4D0NA

Akap13 (akap-lbc) rhogef domain in complex with rhoa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
b'AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title The Crystal Structure of the Rhoa : Akap-Lbc Dh-Ph Domain Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4d0nA00
5FPSA 4YMUA 2O8DA 4PZLA 3C8UA 1JJVA 2V1UA 1YU9A 5FUVA 5J5CA 2WHXA 2ATVA 2AX4A 5HR5A 1T91A 2V4ZA 4BQSA 1E2PA 2QM8A 3FYHA 3IIKA 1KI3A 1PZNA 3RWOA 2O0HA 3B7GA 4LPKA 3J81k 4OI0A 2ZRLA 3M1IA 3CH4B 3WRYC 2KBFA 4KHZA 4KXFB 4JVNA 5KYKA 5JFGA 1LF5A 3RVBA 1E9CA 2HV8A 3OEEA 4II7A 2PT7A 2RGXA 3K0AA 1KNXA 1AKEA 1N0UA 1N6HA 3X1XA 1BOFA 1T5LA 5FUWA 3QQ5A 2CE7A 1OXVA 2WTUA 1XMJA 2ZSDA 5DH9A 4DB2A 1QVAA 4B3BA 1J8MF 1N2CE 4KSBA 3BH0A 2OCBA 3VFDA 3K0FA 5EQTA 2B8TA 1Q57A 2CK3D 1VIYA 2OZEA 4TLCA 2NG1A 4JLMA 1GM5A 2RGGA 4Q4JB 1OH8A 2ECKA 1KMQA 5E7JA 1SVMA 1ZP6A 3CPJB 3OAAD 2OESA 3TK1A 3TMKA 1II9A 3BC1A 2ZAOA 1G4AE 3N2EA 4G1UC 4JVLA 4KFSA 3DKPA 2AR7A 3SDZA 5JEDA 3CRVA 1HV8A 3MWKA 3FDIA 3CKLA 4IOLA 4URZR 3FTQA 3LLUA 5EP4A 1E79A 5JHGB 1W0KD 4KSCA 2J7PD 1PV4A 2QG6A 4DDUA 5HE9A 5EXSA 5J47A 3GEEA 3ZH9B 1YJ5A 2NO6A 2R2AA 4BZPA 1NBME 2HT1A 1ZAKA 3Q8XB 5KSOA 1JR6A 1NMYA 2WJVA 3KKMA 2PLFA 2HXSA 2ZRPA 3K0FB 3ZVNA 3QKTA 1KJWA 1AKYA 3SQWA 2ZUDA 1E98A 2XZPA 2IYYA 4A4DA 2XJ9A 3A1SA 1QHHB 2QMEA 1E9DA 4NYMQ 5AR1A 3BORA 2OBNA 3R9IA 1QG4A 3QG1A 3T34A 2GBLC 2NOAA 1G4UR 1GL9B 2LKDA 3GLGB 5L3RA 1IXRC 3U3OA 4Q21A 1ZM3A 1T0HB 4KFRA 1TEVA 4HI0E 3I92A 1JEEA 2UZ3A 4NCIA 1CJVC 1YRAA 3CWQA 3B1ZA 3KUCA 4C0KA 4EPTA 1QVRA 4JKYA 4RD4A 2IK8A 1I2DA 2G0TA 4PFSA 5DE3A 3LY5A 2FSIA 2ZSBA 3WHKA 2YWEA 1KO1A 3T1QA 4EIWA 1GNQA 1P72A 3O8RA 4FMDB 3GMTA 4AIIA 5C1BA 4Z1MA 3FOZA 4DUGD 3GEIA 2ERXA 2GTPA 1IBRA 3AVYA 3U7GA 2V6JA 3ZGXA 1QHYA 2ZRGA 4RD2A 3D8BA 1I2MA 1SVOA 4D0GA 5J4KA 4MA4A 4YMTA 2NZ8A 2RGBA 1W0JA 3BK7A 2IWHA 2Q3HA 2UZIR 2J9RA 3B85A 1CS4C 4DWJA 3R7WB 3AVUA 3FKQA 5FBWB 1AZTA 3EPHA 1R8SA 1G5RA 5JJIA 4TZ0A 1TUIA 1JR3E 3TH5A 2H16A 2Z83A 1XD9A 4LHXA 3LDAA 2WZQA 1LB1B 5TV2A 3SBEA 3VAAA 3FHCB 2GVZC 3LQRA 2JLWA 2BWJA 4K81B 3ETLA 4AI6A 1N5IA 5GVSA 1OV4A 2JLVA 2BKUA 4LRWA 3GLIE 2V6IA 4Q18A 4ARZB 2ZUCA 4JL5A 1II8B 4A8JA 3NIBA 4QBFA 3WNBA 2FG5A 4YDHB 2A7QA 5IF9A 5IK2A 5C2JB 1CR2A 3FMFA 4V0ME 3KJHA 1XCGB 2VF8A 4Q4LA 2X2EA 5JS8A 3THWA 1DAKA 1KSFX 4JLOA 3UKDA 1RRFA 4C7OA 1IY0A 3NH9A 1JB1A 4OQLA 3B2EA 4LBWA 1T3SA 3MSXA 2REXB 2OCPA 3I73A 4QJ3A 1XZPA 3L2OB 4Z8YA 1G291 5JMTA 4KITB 1N6IA 4V0NA 3JVVA 2AD1A 2IF2A 4KVAA 4RFSA 4OI4A 4NHOA 2W0SA 3RC3A 1T9HA 1FTNA 2OM2A 1UF9A 2W6JA 1P5ZB 4NCKA 5LPNA 5JCZA 2BJWA 4O2RA 3RRYA 3L43A 1FUUA 3SU8A 1Z47A 2OBMA 4DSNA 4PANA 2IT1A 3BJIC 2PEYA 2G1KA 2V3CC 2C98A 3QF4B 1YR6A 1VKJA 5BXQC 5EZ5A 2EWWA 1L2TA 1CR1A 3KTAA 4WXRA 4KYIB 4JT2A 2GJAA 5G40A 3AVXA 3QEOA 1BS1A 3LV8A 2ZUBA 4M1MA 1P3JA 3B1XA 4LPSA 4TMWA 2D7DA 2QMUA 2AL7A 3NBXX 3I5XA 3DL0A 1G8HA 3GJ7A 4PHTA 2QY9A 3Q5EA 2OAQ1 4I81A 4OK6A 2PMKA 1TF7A 2FZ4A 4CDGA 5E4FA 1M1YE 3AVPA 3TSOA 4DEYA 5BN4A 3EPLA 3THOA 4C9BA 1D2EA 4FMCF 1Z0AA 3ZS9A 5B2ZA 5GADl 1YZUA 2GCOB 1K8RA 3LVRE 2FSGA 3M6AA 1ZD8A 1U0HC 2YV5A 1G5PA 1ZBDA 1Q1QA 3VR3A 3CR7A 3OIVA 2OEPA 4D4KA 1XXHB 2FFQA 1COWA 1UM8A 3NXSA 1GP2A 2D4HA 1R2QA 4WAUA 1OFHA 4EPXA 4AYXA 1S8FA 1S2MA 2REBA 2LKCA 4WBSA 3ZS8A 3SR0A 3SI7A 3BB4A 3AVQA 4ESVA 1Z6XA 4DBLC 4K46A 4PTLA 5HCNA 2O0JA 4OK3A 2XOKA 4ZIRA 3FFBA 5CJPA 2HUPA 4RKEA 4TLAA 2FE4A 4JT4A 1P2SA 4MYTA 1P62B 2B21A 1FX0B 1RPZA 1SXJD 4US2R 2WM9B 4D0NA 4LHVA 2C5LA 1HYQA 4S2EA 4EAQA 1ZD1A 4AURA 4B47A 4Q47A 1PLJA 1TF5A 1SXJB 4Q1EA 4QGAA 4R7ZA 2JLUA 3ZJYA 4CEHB 2GXSA 3QF7A 4BGDA 2HCBA 3I72A 5TXGA 2G9NA 4B3DA 4O25A 5FPHA 5J40A 4RZ2A 3U6KA 5DGXA 1H8ED 2AFHE 5JLJA 2BM1A 2IYZA 2X8AA 1CJMA 4XJXA 1W2HA 2ZRDA 1TPZA 3IHWA 2BEJA 1GKIA 3MD0A 5CYPA 5AJWA 3SYKA 4YQFA 2JLSA 2ORIA 5F9FA 1CTQA 2CHVA 2O8EB 2W83A 2ORVA 1Z8FA 4A15A 4AYTA 4JS0A 2GETA 3QXHA 3RYTC 4QBGB 4F91B 4RFVA 1P9NA 1NLFA 2O8CB 2VEDA 3W5JA 2VQSA 4ZPXA 3B82A 1R6BX 4W5WA 3TIFA 3HPQA 2A5DA 4P0TA 4A0FA 1XEXA 2HF8A 5AJYA 3GLFA 1EFUA 4BRUA 4BZQA 1G41A 5TARA 2ZRFA 1D9XA 3NDPA 3CX7A 4RZXA 2VL7A 1R5NA 1FMJA 1Z5ZA 5KUTA 3N5CA 3GQBA 4HDQB 4TT3D 4QJ5A 3QKRB 4TYNA 1YZTA 4KBFA 2XZOA 3G82C 3EPJA 1AQUA 4G5OA 3I8XA 3BGWA 5FL7D 3PUZA 4LY6A 2IYVA 1ZYUA 2DHRA 1M6NA 3Q85A 4TL7A 2PZFA 1SXJC 3IQXA 3SJAA 1KI2A 1KSHA 1F60A 1W44A 2WWGA 3U60B 2DYKA 1KY2A 4XWKA 1E69A 4C3ZA 2CMKA 3K0EA 2J59A 4ZO4A 3UWOA 4Z54A 5BWMA 1VCNA 5CJ2A 2QBYA 3QKSA 4QG7A 3AKCA 1W49A 4B75A 2OILA 3QJYA 4RD6A 5DIFA 2QT1A 5EZ6B 3AP3A 3SN6A 3EIEA 1KO5A 1LNZA 1OIWA 1QZXA 3H1TA 1XD2B 2GZAA 2VBCA 4JYCA 4NONA 4EFLA 3BFXA 3PG5A 3TAHA 5EXXA 3SZRA 4D26A 3FHOA 3NTUA 1E4YA 3NWJA 4XSHA 4B73A 3QPUA 4ZDIA 1R0XA 4XSGA 2QE7D 2J1LA 1NLYA 4DSUA 1ZM9A 4Q9IA 2GRJA 1IN6A 4R71A 4A36A 1ZIOA 2W6ID 1HY3A 3PEYA 2FFHA 2H17A 4EQ6B 1Y63A 4UXHA 4PSVA 3K9HA 4TL9A 2BV3A 2SHKA 3E5HA 1E99A 1W2GA 4Q4AB 4TLBA 2QROA 3T1OA 4M4SA 3T15A 5DO9A 3LD9A 3AF4A 1IJFA 1IXSB 4NTZA 3VU9A 4URXR 4BRWA 1WE2A 3REGA 1NL3A 5EE5B 4DC9A 4ZI3A 1W4CA 4ZDWA 2F43B 3S1AA 1JEDA 1E4VA 1OKKA 3FWYA 