4D1SA

Pyrrole-3-carboxamides as potent and selective jak2 inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
280
Chain Sequence
TQFEERHLKFLQQLGKGFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVSPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIESKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Pyrrole-3-Carboxamides as Potent and Selective Jak2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 280
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d1sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d1sA01
2R3KA 3C9WA 3OXZA 4RVTA 3KF7A 3EL8A 3HRCA 2WMUA 3KREA 4DGMA 1REKA 4U5JA 4D9TA 2W7XA 1LPUA 1UWHA 2XNGA 1Y8YA 4EK8A 3PPZA 3U6HA 1JAMA 3G2FA 3IKAA 4I4EA 2UZDA 2BAQA 3HKOA 4YZBA 4C57A 4QYYA 4O91A 3UVPA 4YPSA 3O7LD 5CAQA 3NVMB 2HOGA 4XG2A 2BKKA 4FKIA 4NK9A 5E8YA 3H3CA 2V7AA 3MH2A 3V6SA 5ITAA 1YI4A 5LJJA 3TZ7A 5EM6A 4BBMA 4FIHA 1BYGA 4LOOA 3QD2B 1ZRZA 3SD0A 4IM3A 4X2GA 4EHVA 3HP2A 3IGGA 4XG6A 2A0CX 3EKKA 4XCUA 2XNMA 5BQ0A 2YWVA 1ZOHA 1AGWA 3DS6A 2J5EA 3DBFA 3RAHA 1H4LA 4QP2A 4PDYA 3A8WA 4E5WA 4FV5A 4D1SA 4IX3A 4F1TA 5JGBA 4BDIA 1OBGA 3VS0A 2CN5A 2W1CA 4O6EA 3VHEA 4IAZA 3TL8A 3WZDA 3ET7A 4BCKA 4FIEA 5FTGA 1IEPA 2C5NA 3U6IA 5I9WA 4MD7E 2W1IA 3LFNA 4FV9A 1PXNA 4O0SA 4QQTA 4JBOA 3NAXA 4X7QA 2FSLX 4OT5A 4BBFA 5B2MA 4DGOA 2BRMA 2XJ0A 2F57A 4YZCA 3DOGA 2B54A 2B9IA 2QQ7A 4N6ZA 5E8UA 1E1VA 1ZY4A 5GNKA 5GZ9A 4QPMA 5KMMA 5DA3A 3MESA 5HU3A 1W7HA 4FTTA 4O7ZA 2BHHA 5C4LA 3PRIA 1ZAOA 4WG3A 4AGUA 5LVMA 3D14A 3NRMA 4U8ZA 3AMBA 2QOHA 2WU6A 3HYHA 2HYYA 4MAOA 4AS0A 4BCIA 3PYYA 4Y8DA 4AGCA 3G51A 1P2AA 2WHBA 3MPAA 4E4LA 1QPCA 4AFEA 3PIXA 1UU3A 3TUDA 1PKGA 3FLZA 4D2VA 4TXCA 3IDCA 5HHWA 3IW8A 4UYAA 3O96A 4IVDA 3UNJA 1R3CA 4ANMA 5IQCA 3DDPA 4M69A 4ALUA 5TO8A 4U42A 3A61A 2C6KA 