4D0NA

Akap13 (akap-lbc) rhogef domain in complex with rhoa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title The Crystal Structure of the Rhoa : Akap-Lbc Dh-Ph Domain Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4d0nA00
2QT1A 4QGHA 4MRSA 3UWOA 4BECA 3HR8A 3CRVA 1P60A 3VKWA 4X8OA 1DG3A 2HF9A 3KX2A 2FSFA 1JXMA 5CJPA 3PUYA 2NTYC 1Q1QA 1SVLA 1D8TA 4LJ6A 1Q0UA 1TQ4A 2ZM5A 4W7SA 1E0JA 3QXHA 4TZ6A 3CLVA 4BFVA 2OCPA 2HYIC 2JA1A 4P33A 2EFDB 2ZYVX 1ZRHA 5FOUA 3I32A 3VNVA 3M1IA 2OXCA 4RCYA 3F0TA 2BM0A 2QAGA 4NYIQ 3AB3A 4RCZA 3CZPA 3T1QA 1MR3F 2XEXA 3F3YA 3PV0A 3UG7A 1OFIA 4M1SA 1G8HA 1M7GA 4N3NA 2F1JA 2H8KA 5EZ6B 2J45A 4M1MA 3U6BA 2C78A 1UBEA 2FFBA 2ZSBA 3MJRA 2P2LA 3AVYA 1PUJA 3X1DA 2GESA 4MKIA 1VPLA 1KK0A 1G21E 1X86B 1Z0JA 2ERXA 3ZH9B 2EQBA 1ZVQA 2AK3A 1IBRA 4KSCA 2O8DA 4U00A 2O52A 2O8EA 3R7WA 4OI4A 2O8FB 221PA 4HAWA 4LYJA 2OXRA 3SYNA 1A4RA 2DHRA 2FJUA 4PQYA 3SU8A 5DYGA 3OFNA 1KI3A 2FSGA 2ZU0C 1JEDA 2QMOA 4LUCA 1SHZA 2DY1A 3T12A 4TT3A 1KI4A 4IOLA 4DLWA 4AC9A 1J99A 4MA4A 3QKTA 4BEJA 4DT1A 3PXGA 4AYWA 3U7HB 2GHIA 3KZ1E 3WYFA 4TMWA 4EKDA 3AP2A 1CEEA 3N70A 3TW8B 4F92B 1HURA 2QROA 2JDIA 1E2NA 1NBMA 2OFWA 4C0LA 2XXAB 3SC3A 3CPJB 4V0NA 1DAEA 3AVQA 1DAMA 1Q3TA 1VMAA 3CPHA 3I5YA 4HLQB 4NCIA 4QBGB 3THOA 2XSZA 3OE7D 4Q4AA 3MJHA 1XXHA 3P26A 4QGGA 2AXNA 2RHMA 2G6BA 3AF3A 3DMDA 4MUAA 4OJKA 1JB1A 3QI2A 5KYKA 3GLIB 3IO3A 5FPHA 5FUYA 1QHNA 2XOKD 4UNNA 1G6HA 1P4SA 4NKRA 3VR4A 4JLVA 5FPSA 4DCUA 4OI0A 4LPKA 1N2CE 1U0JA 2XGJA 3OIVA 4L8GA 1FOEB 3IPXA 3K0CC 4KYUA 4ACBA 4E07A 1OB2A 4ZCIA 5E7MA 4LCBA 3LNCA 3K0FA 1HE8B 3OIYA 3PJRA 4GI7A 3SYKA 1RRCA 2QA5A 3ZZ0A 5JBQA 1Q57A 4DLYA 3FTQA 2B8WA 1U99A 3LDAA 5CB6A 4YDSA 1W36D 2CK3A 2GK6A 2GILA 2W6JD 4CGZA 4W5JA 2YOGA 3DZDA 1VG9B 4Z1MA 1W4RA 3W6OA 4DC9A 5L3QB 3PVSA 2OV2A 1X1RA 4NCJA 3RRMA 2YWEA 5E95A 2O8CA 1UBFA 1AN0A 1YRBA 2E87A 1VCMA 5EE3A 1X1SA 3C4JA 4YXWD 4WBSA 5EE1A 1H8ED 3I8SA 1FMJA 2H5EA 2QTVB 2ZRHA 1O87A 4HAYA 4HLDA 1JI0A 4NBSA 1XD2B 5JRJA 1FTNA 2I1VB 2IYTA 4KJZA 4RZUA 1NN5A 1IN6A 2ZUCA 2QSZA 3FHTA 4A2WA 3RVBA 1ZD8A 3ZD7A 2V9PA 2GXUA 2ZRAA 1FNNA 3OEHA 5E3HA 2HJVA 2OG2A 3MSXA 5JZVA 3OAAA 1W36B 3ZQ6A 1YZQA 1XCGB 3W3AA 4QBHA 3MLEA 1OXVA 3EZFA 3TBKA 3HYTA 2FGKA 4JJKA 3AP1A 1VDZA 3GMTA 2J9RA 2BMJA 3BH7A 3OEEA 1CTQA 2ZVPX 4DLRA 2EWVA 2OCAA 3RRYA 4PQFA 1ZUHA 1OXXK 1COWA 2G88A 4YLGA 2ATXA 3WBKA 3LH5A 4PO9A 1XNJA 2IUTA 1S0UA 3AEZA 2IUSA 4Q7KA 4Q02A 2PX0A 5IDVA 3SZRA 1UPTA 2C9OA 4DDVA 5FL7A 3ZZTA 5H8WA 2AN9A 3L0IB 3WRXC 2GEUA 1OFUX 4NYIR 2WTUA 3ND9A 4UXIA 1Q12A 4KV9A 3WHKA 3FKQA 4NMMA 1OPXA 4D4LA 5EUMA 4GDFA 1CR1A 2WHXA 3SBDA 5C1BA 1KZ7B 1W0KA 2GK7A 4Q4HB 4CRWB 2R9VA 4ARZB 2V8OA 4B34A 2IYXA 2X2FA 3A4NA 2F43A 4FXPA 2ZVQX 3T5GA 3TW4A 1OKKA 5B57C 1FPMA 2OEPA 4OHZA 3K70C 2QGZA 1KI2A 4MRRA 4BLOA 1U8AA 1GL6A 3DZ8A 3BK7A 3LD9A 1KTVA 4FWTA 3HR7A 1BH2A 4HDQB 1G8FA 1HE1C 2OHFA 3FMOB 1GIAA 1ZUNB 1E0KA 4PFSA 3ZLJA 3U3KA 2JLWA 1VG1A 4OHVA 4XD7D 5C4GB 4BLTA 3KB2A 1UDWA 5HE8A 2VHJA 3C8UA 1KDPA 4HYYA 5KTYA 4AIIA 1BS1A 3FE2A 4JVMA 1E2DA 2GEVA 4URWR 4EPVA 3W5IA 2GXQA 1L8QA 2OT3B 3QJYA 3X1YA 1GG2A 3DPUA 1QHHA 1EFRA 2Q3FA 2Q9CA 2IUUA 1KI6A 4MKHA 1W1WA 3T34A 2FN4A 4A9AA 1D2MA 3JVVA 5TDHA 3L0OA 1G3QA 1NF3A 1Z0KA 3D3QA 2QTFA 4Z8XA 4HUTA 4Q1DA 3K9HA 4LHWA 4I1VA 2RGDA 2N46A 1GKYA 4QOSA 1LF0A 4A92A 1TEXA 2CNWA 3EZ7A 4RKEA 1SVMA 3QNUA 4L15A 5D3QA 2WOOA 4GPTA 1S4QA 1BYUA 1P2UA 3GFOA 5CK4A 1G8YA 3MAAC 3AV0B 4U02A 2W6ID 4ZO4A 2WMNB 2D4HA 4A8JA 4D0LB 3CNNA 3U7FB 3EIQA 4F38A 3DM9B 3RS4A 3GLGE 2NIPA 4ASUD 3A1UA 1P2SA 2HV8A 4Q00A 3BB3A 3KJGA 1DADA 1GNRA 1LFDB 2B21A 2AHOA 2ZRKA 2KI5A 1VKJA 4M1YA 4G5QA 4P4TA 4Q4JA 5IK2A 3HU3A 1QHXA 1KO1A 1L4UA 1OXSC 5J4KA 3DOFA 5L3VA 3KKMA 3BIFA 3I61A 1JQLB 4KFSA 1YZGA 4OK5A 4EJSB 4BUJA 2QBYB 4JSTA 4LJYA 2ZJ8A 3NEYA 4JLMA 1EWRA 2ORVA 2WVJA 3KKPA 3QKUA 4IDOA 1XD8A 1YZLA 1Z6AA 4RFSB 4N1AA 2ZRCA 4TSFA 4A15A 1G8GA 4GMXA 2XNSA 4YMUA 2YYZA 5DN6D 1GILA 2RCNA 1PLJA 3L0PA 5HCIA 3WNCA 2QTHA 5LD2B 5EXTA 5KHOC 1F2UA 3NBXX 4G3XA 3KXIA 1QG4A 4IDPA 4K8OA 1NG1A 3TNFA 5K8TA 4A2PA 3AGQA 4POAA 5CLQA 4B3DA 4C4PA 3BFXA 2H1LA 1XPRA 1E1RA 5IT5A 4US2R 1KDRA 4A1FA 1WA5A 2QI9C 5CM9C 2W83A 2QMUA 2I4IA 2VQSA 4DRZA 2QM8A 5DHFA 4PXAA 3SHWA 2TMKA 3GLGA 5FPKA 2QSYA 4G5RA 4TMKA 5F9FA 1BMFD 4TQAA 3JVUA 1W49A 4H1UA 1WMSA 3LO5A 2Y8EA 1Q3HA 5DH9A 3GP8A 1NKSA 3VHLB 5L3SA 3KQLA 1N3BA 2B8TA 1KY3A 1WE2A 2PCLA 2QQ0A 4GOJA 4A2QA 2WMOB 5K8LA 2ZJOA 2OAQ1 3QEOA 4RZ3A 1RRFA 3LXXA 4KU4A 3CNLA 3MG9A 1II8B 3C41J 3J81k 4LHXA 4O3MA 2GJSA 2PBRA 1T5IA 3AVOA 3WNDA 1KO4A 1WB9A 2WOJA 1FUUA 4C3ZA 1KJWA 1KK2A 1T3HA 4JMPA 3EG5A 4UKDA 1OH6A 1U90A 4GRAA 4NCKA 5LBIA 1U94A 1IQPA 2SHKA 4ZCLA 3VTKA 4OHXA 3GJ5A 2WAXA 3CR8A 4OQLA 3U7EB 4DLTA 2AKAB 1N25A 2MSDB 3QF7A 5DGXA 4CEHB 2OBNA 4OQNA 3OZXA 5KNDA 2RGAA 1YU9A 2ASEA 2Q9BA 1Z0AA 1VCOA 2RB4A 1ZBDA 3A37A 1CKEA 3IUYA 5BXQC 2X1VA 2JLYA 3P1JA 2O5VA 3NKVA 4DCSA 1YZUA 3L43A 3FHCB 3IKJA 2QE7D 2RMKA 1MRNA 1QHIA 2OBMA 3R20A 4EFLA 2QAGC 1UBGA 4MITA 4AYTA 4Q7MB 3SYLA 2LKCA 4MYTA 4QHSA 2FWRA 1Z47A 