1M8PA 3D3QA 1US8A 4TSFA 1G7CA 1Q1EA 4M1WA 3VHLB 2RH5A 1VYVA 1LS1A 3EA0A 4OI2A 3AKEA 2WKQA 4V02A 1W1WA 1YZNA 2CLSA 4HZUB 4Q7KA 1UPTA 2WAXA 2VSFA 1A1VA 3C16C 4Q19A 2QN6A 4V0KA 4HUQA 5AWFC 4URUR 3ZIAA 1N6PA 2XXAB 3MCAA 1E0AA 2VP5A 1I4TD 5FOXA 1UKEA 1G16A 4P31A 4RZUA 1YR7A 2PX0A 4TTPA 1U8YA 5FUXA 5FTMA 1X8LA 2DCUA 4LHYA 3FMPB 3C5CA 4URWR 4C4PA 1NBMD 4HDCA 5L3SA 3X2SA 2BM0A 1NLZA 2J41A 2F7SA 4JBXA 1UDXA 4FCTA 5KSZA 3QE0A 1DAMA 4DLVA 2J3EA 3F0TA 1Q3TA 1IM2A 1OFIA 2IS2A 1KTVA 3PUXA 2BBOA 2R6DA 2F1HA 1KMHA 3R9WA 4PPNA 1PUJA 3IGFA 1L4YA 4MITA 2BBTA 5HCIA 2FNAA 1R0YA 2WWXA 1FUKA 1MO6A 4IVPA 1OHHD 5JSZB 4ZCLA 3WXMA 4BFSA 2FU5C 4G3XA 1G8YA 2WPDA 4IVQA 3RNLA 2FN4A 4IKEA 3GLHA 4Q03A 1WBBA 2Z4SA 4Q1AA 2QP3A 4HATA 4KJZA 3NDBB 3MFYA 2MMGA 4OJKA 4MRRA 4UKDA 2O52A 4QHTA 3CONA 1KK2A 3U3MA 5JS7A 3LBNA 1KSGA 1Q12A 2ZSAA 2BVNA 4A0GA 1QHGA 3EAQA 3EW9A 5KHOC 4TMZA 5HE8A 2L0XA 4LDJA 2JJ8A 1FOEB 2ZSEA 3EZ9A 4BLSA 3K09C 2O0KA 3OE7A 2CL6X 2HEIA 3IQWA 1SQ5A 2YOHA 2ZJ8A 4IJMA 4HAZA 3MJHA 1KMHB 4QGGA 4JLAA 2LCFA 2HF9A 2WICA 2ZROA 3KQHA 2VP2A 4WVFA 4U5XA 2W2VA 2OO7A 3U4QB 3ADCA 1IN8A 2NZJA 4UNQA 4JL6A 3U3RA 3EPKA 5KPJA 3VNVA 4Q9LA 3KQKA 3H0KA 1RRCA 1W46A 2BMFA 4BFUA 2XB2A 4FMBB 2GILA 4URYR 2R6CA 3CF2A 1JR3D 2AHOA 1TTTA 2XSZA 3QNUA 4TWZA 2P6UA 5JHHB 1Z0FA 3NC1C 2KB0A 3QY0A 2ZM5A 4B35A 5DYIA 1ZU5A 2XTNA 1YHNA 4GOXA 3EZ6A 4G5RA 4MH0R 1W5TA 5KNCA 2J5XA 4US0R 4AY2A 2DBYA 2XITA 4HAUA 1CR0A 4PZYA 5AJZA 1ZJ6A 3U61B 5GJWC 5KNBA 1GL6A 3BAFA 3BRWD 4MKGA 1E9FA 3QPWA 1W7AA 4JKIA 4FIDA 1JAIA 3TVDA 4FWTA 4CEIB 2ZI3A 4KO8A 4MDEA 2B92A 2EWVA 3HWSA 2HDNB 1G8GA 1OXSC 3OIYA 4PC2A 4Z8XA 2AK3A 2RHMA 2RGDA 3AF2A 3AF0A 4ERNA 2Q9BA 2V1XA 1F6BA 3VMFA 5FPKA 2QP4A 2R62A 3KJEA 4LYHA 3PIRA 3FGNA 2RKOA 1G21E 4M9QA 1NMXA 1YQTA 2Q21A 1MOZA 1G64A 1CEEA 1F2UA 2JA1A 1YVDA 2F3TA 4TL6A 4BWYA 4CT4B 3PJRA 2C2HA 4HUTA 2IYWA 4PHHA 4DRZA 4PSKA 1UKVY 2OE2A 1M74A 2P6NA 4R2HA 4FCWA 3UIEA 4XD7A 1OLOA 2WJGA 1S96A 3DHWC 4QBIA 4RD1A 2YC2C 4RCYA 1RYHA 4LYJA 3KFXA 3IUYA 4HZIA 4LJ4A 3O47A 1VPLA 4Q66C 1NIJA 4PC1A 1X6VA 3W6NA 1NY5A 5FR2A 4B32A 4XVRA 2I1QA 1KHTA 3IO3A 1GDDA 2YNMA 1E32A 3GJ4A 1KJZA 2CDNA 1BKDR 4AKGA 2PZEA 5TVKA 2ZVQX 3I8SA 4B3XA 1Z29A 3MGCA 5B64A 1NRJB 5KDDA 1R0WA 4RD3A 1R10A 2P2LA 1PUIA 2QQEA 4FI3C 3PEUA 2PLRA 3B1VA 3SYNA 5CK4A 5AUQA 1VCIA 2GBLA 2JCSA 3NEJA 3RS7A 2O8BB 1DG1G 2D2EA 2FV8A 1DADA 4BPBA 3NHBA 2G83A 2OXRA 4PO9A 4Q4JA 2C78A 4CIDA 2D7CA 2CK3A 2HLDD 4LV5B 2IW3A 2IYRA 4IDNA 1RYFA 3W9YA 1HQYE 5FTKA 4KI0A 1LVGA 2PH1A 2PJZA 4GP7A 3OAAA 4LZZA 4LC1A 1MRSA 3DZ8A 4BZXA 3GCGA 5FOTA 4XWOA 2ZJAA 2VIIA 1W4BA 3KDSE 1KK0A 1NG1A 1EFCA 2ONKA 4MRSA 3T61A 3TSWA 1N6RA 3IPXA 1AZSC 1XMIA 1Z0IA 5L3QB 2H5EA 4B33A 1G17A 2ZS7A 1W0KA 2WJJA 2WJIA 1G6HA 2VO1A 2OHFA 5DISB 4YONB 4YXWD 5KTYA 2GA8A 3GLFE 1ZVQA 2DWPA 4HEJA 5E7MA 2CCKA 4LBVA 5DHAA 3U2QA 3QPVA 1XJQA 4C0QC 1FFHA 3VHXA 2A9KA 3FMIA 3PV0A 4CVNA 2FPKA 1F3OA 3WYAA 3TE6A 3LBHA 2Z5FA 2XNDD 3B9QA 4M9XA 3BERA 4HLCA 4KYUA 2QL6A 2Q9AA 3MWLA 2WV9A 2RGNC 1W5SA 2XGJA 1ESMA 1QHHA 5JWHA 1N5KA 1QBKC 4NYJR 2BOVA 3IEVA 4E22A 1SHZA 1J8YF 3GLGA 1MKYA 4F38A 4DEXA 1TL7C 5CIQA 4UJ5A 1E2KA 2AWNA 2EFEB 5JRJA 1U0JA 1Q21A 2VTKA 1E0SA 2IS6A 2FOLA 2D3WA 1OF1A 4WZBE 2GCNA 1SHKA 2FZLA 1NY6A 2ZI7A 4AKHA 2IEYA 1OXTA 2P0EA 3TJZA 3WY9A 4BE7B 1JNYA 1Z63A 2HCJB 2NTYC 2QORA 2ZIAA 2ZVPX 3Q7QA 2BDTA 3RHFA 5CYOA 3THXB 4H1VA 1GIAA 3OEED 2QMOA 2CL7X 4RY2A 5SZJA 1ZUNB 3RWMB 1GVNB 3VR1A 3AKDA 2N42A 121PA 1KI9A 3I5YA 2FJUA 3CZQA 1VG0B 4FN5A 2GK7A 4HAXA 2F9LA 3NKVA 1E0KA 3JVUA 3BH6A 3GFOA 3R20A 1NN0A 1UJ2A 1YR9A 2D2FA 5FOSA 3R7WA 4X8MA 5JCPA 3AV0B 4QGFA 1XP8A 1XTSA 5AJXA 1MABB 3QKUA 2Q9CA 1P60A 4RZ3A 3K1JA 4GPTA 2ODNA 2IL1A 4A9AA 4QRHA 3RRZA 2WWYA 3ADBA 1U2RA 2DY1A 3PCRB 2CJWB 3DVLA 2H7VA 5FTJA 5DHFA 3UMFA 1E6CA 3VX4A 1ZUIA 4ARZA 1GNRA 5B30A 1DS6A 4DLZA 3D31A 1II8A 1CP2A 3RSOA 4DCUA 2IWRA 5JBQA 1MO4A 1TAGA 2QT0A 2ZYWX 4Q01A 2BIFA 1Q1ZA 5K8UA 4XOIA 4D4LA 421PA 3F3YA 1M2OB 2IUSA 1N0WA 2NO0A 1IY1A 1E1RD 4G5GA 3MRSA 3PUVA 2ZR7A 4KU4A 2JLQA 2JLZA 3C14C 3K53A 2QRNA 2ZXUA 4HYYA 2OFOA 4X8OA 4U00A 4FMCB 4DLSA 3P26A 4B76A 3W5IA 3HU2A 2IYQA 1FP7A 1J99A 4KV9A 1GSIA 5AUNB 4US1R 1CJTC 1RRGA 2V8OA 2JLXA 1GRQA 3W8RA 5FBVB 4QNRA 4IDOA 1HE1C 3GLHE 2R6AA 3LH5A 4WZAE 4L8GA 5LB4A 2QNRA 2QSZA 3ZYCA 3CX8A 1KO7A 2F6RA 3HR8A 3QF4A 4TMVA 2VRWA 1TADA 4TLEA 5IRCD 2YWGA 1ZC3A 5E3HA 4UNSA 2FDCA 4L16A 4OHXA 3WRXC 1DAFA 3TNFA 2CL0X 1JQLB 5H1YA 3UG7A 4I1OA 4Q7LA 1PLKA 3TAUA 5FOUA 4Q5IA 3O8DA 1KYIA 3ZZ0A 3E2IA 5C46F 1TQ4A 1H8HD 1UDWA 2VHCA 4JLPA 4E09A 1EXMA 3LA6A 2DFTA 5P21A 1Y3AA 3HYRA 2CEAA 3QBTA 3AUYA 5JEEA 3ZD6A 3IIJA 2OUKA 4X8HA 2ZE5A 2DFKB 3EZ2A 2BC9A 5FTNA 2H1LA 5C4MA 4QKQA 2J87A 4N0EA 4BFYA 1E2HA 2BCGY 2REOA 2XB4A 3ADDA 3M0EA 5DI3B 1CR4A 4LUCA 4R9UC 1KIMA 1UBCA 2GCOA 4R2IA 5FPYA 5E95A 1E2QA 3TGPA 3CM0A 4CF7A 3DOEA 1NN3A 1XXHA 4M1KA 4IFBA 2HT6A 5KSPA 5DYGA 1X1RA 5LD2C 4PQYA 1T3LA 2WKRA 1B0UA 3NBZC 3W90A 4D0LB 1JPJA 4BFZA 4MRPA 2GCPA 3FMOB 4MYUA 2ZJBA 4AKIA 3P4YA 2ZRIA 3TUIC 1GTVA 1EFRA 2OCYC 1FX0A 4NPHA 