4YTIA 2RG6A 4J8NA 3AG9A 3GQLA 2VO6A 4DITA 4DBXA 3Q9ZA 2GQRA 4IH8A 4I0SA 4LI5A 2PSQA 4G3FA 3SDJA 5LARA 4E5BA 1JSTA 4BDGA 4W9WA 3CGOA 3I6UA 4GK4A 3UBDA 3HUBA 5KMIA 2WZJA 2QD9A 3UOLA 4GEOA 4F7NA 2X1NA 3EMGA 2NP8A 5IZFA 5E92A 2HZ0A 4DTAA 4M13A 4FTLA 5IA5A 5A4QA 4ZS4A 3B8RA 3TV6A 2X9EA 2H96A 4ANLA 1PW2A 2J50A 1PKDA 5DBXA 4MXCA 4EOIA 3DY7A 3LXPA 2Y4IB 4FKTA 2YFXA 4O22A 3ZFYA 4BBEA 4CFNA 3KRRA 3W8LA 4FE2A 2CGUA 3ELJA 3VS5A 4FTAA 3UMWA 1NVSA 2I0EA 3AMAA 4P4CA 4ZP5A 1PXLA 4K8AA 4LG4A 3ORXA 1H0VA 5H8GA 4IDVA 4U97A 4WSYA 3UTOA 4M69B 1XR1A 2C3IB 2JC6A 4HNFA 3RAIA 5HTCA 4QD6A 4Y83A 4NM0A 5L8LA 3P78A 4DT8A 4EK6A 4RQKA 1WVWA 4OR5A 3U51A 2ZM4A 4I6QA 3KRWA 2YAAA 2PUIA 1YDRE 4ZXTA 3WZUA 5HX8A 4FICA 4WNKA 5K3YA 4EH2A 4WIHA 4JG8A 5J7BA 2OF4A 2WQOA 5HCZA 3TCPA 2QU6A 1JKTA 5CEIA 1JNKA 3FZSA 4Y72A 5HE1A 3RHKA 5JZJA 5HG9A 3E63A 3SA0A 5AV2A 2O63A 4BDDA 3LCTA 5CXHA 1J7LA 1SVGA 4I5PA 2R3NA 3IONA 4FSWA 3NW6A 4USFA 3NR9A 2J7TA 3ORZA 1IAJA 5E8TA 4JG6A 5KMNA 2XF0A 3NNVA 5CX9A 3VRZA 1CDKA 2XUUA 1FMOE 4I24A 3I6WA 3LFAA 3U9CA 3UYTA 4QTEA 5BYLA 3QTWA 1J1BA 3PY0A 4D9UA 4AACA 3SLSA 5AEPA 3DFCB 2O5KA 3O23A 2GNHA 4BICA 1WBSA 3POOA 5AR2A 1IA8A 4II5A 3A7HA 4YP8A 3KF4A 3RTPA 3UGCA 4GG7A 5AAFA 3W2QA 2Z60A 2XBJA 3D4QA 1UNHA 3DA6A 3FI8A 2OJ9A 3CGFA 4UXLA 3O17A 4IZ5A 2OFVA 4LV5A 1ATPE 5TF9A 1OIUA 3F2AA 4CFXA 3WOWA 4XLIA 2VTAA 4NTSA 4USEA 4WA9A 1R39A 2I0HA 4I5HA 3RPVA 4O7RA 3AOXA 5HIEA 1H00A 4PQNA 3TKIA 2R3QA 1YOJA 2YERA 3BLQA 3FAAA 3TZ8A 4TWCA 2QOKA 4ERKA 5HLPA 2I0YA 4EORA 3OFMA 2IZTA 4YNEA 3FHRA 5IQAA 2GHGA 4GS6A 4GKHA 2UW7A 5IPJA 1ZXEA 2YWPA 1PMVA 2CLXA 3VF9A 4DTKA 3MS9A 3RKBA 4DFUA 2IZSA 3QKMA 1UWJA 2QI8A 4FYOA 3PDTA 4IFCA 5M08A 3E87A 1QL6A 3D0EA 4ONAA 5AAGA 4BF2A 5HNBA 5L8KA 2OU7A 4YLKA 2PE2A 1L8TA 1XH8A 3JYAA 4YHTA 