4HB3A 3KQKA 2XNDA 1OHHA 2FA9A 1TF2A 2JAQA 1JALA 3A4LA 3CWQA 3ZIAA 2DB3A 3B13B 1OT3A 2J87A 5EP3A 1OYYA 3BS4A 4JBXA 4DIDA 4C2UA 1SXJD 2QGNA 1U81A 3CF0A 3BFKA 2B7CA 5J4LA 2OFXA 1SVWA 3CRMA 3B2EA 4EAQA 1IXSB 2WWXA 2NZ8A 2G3YA 3ZQJA 2BCGY 5FOXA 4ZI2A 3EXAA 3AKDA 1CULC 2QPTA 1FP7A 4NCNA 2IHYA 2QORA 3SQWA 4KCGA 4TMVA 1X8JA 3I92A 1GL7A 4Q19A 3CF2A 1OB5A 4B33A 4HI0E 1P73A 3EZ9A 1XCMA 3F5FA 3HDTA 2XZPA 1DG1G 2VH5R 3LQRA 4Q66C 1X8LA 2BOVA 4IHQA 3CO5A 3DKPA 4YDHB 1GDDA 3A58B 1OH5A 2Z4RA 2XJ9A 5FTKA 1DE0A 3THYA 1XU4A 2IWHA 1JR3D 2DFLA 3A1TA 1Z22A 4ESHA 2GRJA 2ERYA 1ZU5A 1SXJB 2ZE5A 3QF4B 5GJBA 4JLDA 1N0UA 3HPRA 3WP1B 4EFMA 4YMVA 3DDCA 1EESA 2X19A 2J7KA 1MO6A 4Y0AA 3IGFA 5ANRB 1R0WA 1UKZA 2W0SA 1XZQA 2R62A 4JLPA 5FBVB 1OIXA 3THWB 2FSHA 4FCWA 2RKOA 1N6PA 3VR1A 3QG1A 2CEAA 3U3OA 4AI6A 3REFA 3RS0A 4BRWA 2FH5B 4DDUA 1GFIA 3T15A 1N6KA 4RSGA 4CT5A 4LY6A 1QHYA 3ICQB 3UWKA 4DCNA 1VHLA 2OM2A 5KDLA 4TTRA 1U8ZA 4XSGA 2IEYA 1LF5A 1DS6A 1KZGB 2O8FA 2DFTA 1QRAA 4LBVA 2Z0MA 3TAHA 4HLUA 3QKSA 1S1CA 5EXPA 3Q9LA 2WKQA 5JWHA 2W00A 3BC1A 4P32A 4PO8A 4KODA 1ZCBA 2ZITA 2HYDA 2YC4C 4MYUA 4TQUS 3X1ZA 4TMXA 1N6LA 2J0UB 4IXMA 5EP4A 4ZI3A 3U44B 5DIFA 1SULA 2G0TA 4B6FA 1GOTA 4QJ5A 1R10A 2P5SA 2XXAA 4KBFA 3I73A 4MGKR 4M9QA 5A4JA 4RD6A 4KO8A 1N5JA 1E9BA 1PUIA 2R6CA 3B1YA 3VR3A 1XPUA 3LV8A 3ZVMA 3UANA 3EA5A 5HZHA 1XTRA 3C5HA 2EYUA 4MRVA 1L2TA 5FTJA 2AXPA 4QJ4A 4HUQB 1YR8A 2NG1A 4XH9B 2CVHA 4NYMQ 4I81A 3GLIA 5EE0A 3UXMA 5E4FA 1TL7C 1SKYB 4LV6A 1IN8A 2IC5A 4DDTA 2A78A 5A0FA 2BCJQ 4M4SA 1JBKA 1YJ5A 2AKYA 2PEZA 2QM7A 4M8NE 1NJFA 4PAQA 4QC2A 4FINA 3B7GA 3CIOA 5FUXA 1F6BA 1XX6A 3E70C 3VQTA 4Q9IA 1MABB 4DLSA 3WBJA 2V4ZA 1JJVA 4AKGA 1NNEA 4NL4H 4XWOA 3CPEA 3UKDA 4RJLA 3NEJA 2WM9B 5G3ZA 3QXSA 4HSEA 1GRNA 4O0MA 2IYLD 1G3MA 2X8AA 1M8PA 4MRNA 4WXPA 1TAGA 4Q03A 2G77B 2OCBA 4DWJA 2WKRA 3IO5A 5JCPA 4IEEA 3OE7A 1P2TA 3TUZC 4R7ZA 5DI3B 2VHCA 1IN4A 2FPKA 3BBPA 5L3QA 1G1MA 3U7GA 2V1XA 2JLQA 2UZ3A 1KNXA 4LZZA 1L4YA 1E3MA 3KFVA 2BEJA 4LK2A 2EWWA 1KAOA 1Z2CA 2XOKA 2BV3A 1C9KA 1K5GA 4Q9HA 1ESMA 1ZYUA 2KB0A 2FMXA 2LCFA 2CJWB 3BRWD 3EA0A 3HWSA 1A5TA 1KOFA 3OESA 2L0XA 1G3UA 1XD2A 2AL7A 4A0GA 1OIWA 1SZPA 2NO7A 4B32A 3KB1A 2ZJAA 1UDXA 1E9SA 4KFTA 2YHSA 2ZI7A 1XTSA 2W6JA 1MRSA 1V43A 2AD5A 1FZQA 2I3BA 4FD2A 4ZKEA 4XTCS 4C0HA 3NHAA 5JECA 3EX7C 1OYWA 4PTLA 5E7JA 1GZSA 4OQFA 2QG6A 3BGWA 1DAGA 2VHUA 1XRJA 4M1OA 4F7WA 3TRFA 4LV8B 1E79D 4RD2A 1WBDA 2BJVA 2BJWA 1EWQA 4YXWA 3SJZA 3U4QB 2RHDA 4MGZR 2BEKA 1M1YE 1P62B 4G0NA 4JVLA 5EP2A 3W6PA 3Q7PA 1XJCA 5C2JB 2GXAA 1KMHB 4P4SB 2N1BA 4HZUB 5BN4A 4PANA 1WRBA 2WSMA 4QM7A 2MSCB 5EJEA 3GLHB 2QRNA 4QJ3A 1KGDA 2GKSA 3EC2A 5EQTA 1DO0A 1IY2A 3SS8A 2VTKA 2HEIA 4O25A 3TE6A 4B74A 1FW6A 2BBTA 5GJWC 1N6IA 4B3GA 1G16A 2BBWA 3IPYA 4O2LA 3O8CA 3T1TA 3IDQA 1E2EA 5GJVC 4A0HA 4Q4HA 5TXGA 1AZTA 4DSOA 1DO2A 4RZ2A 3CX6A 4JL8A 3AQ4A 4ARZA 5KNCA 2CVFA 4JJZA 5JJLA 2PLRA 2P67A 2ZE6A 3B8HA 1E32A 5CLLA 4CZ2A 5AUOB 2C9CA 1NLYA 3LBIA 1GITA 3GJ4A 3L8ZA 5EP1A 2Q0HA 3PEUA 3PQCA 1AK2A 4PSKA 3K70D 3GEHA 3BH0A 5AJVB 5IRCD 2HCJB 5FOWA 2A2ZA 4KAXA 2G9NA 3GLFE 3B78A 2XITA 1WCV1 1G7TA 1ZJ6A 4OQMA 1XBTA 4AY2A 1NG9A 4P31A 4B71A 2DPXA 2Z6VA 2D7CA 3OIUA 3BB1A 2HJGA 1XTKA 3CX8A 3AM1A 2QU8A 4A4DA 4RD1A 3GD7A 3TR0A 3VNUA 1XDBA 3HP1A 4W5WA 4QNMA 2EFGA 3CNOA 4M0LA 1LTQA 3KTAB 4LC0A 1KI7A 2PT7A 2CCGA 1RIFA 2XAUA 3UMRA 4EQ6B 1R8SA 1SVSA 5BWMA 1NVWQ 5F9HA 1NN3A 2V54A 1MKYA 2VEDA 2ECKA 2GDJA 3PFIA 3QIAA 4NHOA 5JS7A 1NP6A 2NO9A 3C7KA 3QQ5A 1Q22A 4IKEA 1T8TA 4P3YA 4NYMR 1FP6A 5JHGB 1QVAA 2YZ2A 3V9PA 1P6XA 2Z43A 4WZAE 4G5SA 1XB2A 4XD7A 3TAUA 5KUTA 4UXHA 1RVDA 4Q7JB 4V0OA 3NVAA 5C18A 1KY2A 2ODWA 4QRHA 5HKKD 2VF8A 5FOSA 2D62A 4N0DA 4PAMA 2QENA 4ZIRB 1VECA 1T3LA 3QY0A 4TLAA 3A8TA 4TL8A 1RPZA 2D3WA 4LHYA 1NJGA 2ZI9A 3TSWA 2QL6A 3OHMA 3R8FA 1ZD9A 1IONA 2EW1A 2ORWA 2ZQ5A 5IF9A 3GEIA 2RGBA 3RRNA 3FVQA 1QBKC 1KHTA 2AK2A 1RYHA 2W2VA 2WWFA 2PZEA 1G7RA 4Q1EA 3R8CA 5BW8A 1KSGA 3G0HA 1C4OA 1GKUB 4EJSA 4FMBB 2QBYA 3IQWA 2WICA 2A7QA 4PC6A 1EG7A 4TYYA 4Q1BA 4RFSA 2EFEB 2W6IA 3SJCA 5JJIA 1TMKA 3NC1C 1HA3A 2P6NA 5CM8B 3CF6R 1EFUA 3MWLA 4TYQA 4XTRA 2KWIA 1PLKA 1J7KA 1DAHA 5FBQB 2CL7X 4ASUA 2YVUA 2ZSAA 3KKQA 3WHLA 2BM1A 4M1TA 1IJFA 4ZV4A 1AQYA 3EPHA 1W2GA 2HXYA 1OF1A 5ELXA 2UZIR 1KK1A 2GBLC 5EUQB 2WWIA 2FZLA 3LA6A 2IXFA 3Q3JB 1YVDA 4URUR 4DLZA 1JR6A 1P2VA 1N6NA 2P5TB 2ZAMA 3PUXA 4UQOA 1PLLA 2GZDA 2F1RA 4L9SA 4F4JA 4DCTA 1XCPA 5KPDA 2PL3A 1TQ2A 3PIRA 4PC1A 3A1VA 4NCHA 4IOJA 1YRAA 1PV4A 1A2BA 1IXRC 1M7BA 3H4MA 4DXAA 4QHTA 2VBCA 1KI1A 4OL0A 2ODEA 1NRJB 1G4AE 2VSFA 4A36A 1AJEA 1II8A 1E2KA 3TJZA 4ERNA 3P4YA 1VCNA 1IJEA 4B6EA 5IHPA 2G83A 2C96A 3B1VA 2G1JA 1MO4A 3RSLA 4A6PA 4M21A 5GVRA 1LNZA 1YR6A 4QXAA 1LVGA 3LW7A 4PPGA 4G01B 1RKBA 3P4XA 4CEHA 1K6MA 2R6AA 5TY0A 3W8RA 2EVWX 3LLMA 4L5BA 4PC7A 4JBYA 5JWRA 2X77A 1H8HD 1L7VC 2ZSFA 4E22A 1IN7A 1BMFA 2YV5A 4JT2A 4YC7A 3TSOA 4RVCA 3TVTA 4Q47A 2B92A 2QN6A 4LWZA 2GF0A 2QMHA 3NG1A 1CRPA 2ZEJA 1F2TB 1SXJE 2P6RA 3EPJA 3U3JA 2VRWA 4C9BA 3VU9B 1JJ7A 2ZRIA 5H70A 5HCNA 3QG5A 