1LF0A 3RS0A 3UMRA 1T6NA 3LXRA 4F93B 1P61B 1E2LA 3CZPA 4K8OA 4DXAA 1F2TB 1JBKA 2KE5A 1GRRA 2IA5A 1SXJA 4CEHA 3QBVA 1Z6YA 2RGCA 3U3KA 3TBKA 4TYWA 2ZTSA 2V9PA 4ASUA 1G9XA 4A2PA 3U44B 4MUAA 3ADKA 1OH5A 3CRMA 4YLGA 3GFTA 5AK0A 2YOFA 1W4AA 2IS4A 1KAGA 5EE1A 5K8LA 3VKWA 5F9HA 2ZJZA 3AP1A 2VA8A 2OBLA 4LV8B 1E1QA 1NSTA 3GJXC 4U02A 1H8EA 4B6FA 2VP0A 3SNHA 1S3SA 1HTWA 2GF0A 2O8EA 3UMSA 1WB9A 4IVRA 2X1VA 1SGWA 3B9PA 2J7KA 2JDID 3DMDA 3CF6R 4ILEA 1TMKA 2QUZA 4G01B 2DR3A 5EJEA 1Z08A 1G18A 2W6JD 5FFMA 2W0MA 1RKBA 2GNOA 2ZI9A 2EYQA 4L15A 2O8CA 4JSYA 4M9SA 1SKYB 4YMWA 3RS3A 2QP9X 5A4JA 1G20E 3QXCA 2ZYVX 2NPIA 2Y8EA 3K9LA 3BOSA 3ICQB 3VKGA 1KI1A 3SC3A 4Q1BA 3ND8A 1KAOA 4KFUA 2ZS9A 3QKRA 3NG1A 1U8ZA 5AUPB 2P3SA 3OFND 3IIMA 2W00A 3KJGA 1ZIPA 2YYZA 3IPYA 1TU4A 2ZRAA 1UEIA 4G5QA 4MQBA 2FF7A 5D3MB 4D80A 1XBTA 4LC0A 1AGPA 5FL7A 3NBYC 2IXGA 2WVJA 5CM9C 1CJUC 5L3VA 4JLBA 5KO2A 3MAAC 4LGMA 1YRBA 3AKYA 3W6PA 2Z0MA 3ECCA 2GESA 1QHNA 3GJ3A 1RFLA 4O0MA 1AK2A 4LHZA 3K0CC 4BUJA 4JBWA 5CITA 5KSYA 1DELA 4PSAA 3HU3A 2J0QA 3LX8A 1L7VC 1COWD 1XD2A 3SJCA 4OHWA 4E07A 4URVR 4JLVA 4Q02A 2EFGA 4P4UA 2FX3A 1M7GA 2YWHA 3A1TA 4MGZR 221PA 2R6FA 5BN3A 1RJ9B 1RRPA 3WYFA 4LSGA 1C1YA 3H86A 1VCMA 1G1MA 2Q3FA 3CW2A 3CBQA 1ZM7A 4TN1A 4KODA 4M1OA 3ASYA 2GAAA 1A4RA 2IS1A 1WQ1R 1GUAA 2JJ2D 1G8PA 2TMKA 3QXXA 3EA5A 4EQ6A 1E2NA 4LHWA 1FL9A 1GILA 4PQRA 2O5VA 1BYUA 3IEUA 4BFTA 4DCSA 4ZKEA 3CIOA 3GJ5A 3A36A 4Q4AA 1Z6GA 5A0FA 2C04A 4XIGS 2QU8A 3JZMA 3K9NA 2ZI4A 3RS5A 3V4RA 3CB4A 1V5WA 3WNDA 1BYIA 2J0SA 1ZCBA 5JRZA 2FGKA 5HZKA 2F43A 5BYJA 2XX3A 4HB3A 4GDFA 1OSNA 4LX0A 1CRQA 2JIZA 4NE2A 1M7BA 2WMNB 2F55A 4ACAA 1KSJA 1SVIA 1Q44A 2ATXA 2C77A 1E96A 2C8VA 3O8BA 1QDEA 2EYUA 2PX3A 4HZUA 4DT1B 1UBGA 2A30A 4UNRA 1P2UA 3KB1A 4ABYA 4M1SA 3FB4A 2XXAA 3B78A 4AC9A 1SULA 3GLGE 4B3CA 3VR4A 2B8WA 3K09A 1N0VC 1FQKA 4Q1CA 1GAJA 2QAGB 3RC8A 1LS6A 4FCVA 1NP6A 2P5TB 4DLUA 5FI0B 3V00A 2VP9A 1OXUA 2ASEA 4WZ6A 2VYFA 4NYIR 1XU4A 2QA5A 3B6EA 2GXUA 2ODEA 2HJVA 3AGPA 1VG1A 4MKIA 1WP9A 4Q7MB 1SVWA 5B57C 2IC5A 1I4LD 1KZ7B 2KWIA 4AG6A 5FBQB 3PQCA 2ZJ2A 1JQJC 3QVVA 3UPUA 3DDCA 4UJ3A 1NJFA 4M53A 1LV7A 3IO5A 1KDRA 4PXAA 5JSZA 2J0UB 5E7IA 2YKGA 3NEYA 5CIWA 4DZZA 4ZV4A 4HB2A 1FZQA 3T5GA 4X8LA 4Q48A 3P32A 2CNWD 3SHFA 3L82B 5CB8A 4C0JA 1UAAA 1NSFA 1II0A 4OYHA 5CDFA 3SOPA 3R9XA 1GWNA 1ZINA 1Z06A 4I99A 1G19A 4OL0A 3OEHD 2OXCA 3OF5A 3Q72A 2XTMA 2GJ8A 1RZ3A 1DO0A 4XVUA 1DG3A 1S9HA 2RAPA 5GVRA 1ZNYA 2DFLA 2ZPTX 3IILA 3UANA 3VR2A 2GK6A 2X2FA 4I1UA 3A1VA 4UQOA 4XTRA 3TRFA 3TUZC 3OIWA 3NC0C 5IDVA 3EIHA 2ZJOA 2QGNA 1JALA 2ZU0C 2QAGC 2QMHA 2ZAMA 4QHYA 1DBSA 3B1YA 1XMVA 3KQUA 1KY3A 4P4SB 2ZE6A 4RSGA 2ODWA 5G3YA 1MV5A 1NVVR 3CRQA 4A0HA 5DN6D 2Z6VA 2JGNA 1G6OA 3SYLA 1OPXA 3U4QA 4Q4HB 3X1YA 3X1WA 4B74A 2EFDB 1EFTA 2IUTA 4LJ5A 3TLXA 4PR0A 1XMSA 3PENA 4ZDJA 2DPXA 5DI9A 1OKKD 2J45A 1FMLA 1D2NA 2R8RA 1J70A 1KOFA 1CIPA 1NJGA 1U9IC 5EUMA 4NL4H 1ZM2A 2RGAA 4IEEA 2F1RA 1AM4D 1VHLA 2QPOA 4KAXA 5FOWA 4D4JA 4HAWA 4S35A 3TKLA 1RIFA 5BW8A 3A58B 5BN5A 1ZNXA 4C2TA 5AUOB 2PBRA 1KDTA 3PUWA 5H68A 2WOJA 1KGDA 3LLMA 1EX7A 4WIAA 4D25A 2AKYA 2A3RA 3RLFA 5JI2E 1OIVA 2DWOA 4LBYA 4NYJQ 1L8QA 1XX6A 2OG2A 4FD2A 1XTRA 4M22A 1AIPA 4PX9A 4CEIA 1M7HA 4QGHA 4G0NA 4QJ4A 3I4LA 2QAJA 1JI0A 5HPYB 3L0SA 1G7RA 4DJTA 1BMFA 3C41J 2MSEB 3CWZA 1VYUA 3B60A 1S1CA 4BLRA 2ZRNA 2VPPA 2H57A 2G3YA 4LWZA 1IHUA 3EX7C 2RMKA 3LVQE 2GHIA 1UKYA 2WIBA 4OJQA 4GSYA 1DOAA 3T1VA 4QM7A 4IDQA 3W3AA 4DLWA 1G8FA 3QOFA 4H9GA 4JBYA 1XPOA 4JMPA 5SZHB 4TYQA 2G88A 4HLUC 2ZS8A 2ZU6A 3A6PC 3DM9B 5IT5A 5EE9A 2UKDA 2VH5R 2PZGA 5F2EA 2ANCA 4EFMA 2ZRHA 1XXHE 3GLIB 5C18A 3HJNA 4GMXA 2B6HA 4PO1A 1VYTA 2WSSD 3SFVA 5H8WA 3B13B 2JASA 3GJ8A 3OE7D 1CKEA 1LW7A 5HZHA 1KKMA 1WXQA 1KI4A 2W2XA 2ONJA 1N6KA 2H92A 3BWDD 2ZSFA 2QSYA 1X1SA 1N6OA 2NIPA 1A2KC 4EPRA 4XH9B 1ZRHA 4P32A 1KO8A 1SXJE 3CPEA 5EXPA 2WWHA 4RVCA 4BECA 5EP2A 1NN5A 1M34E 2ZRCA 4BFXA 3T06B 2O8BA 2PEZA 5GJBA 1Q1BA 2KSQA 3SBDA 4D82A 2VF7A 4IXNA 2P65A 4HB0A 2CCGA 1ONBA 1CU1A 4OKSA 4W5JA 2ZI5A 1PLLA 2JJ1D 1E9SA 3KZ1E 4JLKA 4NCNA 4B2LA 1OE0A 1FNMA 4HSEA 1WDTA 1ESNA 2V55B 2ZYTX 2HLDA 2P6RA 5TY0A 1DTSA 1HUQA 1A5TA 2WIAA 4GBMA 1CLUA 2BJVA 3OIUA 2JEOA 4TYPA 4CT5A 3A37A 4EKDA 1TUEA 3MUFA 2QENA 3PR1A 4GOKA 4QNMA 1Q0UA 5L3QA 1SVKA 3K8YA 3K70D 4CEJA 2A2ZA 3GFPA 4DHEA 1PJRA 3FHTA 2BBSA 5CK5A 1IN5A 3KXIA 1VECA 4OHZA 4MGYR 2V7QD 2IHBA 2X19A 3HR7A 2F1JA 1LY1A 1N5JA 2WSMA 3LFUA 3OHMA 3I1FA 4YXWA 3ZVMA 3QENA 4AYWA 1G3QA 3EIQA 2F9MA 1BO6A 1CJKC 1Z28A 2HJGA 1IAQA 1YKSA 4AKEA 1D8TA 1OT3A 1N6NA 3AF3A 4DLTA 2WMOB 2O8FB 3TR0A 4GRAA 2GDJA 5KOYA 3CF0A 1KDPA 1AA9A 2IYLD 4F7WA 2GF9A 4HB4A 5M04A 3KUDA 2EFCB 5EE0A 3TUJC 3FVQA 4OBEA 1J90A 2QTVB 1XJ0A 4IOMA 4JYBA 4DB4A 3SQXA 3C4JA 1U94A 1XEFA 3AVOA 3N2IA 2ORWA 4Z51A 4DDWA 1VDZA 4HAVA 1QRAA 5JI3E 2HXYA 4Q9JA 4PC6A 2C9CA 5KNDA 2F1IA 1OYWA 4RJLA 3UXMA 1Z0KA 4CEJB 1OJLA 1KI6A 2J7PA 2CE2X 5JZVA 4L5BA 3DOFA 1S4QA 8OHMA 3KJIA 1KKLA 2GZDA 3F5FA 2HYIC 4IOJA 4B43A 3LRPA 5HKKD 1MH1A 1GZSA 1FP6A 3VX3A 3KKOA 3THXA 1OFTA 4HLQB 1HA3A 