2BCJA 2HZNA 2C6LA 2XK3A 3ZFMA 4EC9A 2ZVAA 1NT2A 1KOBA 5FLFA 4ANNA 1QCFA 4PTCA 3EHAA 4XP3A 5CU0A 4RJ7A 3TIZA 2NNWB 3DZQA 3P7AA 4NFMA 3D83A 2XKCA 3FZRA 5M4UA 4BYIA 3L9NA 4JAJA 3EH9A 1B6CB 2ITNA 4NW5A 3RZFA 5EQEA 1H8FA 4I6FA 4X2NA 5D9HA 3SRVB 5EQPA 2Z7LA 4HZSA 4QP9A 4D1XA 4ZY5A 2WTCA 3UO4A 5CAPA 2OXXA 3PXQA 3CQEA 4AA0A 3EQRA 3P4KA 5AWMA 4BCNA 2JAVA 4QMUA 3BWFA 1VZOA 4M97A 1CKPA 1VYWA 1XBBA 2J0IA 2PZYA 4FV3A 2P0CA 4C02A 3ZYAA 4QMNA 3RWQA 5AAEA 3BEAA 2P4IA 3UQCA 3RK9A 3AT2A 4G3CA 3SVVA 2X8DA 4EK5A 5AFVA 4V05A 2EVAA 4D4SA 2C0TA 4MF0A 5HCXA 3WZEA 4WG4A 1YKRA 3GEQA 3K3IA 4F4PA 1VJYA 4LGDA 4D2TA 4GT5A 4AT3A 2J9MA 1LUFA 2HENA 2UUEA 3R01A 3V5QA 3ZM9A 3OW3A 3P08A 4IFGA 4RIWA 4BGQA 1GY3A 1M14A 4C35A 4Q5EA 4N0SA 2CCHA 3E64A 3LFFA 4ZSJA 4EWHA 5EFQA 3UNZA 3AQVA 4A7CA 3QUPA 3PA3A 1OUYA 4RJ3A 3UPXA 3R83A 1Q8UA 3TI1A 1Q97A 2E9OA 3DLZA 2Y4PA 2CMWA 4K0YA 2PVJA 2ITPA 3A2CA 3DJ5A 2YEXA 3BLRA 3SOAA 2C5OA 3RVGA 2OI4X 4LGGA 5BYZA 2ZDUA 2B9FA 3C51A 1SMHA 3EIDA 1UKIA 5M55A 5CZIA 3L8VA 4N70A 2W17A 3HRBA 1JKKA 3FDNA 2C6DA 4K2RA 4UZDA 3SHEA 5J9ZA 2XIXA 3PIZA 4D4VA 2C5YA 4H58A 3GP0A 3NDMA 5JRSA 4RMZA 2R0UA 4DEGA 3QXOA 5AIKA 3EN4A 2JIUA 4D5HA 4F0GA 3EFLA 3EQCA 3BU3A 2XEZA 4RBLA 4TW9A 3B2WA 3OEFX 2BZJA 4QOXA 4FUXA 1CKJA 4DAWA 4GYGA 4QMMA 4X2KA 4ZZOA 4J8MA 3OROA 4NCTA 3CXWA 2BPMA 4UEUA 2JITA 5HCYA 1YQJA 3Q6WA 4FSTA 3NNXA 2VX1A 3FMLA 4BDBA 4WSQA 5CZHA 2X4FA 3ALOA 2PE1A 2A27A 2OIBA 4A4LA 2HAKA 2CPKE 2C6OA 3NGAA 4F99A 5EYKA 4TN6A 3QKLA 3LXKA 3ZS5A 3ORMA 1UKHA 4UXQA 3VUHA 4J97A 2I6LA 3KXZA 4IWQA 3ZO1A 4E6QA 5C8NA 5KUPA 3FE3A 4BCJA 1EH4A 1YXSA 1MRVA 4NTTA 4IJPA 4RA4A 2ONLC 3KXMA 3Q32A 4ZTHA 2OJIA 3QRKA 1E1XA 3HAVA 1V0PA 4P5ZA 4U9AA 3BBTB 2ZV2A 1XH7A 4NJDA 5EM5A 1CMKE 3DK6A 3FI4A 1O6KA 3I7BA 2PUPA 4DHFA 2PPQA 3MY5A 