1G5PA 4LBYA 1XF9A 3L2OB 5JCZA 4QBFA 1D9XA 3EC1A 3V4FA 1Z07A 3GFPA 4O2RA 3AP3A 2WZQA 3QXXA 4JL5A 3RLFA 4E5UA 1E0AA 4PPQA 2GZAA 2WJYA 3ETLA 4S35A 4XOIA 3BD9A 5BN3A 5JSZB 2V7QD 1AS0A 1D5CA 2BKEA 1R4AA 3KXLA 2GCPA 1BIFA 2ZAOA 3ZZUA 1W46A 5TV2A 1UKVY 2YOFA 4CYMA 4JLOA 3LFUA 3U2QA 2ZJBA 3AH8A 1EFTA 1E9DA 1E96A 4HLUC 4UJ3A 2ZRMA 3QVUA 1KKMA 1HTWA 1JR3E 4UXJA 1XMJA 4BFUA 1Z6YA 3RANA 2IYVA 4R9UC 1DELA 5AR1A 3KUDA 1G3RA 1Z2AA 2F9MA 2QE7A 1QHSA 1CU1A 1I4DD 2J0SA 2FF7A 2OLJA 4TT3D 1OE0A 4FCTA 2BWJA 4FMDB 1ZM7A 2GJ9A 2RGEA 3MRSA 2ZRDA 5CK5A 1UM8A 3TK1A 3ONWA 2F1HA 3CX7A 1BOFA 1KIMA 2F9LA 3SFZA 2JASA 1CR2A 4LJ5A 2PJRA 2C99A 1E9FA 4M53A 2RGNA 5FI0B 2Q6TA 3PEVA 2FEMA 1E99A 1V5WA 3EZ6A 1FX0B 2Q21A 3L8YA 2HLDD 4U7DA 3V4RA 1SXJA 2KSQA 1ANKA 2ATVA 3QF4A 1R8QA 3KJHA 4PO1A 1DPFA 4G5GA 4PPNA 1E9AA 3QENA 2WSSA 3RC3A 2CLCX 4UNQA 2JLZA 1CJUC 4C0KA 1WBBA 3THWA 2E9SA 5AUQA 1E69A 1S9DA 1DAFA 3BERA 4BZXA 3ASZA 5BQ5A 1SKYE 3ECCA 3K9GA 1W0JD 3AF0A 1N0VC 4EPYA 4MYHA 5JEEA 3HU2A 3VX4A 4ITRC 1ZINA 2F6RA 3W34A 4V03A 4ZDJA 4M9SA 3GLFB 3KXKA 521PA 2VP2A 2ZSEA 1D9ZA 2IYRA 3L82B 2CL6X 3AUYA 1GRRA 4Z54A 2CE7A 2E1RA 3K8YA 2RH5A 5EE9A 4LPSA 3ZJYA 3FDIA 5CYOA 1RW4A 3QBTA 2C98A 1WQ1R 4B3CA 2OFOA 4EPRA 3VX3A 3L0SA 2CMKA 2J0UA 1VIAA 3NIBA 3U44A 1E2GA 1G3IA 5SZJA 1KO7A 4LI0A 4ZDIA 5LB4A 1KK3A 4PZZA 5EE5B 4Q9LA 5BN5A 2CXXA 1UADA 1Z0DA 3K9LA 3X1XA 3KJEA 4TYNA 1XEFA 5A5GA 5G41A 3ZDQA 2W2TA 4LX0A 4HUQA 3LWNA 5GADl 2ZE7A 4AKIA 3IEUA 4ILEA 5FTNA 1H65A 3DEFA 2JJ2D 1W36C 4KYIB 1II0A 4XWKA 3RC8A 2XTZA 3KL4A 1S3GA 2ZS9A 1J70A 4PAOA 3FKSD 5BYJA 2GVZC 5HR5A 1YZKA 2F1IA 3K09A 1M34E 1W44A 2Z5FA 3OF5A 4NE2A 2IYUA 3I5XA 4OJQA 1J8YF 4AG6A 3C16C 1MABA 4DZZA 4B2IA 1D2EA 4GP7A 1Q1BA 2VYFA 3LLUA 3NDBB 1RRGA 3HU1A 5AWFC 3SJAA 3QXJA 2FPMA 1S3SA 2IBMA 2JATA 2VA8A 2FGJA 3RWOA 4QGAA 3TH5A 1R7RA 3TQCA 3NBYC 4BFTA 3MGCA 3W8NA 2ZRGA 3DO6A 1FUKA 5DI3A 1G9XA 3MUFA 1I4TD 2O0KA 1DARA 4B43A 4Q9JA 2CHGA 2GETA 3GLHE 2YWHA 3FWYA 3M0EA 4B35A 2HCBA 4GP6A 3UMFA 4FWIB 3T61A 4MDEA 5FPYA 1N6HA 4GZMA 1AGPA 1E2IA 1ZIOA 4GOXA 4R98A 3NH9A 3BE4A 1XFAA 1GVNB 4GNKA 1W0KD 3GFTA 4H1VA 2KJQA 4LGMA 5FUVA 1N6RA 3T1VA 2AD1A 5JS8A 4BRUA 1OXUA 4IFEA 3VR6A 3GPLA 3EPKA 1OKKD 3HYRA 1OH8A 2ZI4A 2RGGA 3Q7QA 5AJWA 4EPTA 3A6PC 5C46F 2WWYA 3E5HA 3JZAA 3MCAA 3KQNA 2V3CC 1NI3A 4A6XA 1LY1A 1ZC3A 3PUWA 3E1SA 2QNRA 1OJLA 2DBYA 2YWFA 4D82A 3LBHA 4CDGA 2ZJYA 1KO5A 1Q21A 5AJXA 1RFLA 4FIDA 1XPOA 1Z0FA 1FMLA 2Z4SA 3FPAA 3U61B 3BH6A 4LV5B 3U4QA 4BZQA 4KLNA 8OHMA 4KBGA 1G19A 2PJZA 1KMHA 4P4SA 4HZUA 5FPTA 3VR5A 3M6AA 1WP9A 4XWAA 1DBSA 4TL9A 3TQFA 3GLHA 4KI0A 4PR0A 3C14C 2V6JA 5CITA 1VTKA 2J7PD 2WJIA 1UEJA 1NMXA 1P9NA 1AM4D 2CE2X 2XX3A 1LS1A 3DOEA 3NWJA 3SEAA 4Z8YA 2H18A 4BE7B 4TMTA 3IIJA 4QFMA 2ZANA 2J0VA 4HEJA 1U9IA 2QUZA 5FL3A 1E4VA 5JEDA 2QPOA 1TX4B 2ZYWX 1GM5A 5DLQC 3KQUA 2REBA 2FE4A 1R5OA 1TPZA 2P0EA 3PUVA 2FV8A 5K8UA 4DCVA 3TMKA 4W9MC 1UEIA 2ZI6A 4B3XA 2IHBA 2ZYTX 2QY9A 1AS2A 5JFGA 4M1WA 3EW9A 2WKPA 3CRW1 5AUNB 1SKQA 2OCYC 2ZRFA 2EFCB 4D2IA 3IEVA 3N5CA 5SZIA 4BLPA 3KKNA 2YINC 2KBFA 4IXNA 4OQXA 5D3MB 2YJTD 1ONBA 4AWXA 4EJSC 2F55A 1T0HB 4MGIR 4PC3A 2J0QA 5J47A 3B5JA 5L8VA 1DEKA 3LVRE 3KTAA 4C2TA 1YR9A 3MFYA 4IDNA 2A3RA 4EQ6A 5LD2C 5H1YA 3C15C 5AJYA 3IQXA 3RYTC 1D2NA 3PR1A 5FOVA 2O8BB 4UJ5A 4CEJB 4JKIA 1GTVA 3KQHA 1ZNXA 5FOTA 1VCIA 4BZPA 2PCJA 2XJ4A 1P9RA 3GJ6A 4OKSA 1Z28A 4C7OB 4JVNA 4ON9A 2C2HA 3RSOA 3U3RA 1II9A 2QMEA 4GT1A 1R2QA 2V1UA 2AX4A 2K5UA 2PLFA 3EWAA 3FOZA 4QM6A 4QL3A 1F48A 4B3BA 1JAIA 3H84A 1G6OA 3ASYA 1E2PA 2DFKB 3RS5A 2VHQA 2ZRPA 1W2HA 5JI2E 3JZMA 3ADBA 2JLXA 1WF3A 2GCOB 1FQKA 2NZJA 4ZIRA 4URYR 2BVNA 2F3RA 4K81B 2Q3MA 4CVNA 3AVUA 4M9XA 4X8LA 3LXRA 1DTSA 2OUKA 1IHUA 1KJYA 2V55B 3LX8A 5CYPA 1VG8A 4OK3A 4CIDA 4JLJA 2Z83A 4R71A 1TQDA 2GA8A 2FOLA 1Q20A 3B85A 1ZU4A 3FMPB 4NH0A 5JI3E 3CRQA 3MD0A 4JKYA 4B48A 1S1MA 3WP0A 4PZLA 3O8RA 1U98A 3MWYW 1ZNYA 3EIEA 4C30A 1QVRA 2VF7A 4TLDA 2IEZA 1UAAA 5HKKA 5FTMA 3EPLA 2RGXA 4MKFA 3DL0A 2LKDA 4RD0A 5H68A 4IDHA 2OE2A 4JT4A 3IBYA 3K9NA 5JRZA 3AF4A 1ZM2A 1RRPA 3QKRB 1GSIA 5KOYA 1CBUA 4XVUA 4TMZA 4WXRA 4P4UA 3H0KA 1U2RA 1DOAA 1E9RA 2ZREA 3F8TA 3PITA 2HUPA 3AUXA 1E2HA 1QDEA 1IXZA 1S8FA 1XTIA 2XNDD 4R2IA 4B75A 1NVUQ 4EIWA 1E2QA 2FSIA 2BMFA 4BGDA 2D2FA 1T5LA 2H17A 5LPNA 4TL6A 2A5FA 3B6EA 1JNYA 3Q5EA 4PHTA 4I99A 1SHKA 2J1LA 3K1JA 4BEBA 3DMNA 1X8KA 2R6GA 1YZNA 1UJ2A 4JL6A 4JLNA 2PH1A 4OK6A 5G3YA 2IWRA 3PEYA 4U5XA 3BOSA 3S1AB 1G291 3OIWA 4I1UA 4M9ZA 4NZYA 4GSYA 4G1UC 2UVQA 2R8RA 1TTTA 1XEXB 2HT1A 5LB2A 1UKYA 2D06A 3CR7A 4HATA 4XVRA 2IYQA 2WWHA 5DO9A 4UNSA 1G20E 2YKGA 1A82A 1G7CA 3BORA 3H86A 3LBNA 3QXCA 1HT1E 4L16A 4BFYA 1H8EA 3QOFA 4LJ4A 4WW0A 5P21A 1TQ6A 3CRRA 5B64A 2RGNC 1PVOA 2EYQA 1ZC4A 1A1VA 4V0ME 4Q9KA 2WPDD 5M04A 4F93B 2B7BA 2R65A 4AD8A 1GWNA 1SXJC 2LWIA 4ZDWA 2VP4A 2GCNA 4OBEA 1W5TA 4BLQA 1F2TA 1CJKC 2C04A 2ZSDA 2XZOA 1NY5A 3VU9A 1PJRA 3SDZA 1AKYA 4DSTA 2CLSA 1B23P 1R0XA 2MMGA 1U8YA 3BXZA 3TSZA 3ZS9A 4DSNA 2D2EA 3WYAA 2VLIA 4DLXA 3B82A 4A8JC 2OBLA 3G82C 2AWNA 2J5XA 2BIFA 