2HYDA 4EJSB 1U81A 2IYXA 3ZVLA 4QL3A 3KXLA 1JXOA 1EG7A 3K70C 3P20A 3RANA 2JATA 3A1WA 1F5NA 2BKEA 1MO3A 6Q21A 2J0VA 2Q6TA 1OFUX 3LWNA 2GEDA 3C7KA 4GZMA 2BMDA 4MDFA 4GL2A 5FI1B 3CNOA 4ZDKA 1VG8A 2VP6A 3FKSD 2A5FA 2NPFA 1MR3F 4TQAA 1XPRA 2CVHA 3B8HA 4NDZA 2GKSA 2EW1A 1CRPA 3THYA 4V03A 1ANKA 2BMJA 3JZAA 5FL3A 4PO8A 2DFNA 3LBIA 2ZR0A 3NH6A 3IDQA 2O8DB 1KI6B 1IY2A 1MABA 1YR8A 1XZQA 2X77A 4MYHA 3WP0A 4NCHA 2W58A 4PHFA 2CJWA 4C0BA 1SVSA 1DE0A 4LJAA 4DVGA 2AWOA 1FPMA 3BD9A 1YZGA 2P67A 2R6GA 4ESHA 2BCJQ 1ELOA 2ANBA 1JJ7A 4PPGA 3BB3A 2D74A 4ITRC 3K0AB 4PHGA 4MRNA 3IHLA 4JL8A 4DUGA 3CO5A 2OLJA 4UNNA 1R5BA 2FA9A 2NQ2C 4ZI2A 3DKVA 3UK6A 4EJSC 3SHWA 5DLQC 3W34A 5L8VA 3AUXA 1G7SA 2G0NA 4U7DA 3EARA 3MJRA 3R8FA 1E1RA 3THYB 5FR1A 1RE0A 4Y0AA 721PA 3TQFA 2R9VA 4F4IA 1G7TA 4M0LA 1UBEA 621PA 2FSHA 4LJYA 5GJVC 1ZC4A 1AS3A 1WA5A 1ZNWA 1CXZA 1KNQA 2RB4A 3A4MA 1N5LA 5ANRB 3P4XA 2BBWA 3CNLA 3U7FB 2KBEA 4A2QA 1WRBA 1TU3A 1EX6A 1Z6TA 1E79D 5D3QA 3HYTA 1PVOA 3DEFA 2YZ2A 1GOTA 2OAP1 1NMZA 1G3MA 1VG9B 5CDFE 1U90A 1XJCA 3QSYA 2IXFA 2MSDB 4B34A 4ZCMA 4LYAA 5G3ZA 1A7JA 3L0OA 4I1SA 1G5TA 1EWRA 1TX4B 3EWSA 3L8YA 2B7CA 1U8AA 4PC3A 2C95A 2FH5B 3H84A 4BLQA 2QPTA 1MO5A 1OIXA 1RC8A 1XWIA 2ZR9A 4QXAA 4XWAA 1NG9A 3SJBA 1T4GA 3BH7A 3KFVA 4JIMA 4QBHA 2FGJA 4DSTA 1E3MA 1P6XA 1Z6AA 1GITA 4V0OA 3LO5A 3SS8A 1H8HA 1E2DA 4N3NA 3EG5A 5FTLA 2ZEJA 4NH0A 1RW4A 5LD2B 3AP2A 5KDOA 1XDBA 2JLRA 4O2LA 4PAMA 2I3BA 5DI3A 2ZREA 4H1UA 2D06A 3GEHA 4AK9A 3TW8B 4DKXA 4EPYA 3T5DA 2IEZA 3LXXA 1YZQA 1HH4A 3G5UA 4WOPA 3CR8A 4POAA 2PJRA 3X1ZA 1E2GA 4DIEA 4A1FA 2AXPA 4NZYA 1P7CA 3FE2A 1FQJA 4ZKDA 1DAHA 1Z3IX 1IJEA 3IBGA 1OB2A 1I4DD 2OSBA 5GJCA 2YC4C 2XJ4A 2IX3A 4A6XA 1XPUA 2YVUA 1XD8A 2ZYUX 1FTSA 3L0IB 2GEUA 4PZZA 4M9ZA 5CB6A 2CCJA 2PCJA 3HP1A 1T0JB 1F2TA 4PC7A 4Z1MD 3C5HA 4GI7A 4B71A 3O8CA 1D5CA 4JLNA 3U5ZB 3PEWA 3T35A 2IUUA 4DSOA 3CNNA 4GOJA 1N3BA 2NO7A 3HDTA 1E2EA 4UXIA 3UATA 4XTCS 3ZVRA 3U44A 1BIFA 2YINC 3I32A 1W0JD 2KI5A 4JLJA 3VNUA 2D62A 1X8KA 4TMKA 4IOKA 4E03A 1KI8A 4YMVA 1EK0A 3K0CA 3EXAA 2PMDA 1AGRA 1X86B 5BYKA 1KI7A 4OI1A 1XB2A 2QTHA 4AG5A 5J4HA 4NYIQ 3ONWA 2B7BA 3K9GA 1NKTA 4MUBA 1EFHA 3CRW1 4B2IA 4JVSB 4D81A 2YJTD 3RS4A 2CLDX 4WXPA 1OH7A 4I4LA 3BFVA 4MGIR 4OHVA 3UG6A 1D6JA 5KDLA 3CRRA 2JDIA 5EE3A 1QHIA 1IONA 1XTQA 5JWRA 2EVWX 4OQNA 2ZRBA 2VHUA 1DO2A 5FOVA 4NBSA 4F4CA 1X3SA 2BMEA 1MRNA 3U3JA 3WNCA 3Q7PA 1FNNA 3MMPA 3MG9A 4D6PA 4EFNA 4GZLA 4A8JB 5IK2D 4A0RA 2EQBA 2V54A 1C9KA 3KL4A 4YC7A 3W8NA 1AQYA 1S1MA 1IN4A 4YDSA 5K8TA 4FMDF 2CBZA 4HDOB 521PA 3AGQA 5D3MA 3OFNA 4DCVA 4B6EA 1OYYA 3BFKA 4TLDA 3SJZA 5DNYB 1GFIA 3THWB 2OLKA 1HQCA 4C7OB 2GVDC 4B2PA 1KJYA 1E9AA 1AN0A 4V0LA 1XTJA 5EXTA 1K6MA 2WJYA 2WJHA 2QGZA 3L0PA 3KKNA 1H65A 3DZDA 3WHLA 1WBDA 1ZM4A 1KK1A 4RFSB 2RCNA 1EWQA 2I1VB 2Q0HA 1NVVQ 4QOSA 3REFA 3LAWA 3ND9A 2QPAA 1EGAA 4NKRA 3WYGA 4AD8A 3EC1A 5KU1A 1EESA 3ZDQA 1XEWY 4CYMA 1B23P 2C96A 3I61A 4DDTA 4MKHA 2OV2A 5K8IA 5LDDC 1RJ9A 4Q00A 2XTZA 5G41A 3KKPA 3LNCA 3H2YA 1F48A 1XEWX 4TTQA 2QRZA 4C0AC 4NCJA 2DB3A 2AK2A 2EFHB 1ZUHA 1NF3A 1EFRD 4IHQA 5JWOA 3KTAB 2CVFA 3AVVA 4NYMR 1E9BA 4TT3A 3RRMA 1JAHA 3CPHA 3RABA 2JJ2A 1NN1A 4A6PA 1G3IA 1O3YA 4FW9A 1XTIA 1XRJA 4A8JC 3K0SA 1IOZA 3BS4A 1NVWQ 1VIAA 3AQ4A 4RD0A 5EP3A 2IBMA 4ASUD 1A2BA 3WBJA 2YOGA 3OESA 1IXZA 3TQCA 2WWWA 3A1UA 3RRNA 2VHJA 3IKJA 5UKDA 3D6TB 1KZGB 1X8JA 3VR6A 3PITA 4C30A 2AFIE 2VSXA 2YWFA 3EZFA 1E94E 1XNJA 1E1QD 4M1YA 2VSOA 3VKHA 4DT1A 1K5GA 1YZKA 1YZLA 2AN9A 3EZ7A 4JZKA 2PL3A 4KFTA 1WMSA 4A92A 2RGEA 3V4FA 1Z2CA 2FPMA 3KKQA 3TVTA 4NP6A 1HE8B 4P3YA 1E9RA 2XOKD 3AVWA 5AJVB 3Q9LA 1U98A 2H18A 4PAOA 4PQFA 4I1VA 1DEKA 1NVUQ 2QE7A 4LBZA 2FSFA 4LV6A 2FFBA 5FPTA 4ZIRB 3KXKA 2WOOA 2QAGA 1UBFA 1UEJA 2XNSA 1XF9A 3AEZA 5DSZA 4IW3B 3QEJA 2QI9C 3L8ZA 2W6IA 1P75A 1OH6A 4OK5A 4QHSA 2NMVA 2ZE8A 5C4GB 4LJ6A 4CGZA 1N6LA 1CBUA 1TQDA 1VCOA 5JJLA 2XZLA 3KX2A 1W36D 3LW8A 1AJEA 2NGRA 1QF9A 5TDHA 4IXMA 5F3WB 3T1TA 1W36B 4IDPA 2GZHA 2PCLA 4M21A 4TQ9A 1GNPA 2OFWA 5LBIA 1W47A 4O3MA 2FEOA 1J7KA 1U9IA 2J0UA 2GWHA 4YMSA 2E87A 3Q5DA 1JXMA 1P2TA 2WAYA 4TQUS 5LB2A 1XFAA 1P9WA 4QM6A 4F4JA 4PPFA 3ICEA 1OB5A 1P2VA 3PVSA 4BASA 2CNWA 1N25A 2GEVA 3PFIA 3GJ6A 3QIAA 5J4LA 5CLQA 821PA 4D2IA 2UVQA 2CHQA 3CX6A 3LQQA 4OQXA 2AXNA 4D4MA 3F8TA 2N1BA 4TTRA 4HLDA 3I62A 1DAGA 3CUEF 4ACBA 1T3HA 3NBFA 1NBMA 3OEHA 3RDPA 1XEXB 3GLFB 2G77B 3LX5A 3WMGA 4EPWA 1UADA 2C99A 3U6BA 3A4NA 1S0UA 1IN7A 2E1RA 4LK2A 4LYFA 5JJKA 4UNPA 2OCAA 1YE8A 5CM8B 5FH9A 1GKYA 2ZRKA 2AKAB 3EWAA 4Q9KA 1OW3B 4IEIA 4P4SA 1G3RA 1ZW6A 4QC2A 4LCBA 3X1DA 2A78A 1KDOA 2WWIA 4GNKA 4Q4HA 2RHDA 3EC2A 4TL8A 1SZPA 5ELXA 3A4LA 4MKFA 4B3GA 2BEKA 2IF0A 5G53C 5BQ5A 1ODFA 2G1JA 1DAIA 1OHHA 4Y0VA 5DN6A 3G0HA 2WWFA 1W36C 1Q20A 3MWYW 2E9SA 1KO4A 3R8CA 5B58C 4OQMA 1R8QA 3P27A 4HLUA 1HEIA 4OQFA 1R4AA 2QBYB 3QI2A 3QKSB 2JIZD 4P4TA 4NMMA 1KK3A 1ZU4A 3VQTA 2WBLC 2ZE7A 4A2WA 1TF2A 4F92B 1K5DA 1NKSA 1UFQA 2VHTA 4W5HA 4TZ6A 4MYCA 5EP1A 3DMNA 2EU8A 4ZCIA 1QHSA 1ZMXA 3UWKA 5FBRB 1TEXA 1P4SA 1D2MA 3DPUA 3OZXA 3BBPA 1NVXQ 2NO9A 