HNGA 2Z58A 5CJ2A 1VIDA 3R75A 1FX0A 4MPDA 1F3OA 5BSEA 1K97A 4K9QA 2QQFA 1X1DA 2ZUSA 3ZLTA 1FNSA 1II8A 1UIRA 2JD2A 3PPIA 3S4YA 1B6TA 3GEGA 1HYQA 2C4UA 4MGKR 4EKYA 4P0QB 3ZDYB 2VPZA 4X7BA 3VR4H 3TRJA 5LJIA 3HXMA 1Q57A 2WHXA 2P91A 3UQYS 5M34A 4ZOLF 3WIOA 2Q0XA 2R00C 1GGKA 5K3SA 2YASA 2UYGA 4IS3A 3IUQA 4C87A 4EY7A 5HIJA 2WM2A 4G1MB 2FSGA 4O4LB 1N2JA 2WT8A 2PV7A 3Q4GA 1Y9EA 1H94A 1V3VA 2IHVA 1HGXA 1VYHA 2PGXA 5CFRA 2AEJA 3KOYA 1REQB 4RKEA 4W6QA 3ZDEA 4IZHA 1WZUA 4DBLC 5A7FA 4OHYA 4TT8A 1IY0A 4JA0A 1H5NA 1M6VB 3B1WA 4L3VA 1Z4KA 3F2IA 1XQWA 1WXHA 1Z4PX 2NUPA 2BEWA 2ANCA 2X0JA 4ZCMA 5LZ2A 3D2LA 1P0IA 2WWIA 4NEGA 3PC7A 4RENA 1Y6RA 3IP1A 3LVRE 1PL8A 4UW9A 3VC7A 1T4GA 1T1GA 3COJA 1MOZA 4LRXA 1LLCA 1IU9A 3DYVA 3LK6A 4PC7A 1MF7A 4JBHA 4FKZA 1XQYA 2AN9A 1M1NA 3MW8A 5KINB 3WNDA 3HJBA 4KWEA 3OUUA 4LV5B 1BS2A 2CMDA 3TW8B 1DRKA 4A9AA 4AG3