4F4IA 2JJ1D 5JSZA 1WDTA 1N5LA 1NMZA 3NC0C 1HQYE 3X1WA 5GVSA 4JVSB 1KKLA 2CLDX 1ESNA 2IL1A 4JLBA 4DLVA 3EASA 1KNQA 1CS4C 5EXSA 4YMWA 1H8HA 2MMCA 2R6FA 4JYCA 4D80A 3THYB 1EK0A 2FPLA 3QEJA 4D0NA 821PA 3K0EA 5JWOA 1M7HA 1NBME 1Z63A 3DVLA 1JQJC 4DUGD 5KU1A 1OH7A 2GJKA 1J90A 1WXQA 2DWOA 2ZPTX 1E2JA 2ZRNA 4JLKA 4TYPA 4A0FA 3FFAA 1XXHE 2OLKA 4EUNA 1K8RA 2VP0A 4V0MA 2IS4A 3V00A 2DCUA 3UATA 1KMQA 2DYKA 1OFTA 5B58C 3PCRB 2V7QA 1FX0A 2PMDA 1B0UA 1Y3AA 1CLUA 1J2JA 2KE5A 4Q5IA 3WYGA 1HY3A 2B6HA 4AKEA 1BO6A 3AVVA 1TU4A 4AK9A 3K70B 2GJ8A 4FN5A 5DISB 1T8UA 1ELOA 4URZR 1G64A 4BFSA 3QKSB 5J40A 2N42A 2MSEB 1VG0B 1Z3IX 2AR7A 2D74A 3THXB 2VO1A 3K09C 2PZGA 2ZS7A 3R9IA 2BMDA 4ESVA 3REGA 1LW7A 3HPQA 3K0SA 5DNYB 1O3YA 2WIBA 3O8DA 1E1QD 1RJ9B 4XSHA 2NPIA 3H1TA 3PUZA 1KJZA 1TU3A 4X8HA 3K0AB 3TLXA 3GLFA 3CKLA 1E2FA 1NLZA 2EFHB 2J59A 1S9HA 4WIAA 4Q1AA 4B76A 2HLDA 2FDCA 3AVXA 1E9CA 4LHVA 1P75A 3FHOA 3IBGA 1Q1EA 2JCSA 2W0MA 1P72A 1R0YA 2UKDA 3RHFA 4OI1A 1ZW6A 2F3TA 2HDNB 5HTKA 2X2EA 4HDOB 2BMEA 2JIZD 4URVR 4I1SA 2C03A 3MMPA 3T06B 1Y63A 4DEXA 4Q7LA 4NTZA 2ONJA 1ZM3A 4TWZA 3CZQA 4QBIA 3ADDA 1UFQA 1MOZA 3NH6A 2FNAA 1AS3A 4D4JA 3RS2A 4QG7A 2AFIE 1W0JA 3AF1A 1IY0A 1P7CA 2JLSA 4DBLC 3PEWA 1MV5A 4X8MA 3FMFA 1T6NA 1OFHA 3TUIC 1XTJA 1Z0IA 3R9WA 3AGPA 4YONB 4D81A 5JHHB 3NHBA 3BAFA 2HXSA 1OSNA 3D8BA 1G5TA 1MH1A 3W3ZB 4HDCA 1P9WA 1I4LD 1W5SA 1TNDA 3VHXA 4RY2A 5HZKA 3KUCA 3D6TB 4C0QC 3EWSA 2H92A 2C77A 4TTQA 4KHZA 4FMDF 4HB4A 1XZPA 1NLFA 2GJAA 4HB0A 1M6NA 1ZMXA 3RWMB 2FU5C 2KBEA 1ETUA 1Z6GA 3IIKA 3ZVNA 5DN6A 3WY9A 1W4CA 4MQBA 1F60A 1AA9A 3BB4A 2YOHA 3I62A 1W4BA 4PHFA 4IDQA 2ZXUA 4Q18A 2QQEA 1US8B 3PENA 1NSFA 2WSSD 1NKTA 1GUAA 3LAWA 4LHZA 2JJ2A 1HEIA 1KI8A 3RAPR 1E2LA 4CEIB 2NMVA 1NVXQ 2G1KA 3FKSA 3FMIA 2NPFA 2J46A 4D0GA 1GNPA 1U9IC 5CIQA 1IAQA 4JZKA 1E6CA 2QP4A 1MO5A 2VSXA 4C0SA 2FFQA 1NN0A 3MWJA 2VP6A 5FR1A 3ZGXA 4MH0R 5CIWA 3WRYC 4MKGA 4BWYA 4DSUA 3AVWA 5TVKA 2BDTA 4NU0A 2BC9A 2BKUA 2CCKA 2FFHA 2NGRA 2OESA 4NONA 4LBWA 4DHEA 4OHYA 4LYAA 3I8XA 4LBZA 2IT1A 5FUWA 4L9WA 3LQQA 1KSHA 3CH4B 2NO0A 1N6OA 1G4UR 2XZLA 1MO3A 4Q4LA 4JIMA 3P27A 4GZLA 2IYSA 2G0NA 4ZPXA 4GL2A 2ZR0A 4V0KA 1TEVA 2ANCA 2RGCA 4US0R 2ZUBA 1AZSC 2GEDA 2YNMA 1QHGA 2OAP1 5AUPB 721PA 1TUIA 2ZYUX 1RC8A 3P20A 1DAKA 3CH5A 4W5HA 2DFNA 2IA5A 2YC2C 3B60A 4A82A 3I3SR 1LV7A 2ZJZA 4FW9A 4GBMA 2OSBA 5J4YA 5JJKA 4TTPA 4F4CA 2V6IA 1OXTA 4B44A 4E03A 3LX5A 4KVGA 1T0JB 3B1WA 1YZTA 2W2XA 3TKLA 3OFND 1G7SA 3R9XA 2WV9A 2WIAA 2QZ4A 4WOPA 1XMSA 1SGWA 1EGAA 2I1QA 5E7IA 3O47A 4BASA 1KYIA 1S2MA 5SZKB 4TYWA 4S2EA 4P0TA 3VFDA 1T9HA 2QAGB 3ZS8A 1PZNA 1TF5A 3AF2A 3QPUA 2GAOA 1P61B 3GJ3A 4HAXA 1NL3A 2AFHE 2CHVA 2CL0X 2ORIA 3CUEF 2IYWA 3O8BA 2JDID 1NBMD 3TIFA 3U3MA 1CR0A 3FB4A 3NDPA 4DLUA 1EXMA 2C5LA 3ADKA 1T91A 1Z08A 1RZ3A 1W7AA 4MDFA 3SBEA 2C95A 3Q5DA 2IS6A 1E2MA 3W90A 2XSZD 2VSOA 4JS0A 1CP2A 1G41A 1Q44A 2XTMA 4HB2A 1FNMA 5CB8A 2O8DB 2O8EB 3CWZA 3R7WB 3UK6A 1ZNZA 1M2OB 3CBQA 4XIGS 3A1SA 4YMSA 5TARA 3TGPA 4QKQA 2QP3A 4Q48A 3ICEA 4F91B 4IRUB 4PPFA 3X2SA 3TUJC 2ZI5A 4PQRA 1N5IA 1BKDR 2C9YA 5DSZA 4AURA 3W9YA 1FQJA 1XJQA 3UPUA 4DT1B 2H16A 2IF2A 4MYCA 5D3MA 2J7PA 4DVGA 1HYQA 4LJAA 1W47A 4TL7A 3T1OA 1OW3B 3QPVA 1JR3A 1AKEA 2VHTA 4QHYA 2IW3A 4IVPA 1X3SA 3N2IA 2JEOA 2ONKA 3NTUA 2JLRA 5TMPA 1HQCA 3LY5A 2O0HA 2CK3D 1CR4A 1NVVQ 4MGYR 2IK8A 2QAJA 2HF8A 4JYBA 4LJ8A 4Q4AB 3TVDA 4IFBA 1XXHB 2O8BA 1HUQA 4Z1MD 4CEJA 1EFCA 2FFAA 2A30A 2JGNA 2W58A 4B73A 2Q9AA 1M74A 4IVQA 2XB2A 4AYXA 1FFHA 5KO2A 3MWKA 4C7OA 4DDWA 1I2DA 2IXGA 2ZI3A 3AKEA 3UMSA 3ZVRA 1EX6A 4NDZA 2IS2A 4BFWA 5KNBA 3KJIA 3SNHA 4Q21A 1J8MF 2VL7A 4WZBE 3SQXA 5C4MA 2ZU6A 4DEYA 3K53A 5B30A 1Z5ZA 2GTPA 2OILA 1DAIA 2BBOA 2WJVA 3AKYA 2GWHA 2GCOA 2R44A 2ZROA 3HJNA 3K0FB 1XEWX 3EIHA 4NYJQ 3CONA 4N0EA 4RZXA 3WMEA 4B3FX 4TLBA 1P5ZB 4TLEA 3OEHD 4JLAA 3D31A 5FBWB 4EFNA 4EPXA 2GAAA 4B47A 3P32A 3OAAD 1UKEA 2P65A 2A5DA 4HLCA 1SVIA 4LJ9A 3AKCA 2A9KA 3W6NA 3FGNA 3VKGA 3QVVA 2F7SA 3Q8XB 2REXB 1GNQA 3A36A 2D7DA 1IM2A 1HH4A 4URXR 1UBCA 2FG5A 1UF9A 2O8CB 3OEED 1Z06A 1X6VA 1DVRA 5K8IA 2AWOA 3EZ2A 1Z6TA 1CJMA 4ZDKA 4PHGA 4LOAA 5DYIA 3ZYCA 4OI2A 2PZFA 1VIYA 1COWD 1G18A 1ZD1A 2IXEA 4WAUA 3T5DA 3M4YA 4D4KA 5F3WB 2CBZA 3PG5A 4BLRA 4AKHA 2ZIAA 3BWDD 4CT4B 1KSJA 1E4YA 3SE0A 5G53C 1CIPA 4PSVA 3W5JA 4AG5A 4V0LA 4LYFA 1VYVA 2QEQA 1C1YA 1XEWY 4LSGA 3WMFA 1T3SA 3VR2A 5J4HA 2ZR9A 4LYHA 3IILA 3SOPA 4DB2A 1MT0A 5HPYB 3SHFA 5FL7D 1GL9B 1LS6A 1E0SA 5KDDA 4KFUA 1KSFX 1GAJA 3DM5A 3NBFA 3QKRA 4FCVA 4YQFA 4Z51A 3B1XA 4DB4A 5DHAA 1K5DA 1TUEA 3B1ZA 2CJWA 2DWPA 2ZJ5A 1W4AA 1VYTA 2QP9X 2BBSA 4D6PA 1R5BA 5AK0A 3K0CA 1RE0A 3GJ7A 4WA7A 3AVPA 2GXSA 4HAUA 1KDTA 4RFVA 2WWWA 3U5ZB 3GJ8A 3LW8A 1KI9A 1ZM4A 4MRPA 4KXFB 4PHHA 4KLZA 2GZHA 4TLCA 1GP2A 1IY1A 3IIMA 4EDHA 1N5KA 5KDOA 2WJJA 2FZ4A 5UKDA 3T35A 4LJ7A 1A2KC 1JPJA 4D26A 2WJGA 3EAQA 4QNRA 1T4GA 3S1AA 1OIVA 3SN6A 2ODBA 1ZNWA 1SQ5A 2NO1A 1XEXA 3SI7A 1NN1A 2IS1A 1R0ZA 4RD3A 1LB1B 4R2HA 2R2AA 3N2EA 4C0AC 3WNBA 3I1FA 1Z29A 3VAAA 1YE8A 2GBLA 2ZRBA 2R6DA 1AQUA 4GMDA 3A4MA 