3QG5A 4PAQA 1HT1E 2CLCX 4KLNA 2PT5A 1QG2A 2C9OA 1IQPA 2GXQA 3U7HB 4FXPA 2IXEA 4BLOA 3BXZA 3ZQJA 2QM7A 3AVTA 3WP1B 4P33A 2QQ0A 4C0HA 2ODBA 2ZQ5A 4JSTA 1V43A 1Z0JA 4B3FX 2GJKA 1AS2A 1XCPA 1D9ZA 3VU9B 2VLIA 4TSFD 4JVMA 1G3UA 3C15C 2AD5A 3RAPR 4GMDA 2FFAA 3S1AB 3DM5A 1E9EA 4LJ8A 2JLYA 3CLVA 3E1SA 2XAUA 1US8B 2KJQA 4N1AA 1Z07A 2Q3MA 3D7MA 4GT1A 3U7EB 3ZLJA 5CLLA 1JR3A 4WW0A 5JECA 3SEAA 3RSLA 5TMPA 1AS0A 3ZIAD 3NVAA 2MSCB 1A82A 2IYUA 2VHQA 3W6OA 3ZQ6A 3T12A 4XVQA 4HUQB 1TQ2A 3BIFA 3HPRA 3NHAA 1Q3HA 3PUYA 3GLIA 4FWIB 4BFVA 1W4RA 4EDHA 4W7SA 1NI3A 2C9YA 5L3SB 1TQ6A 1GKUB 4Q7JB 4BLPA 2WSSA 4V0MA 3ZZUA 4JLDA 3PXGA 2IHYA 1GG2A 4CW7A 3GP8A 1P9RA 2OFXA 5FBLB 2CHGA 1RVDA 4E5UA 4GP6A 3EASA 4MGKR 4C2UA 4L4UA 1E0JA 2C03A 2WPDD 1Z83A 3CH5A 2R65A 1DAEA 1CF4A 3A8TA 3AF1A 1VHTA 1CULC 3B5JA 4M2LA 2ERYA 2GXAA 1E2FA 1E2JA 4JJKA 1P73A 1U99A 1J2JA 1OXXK 1ZCAA 2J46A 4DDVA 1NNEA 2A5JA 3GLHB 3KB2A 2FEMA 1R7RA 4LJ9A 1GRNA 2MMCA 4DCTA 2Z43A 4BFWA 4DIDA 4CRWB 1ETUA 2FPLA 1HURA 5A5GA 5KPDA 2CXXA 1MT0A 1TNDA 1ZNZA 4NU0A 2ZETA 3B1WA 2GJSA 2JJ1A 4LJ7A 4G5SA 3AH8A 3VTKA 3WMFA 3H4MA 3KQLA 4EPVA 4DCNA 4JJZA 4DLYA 3KQNA 2JAQA 1SKQA 3Q3JB 1JPNA 5J4VA 3ZD7A 2GAOA 3FFAA 3AM1A 1T8TA 1BH2A 2N46A 1SKYE 3SFZA 1T8UA 4PPQA 2DWQA 3MWJA 1LFDB 1S3GA 4Q9HA 1LTQA 1DVRA 1R0ZA 4FINA 1Q22A 3GD7A 2G6BA 2ZJYA 4BLTA 2RGNA 3TR5A 5J4YA 3GPLA 1U0LA 1E2MA 2V7QA 4B44A 4C0SA 1BMFD 3QUSA 4B48A 1Z2AA 3M4YA 1DPFA 3WBKA 4KCGA 1C4OA 2F3RA 3ASZA 3BB1A 4KBGA 3P1JA 3W3ZB 4BEBA 2O8FA 1QHXA 3TW4A 3RS2A 4W9MC 3LW7A 2XSZD 3AB3A 4M1TA 3PEVA 3SE0A 5EUQB 4ON9A 4LI0A 3WMEA 3DO6A 2A5YB 1NIPA 4N0DA 2IYSA 1UKZA 5TB5A 3E70C 2ZI6A 2ZANA 1JECA 4UXJA 2XEXA 4A82A 5IHPA 1W48A 3FPAA 2P5SA 3VR5A 2W2TA 1S9DA 4Q1FA 3BE4A 4OHYA 4MRVA 2H8KA 4QFMA 4IRUB 3QXJA 4L9WA 4M8NE 2Z4RA 4R98A 1VMAA 1Z22A 3GJ0A 3QVUA 4TMXA 1XCMA 4BEJA 2GJ9A 2ZRMA 4C0LA 3K70B 1XTKA 1L4UA 2ZRJA 3TSZA 4GFDA 4CZ2A 2R44A 4RCZA 4L9SA 2A5GA 4TYYA 2ZJ5A 4HAYA 1FW6A 2FWRA 4WA7A 4KLZA 2OT3B 5FUYA 2NO1A 4EUNA 4IFEA 1DARA 1ZD9A 1E2IA 1VTKA 2VP4A 3V9PA 1T5IA 4EJSA 5HKKA 2QEQA 1SVLA 3MLEA 1Z0DA 4RKFA 3ZZTA 5SZIA 2FMXA 3IBYA 1O87A 1WF3A 2XNDA 5H70A 5HTKA 2I4IA 4KVGA 4TMTA 2YHSA 4J0QA 2IYTA 3N70A 4DLXA 2QTFA 4AWXA 1R5OA 1WCV1 2WKPA 3QXSA 2QZ4A 1F2UB 2K5UA 3HU1A 4Q1DA 4LOAA 4XD7D 4DLRA 5F98A 2BHRA 3I3SR 3FKSA 4IDHA 5SZKB 2LWIA 2ZITA 1GL7A 1HT2E
chains in the Genus database with same CATH superfamily
1A77A 3PEEA 2W2OA 2IITA 3FCAA 1O5OA 3M4XA 1ODJA 1G20B 5J5CA 1ZONA 2WHXA 3VC2A 4PLFA 1DRKA 1U8EA 1T91A 3GQVA 5A3SA 4BQPA 2V4ZA 4ER6A 1M2GA 2DVMA 2QM8A 5KJCA 2P91A 2BFNA 2IU4A 1HFJA 5F77A 1PF7E 2I6SA 3RWOA 5F52A 4ZOQI 1F9AA 1LPSA 2R86A 2NQ8A 5AKXA 4ZAVA 4FC6A 3LF1A 4V0SA 3J81k 1TC1A 3D59A 3GZTB 1Z5NA 3M1IA 3CH4B 2VDWA 3N8IA 3TZLA 4CFYA 1USKA 4FGKA 4JVNA 4KXFB 2VHXA 1UC8A 4M1EA 4X60A 4Y2HA 3RVBA 4UPEA 3OEEA 3K0AA 5D8DA 4BMVA 2HBQA 4BS9A 1PJBA 2GZMA 1N0UA 3Q41A 4X9XA 4N48A 2QV0A 1ZGAA 3WA6A 5ARCA 2CE7A 4X91A 1OXVA 1GTSA 2HMUA 5GM2A 4DB2A 3MAJA 5DNDA 2G76A 2BGUA 4QGBA 4BCDA 3QE4A 4IV0A 4OHMA 3VFDA 4AJKA 3QHQA 3S2SA 2B8TA 4AKSA 1T25A 2CK3D 2EATA 3G8DA 1A98A 3GJTA 3JCZA 4OAPA 4K28A 4JLMA 1QP8A 3KAJA 1GM5A 4D98A 2RGGA 2B78A 1JEQB 1XU7A 4LI3X 5E7JA 1ZP6A 2E85A 5I7WA 5IAAA 1KA9H 3TK1A 3TMKA 4OIMA 4EOGA 1AMOA 4K6HA 1YJCA 2ZAOA 3WRXA 1CUZA 1I6WA 2Q27A 4FIZA 1NUQA 1ZI9A 4TKUA 1O5IA 1JZSA 2AR7A 5KX5B 3G7SA 1L5HA 4YRCA 1HSZA 3MWKA 5EN4A 1N2HA 4IOLA 3AW8A 2NZ2A 2R8BA 3FTQA 2O6HA 4K9OA 4Q0MA 4KGVA 1ISPA 3B1FA 5T67A 3QK7A 3CLTD 5DHTA 2R96A 4D8TA 2NVUA 2H4XA 1M66A 1DUVG 3SBOA 4C1BA 4L75A 3ZH9B 3AR6A 3THRA 1YJ5A 1SG9A 3IRUA 4IMPA 2PPVA 2NO6A 5AI0A 1PGNA 5LQMA 4WLEA 1CZRA 4HWGA 4S12A 2OZPA 3RB8A 4RULA 3LUJA 4OXYA 5F78A 3ANLA 4R9SA 2DFPA 1PK9A 2JZOA 1NMYA 3AFGA 3VHXB 2O5EA 4EG6A 3F74A 1WKBA 4OPMA 4AXXA 2JD1A 3LBFA 1R66A 4HTFA 4Z9AA 2GARA 4U3JA 3SQOA 1JLRA 1CERA 1FVOA 2VYND 3I9NA 3TTUA 1KJWA 1AKYA 3N74A 2A67A 3IAAA 3FSJX 5H9WA 5E2BA 2OZKA 3W7BA 1WB6A 2LNDA 1IBMB 2XJ9A 2POQX 4PLWA 2H08A 4UTNA 1RI3A 4NYMQ 1E9DA 5AR1A 3GP5A 1QG4A 2ZBPA 3QG1A 3KVNA 3V32A 4X90A 3HJFA 5JH7A 2QW1A 4D25A 2HWWA 2JAOA 1HDZA 2WSYB 3PDCA 1Y3BE 4I4IA 2DOKA 4KXMA 1ZM3A 4CMJA 1T0HB 3GGSA 3ZD8A 3NBKA 3RTEA 4HI0E 4E5SA 3KYCA 1GYQA 2G09A 2ZJFA 3TX2A 3EQ7A 4XFJA 4UU0A 4ZJZA 4OGWA 3KUUA 4NCIA 1KVRA 3B1ZA 5IXSA 3NAMA 5K6AA 1VHQA 1Q0TA 1CVRA 5THXA 3PRKE 2DFDA 3UVEA 2G0TA 4YMLA 4AY6A 1QGYA 3IT0A 4MA5A 5J2UF 1GZDA 3ZNOA 3UC9A 3C3MA 3GK3A 2IEBA 2HGSA 3O8RA 4OHRA 1GNQA 1IZ9A 3TINA 5IM4F 3FOZA 5EKDA 1YIOA 5C8VA 2PA0A 1IBRA 5AKJA 2V6JA 1Q14A 2HA2A 3G8CA 3LWBA 4XWWA 3V8QA 4LDNA 3A4YA 3FZEA 2VI5A 1I2MA 4H0CA 4UE6A 5FA5A 5ISMA 2FQYA 2XE4A 3MWEA 1RXIA 2RGBA 1YS4A 4LQLA 3BK7A 2HQSA 3A9WA 4G0QA 4HMQA 4YJGB 1WBJB 3A9TA 1XL1A 2JHFA 3HJGA 4K9MA 2EZTA 2ZBQA 2ZLBA 3S2ZA 1TZKA 4W9NA 1QAQA 2JVKA 4NVRA 2Q6IA 5CNJA 4BNIA 3OT4A 2JHCA 4GM0A 5JJIA 3BCUA 1JR3E 1J23A 5DX1A 4TV9A 2Z83A 4G37A 4LHXA 1Q2UA 4B3IA 2E0IA 5ALYA 4XX1A 3U09A 4U2EA 4YP7A 4S05A 4WN9A 4XUCA 2A8YA 3PKJA 3R9KA 4LZLA 1SC6A 1SU4A 2NZYA 2BWJA 4QOEA 3IAM6 4AI6A 