3SXSA 4F6SA 4XUFA 3OCBA 4DC2A 1WBPA 4CQEA 3Q52A 3R7OA 4L68A 3G15A 1U54A 2Z02A 5K4JA 3BLHA 3CY2A 3FJQE 2YJRA 1H26A 3ALNA 1ZYCA 2KTYA 3RPOA 2WEVA 1OL6A 5DH3A 1Q8WA 4AG8A 4LOPA 4F70A 1GZNA 2QCSA 3HECA 4ANOA 5HD7A 4BWXA 4MX9A 3FLQA 5HO8A 3V8SA 4I6BA 4WHZA 3R8ZA 3AD6A 1YDSE 3MH3A 2ZV8A 1XH6A 5IH4A 4I5CA 4CRSA 3F3VA 4RPVA 5HD4A 3HMIA 4ANBA 3IDPA 3ZOSA 3W2OA 3W8QA 1Q24A 4JS8A 3W2CA 1KE7A 4CV8A 3BV2A 3FYJX 4FT7A 3NW5A 3UC3A 3F82A 2X2KA 4QRCA 5HO6A 4D28A 4EK4A 1WBOA 4RT7A 4PMMA 4QO9A 1PXOA 1JSUA 2DYLA 3BQCA 4LMNA 2VAGA 2XK7A 2WIHA 2VU3A 4QP6A 2CKEA 4O0RA 5ETAA 3QBNA 3V8TA 3BYUA 2VO0A 2ZV9A 5FP6A 3V6RA 1UA2A 4W4XA 2BMCA 4NEUA 4G9RA 5ETCA 5D11A 2JIVA 2OH4A 3QTXA 3SW4A 4CXAA 3A4OX 4A9SA 3DKFA 3ATTA 4XV1A 4CTCA 1U54B 1ZYDA 2R7BA 1OVEA 4TZRA 5EG3A 2F2UA 4C3FA 2OIDA 4EZ5A 3DBQA 2XK6A 3KRLA 2XIZA 5BVDA 2F7XE 3PVGA 4IAAA 1CM8A 3HA8A 3PVBA 3HV7A 3DNEA 5BMSA 4OGRA 4DFXE 3IPHA 4ITHA 5DWRA 4F08A 5CSPA 5FTQA 5CY3A 3QLGA 2UZNA 4RFMA 2P3GX 4RIYB 5KHXA 3COIA 3KMMA 2VO7A 4PMTA 3BU6A 2XS0A 4FC0A 2GNGA 3HLLA 4FT5A 2XRUA 4DFNA 3F2NA 5CF5A 4FNYA 4MBLA 5M07A 5FM2A 4RG0A 1MQBA 4NM3A 5KZIA 1ZOEA 4CRLA 3DBDA 3KXGA 5LVLA 4G6OA 1ZYJA 2PMIA 4EUUA 3RZBA 1K3AA 1V1KA 3QTIA 5FGKA 2W99B 4MNEB 3AMYA 4BKYA 4XOZA 5IISA 4FKWA 2WMSA 2PU8A 1LR4A 2WTIA 3UZPA 2EB3A 3N4VA 5K5XA 5GIOE 5DVRA 3E8EA 5BYYA 4GFGA 2X39A 4GRBA 1S9IA 2UW8A 4WKQA 4AAAA 5J7HA 5D1JA 2BROA 1XKKA 4CCUA 3R73A 5J8IA 1TQMA 4JQ8A 4X0MA 4AU8A 1CTPE 4FSMA 2JD5A 4HGLA 4F09A 4UWBA 4FSZA 4Y85A 2XKEA 3F61A 3LM5A 5GHVA 1PXPA 4FODA 1AD5A 4KBKA 3S3IA 3HMPA 4YNOA 4ZY4A 2OBJA 2W1EA 5L4QA 3ENHA 2VTQA 2O64A 5LMBA 3EZVA 4LMUA 4BY9E 5LMKA 3HEGA 3ZFXA 4CG8A 3EFWA 3GCPA 4IVBA 2P2IA 2R3OA 3FI3A 4WUNA 5A4TA 3ANRA 4YZMA 3RM7A 3L8SA 4A9YA 3PJ8A 4D1ZA 3FPMA 2YLFA 3ODYX 3U6JA 3I0QA 