1EFRD 3RRZA 4IEIA 2F43B 1NIJA 1FL9A 1JEEA 1TF7A 3QE0A 2ANBA 5DE3A 2PEYA 1A7JA 1KAGA 4PSAA 1D6JA 1G5RA 5LDDC 1XWIA 121PA 1OLOA 2A5GA 2CNWD 3AVTA 1KDOA 3D7MA 1ZM9A 2ZR7A 4HAVA 4CF7A 1ZP6A 3BFVA 5FBLB 1E79A 2QRZA 4JSYA 1QF9A 2EU8A 2H57A 4HAZA 1NY6A 3KFXA 2GNOA 3FYHA 2JLUA 4IVRA 4XJXA 5JLJA 3LVQE 2WBLC 1VYUA 4US1R 3GEEA 4RKFA 4H9GA 5CDFE 4IW3B 4ABYA 1OV4A 2WPDA 3RS3A 1QHHB 3U60B 1XMVA 1KI6B 5JMTA 2XB4A 2IYZA 1I2MA 5KSZA 2P6UA 2BHRA 621PA 4Q1FA 1NVVR 1QG2A 5EZ5A 4CW7A 5IK2D 1E94E 1ODFA 1Z83A 3NBZC 4A0RA 1SVKA 2IYYA 4KITB 5KSYA 5FR2A 1GRQA 2HT6A 4KVAA 4FI3C 5FH9A 1CJTC 3E2IA 5KSOA 2PMKA 2IX3A 4MUBA 2NO6A 4I1OA 5FFMA 2WAYA 3ADCA 1R5NA 1YQTA 4IJMA 4Q01A 4TSFD 3GLIE 4UNRA 1XTQA 1Z8FA 2JJ1A 2Q3HA 2ZUDA 3CB4A 4JBWA 421PA 4BFZA 2VIIA 3I72A 4A8JB 1JECA 1R6BX 5DI9A 4J0QA 4D4MA 4M22A 2NQ2C 1ZAKA 4ZKDA 1W48A 4NYJR 2FEOA 1E9EA 1KO8A 1U0HC 4ZCMA 4GOKA 2J3EA 1N0WA 1HT2E 3CM0A 2XTNA 3KKOA 1E1RD 1F3OA 1F5NA 4TQ9A 4Q4JB 2OZEA 2RAPA 3SFVA 3THXA 3DHWC 2DWQA 4DUGA 2A5JA 2A5YB 4XVQA 2CCJA 4II7A 3VMFA 5GJCA 1RJ9A 5FI1B 1ZIPA 4DKXA 5CDFA 4LRWA 3K0AA 4V02A 5B2ZA 3H2YA 2WJHA 3B9PA 4KSBA 3Q72A 2FX3A 5F98A 5J5CA 1CRQA 2H7VA 4C0JA 3B9QA 2QPAA 3GQBA 1SVOA 3RNLA 2VP5A 3GJ0A 4RD4A 5CJ2A 2J41A 1E98A 1F2UB 4B2PA 5HE9A 3GCGA 4G5OA 1JPNA 5KPJA 1YHNA 3FFBA 3RDPA 1YKSA 2PX3A 4WVFA 2C8VA 5BYKA 1JXOA 2DR3A 2JLVA 1CF4A 4I4LA 4DJTA 1QZXA 4OYHA 2VP9A 2O0JA 1AIPA 2REOA 5KSPA 3DKVA 4FMCF 4E09A 1S96A 3GLGB 3UG6A 1E1QA 1GKIA 2OO7A 1XJ0A 4BQSA 3QSYA 4BPBA 4DIEA 1G8PA 5L3SB 1XMIA 4M2LA 1JAHA 1AGRA 4Y0VA 3UIEA 2ZE8A 3G5UA 4K46A 1ZUIA 2IF0A 3SJBA 4HZIA 2YWGA 4C0BA 4L4UA 3LRPA 1EX7A 3BJIC 1OHHD 3SR0A 3ZIAD 2CHQA 3QPWA 1IN5A 2ZS8A 2P3SA 2QT0A 3QUSA 4QGFA 3IHWA 2CDNA 2ZRJA 4PC2A 2JJ8A 2ZETA 2JIZA 4LDJA 5F2EA 4OHWA 1BYIA 3QBVA 5L3RA 1CXZA 4TN1A 2ZJ2A 4IOMA 2GVDC 2NOAA 1TADA 4KFRA 1YR7A 2ODNA 2VPPA 4B2LA 6Q21A 5G40A 3IHLA 4NP6A 1US8A 3VKHA 4GFDA 2ZRLA 4BLSA 2ZTSA 4YMTA 1IOZA 3ND8A 3TR5A 1CJVC 5SZHB 4BFXA 4IOKA 4CEIA 3ZVLA 5J4VA 5FTLA 3WXMA 1RYFA 4UNPA 1NMYA 1G17A 3I4LA 4WZ6A 1EFHA 4LC1A 2GF9A 5TB5A 1P3JA 1HV8A 1Z6XA 4TZ0A 1XP8A 3CW2A 4NPHA 1NSTA 4D25A 3GJXC 3RABA 5AJZA 1NIPA 1VHTA 4PX9A 1ZCAA 3A1WA 1Q1ZA 5FBRB 5EXXA 4ACAA 2WWGA 4M1KA 4Q1CA 3KDSE 3ZD6A 1FTSA 4PZYA 3RS7A 3C5CA 3EARA 3U6KA 3NXSA 1XD9A 4EPWA 3Q85A 4FMCB 3WMGA 2PT5A 1U0LA
chains in the Genus database with same CATH superfamily
3DMPA 3I2KA 4QJBA 4EGCB 2IIPA 3FPFA 5HHTA 4N4AA 3UMVA 4H16A 3VYVA 3C3DA 3HR8A 4JBLA 2D3TA 4KMRA 3VR6H 3JQGB 3UBTA 3LGXA 3DTVB 2FSFA 1QMGA 2ZIGA 3PDWA 1TQHA 4Y2YA 1UOPA 4CCYB 1PZFA 4HWKA 4BFLA 1A77A 2GN1A 2H08A 5MN5A 5J2TB 4ZYUA 5LU8A 2VDUE 1SVLA 1D8TA 4LJ6A 4U6NA 4A5OA 4XX0B 2ZM5A 4W7SA 1E0JA 3V8PA 2G06A 3M2PA 2JA1A 4UCWA 2EFDB 4ISBA 1D1SA 2PZJA 2QXTA 4WNAA 5FOUA 1HDGO 2ROQA 4RELA 2VJOA 5IXJA 4RCYA 2FWNA 2QAGA 1BD3A 5AD1A 3G5TA 4KN9S 4PU0A 1L7BA 3PFKA 1EE9A 4PZUA 1HE5A 3PV0A 4M7OA 3VVBA 5KYXA 4M1SA 3SJUA 4HFNA 1T15A 4G97A 4RF3A 1M7GA 4N3NA 1SAYA 2H8KA 4JJGA 3WI7A 2J45A 3QEBZ 2XMDA 4M1MA 4CM3A 3CW8X 4HNHA 5EJ6A 2ZSBA 3KYCB 2GN9A 3IBTA 5ALLA 3R76A 3SSNA 1PUJA 4AY4A 3AVYA 4QO7A 3VR3D 3X1DA 1QBGA 3VHRA 5CPBA 2VHXA 1M8JA 1G21E 2ERXA 4ILKA 2CUKA 4IUDS 1SQGA 1JPUA 2AK3A 1D4ZA 3WTCA 4HUJA 3NWBA 3CS3A 3IJPA 3TYXA 1MW8X 3W5HA 1ESDA 3AETB 1Q83A 1E1DA 2FJUA 3OT1A 4PQYA 1SCIA 3LF2A 4LRXA 5EZYA 3SU8A 3OFNA 4P7JA 1ZGHA 3A14A 2H59A 1K2WA 4IO0A 1JEDA 1Z7YA 3B52X 4LUCA 4NZPA 3ADPA 1SHZA 2DY1A 3REOA 3T12A 4BAGA 3VC3A 3PJEA 4AS1A 5DHPA 4IOLA 4PYLA 4DLWA 4LF5B 4OB8A 1BXRB 3ZE1B 4BEJA 3QPBA 3UV6A 2Q0QA 2C9DA 4M99A 3W2EA 3KZ1E 1NE7A 1J9GA 4TSKA 1SBYA 2WM8A 1E3IA 3TW8B 4COKA 1UL1X 2JDIA 1E2NA 4R2WA 4QXQA 3QUQA 3OOHA 3AVQA 1AUPA 1Q3TA 3NC4A 2YICA 2OM6A 3C0KA 3CPHA 4HLQB 3ZV4A 3WWYA 4TXHA 2W6PA 2B3TA 4UU1A 3OE7D 4ZYZA 4UU0A 3MJHA 5AFSA 3N2LA 1GZ3A 2V9ZA 1MHTA 4MS1A 4ALLA 5LJLA 4ATNA 5IAKA 4OJKA 5I3CA 4WCFC 5DBFA 1BE8A 3C48A 3E23A 3GRYA 1PD0A 4IQ4A 5BN1A 1EB8A 1SOMA 3A9RA 1KXZA 1DINA 4M9CA 4NR0A 4OKNA 4EX7A 1LPPA 4NKRA 4DCJA 2I2FA 5FPSA 4DCUA 3MWEB 3T8YA 5HJ5A 3OZIA 3ZCVA 4E5NA 4ZYYA 2GD6A 3OIVA 2P5UA 3K0CC 1A9PA 2MSWA 4GLJA 2FZEA 2OP0A 4KQFA 4LZPA 2X5OA 2QF7A 2OBXA 4OJYA 1YDHA 3PKIA 4GWGA 2FJPA 1PL6A 4H3VA 2D1SA 1L5LA 5JC1A 1KH1A 3TBFA 3W2FA 3LPAA 4FBGA 2C1ZA 3K6SB 1JJFA 1BWPA 2XVAA 2HMTA 1Q57A 1V0JA 1XROA 1V8PA 2UDPA 3GT0A 4GYWA 4PAWA 5TPZA 2B8WA 3SHQA 1U99A 3LDAA 2WUVA 2JGMA 2EJBA 4LDAA 2Q3JA 2CK3A 2H4JA 2GILA 3ZZNA 4CGZA 1XZMA 4W5JA 3NYIA 2HA7A 5TGDA 2P77A 1FMCA 3GT7A 2PRIA 1RE1A 2W42A 2IOFK 3DCYA 2QX7A 4JASB 2OV2A 2AZ4A 1X1RA 4G0QA 2XMQA 3ZCQA 4WHMA 5ITZB 1CYDA 4JA2A 3UK0A 3V2HA 1DLJA 4K7JA 3EUFA 5IW8A 3TX6A 4ZJZA 1P7PA 1U2PA 1YTLA 1X1SA 3GD5A 2PKXA 5F76A 5CGQB 4G0ZA 3TSCA 4NHEA 4IDBA 4MWSA 3R7AA 3I8SA 1YACA 2H5EA 4GE3A 4DV3B 1QZZA 1HTTA 6GPBA 4ZXPA 1Z2DA 4M6WA 3W06A 1JI0A 5CA1F 2A67A 3HJUA 4NBSA 4PRLA 1HNNA 4GC5A 3ICVA 3GEBA 3WLQA 1FTNA 4KJZA 2B78A 3P9YA 4RZUA 1IN6A 2ZUCA 1F14A 4W5RA 1YDGA 3RVBA 3TRKA 1E2BA 4RHFA 3ZD7A 4P82A 2V9PA 2ZRAA 4IG9A 1FNNA 1QKIA 5E3HA 1DRWA 2HRBA 2RH4A 4IL5A 