3B51X 4DA8A 5GVSA 1E64A 4WNYA 3PK0A 2W6PA 3HHPA 1K4YA 3K72B 4F5WA 3ADOA 1RXSA 4ARZB 1RRMA 1TW2A 1AQ6A 3MMXA 4KIGA 5ITZB 1AGXA 1AHHA 1BA2A 2G36A 2VJLA 3NIBA 5DSTA 3ROZA 3WNBA 1P19A 2FG5A 4YDHB 3TGWA 3EHDA 3A32A 2A7QA 3AC0A 4F4HA 5KWVA 3LC0A 1YI1A 1AKNA 2XVYA 5IBRA 5IF9A 3C1UA 4X94A 3SKVA 1QR2A 3DCJA 4Q82A 4ITUA 3VJMA 5C2JB 3EFHA 4ZGGA 2O1EA 2PBLA 3INRA 3KJHA 1Z4KA 1XCGB 3TPCA 5CJJA 1BEEA 2ST1A 3BXHA 1OASA 4CMBA 4CQMA 1CUHA 4FSHA 3LRTA 3QE9Y 1JQEA 3FPHA 1KSFX 4JLOA 3NALA 3SXUB 3UKDA 1BXGA 1UKAA 4C7OA 2FVYA 4PNZA 2DQYA 4D9FA 4OQLA 1B6RA 3B2EA 1FU4A 1L7QA 1H0KA 2FEKA 3NAGA 4GRDA 4LBWA 4Y6GB 2UVPA 4MJ7A 3SIWA 4Z8YA 2XUIA 2I2AA 2QL7A 4EF5A 4KITB 1YC2A 4X7MA 1N6IA 2ZXFA 4V0NA 2Z2XA 1EBUA 3L1VA 2NUAB 1G8MA 4AUNA 3H05A 4RFSA 5FWAA 3RC3A 2JCYA 5H4GA 1RLOA 3VBEA 4MX8A 5DMHA 3NNNA 2X9QA 3E2MA 1JEAA 3BJIC 2HB6A 4LW8A 1B2RA 1GZVA 1JJIA 3VDMA 3GT3A 2C3YA 1EP1B 3CJQA 2V3CC 3QF4B 2FW7A 2AQKA 4L72A 1ESCA 1L2TA 1SBTA 4Z4QA 1FDIA 4JWTA 1B8UA 3W5CA 3FSEA 3HGMA 4JT2A 1WW8A 2B4TO 5MGNA 1XFDA 3IELA 5ILGA 1N3IA 3FRIA 5G40A 4BVLA 5LU9A 1BS1A 3WKEA 3ZXIA 1P3JA 1E0DA 1H2EA 3UMCA 1EK2A 2QRLA 4PTZA 2QMUA 3NTRA 1GPKA 2EF1A 3DL0A 2C5HA 3GZ4A 4KO3S 4BB9A 4QD3A 1YS6A 4XX0B 2YN4A 1EM6A 3JALA 3KU4A 2FZ4A 4RF5A 2A9FA 4Q3CA 4YCAA 5LIPA 4Q3EA 1TJ4A 2ZCJA 5SICE 4C5AA 1JQ3A 3FNFA 5B2ZA 4CDNA 3PEFA 4UOZA 4U7TB 4A73A 5GADl 2VJDA 1B8VA 1W96A 3M6AA 5IARA 2YV5A 1YJXA 1EMDA 1ZBDA 2R8XA 4P98A 3CR7A 1KAMA 1OFUA 3QPAA 4N7MA 3VR3A 4NFHA 4I5FA 4EYGA 1GP2A 2D4HA 1QX3A 1XZBA 3UMYA 2WFLB 4EPXA 2F48A 1S8FA 1JJAA 1IWBB 3DV9A 2DBQA 3GRAA 4OYYA 4WBSA 4JB0A 2HDWA 3SR0A 3KEQA 3BB4A 3BK2A 3PYXA 4FOOA 4GI1A 3SI7A 4AY5A 3T3MB 3RUAA 1PJAA 4K46A 2ZM6B 1X9GA 5A03A 1AY0A 4OK3A 5HFAA 4JQZA 2HEGA 4JKOA 2Y92A 1FQOA 1CY4A 4ZVVA 4GYYA 1R0LA 1P62B 2B21A 4MYTA 2GKGA 4IUBS 5E1MA 2Q2QA 4ANFA 4AO8A 4PGGA 1STOA 4LHVA 2C5LA 4ER7A 4EAQA 5KIAA 2B5VA 4AURA 4YRDA 4B47A 4H15A 4XXHA 5AK4A 1U7TA 4AY4A 4Q47A 3FUTA 4UD6A 1XCOA 2VF2A 2GM3A 1TF5A 4ZVPA 1T9DA 1T9GR 1W5EA 4NBLA 1GZUA 4PZDA 4B2YA 1KEEA 2HCBA 4JDUA 3EMDA 2JEYA 4C6SA 1UPCA 2G9NA 4RTKA 1JIJA 2QRKA 1M34B 4M6WA 1LI5A 5TQ0B 5FPHA 4FBMA 1MJHA 1H0HA 1V8BA 4NDAA 4XGNA 4U4AA 3T52A 2FAXA 2GH1A 3U6KA 4EY4A 3K8QA 1H8ED 2AFHE 3A6KA 4QEZA 2X8AA 2XECA 5K5EA 2OZLA 2YFHA 2ZB7A 3H2ZA 3IHWA 3EVNA 3G5MA 3LG2A 3DE2X 5AJWA 4G9BA 3OZIA 3A2LA 3REQA 2ORIA 5B1EA 3NXKA 2XE6A 2XZTA 1IDN1 3P5SA 3PKZA 4ZO8A 1KRWA 1XLUA 2PWAA 5BSTA 2O8EB 1X7GA 1OQAA 4ECEA 4A15A 4BO4A 3P2EA 4RQTA 3UJBA 5BPFA 4BBZA 5PGMA 4I1IA 1C9JA 4RFVA 1GLGA 3JWHA 2MR6A 2AMJA 1EFLA 1CZHA 2EEZA 1QZZA 3B82A 4W5WA 5TGDA 2AN5A 1UJCA 3HPQA 3TIFA 4IDAA 1XEXA 3GLFA 1EFUA 1XEAA 2WG1A 2ZZNA 2ZRFA 2XUJA 4WK2B 3OM1A 2CNLA 5EIBC 2RAFA 3TG2A 4PLGA 1KEEB 1Z5ZA 3G0BA 4O4LA 3N5CA 4TT3D 2XZOA 4QJ5A 3QKRB 2C0QA 2A84A 1HSOA 2Z9CA 4KBFA 3TL2A 1AQUA 3GCXA 3IC5A 4G5OA 1QTNA 1IPHA 2XE8A 3GOHA 2FMHA 5FL7D 5MHTA 5DPMA 1EEXB 3Q85A 2G4VA 4TL7A 5ALTA 1P0FA 3ETHA 2WAOA 1K3UB 2NSYA 3SJAA 1KI2A 2CNBA 3BVPA 3IDFA 4YRRA 5IZCC 4QDZA 3AJ8A 4AAYA 5HYVA 3IUQA 2ZWVA 3F3SA 4AZVA 2ICAA 4U6SA 3F90A 4C3ZA 1GT6A 3KSMA 5KYGA 2QW0X 3I1IA 1YMUA 4G41A 3DTVD 2H85A 2JF0A 1FRNA 3HO6A 3SZLA 2PUJA 2Y67A 3R5XA 3T3DA 4B75A 1X1AA 3DOCA 4ZVTA 3GBPA 2QT1A 5EZ6B 3KJNA 3DTVB 1NBWB 4FZ3A 4JQOA 4MWOA 3AP3A 4EUSA 4ZYVA 1QZXA 2RI0A 2VBCA 3SJ7A 1GHTA 1HORA 1OI4A 2X13A 3FHOA 3NTUA 3OUZA 2H2IA 4XW2A 1TUGA 3QPUA 3LIPA 2HX1A 2QE7D 2VXBA 3IVGA 4XSGA 4EA9A 3DBVO 5BNFA 3O5AA 5B6JA 2DJIA 1QQAA 4NSNA 3EGOA 2FRDA 1I5OA 1YQDA 2GRJA 3HJUA 3W4JA 3QOWA 4YRKA 3EZNA 3PEYA 1EBFA 2IU6A 1SA0B 1UPAA 2FFHA 2X5KO 3PTZA 5KQMA 2WKWA 4ND3A 1JBEA 4RNDB 3EPPA 4AG3A 3N2KB 4TLBA 3O8QB 2A0KA 4IYRA 2QROA 3ED1A 4M8LA 4Q4AB 3T15A 5IKPA 5JBIA 4XM2A 5DO9A 4GWLA 4I4CA 3DEAA 2DX7A 1JLMA 1BHO1 4OUDB 5DOVA 3VU9A 3D6HA 3NIDB 4QULA 1WDLA 4CMHA 4NJEA 1WE2A 3REGA 4NPCA 4RZSA 5EE5B 1IY9A 3MHTA 2HRQA 4XWTA 1OKKA 1M8PA 3EMVA 2XA2A 2I2FA 1SUPA 4TSFA 3W6ZA 3L8DA 1VPDA 2RH5A 3FCSB 1SBZA 1VYVA 2HNBA 1REQB 3NHJA 3WO0A 1RABA 3EA0A 2NVOA 1Y1KE 5BSKA 2CLSA 5FNVA 3OZEA 2OY0A 4HZUB 1F8YA 2CUKA 5TQVA 4D3DA 2VSFA 1A1VA 4W5TA 4Q19A 4V0KA 1Z8NA 5JD5A 5KYUB 3U56A 4UTRA 3ORRA 3MCAA 1E0AA 1OBOA 3PGVA 1I4TD 1U0TA 4CMGA 2C4VA 4EVSA 1EINA 1X9IA 4W7HA 2PFKA 5KTTA 2A0XA 1ONOA 1U8YA 2PX0A 4MVJH 5FUXA 2GRUA 1OGYA 2O20A 3BWMA 4HNUA 5GV7A 3FMPB 3GNLA 4C4PA 1NBMD 3JD0A 4DARA 4YY3B 3X2SA 2YQ5A 4PLHA 1NUHA 5LP6C 2HSZA 5LWHA 2K2WA 3EWIA 2FOIA 2L82A 1R15A 3OZFA 4EW6A 3A0RB 3N75A 1L5WA 5FWNA 2Z8ZA 3MYRA 4UAVA 1I3OA 4UDNA 1IM2A 3JWJA 1ZJ5A 1L0BA 1KTVA 2C2WA 1D0IA 2R6DA 3F6RA 3GDOA 5K7SA 3J7TA 3NAZA 1KMHA 3IAXA 1LZKA 1PUJA 1VMKA 2FW6A 4MITA 2AMFA 1JQ5A 2LVBA 4V2UA 1GZ5A 1WUJS 4IVPA 2XQVA 3WKCA 1K92A 1V9SA 2H1CA 2CN1A 3TPFA 3WXMA 1WG8A 2DTDA 3E7PA 4G3XA 5P8WA 3EQ8A 3CSDA 1JUDA 4K87A 3RNLA 3VAZA 2XOEA 4ZFNA 3RVDA 1E5LA 5GZ1A 4Q03A 1VIDA 1YE5A 3PC6A 4Q1AA 1T9AA 4DMUB 2EJVA 5CCBA 1WWKA 4G81A 1MVNA 1ABBA 2BUCA 3MFYA 2MMGA 3OKFA 4B9AA 3LSYA 4M7PA 3NDBB 4OJKA 4EKIA 1BE0A 5BUSA 2VJBA 5LP6F 1P4JA 4JI0B 3GJRA 4YRSA 4ZJUA 5KQSA 1HL3A 3CC8A 