1JU3A 1CJCA 1N4DA 3HCEA 1B7GO 1HRKA 1KIFA 1YZQA 2L2QA 2O1XA 3EZNA 2I54A 3MLEA 1OXVA 3N86A 3QH4A 1K0FA 1MPTA 4KKXB 3TBKA 3HYTA 3H5VA 4JJKA 4QUJA 2VYNA 4I6JA 3W05A 1QIGA 4RLSA 1KFEB 1SU7A 1YH3A 2J9RA 3BH7A 1ZI8A 1OWMA 3DLIA 1FP2A 1ZEJA 1CUJA 3ESQA 3OEEA 4GDMA 4TWAA 5HKBA 1X7GA 1ZUHA 3QGMA 1NVGA 4P92A 5JJCA 5BY2A 4B3HA 2ZB3A 3LH5A 3RVMA 4EYEA 4QBKA 4U2GA 4X71A 4KNYA 1S8NA 4YAGA 4KXYA 1H9AA 3K35A 4BMXA 2ZWVA 4L4XA 4DJJA 4J8PA 2CDCA 2PX0A 2QRGA 4RVFA 4XQEA 5EPUA 5EY5B 1XK7A 1UPTA 5HGXA 5FL7A 5H8WA 1CJSA 3LQ1A 2QR2A 3WRXC 1D1QA 1QJCA 3ND9A 1Q12A 4E3WA 5KYGA 5TSDA 1H4VB 2XDQB 4NMMA 3U4HA 5DOVA 3BXXA 3N2ZB 5EUMA 2UUCB 2FUKA 2YCLA 5DM60 5LQCA 1Z7GA 2OHOA 5HM6A 2GA9A 3BILA 3BWVA 4ZOCA 3CLSC 3T9DA 2FZ5A 3WQBA 3H2HA 2P0YA 3ZI4A 1VL8A 2PVPA 3ZK8A 4RZSA 4ARZB 5C81A 2IYXA 2X2FA 2F43A 4MNTA 2F1OA 3VBEA 4BQRA 5B57C 2XOXA 3DEAA 1BEEA 2OEPA 1HE4A 5AVUA 3K70C 5DBGA 4KQ2A 3K1YA 4FP9A 4XDGA 1KI2A 4PLCA 2GEFA 3BULA 1U8AA 2ZYGA 2V59A 3BK7A 4BU0A 3M6MD 1BH2A 3TLGB 1G8FA 1HE1C 2IRWA 1GIAA 1ZUNB 1E0KA 3W8FA 4FKMA 3W2TA 5AW3A 4PIPA 3EOBI 3SS9X 3W1VA 3M1LA 4FYIA 4JY7A 3RK1A 4XD7D 1KVRA 1TM5E 2R60A 3EYAA 4FCCA 5HE8A 1DBVO 4R2KA 3VO1A 1PR9A 4I5GA 3VU8A 1W96A 4I4TF 3ITDA 2EKBA 5KTYA 3R7SA 1BS1A 2XGOA 3IOEA 4LMBA 4QAJA 1CS0A 2GEVA 3PKJA 2V5VA 1IU9A 2O06A 3BXPA 2I33A 4JR2A 1PFKA 3BJRA 4XQ9A 3K32A 4KPUB 1HE3A 5A7HA 3V3KA 1AHIA 1M76A 4BN5A 3DPUA 2EHDA 1QHHA 1EFRA 3O2NA 1ZK1A 4DV2B 2Q3FA 2ZBGA 4YO8A 2WB4A 5ESXA 3NHFA 1QPBA 4MKHA 1W1WA 2JBAB 3IEPA 3WGYA 4DWWA 4ARCA 1D2MA 2YWCA 1UKAA 2PGOA 4TPKA 1U7XA 3IQDB 5TDHA 4F12A 4WCDA 1NF3A 5JCOC 5JNVA 3DXYA 2ZAIA 1UK7A 5REQB 4RSRA 4UE2A 3II6X 4Q1DA 4Q3OA 4RF5A 2V7BA 3A2NA 4BEWA 3RJZA 3U19A 4K6OA 4A8JC 1TEXA 1C9YA 3HB7A 3JQFC 3SY8A 4ZCTA 3QNUA 4O33A 2M2IA 5D3QA 5AKKA 1RKXA 4LOKA 1UBRS 3HA3A 4GPTA 4HCJA 4LQDA 4ND3A 2W6ID 3RS9A 4OYYA 2PR2A 4L0MA 3UXHA 2WIKA 3CNNA 3C24A 4F38A 3TF5A 4EG0A 4MTCA 1CNMA 1H2EA 4DMRA 4ASUD 5EIOA 1JFLA 1YA8A 5ITWA 3A1UA 4HD8A 4FONA 1E0DA 3BB3A 3JYLA 1RWBA 3NHKA 1R0LA 4ZXFA 1FU7A 1UPXA 3KCNA 4HQ0A 2ZDHA 1TGYA 2KI5A 3EFBA 2PRSA 2Z08A 1OMOA 4K40A 1XP5A 3M83A 4P4TA 3NHRA 3OE1A 3PHCA 3T7SA 5KWJA 1XF1A 4XGNA 4IDDA 4DPKA 4BC1A 2JANA 5J4KA 2WYVA 2HADA 2IE0A 2CLFB 5SYNA 5L3VA 3BIFA 1EE2A 2G9VA 1E2UA 3ED1A 2AI2A 4W8OA 3D1LA 4LQ4A 1TCUA 2MWMA 3DHNA 2ZJ8A 1DJPA 1ITZA 4ZVNA 1CLEA 3A1FA 3JALA 3NEYA 1EWRA 2WVJA 3QVOA 2UVPB 4TSFA 5TQJA 3S5JA 4LF6B 3LVFO 3TCKA 1EIZA 1PS8A 1WXGA 1D03A 1ZOPA 2H85A 1Q14A 3DDWA 4GMXA 5HBRA 2JW5A 1MC4A 1TJYA 2WNSA 3ZHXA 5I8WA 3TIGA 2X76A 3L0PA 2CZGA 2QTHA 2EDAA 4IGIA 4KGDA 5CVDA 5HCIA 3WNCA 3HKDA 4CL0A 4KWTA 5K99A 1V9LA 3Q0TA 1QG4A 3HZRA 1KBZA 1GKKA 1NG1A 1OBVA 1PBNA 3TNFA 4A2PA 5K8TA 5B6PA 3BFXA 2XT6A 2JGDB 3LC0A 3FHJA 1E1RA 2PUHA 1PJLA 2D0OB 1V39A 4W8HA 4US2R 1DTEA 1R4MB 4MXDA 5H02A 4D3ZA 5LQDA 3STTA 1FP1D 3HGMA 3F7TA 2Y4OA 3FW1A 2C9MA 2R86A 4PXAA 4QUGA 3UYKA 2TMKA 5F9FA 2GCIA 2QSYA 5FPKA 1N32B 5I47A 1BMFD 4TQAA 3HKCA 1U8TA 5AT1A 3QIVA 4BP8A 2Y8EA 5DH9A 3H1EA 3ZLTA 4D9KA 5L3SA 3PNLA 1SCAA 5E3IA 1NJSA 4I5DA 1AKUA 4X95A 4BB9A 4FM9A 3DOCA 2PCLA 5KNLA 4I55A 1XTVA 3JY6A 2PKEA 5CD1A 3TZHA 3MG9A 1NX9A 4WUVA 4QWMA 4FT4A 3J81k 3DPIA 4O3MA 3TR6A 2PBRA 3AVOA 4FDTA 4EB0A 2FW8A 5C52B 2WOJA 1KJWA 1T3HA 3EG5A 1SCDA 1OH6A 1N3IA 1N75A 1U90A 2Y2UA 1WPGA 3K1TA 1U94A 1RM3A 3WLSA 3ZKAA 1Y5RA 2WAXA 5CIYA 3FBWA 4DLTA 2AKAB 1N25A 2PN1A 5D00A 5DGXA 4UTPA 2WE8A 3E3OA 4JI8B 5BV7A 5KNDA 2RGAA 3L1IA 3ZHQA 3WJ7A 3L6CA 4I8IA 1Z0AA 4ENTA 1X14A 5A4KA 1CB0A 3FNIA 1P2FA 4P7BA 1NUHA 5HA5A 1WVIA 2WFLB 1CKEA 1T13A 1U1FA 2HK7A 4PRKA 2X1VA 5BXQC 1RC8A 3SC2A 2O5VA 3NKVA 2BFOA 5BQFA 5IUKC 3FHCB 1RBQA 3IKJA 4G63A 2G67A 2OBMA 2QAGC 1P6QA 2CLHB 3MJCA 5ALNA 4Q7MB 2PSFA 1JFVA 2LKCA 5B3AA 4X60A 1FBTA 3PCXA 2FWRA 3KT0A 1I3LA 2IEGA 3VUFA 1FVHA 3A4LA 1Y4ZA 1E8DA 4N5IX 4CFSA 1TYZA 2C7RA 2H8GA 3H4TA 3LKZA 1OT3A 3F5MA 3SEZA 3K2IA 3QU7A 4ZN6A 4LJKA 2VAXA 2O8VA 4J16A 4UBIA 3BJZA 2P9HA 4JBXA 2VWPA 4J07A 4DIDA 3M1AA 5COQA 2V7GA 2QTAA 2PQ2A 1U81A 3AR5A 3CF0A 2XRZA 3QYAA 3HLTA 4KWEA 2HL6A 4D8TA 1FIUA 3QMPA 2B7CA 4Z4QA 3CRMA 2Y1CA 5LP6A 3L7NA 1TLLA 2BCGY 2A0UA 3EXAA 1RRVA 1LJLA 2EERA 3IA7A 2QG4A 4HNRA 4IHAA 5KTMA 5CXSA 1HPLA 2IHYA 2QORA 5I9LA 1CG6A 4WY5A 4TMVA 4B87A 3T5PA 3I92A 3OLCX 3E05A 4HGNA 2GSWA 3A70A 3CF2A 1XZJA 3TNJA 5C1PA 5TNXA 4GOMD 1U3WA 1N2EA 3NBMA 3H5TA 4BKPA 1RABA 1DG1G 2CL5A 2VH5R 3C8DA 4LWPA 4IHQA 2BOVA 3SDSA 3DKPA 4G9EA 3RQSA 3VXKA 2A9VA 3V1KA 1GDDA 3A58B 4RKRA 4BKUA 1KS9A 2OGTA 1M6EX 2KX7A 2CNOA 4FQ8A 2L69A 3A1TA 5FAKA 1WDMA 4BC0A 1ZFNA 1ZU5A 3JQCA 1ZGJA 1K92A 2ZE5A 3QF4B 1IL0A 2FR8A 3HPRA 3UHOA 1MVLA 1ZG3A 3WA6A 4BGUA 4ZEWA 3IP7A 3IGFA 1K3FA 5HKAA 1ULBA 2BGLA 1NC3A 4W1RA 2BFDB 5THQA 4JD5A 3RIEA 2CB0A 4KTVE 2YIMA 1E3SA 1OIXA 1OX5A 1BMTA 2FSHA 3VR1A 1NOKA 4ZV9A 2CEAA 4EO9A 2VF5X 3QEAZ 3GNSA 2BFEA 5F2KA 3REFA 3CC8A 2AJTA 3F49S 3O1IC 2F2TA 3MTAA 3NOQA 4BRWA 1YZHA 2WWRA 3I9KA 3ORQA 4GNRA 4KQEA 2G8LA 3C2QA 5FWAA 1EWTA 5DLYA 4CT5A 1JXQA 3A2LA 4G2TA 5TF0A 3NOVA 4LY6A 4W5NA 2C83A 5ELMA 2AG8A 3EBOA 5A0VA 