5ESWA 3U3MA 3OPVA 3DVAA 4KMOA 1DDOA 1KSGA 2YFQA 1Q12A 3O4FA 4K3VA 2OGZA 1LJ8A 1QYDA 1QHGA 4EG7A 5F2NA 2C9BA 4TMZA 3P9YA 2JJ8A 4EM6A 4LIPD 2ZSEA 4ZYYA 2AQ8A 2XUZA 1CV2A 4RMGA 2O0KA 1GAEO 2GERA 2X2OA 3N53A 4KAJA 3FNBA 2F62A 4B3TB 2PS0A 3VVLA 1MJGM 1YBFA 4HAZA 1KMHB 4G5XA 4JLAA 4JITA 4BYMA 2HF9A 1TEZA 1GCOA 3FA2A 3GARA 3KJQA 1U7HA 1G5HA 2QVYX 1TO6A 1W0CA 3DTNA 4K9LA 5KU7A 4DZTA 4MPPA 3U4QB 1IN8A 4L51A 3RKRA 2BN4A 4NECA 3RM3A 4JL6A 3TZQA 3TW6A 3E58A 3C6YA 2QR5A 2PBFA 4I9GA 2Y93A 1DOZA 4Q9LA 1XMXA 3H0KA 4P36A 3KQKA 2JS7A 3OCXA 3K0BA 3OOSA 4W9RA 1VM6A 3M7IA 5AHWA 1W46A 1YA8A 4BFUA 3QFFA 4FMBB 4O4IA 3P2OA 3QV2A 3QMVA 3CF2A 3TZ6A 1AKRA 2H4ZA 2O59A 3QNUA 4K7JA 1X80B 3C6MA 4TWZA 2BGMA 4NOLA 3NC1C 4XRGA 4E12A 5JHHB 1S7GA 2HQOA 4Y2VA 1I80A 2R5WA 1TVEA 4MUIA 4X85A 1YHNA 3G8AA 2DHDA 3JV7A 4RVSA 1Y48E 4G5RA 1HWYA 1RZVA 4MH0R 2J5XA 3LP5A 2DBYA 3LX4A 1WZIA 2PMFA 1ZJ6A 3FYUA 1SG0A 1XLVA 3GHYA 5GJWC 3U61B 5A02A 1GL6A 1U9JA 1WM1A 3BRWD 4URZR 4JWKA 2HHJA 4JKIA 4FIDA 4NFSA 2G8NA 3TVDA 4KPEC 1UDRA 2IOFK 3OT5A 2EWVA 1C9MA 1F12A 1X7YB 3DO8A 3PF8A 4INAA 3H17A 3RU9A 2AK3A 2RHMA 2RGDA 1MU0A 3AF0A 4LTDA 1ORIA 2FSVA 1KEWA 2OFFA 1F6BA 4FXOA 5CB4A 1CUWA 1RWVA 5FPKA 1TCUA 4TM7A 1YQXA 1Q11A 2QP4A 4W99A 1NA5A 3DLTA 2GS9A 2PRZA 1I9CA 1NRXA 3G89A 1G55A 3F1KA 3SVLA 3R2JA 5BMVA 4CKZA 1G21E 1C2YA 4KQCA 4V0RA 1IVSA 1MOZA 3KCNA 5DT2A 1CDDA 1CEEA 4BWYA 3KSDO 1WP4A 3TZEA 3E15A 3ANNA 2CF6A 3EQ2A 1WCIB 3A7EA 3GMDA 2P6NA 3O95A 4TS4A 4ZJPA 1O8BA 3ED5A 2QN8A 3WLQA 2EJCA 4G1VA 4MB2A 1DIGA 3W79A 2F1OA 3AYXB 3HBAA 1UQUA 3E9NA 3SIXA 2ADMA 2B4YA 3QLJA 4NS1A 4LYJA 3KFXA 1HF3A 2GBGA 3FOBA 2QLBA 3B38A 2C2ZA 4DMMA 2WHRA 1SUEA 4IIJF 3JQ8A 1Z4PX 3CLUD 3EXEB 1ORRA 1FYVA 4TXHA 2O2SA 9MHTA 4MR8A 1GDDA 1L7XA 1E32A 2YNMA 3GJ4A 3PNMA 4MWEA 4AZTA 5CDHA 2FWJA 4B1FA 1J06A 3DAFA 1BDMA 3JQ9A 2B2XA 1BEUB 1ATIA 5TVKA 3E3NA 3I8SA 3OTGA 4BXOB 3P7MA 5HQJA 2G9ZA 5KDDA 3FFWA 3WDLA 2PUVA 3EUAA 3A3OA 3IR7A 2W2NA 5C34B 5KMGB 3TB6A 1P2FA 2QQEA 1O6CA 1N78A 5IXJA 5LU8A 3RC7A 4CLDA 3MRXA 4KH0A 5GM1A 4GLBA 4DMGA 4F1KA 5CM2Z 1F6WA 3LFTA 3KDAA 3SYNA 5CK4A 4Z3OA 5DHPA 1SHUX 3NEJA 2F9FA 1CCWA 1ZHFA 3UFXA 4MV1A 2E3JA 2W5UA 3BJMA 3HO8A 3NHBA 3ZLUA 2G83A 5IU6A 1YBVA 4Q4JA 5AT1A 1H9BA 1MP0A 5DCYA 2HOQA 5EXDA 2B4AA 2HLDD 2P9HA 3NP9A 3T4XA 4U0JA 4URFA 1HQYE 4KI0A 1LVGA 1U2EA 4KC0A 2NVWA 1YS7A 4GP7A 5YASA 4CHTA 3IH5A 3L7YA 1P3Y1 5K01A 3KOOA 4CODB 1MRSA 4BZXA 2X15A 2HHCA 3LI2A 1K2WA 3N2GA 5FOTA 3B6MA 2ZJAA 1W4BA 3LJKA 1J8DA 1O6GA 2ONKA 2PUHA 2VFAA 3NKLA 4P1ZA 4ZPJA 3T61A 1T6YA 1WXIA 1N6RA 1IH8A 3IPXA 4FT2A 5L3QB 3ODPA 1QB7A 1S2OA 2EAUA 3QFSA 5TX7A 2AN4A 4B33A 4EZBA 1R74A 3E05A 3BYZA 3OCJA 4RA9B 3OLVA 4F7DA 1C3EA 2QTMA 2WJIA 4M9CA 4XR4A 5T4FA 3UK0A 2GKOA 4MIYA 3AHDA 4YXWD 3A6FA 3ANXA 3IP8A 3OM0A 1ZVQA 4ERXA 1V26A 3H0CA 4HEJA 4IG9A 3U2QA 1H1DA 1SVNA 1GPBA 3CF4A 4LN1A 4O02B 3L7BA 4H08A 4U2KA 3TB4A 3HA5A 2H9IA 3M3HA 4CG1A 4H2DA 2AVDA 3OLWA 1UT6A 1F3OA 4XB1A 1CY1A 3JU3A 1UIMA 1FU7A 3T5CA 5DU2A 2XQGA 5IZ4A 1L5FA 3BERA 2P0AA 4FYVA 3DAPA 3Q3IA 4LK3A 1YOBA 2HK9A 1EI9A 2WV9A 1CWUA 1DKOA 1LI4A 1NLUA 3MWLA 4EVRA 3WWDA 4QBTA 2AN3A 3UK2A 3ZWPA 2PL9A 3AM3A 4BIMA 3AR3A 4EHNA 5BWMA 3T7EA 3G5TA 1B8PA 1SHTX 3ZXUB 1C7RA 2GLUA 4RQBA 3QX8A 3MYYA 3C0KA 4FWBA 2CYCA 4GXQA 5CX4A 5U4XA 4XB2A 2NUTB 4CL8A 1K89A 1GPDG 1YB6A 5DBEX 2R5NA 5HRUA 2G63A 1ZEMA 3JYHA 3N3AC 4YRMA 3DBOB 4BU0A 3C48A 5EHXA 3UW1A 1C2TA 4TT8A 4L73A 2I76A 2D13A 4CM6A 2VOJA 3TJZA 2P0EA 1FLDA 1QWOA 3H83A 1X39A 3EVBA 1R0KA 2ZIAA 1NRWA 1X2EA 4D2IA 2BDTA 4J0CA 1RADA 2A7XA 4CUKA 4Z0TA 3OLYA 3T7CA 5H9VA 1WD7A 1Y6JA 5JS1A 2PGNA 1GIAA 4WFIA 1XTVA 4LJRA 4NRDA 2LXNA 1ZITA 4XYLA 3V6LA 1ZUNB 2Z30A 2Z8XA 4XGKA 1JHQA 1SQGA 4IQGA 1GVNB 3MNFA 1NX9A 2H2GA 2QX4A 3A3PA 1DHRA 3AKDA 3BF8A 121PA 5HBRA 2AB0A 3H11B 2FJUA 4FDLA 4FN5A 4HAXA 4XWYA 1PZGA 1VE6A 2CB0A 5IYZB 2MIIA 1U4NA 3NKVA 2MINA 4MROA 2JKVA 5AOAA 1E0KA 3E5RA 1YGYA 3EH2A 4RHEA 2HRRA 2HZ7A 2OK7A 2Q5IA 3UAZA 3WL6A 4I6EA 1NN0A 5D7BA 1E7WA 1RS0A 5EHNA 4CM9A 4FE3A 4HL6A 3OZSA 1NT2A 1PKEA 1EFPB 2YZGA 3COPA 5FOSA 2AEJA 2FB9A 2HK8A 3WLLA 1Y1PA 3OBBA 3G2KA 1JDPA 1F06A 1NC1A 3MERA 5IPFA 1JTEA 2OCDA 3QKUA 4O2BF 5A5EA 2Q9CA 4EKNB 4LGVA 3FPFA 2R68A 2ODNA 1CNMA 2IL1A 3BRCA 3U1BA 2IV2X 4IJVA 4FDVA 5B53A 1Y4DE 3GRYA 1KU0A 3A6HA 4O2AF 2H7VA 1CEQA 4I55A 3PL1A 4RZQA 3VX4A 4L8LA 1KPIA 3B89A 2C31A 3D31A 3RSOA 3GA5A 1H05A 3U39A 1TT7A 5C4IA 8ABPA 2OGSA 3KALA 4LHSA 3OSZA 1PL8A 2Q2VA 4MQLA 1U04A 2BISA 4HQRA 2DZDA 2MINB 2XYGA 3A05A 4WASA 4EUKA 3I2YX 3ZU3A 3MRSA 5D01A 1ISGA 4KU4A 4RA6B 2JLZA 2VYQA 1XSEA 3KJFA 2OFOA 2D2IA 5F1KA 3P26A 2HR1A 1NU6A 1SBYA 1TJPB 2ALJA 2ZB8A 4DMRA 2FMKA 3E8SA 4J2TA 3RUIA 3IRVA 4CF5A 2IHNA 4RMJA 4CKEA 1HNWB 4KV9A 1KP2A 2O6LA 5AKIA 2WLSA 3KOWA 3W8RA 1SXIA 2X4LA 5E4YA 5FBVB 2J6CA 3GLHE 1GXSA 2BELA 3WMRA 2CDCA 5JANA 3GT0A 3LH5A 4L8GA 4WZAE 1RLJA 2BHNA 4UTOA 2QSZA 5ILOA 1LPNA 3ZWDA 3FAZA 4LVOA 4RUKA 1AF4A 1KO7A 3HUUA 3QYJA 3EGIA 3HR8A 2PSSA 3PX7A 1YE3A 4TMVA 4TLEA 4UAUA 3IUJA 3PDUA 3WGZA 3KQMA 4L16A 1QC5A 2B4RO 1DAFA 2VNAA 4K6FA 5H1YA 1PQWA 1PD1A 3UG7A 4CG0A 1QGZA 4I1OA 4DSZA 4TUYF 1PLKA 3K96A 1U3CA 1O97C 3I9V1 5BNIA 3TAUA 5FOUA 2XUHA 2NUPB 1RXUA 2R7NA 3VR5H 4K0KB 3I42A 4G1MB 3AW9A 3E2IA 5C46F 4JJEA 1H8HD 4JLPA 4ICIA 2TMDA 5CNIA 4OSEA 1EXMA 2WF9A 1UBOS 3LA6A 1QFMA 1ZD4A 3N7TA 5K3EA 3HYRA 1EK1A 3EVCA 3QBTA 3RWBA 1UOEA 1NHGA 4JDPA 2XCSB 3TNLA 1KMNA 3T9EA 1OJ7A 4L7QA 2H1LA 5C4MA 4GZ5A 4ARAA 1SCKA 4N0EA 5DSXA 1PGJA 4ND7A 3F5QA 2XB4A 2GAJA 4QJIA 3ADDA 4M8IA 5BV1A 1CR4A 4LUCA 4L3VA 1E92A 1HDIA 1UBCA 1W94A 2GCOA 4R2IA 4TV8F 5K0TA 2A6PA 4GPEA 4MVJA 2L18A 4TTIA 2FWBA 3DOEA 4PFKA 4AJLA 2ZUUA 2HT6A 2AC4A 2JARA 3L6UA 1BFKA 4O6VA 3CQ9A 4BO3A 4CLOA 1T3LA 5AKYA 3NBZC 4TRMA 5KVAA 4D0LB 2ZXEA 1PS9A 1UL1X 2IGBA 4HPXB 1H1LB 1V41E 2RHWA 3FMOB 4MYUA 2ZJBA 1XU9A 3MB5A 1Z82A 4X92A 4PCUA 3IP3A 2ZRIA 4I14A 1B42A 1LF0A 3RS0A 1DXYA 1KJIA 1T6NA 2Y76A 5THQA 5K3FB 1TYDE 5KNDH 3SIRA 4ALKA 4Q4CA 4J0EA 3Q6MA 1JHUA 2J3MA 4BP1A 4ETNA 1EP9A 3K1ZA 4HEA6 3QBVA 3VJRA 3DUFA 4JLSA 3IMKA 2BGTA 1MPXA 2J33A 2V9PA 3O21A 4LXXA 4ASUA 1HDYA 4YCNA 4WI1A 3ABSB 3WQQA 4BNDB 4D3YA 5FO0A 4QFCA 2J3LA 3GFTA 3OCZA 4BVJA 5IAOA 1N57A 4JJGA 5EE1A 3JAKA 4ZREA 3RKUA 2ZJZA 5A7FA 1Z4LA 4LV8B 5LUAA 1B93A 4XZ3A 3GJXC 1RBYA 1HO3A 3JASB 4M7RA 4DNQA 2Y3IA 4EFNA 4EJ0A 3H65A 3RGGA 4B5KA 4F2GA 3UMSA 2QE6A 5IXYA 1GZ3A 1F3LA 1O0SA 3FWKA 2EV9A 1FK8A 2JDID 2B1IA 2I34A 3CF6R 3DMDA 2QUZA 4TKVB 4U7WA 2DR3A 4F2WA 4QUIA 4LRXA 4AS1A 3MAGA 1QPGA 4G4SO 5FWYA 4DMFA 2W0MA 2HY7A 3P9XA 4RV9A 2EYQA 3A1NA 3SC2A 2FX5A 2VDQB 4JSYA 1I9GA 3GRZA 3C24A 2H2WA 1Y9AA 3OOWA 3A1EA 4YMWA 3RS3A 2XGSA 1RJWA 2E4ZA 2Z5LA 3PGA1 2NU9A 4I9NA 4JC4A 2HJSA 2Y8EA 3NTOA 1RKVA 4XDHA 2CY0A 4DRXB 4EGSA 5I7SA 5I9SA 2FWNA 4G63A 1HLFA 3I6QA 5JMOA 2DPMA 4EF6A 2XRMA 2ZS9A 4KFUA 1M2KA 4ZT4A 3Q1KA 4CUZA 5LJLA 4RLSA 1RTKA 1E8NA 1V39A 1LBHA 3H2SA 5FFFA 1WXXA 1I1OA 4QATA 1JLHA 1TU4A 3V8MA 4CUJA 1R1DA 1AGPA 4ZO6A 3PSHA 2R8YA 2B98A 4LXGA 5HXAA 3OJOA 1YCFA 4YT8A 4OBBA 4F96A 3NOOA 3E22A 4JR2A 2ZUSA 2W6MA 5DEOA 4KQ2A 1JE0A 1NP3A 2OCGA 3D0KA 4FYWA 2DE0X 3LX8A 3FTDA 1COWD 4TOIA 3NNDA 4DDKA 1XD2A 3DV2A 1KR2A 3SJCA 2EBHX 1YFLA 2FX3A 1M7GA 2OORA 2ZCUA 1MG0A 4MGZR 4C7JA 4Z4EA 221PA 1FNDA 1RJ9B 2DM6A 1IPFA 1VCMA 5KSWB 1YOVA 5JCOC 3S0JA 4U6QA 3SLRA 2B1GA 2PYIA 3CBQA 4TN1A 4G65A 5SYMA 3DFUA 3HFGA 4HN4B 4MWZA 1GUAA 6CHYA 4JI6B 3UHAA 1G8PA 5IAJA 1WHTA 3U3ZA 3CLSD 1E2NA 2D5LA 2YJZA 1FL9A 2INGX 4PQRA 2QNIA 1AQLA 4ZKEA 4JJFA 1UFOA 2V0NA 2IU0A 3R7NA 1ZX1A 3WSWA 4EP1A 5A0FA 3EDQA 1V7CA 1TZ2A 5E4TA 2X0DA 4WVLA 4BN5A 5CDTA 3Q87B 3M8KA 1JIKA 1V5WA 3WTBA 4BNVA 5C80A 5LKRA 3HI4A 1SBNE 2D0IA 3W2IA 5JRZA 2F43A 3PZRA 2RH4A 4Q9DA 4XQCA 5BYJA 3SZMA 3DBLA 2VZLA 2JD0A 2FTKE 4HO1X 3HBLA 1BU8A 1USGA 2EKBA 1OROA 1CRQA 4NE2A 4UHKA 4ZU3A 4CG2A 5BWBA 2F55A 3ZU2A 3PZBA 3WGHA 1E96A 3I3OA 5REQB 1QDEA 2DWUA 2PX3A 4F71A 3GAFA 1ARZA 1UBGA 1P81A 1W581 1P2UA 1WUHS 2A30A 2P90A 3EVAA 3ETDA 4ABYA 4UNRA 3FB4A 1SPXA 4MR9B 3MT7A 1OFGA 3KEGA 3B78A 1QTIA 3QYFA 2XXAA 4KWCA 4A10A 4L8FA 4AS2A 4UVDA 2PNFA 4OYLA 4A27A 4L5IA 2H7CA 1RHKA 3ACBA 4YK7A 3HXKA 3W2HA 3ZWMA 3T95A 2B8WA 3K09A 3HFRA 2VTEA 3ITNA 4KVZA 2ZUWA 4Q1CA 1J5XA 5MN4A 2FRVA 3DXYA 1PT5A 1LS6A 2RHJA 3ZWQA 5I7VA 1AO0A 1R3DA 2ZAYA 4H1TA 1JR4A 4G2TA 1AV7A 2OYSA 3TTVA 4NPAA 1HQKA 4WZ6A 5F35A 2ARKA 3O92A 1NXPA 1PS0A 3JQBC 2H5JA 4S2UA 1TA0A 2GXUA 3Q3GE 1V1RA 3LUCA 4BP8A 1G2IA 3B6ZA 3OJ0A 1VG1A 1I33A 2G06A 1Y6ZA 3RVNA 5B57C 3KTOA 5JC8A 4YALA 5B1YA 4FKBA 1J8VA 5IDXA 1ISSA 1OX6A 4H18A 4ZVQA 4B6SA 5LYJB 3TWOA 1HM5A 1NJFA 1YUNA 1LV7A 3UYLA 5JSZA 2RK4A 3FWHA 4Q6BA 1RKQA 4ZV4A 1YIDA 1FZQA 2ZDGA 3ZDCA 4ZC8A 1A97A 3P32A 2FMUA 4YTEA 2OYCA 4P9NA 5CB8A 4YJDA 2YJ4A 1II0A 2AFRA 3B6KA 3TBHA 3FFTA 4R1OA 3PPYA 3L6DA 1SEVA 3OOYA 4N5DA 1Z5OA 4DEVA 4BP9A 2IEGA 3GEMA 5I8WA 3FD8A 3K9CA 3CVOA 2PR2A 3FB1A 3TOSA 1G19A 2QDKA 1KVSA 2AUMA 4P3KA 5AKEA 4MQFB 1HDOA 3OF5A 2XTMA 2GJ8A 2CZCA 4L5YA 3ZWAA 4AIRA 1QDUA 2I7CA 3ABRB 3U1TA 4GSLA 4XVUA 3ROGA 4H35A 3P9NA 5B4UA 5HSGA 2XMZA 4UQOA 3TRFA 1PNVA 5CX1A 1FTQA 2ZJOA 2G17A 2QGNA 1TK9A 3CGGA 4FONA 2QAGC 1MJ5A 2ZAMA 3S2FA 4PYJA 1J1UA 3PC8A 3D3NA 4DQ0A 1KY3A 4B45A 1GQ2A 1LJUA 1K27A 1T24A 3CNQS 1GU7A 3FF1A 3GGJA 3NETA 1HRKA 1ADYA 2ODWA 4RGYA 3IHTA 5G3YA 3UV6A 4A0HA 5DN6D 1UINA 3WLFA 3T1NA 2VXYA 2O3JA 3SYLA 1OPXA 3SJUA 4D3XA 5TIIA 1P80A 2X3FA 2PUDA 5H5JA 2EFDB 3SE7A 4A91A 2I67A 3G9QA 1WZCA 4ZDJA 2Y99A 2XUAA 5KTMA 4BNUA 2J45A 2R6R1 3ZU6A 1V16A 4PX5A 1NURA 3R5KA 4WD3A 4XFDA 2PXCA 4F6RA 3BFPA 3IVCA 1AUXA 3K35A 1SQ0A 1NJGA 2NQTA 2OFPA 1P5HA 1T4BA 4EUEA 3OWHA 5EUMA 4CNBA 2O7QA 1USVA 3WIEA 1L5ZA 5ADHA 2QPOA 5FOWA 2HRZA 2PWPA 2BZSA 3AFHA 4KRYA 4D99A 1XVIA 2JCGA 2BGLA 2WYOA 4OLFA 1I7QB 1ZNXA 3RUCA 1Z39A 1GN9A 3HL0A 2Y2VA 4YFVA 2XT9A 2PUFA 1ZK0A 3SHOA 3T0FA 4KR7A 1HT3A 1QO0A 3UXEA 1DWQA 2J32A 2NXWA 3LLMA 3NWEA 5JI2E 1P3DA 1WUYA 2QTCA 3D5EA 2WT4A 3GUYA 1LWNA 1PSZA 3GRUA 2DWOA 3VSAA 3G5AA 4NYJQ 5HF9A 1XTRA 4RK5A 3IBCA 1BE8A 3MUNA 4PX9A 5AOCA 3WK4A 3ANTA 3JR7A 1RM4A 3KS9A 4PYOA 4HGNA 3JQPA 1P4HA 2DWCA 1H0SA 1NP7A 1VE7A 3MJTA 4DMKA 5CBPB 5HPYB 2WPNA