1YMVA 2NVBA 3GG2A 1P0IA 5KDLA 3RHTA 4XSGA 2AG1A 1ORIA 1JDPA 4HBZA 4LBVA 1GCIA 4DIMA 4HLUA 4MVJA 5ESWA 2BHSA 2GHQA 1S1CA 4EITA 5JARA 4J0FA 1J39A 1SN7A 3HB5X 3DAHA 4DLLA 2W00A 2RBGA 3NOXA 4P32A 4Q3CA 3R7LA 4QTYA 3HA2A 3NP7A 1QO0D 4KE9A 3OQOA 3UPTA 1G59A 3ORYA 3WIBA 3LKBA 3X1ZA 4E5DA 4D56A 1T4BA 2IPAB 1HYBA 2J0UB 4LHEA 4M86A 4Y6OA 5ED0A 4ZI3A 2EZ9A 1LBHA 1W5FA 5DIFA 1GQSA 2G0TA 4B6FA 1GU1A 2YHIB 4YCCA 1GOTA 2BUBA 1EU1A 2H1WA 3OY2A 4UM9D 2X8JA 3WJAA 4ZC8A 5CFLA 4L4ZA 4P1ZA 5A4JA 1V8DA 1B6GA 3I3OA 4RD6A 1T1JA 3DL2A 3A11A 5C8XA 1MA3A 2O3QA 4CQJA 1UT5A 5BPFA 1BFUA 3UANA 5HZHA 2W8BA 5CG1A 1P3DA 2GF2A 1Q16A 1C2YA 1O6CA 1H2RS 1PX0A 1RPAA 2AXPA 4TTJA 5A3JA 1GPMA 1FTQA 3IESA 3KELA 4NJOA 3BM5A 2VDVE 3LT4A 3UBMA 2BSQA 3GLIA 2QD4A 4TV9F 3UXMA 3T3OA 1QE5A 2FSSA 4HS9A 3WWEA 4M8NE 3ROFA 1BWQA 2PEZA 5F9MA 1QB8A 4PAQA 1RFGE 2LP4Y 4JP3A 3PWZA 2H9AA 3B7GA 2XMBA 3K8ZA 4DS3A 4B7ZA 1F6BA 1Y6FA 2OYSA 1C1XA 3N0TA 4YASA 3VQTA 3WGVA 2E2WA 4EY3A 3I6QA 4TS1A 4XD2A 4UAJA 2OHVA 3KVRA 1RM0A 3PKZA 1WIWA 2O57A 1NNEA 4KUEA 3NWPA 4Y2SA 3L4BA 3TOXA 2FVYA 3VR6D 4QOEA 3A2KA 3W5SA 1QMPA 1EPUA 3DV9A 4FYYA 3KZXA 3UHPA 4HNAB 4A8HA 1G3MA 4E7OA 4Z99A 4O4HF 2OCBA 4QAQA 1T6YA 3F5DA 4DWJA 5DV9A 5MFZA 1NU8A 3NX4A 2B4AA 4FDUA 2HNBA 3OZ7A 5EJ8A 5KNBH 4R7ZA 5FRDA 1UJMA 2QD2A 1V45E 1X1AA 2Z3VA 1XDGA 3EIFA 4HDMB 1G1MA 4HTFB 3S27A 3U7GA 1FFWA 2JLQA 1KNXA 3IPRA 1OLXA 3KFVA 1FLAA 1A69A 1OTXA 3OSUA 3ZHUA 4EY5A 1HDCA 1T9DA 1Z5OA 2XOKA 2ZTUA 5IWCA 3M34A 4XIFA 3A4TA 3D8UA 1ESMA 5EGSA 1PT5A 1W29A 4RQTA 4KPFC 4NMXB 1FRVA 1SUDA 4AL4A 1SKAA 1A5BB 2SBTA 4LXHA 1O7JA 5IKMA 3H75A 1XA3A 3OFKA 3OESA 1USVA 3QNMA 4CLEA 2GZ3A 1T8YA 4KQ6A 3KZMA 2XUGA 4B32A 1MEJA 4XW2A 3SIWA 3F6BX 5BRNA 3KD2A 4C4OA 1MFPA 1I5RA 3D7NA 5LNK1 3R7BA 4KSYA 1RYYA 3NTOA 4OA8A 1DV1A 3EVGA 5DX0A 4AX8A 4KHPB 2UYOA 3VBCA 3MHTA 2WUGA 4M46A 1MRSA 3FMGA 3LP5A 3GYBA 2AD5A 1ZH2A 1XVVA 2I3BA 3FLBA 1N2OA 5A2GA 4AN0A 4C0HA 3A6HA 1W35A 4R54A 2QX6A 1BE1A 3MB8A 4GMFA 4YUVA 3V3TA 3KKZA 3QMMA 3C3YA 2SCUB 5E7JA 5IDYA 5CCDA 1OYVA 5IM4A 3BGWA 3I04M 4M1OA 4BMVA 4F7WA 4LV8B 1H4SA 2DHDA 1WBDA 2IVZA 2NO5A 5F51A 3TGWA 1T2NA 5BQXA 1PR1A 5A9TA 4MUJA 3U4QB 2N9UA 3NAGA 3RREA 1XCJA 1ENYA 1VYHA 2IZ0A 1PNOA 3KVYA 3IKVA 4G0NA 5T3YA 3W6PA 5B4VA 5A2QA 3VA7A 3H1AA 1XJCA 5C2JB 3V6LA 3ETGA 4P4SB 3PI7A 3SYMA 3INGA 4WXHA 1LQ2A 4LZLA 3V1UA 5AKXA 2MSCB 5F7XA 1GPKA 1QKJA 5IEBA 5NULA 5EJEA 5DCUA 1PYDA 1FC0A 4QJ3A 2VVTA 3CLRD 4Z6KA 2ICAA 1H6CA 5EQTA 3PR2B 2VK1A 3SS8A 2KPOA 1N2GA 4O25A 4HXGA 3L6EA 1RLMA 2ABWA 1AF4A 1YAHA 2D0IA 4RK4A 1U0RA 3EH1A 2CNDA 4HYQA 3TZCA 3VPFA 4B3GA 1G16A 3RVLA 4GXNA 3ILHA 3T1TA 1WW8A 1E62A 3IDQA 3T3MB 2I3GA 5GJVC 1J0CA 5TXGA 1Y8ZA 3ROGA 2OAEA 2AFVA 5ITVA 3BCSA 3L41A 3SM3A 3WHPA 2VDPB 3F7MA 4J0CA 2CVFA 4JJZA 5HTOA 1UPBA 2GYWA 2PLRA 4F46A 1J9ZA 2GN2A 2C9CA 2Z30A 3L8ZA 5EP1A 3PEUA 3N59A 1U5AA 3PQCA 1N2BA 1JILA 1Q77A 2QRQA 4BRSA 2BT4A 1C9MA 1RI2A 3PDCA 5AJVB 1P7YA 2JFBA 1P7WA 2HCJB 3A6KA 4KRYA 5FOWA 2MR6A 4YO7A 2CW5A 4KAXA 5C31A 4F3CA 2G9NA 5IG2A 2V0GA 3AONB 1IWBB 2IZ7A 1XJWA 1RWMA 2XITA 3B78A 3EFOA 2VDJA 3O4GA 1WCV1 2NVOA 4HN2A 4Y1RB 3RIHA 5ICSA 4GIBA 1NG9A 2QOEA 4B71A 2Z6VA 4J2HA 1YQXA 2D7CA 3LZCA 2QUBA 3OIUA 3RT9A 1LVUA 3BB1A 2HJGA 4O2BF 4MW2A 2NO4A 3FWHA 3VNUA 1XDBA 2IY7A 3HP1A 5EKTA 3EWIA 1OWPA 2GEBA 2PZBA 3IUBA 4QNMA 4ZQCB 1LTQA 3BKWA 5ULLA 4DQLA 2YWXA 3GP3A 1M6HA 4YGXB 1KYZA 1KWGA 5IVKA 1R8SA 2MDTA 5BNFA 4JSRA 1W73A 3GR6A 4IZHA 1DNPA 2KQUA 4J0IA 4QQ8A 2GDJA 3H1BA 2CB9A 4RJJA 5TQVA 3S2YA 2VQEB 1ISMA 4UAUA 1NP6A 5DHSA 4Y9UA 1Z45A 4S1OA 3W1EA 2RHJA 3K2BA 3C7CB 1USIA 2G63A 4CM4B 5AJHA 3FUVA 3TEFA 5LFAA 1NP3A 1FP6A 2RHCA 5JHGB 3VO8A 3L5KA 1FU8A 2YZ2A 1P6XA 2Z43A 5IWAB 1BJTA 2FG7C 3FI0A 4WZAE 1F2DA 1SZCA 2XB6A 2BONA 4YDRA 4V0OA 3NVAA 4ENVA 3DVSX 2ZQYA 1KY2A 5B55A 3A4VA 2W6MA 5HKKD 5JVDF 2Y6VA 4B84A 2D62A 4KOAA 4N0DA 2QVZX 4EUEA 2GT1A 3W77A 1T6ZA 1VECA 2AN3A 4E2XA 1EK1A 3QY0A 1X2BA 1A9TA 3ZTTA 4TL8A 3ENZA 4OFZA 2YRFA 3ZXUB 1RPZA 2R66A 3UB3A 2ZI9A 1V4VA 2ZSJA 2FJ0A 3TSWA 3UAGA 3R8FA 2EW1A 1IONA 2ZQ5A 4OQZA 1KH3A 1AK1A 1NVEA 1EKXA 1UQRA 4RIGA 2DM6A 4IRXA 3A6GA 2RGBA 4AZ3A 4GS5A 2FZWA 3IAUA 3T7JA 1GZ5A 4BATA 3I9V6 4C03A 4CMEA 3CKYA 1BN6A 2WWFA 3HY6A 4EA8A 2VZ9A 4Y6GB 2FPIB 3IBSA 1G7RA 3PPYA 4JUCA 4L5CA 3R8XA 1KSGA 5BW8A 4J0KA 4EJSA 3G0HA 3OPMA 4BZWA 4TYYA 1J2TA 4I50F 4B4WA 3ZWMA 5JSFA 1NUQA 1THZA 4LC9A 2OZLA 2Q5CA 5HMLA 3SJCA 3MAGA 3A9TA 1KP9A 3V2GA 2P6NA 4F72A 2QW1A 1J1IA 3CF6R 3MWLA 4U9HS 3RHZA 1PLKA 1IZ0A 2DHQA 2W6OA 1T36A 1DAHA 4ZVPA 3TNYA 3G0OA 1H9BA 3I01A 3GO4A 2R6R1 1RYNA 4M1TA 3HEMA 1EFPB 1S4MA 1IJFA 1V5EA 2YJNA 1ODTC 4P84A 2XHZA 4PCLA 4KZKA 2HXYA 4S1VA 1QO9A 3EAFA 2GLXA 2P3LA 3JQ6A 4ZOLA 2WF6A 2A86A 2ID9A 2NT4A 2OZKA 3JD0A 4RIEA 2XUIA 4EI7A 2WWIA 1AG9A 3EGVA 4YDQA 1LDEA 1YVDA 3FAKA 1JR6A 1J4AA 1DIRA 1DXQA 3DE3X 2WSYB 5DW0A 3IKTA 5KPDA 1Z5WA 2HLPA 3LCJA 2UUPA 4NC9A 2YDXA 4PC1A 1DEXA 2L18A 3A1VA 3A1CA 4J94A 4GOND 4XRRA 2OFFA 3ZI0A 4F6CA 2QX9A 3ANYB 5CMLA 1K68A 1AGXA 1Z34A 3Q3HA 2H1SA 1KI1A 2VDQB 2ODEA 1FDWA 1RNLA 2QU7A 3BRQA 3D6MA 4KX3A 1AJEA 3L6RA 2VA9A 2C2MA 3PTLA 1IJEA 5AXBA 4F9EA 2C96A 1ZRMA 4H3KB 4MJLA 1V1RB 1L8LA 1YR6A 2P91A 2C4KA 5L7WA 5A5VA 3VJRA 3OQPA 1MOSA 4LJSA 4L08A 4MP3A 7REQB 2O0LA 3TLJA 1M0TA 3DOIA 3GA0A 3NS7A 4CEHA 2R6AA 3ESAA 4X90A 5TGZA 4L5BA 2JLBA 4GX2A 3SEFA 1L5FA 3I0NA 4QU0A 5F77A 4ZT4A 3S3TA 2JHGA 1CDZA 3ZJUA 4MIKA 1Y3FE 3LWBA 2AXEA 3CYFA 3DDHA 4K9PA 4C43A 2Z56A 4YC7A 2XNHA 1E5QA 1VPTA 2PMEA 4DXHA 4X6XA 2FR8C 2B92A 4CCAA 4LWZA 4OREX 1CD5A 1CRPA 1SG0A 1F2TB 3EJ6A 1NQTA 4XUCA 5M2QA 4KXNA 1SNYA 2P2ZA 3DV0A 3B6KA 4QICA 4ZO8A 1CZRA 3FHLA 3KUXA 4BRZA 3AY3A 4Q82A 1BMQA 1JJ7A 2YY7A 1XTTA 2BGIA 4PLPA 4LBYA 1H93A 1XF9A 3FYSA 1BMDA 2OECA 3DVAB 2EARA 4N5DA 1WB4A 1Z07A 5ALFA 1DWPA 1VIMA 4ZI7A 1B3RA 4PPQA 2IQIA 3BIJA 2VJPA 2GZSA 4V2IA 2QW0X 2R1TA 5BN3A 2VATA 2V7QD 1D5CA 3D64A 5HK8A 2GCPA 1R74A 4FC7A 3ZK9A 2V58A 4KE6A 3ZZUA 3N87A 3DULA 4HO1X 3IS3A 1XNQB 1K89A 4MIYA 3LFUA 1RIIA 3U2QA 2BGKA 2ZJBA 3AH8A 4DHWA 2QJRA 1CP3A 5ECYA 3G9XA 4HLUC 1X15A 2GD2A 2HEGA 3DWEX 4HVCA 2F8TA 4ZT3A 1KKMA 3VOBA 3WLMA 1XMJA 1YVRA 1Z6YA 2FEAA 1UXHA 1ZEMA 2QJWA 4AJIA 4B3SB 3HM2A 4CQMD 4IHJA 3Q7EA 3TJMA 2IOYA 4MR7A 3H3FA 3OE5A 2XUQA 1SU4A 4FLEA 2J0SA 1HYHA 2ZPAA 4GZ5A 3GT3A 4IJQA 3INTA 4MVXA 2BWJA 5EIAA 1HG1A 3ORHA 4XKJA 3G49A 1UDBA 4CBVA 1K63A 2ESRA 3PA6A 4BV2A 3ANNA 2F9LA 3B9BA 3O1HB 2JASA 3COWA 3RBVA 3ZY3A 3KVVA 1E9FA 1XELA 1AXRA 2RGNA 5FI0B 2Q6TA 2V74B 3NB0A 4HWGA 3WWCA 1FX0B 1VPVA 2WTNA 2XNKA 4IS2A 5MDHA 3GFFA 2D0PB 2KSQA 2PG3A 2X6RA 2ZKLA 3MWGA 5BQOA 4EL0A 1DPFA 4CI0B 4G5GA 3HQ4O 5F78A 4DLAA 3OX3A 5C8VA 2A4MA 1PVDA 2C5HA 2CLCX 3KLOA 4FZJA 4R1OA 1YFKA 4HNGA 2HSJA 4ADSG 3AK4A 3EDOA 1YB1A 4U3JA 3THWA 3GQVA 4E13A 4RW0A 5LQKA 2TMYA 3ZIDA 1DAFA 5BSVA 1GQOA 4K9LA 1UINA 5BQ5A 1H4QA 3I58A 4PNZA 3C1TA 5B7NA 1RWXA 6PFKA 2GD0A 3AUUA 2FPXA 3KO8A 3ECCA 4LCJA 1RP1A 2NXCA 1TZJA 3CH7A 5LVAA 4ABTA 4IIJA 1B0ZA 5DBEX 4EO7A 3KHSA 2HTEA 3JS5A 1GSHA 2QLLA 4MYHA 5JEEA 4NBRA 1JHVA 2AMVA 4MUEA 4V0RA 4V03A 2BEVB 3L4BC 1E7QA 4Y30A 2M6LA 4P8RA 3HI6A 3IUNA 1F8XA 1D9ZA 2I6FA 2IYRA 3L82B 3P9QA 4U7FA 4S0ZA 5CJJA 2GN6A 1XFDA 2DTEA 5E2AA 4ZEOA 1BRTA 1N34B 3QWIA 1P2DA 2E1RA 1XA0A 2F62A 5EE9A 3L3BA 3SGLA 3ZJYA 4M1EA 1U1CA 1VXOA 5BWBA 1I80A 4HP8A 2Y27A 4NX2A 1LK0A 3Q40A 2OFOA 4B3CA 2VTVA 2AA3A 2IZ1A 1JEYA 4BV8A 2BMAA 3Q3CA 1BXKA 2HA5A 4P6VF 3DZFA 4RUKA 3U44A 4HQOA 1WEHA 1Q17A 3VVCA 1G3IA 1IMOA 1JZSA 3F6RA 5FADA 1IHPA 5ALDA 4N5HX 5JO0A 3CZ9A 2ZK7A 3C5VA 5HS6A 3EGWA 4KWHA 1E5XA 3UMGA 4CF6A 5K09A 3WADA 3RGWS 1EHYA 4HGQA 3ZDQA 2B5OA 9ABPA 3QA3E 5HIKA 1ESZA 3IMFA 2VHVA 1WCIB 2ZE7A 4R1NA 4Z0HO 5HIAA 3G9QA 3IEUA 4YIHA 1TYAE 1DXHA 3ZYZA 1R15A 4KYIB 3IE0A 1II0A 4KXWA 2G9QA 4MRAA 3BZBA 4RFLA 3FKSD 1K4YA 3UMJA 3ZC3A 2GVZC 3VHXB 3K2QA 3L79A 1YZKA 3K09A 5K51A 2Z5FA 3ZU6A 4NE2A 4EB8A 2FW6A 2BN4A 3GGOA 2AG0A 1AKQA 2CNBA 4O5AA 3I5XA 2HQ1A 1CVIA 4P0PB 4DYDA 5IPFA 1A8SA 1DEAA 3KPVA 1Y8QB 4KTTE 5D8DA 4YHHB 4WBNF 1PT6A 3R6TA 3UK1A 2FUEA 3EEQA 2R0QC 1BDJA 1KYVA 3P7MA 3HU1A 5AWFC 2FVXA 5DCLA 4UHBA 3CLUD 5D5QA 3QXJA 4GM4A 1PE0A 1S3SA 3FWPA 3O3OB 1AQIA 2C4WA 3EQ9A 5ALUA 1VP3A 3RWOA 1QONA 3U48A 3VYUB 3E9NA 3NBYC 3UT0A 4IMIB 4Z3DA 3EGXA 3KRTA 4GM1A 4NE7A 2FE1A 2Z1NA 1RZVA 2ZRGA 1QU3A 1FUKA 5DI3A 3MUFA 3K6KA 2AUTA 2ZSHA 3GCDA 3GELA 1UH5A 3LUFA 1J5EB 3OCJA 1FFXB 2VT3A 4JJ8A 4OMUA 4MYSA 1EFVA 3FWYA 5CH5A 2HCBA 1XRMA 3GFSA 1GV1A 3Q6IA 1BGVA 2A58A 3LNTA 4P7KA 1NW6A 3UMFA 3OU2A 4F4DA 1N9GB 1VLLA 4GZMA 2ODTX 1BX0A 1M6VA 4GPIB 3CN9A 4N9WA 1KZYC 2HQSA 2VBIA 4KQGA 4BXOB 1EVQA 3NH9A 4HWRA 1MX5A 3M33A 4ZTZB 3M6FA 4H1VA 4LGMA 5JZMA 3NI2A 3T1VA 3V4VB 3FBTA 4U0KA 5JS8A 2PPVA 2Q1SA 4J6EA 4X20B 5IVIA 3QMVA 1Q0RA 4BQEA 2O23A 2VT2A 3R41A 2RGGA 2ACKA 3HU5A 3H2JA 1AQLA 1SK9A 3G8BA 2C5FA 5H4HA 2E6KA 3H2BA 1PS9A 3J7TA 3A6PC 5C46F 3KB8A 3OLVA 1NI3A 5CLJA 1LY1A 2ZJ3A 2DH5A 2HRZA 3DHVA 1L4FA 1MAUA 5IXYA 2QRJA 5DF1A 1OJLA 2YWFA 4D82A 1KO5A 2PM8A 5BNTA 3N6RA 1QVWA 1XPOA 2R11A 1XZLA 2TRSB 2AQIA 1U3UA 4D9MA 2QM3A 4IP0A 1JIIA 1M5UA 3BH6A 2B1IA 4WN9B 2I2DA 1PZHA 4BNHA 1DCTA 2SICE 4D9JA 4BO4A 3D6NB 4KBGA 1TJ5A 2LXNA 3UY4A 5HNKA 1IFXA 1KMHA 2KW5A 1G38A 2VJAA 2VPYA 3MT7A 3VR5A 4ARAA 3CF4A 3BGIA 4F7DA 2IH2A 4OJTA 4IIBA 4ZT6A 1IHXA 4KI0A 3C14C 3DPSA 1RXCA 3IAHA 1ZHOA 4KH1A 3NETA 5CLGA 2J7PD 2QW8A 3OU7A 1NMXA 5FTWA 5I5GA 3ZE6A 2XX3A 1PEAA 3DTVA 4AS3A 3HDQA 4TV8B 5HM8A 2H18A 3RSHA 4BE7B 4DNQA 4JENA 2K2WA 4IHKA 4X1KA 4QFMA 4HEJA 4EB3A 2QUZA 1E4VA 1KFBB 3E0QA 2Y92A 3OLZA 2QPOA 5JEDA 1FRNA 5JH7A 2ORYA 3QU2A 3KC2A 2ZYWX 3OCYA 5I8ZA 3F97A 2REBA 5EOVA 3M70A 4F85A 4RTQA 1GPBA 1TPZA 3CG0A 3K05A 4UM5A 4BJ6A 3LTEA 1NULA 2IHBA 3ZWQA 2E21A 2PWYA 2VSNA 3FRJA 4Q6WA 1T9AA 4W1QA 3CR3C 1DUVG 1PZGA 3LGSA 4NEHB 3BWEA 3S2IA 1YL7A 1RYBA 1L5QA 1F8UA 1SQ0A 3AR6A 4K6GA 4JYPA 1GUZA 1SH7A 3TDNA 3EXHB 5AICA 2EFCB 4NJEB 4CMEC 4KZPA 1I7LA 1EA7A 3N8GA 1PFVA 2DQKA 1JHXA 4ZVTA 3ZE2B 2VK2A 2YINC 5KNBD 4ZCRA 2KBFA 1YBMA 1Z4LA 2YJTD 2WTEA 4EJSC 2GJ4A 2PU7A 4D25A 2Y3IA 5SY9A 3HB1A 4YCJA 2J0QA 2FMKA 1MG5A 1NI4B 1U9ZA 2XVYA 3QXGA 1DEKA 3O4VA 4FZVA 5L8V