4XYFA 3OWPA 5A6NA 4YJSA 4DEHA 4FTCA 3HGKA 4QQJA 5M4IA 4E26A 3KMUA 3GNIB 2UW4A 5ANIA 2UW9A 1X8BA 3QZGA 4UWCA 3AGMA 3EFKA 1ZYLA 2O0UA 5CU4A 4CZUA 4R8QA 1OL2A 3ZBFA 4O2ZA 4ZY6A 4BDJA 2O65A 2PZIA 4B9DA 5BPYA 1KE9A 5HE3A 4CZYB 4RRVA 2F9GA 2ZMDA 2ITYA 2W1DA 5BUIA 4EH6A 5IG1A 5IEXA 5I9UA 3TJCA 5JGDA 3F3TA 2WNTA 2PZ5A 3GCUA 4FZDB 3VBWA 4ACHA 5IUGA 1YI6A 4PWNA 1GOLA 4FV0A 4I5MA 4DG0E 2H6DA 2CNQA 5AIRA 5HZNA 3D5XA 2OZOA 3OTVA 4FEXA 5HICA 4C61A 4IZAA 4OBQA 4TKSA 2R3FA 1LEWA 3CD8A 3NUUA 1XH4A 3H10A 5BVEA 4Z9LA 5IH6A 1DI8A 2GCDA 3CJGA 1BMKA 3OXTA 2ZB1A 2QO9A 5HTIA 3FLWA 1M2PA 3R28A 1BKXA 5K0KA 4HVDA 2XIYA 4GU6A 4RIXB 3TNIA 4L53A 2JAMA 3E7VA 3D2KA 4FT3A 5T68A 3SV0A 1M2QA 2WMQA 5JGAA 2ZOQA 1BX6A 3SXFA 4JVGA 1FVTA 5EYCA 4BGHA 4NZWB 4O96A 1F3MC 4XBUA 3VBYA 3DQXA 2W4KA 3DCVA 4YZDA 3I0OA 3BYMA 3AT4A 5TT7A 5EKNA 5DI1A 3LE6A 2XRWA 3DKCA 4DEEA 5I4NA 1DAYA 4CVAA 1GZ8A 5B2KA 1WMKA 4X3FA 5IMEA 4MBIA 3DLSA 4FUYA 3VBQA 5IEYA 5BVNA 4NJ3A 1SNUA 2IW6A 2QHMA 4CYIA 1OKZA 4FVQA 4QMXA 3F5GA 3EQPA 4FK3A 4R1VA 5FXSA 2R3HA 5DFPA 5EW9A 2PZPA 1WBNA 2XK8A 3DPKA 4K33A 5L2SA 3VHKA 1XO2B 3FZ1A 1H28A 2HW6A 4EKLA 1W84A 2BFYA 4F65A 5JKGA 5AP7A 3FZPA 3KCKA 4JQ7A 4KIQA 2ZM3A 4WO5A 4GVJA 4CZTA 2ETRA 2FVDA 4YR8A 1Y57A 2BDWA 2ZB0A 3COMA 3DGKA 3FHIA 4HCTA 4O0WA 5HOAA 4DEDA 1BI8A 2XIKA 4KBAA 3GVUA 4ZTSA 2CGVA 4KA3A 4F9YA 2YISA 4CNHA 2CGWA 1XJDA 3FC1X 2PZRA 4JL9A 2OJJA 5FD2A 1YOLA 3VULA 4Q2AA 5CAUA 3VC4A 2XMYA 4AQCA 4PV0A 5BMMA 3RGFA 2QONA 3QCSA 4LQMA 4G5PA 5HLNA 3I4BA 1BUHA 1PMEA 3VS2A 4MEDA 5D12A 5C8MA 5A14A 4QPSA 5JQ8A 3JY9A 3TNWA 3TIYA 3O71A 4G6LA 5CNOA 4PNKA 5I9XA 5I5ZA 1OZ1A 2YABA 3LFDA 3MJ1A 2ZAZA 3TV7A 2YIXA 3FL5A 1H25A 1UNGA 3DAKA 3C0HA 4YTHA 4YTFA 3E88A 2AYPA 3GFWA 3DJ6A 3GU4A 4JX7A 4IACA 4P7EA 5JN2A 3TTIA 2GHMA 2O3PA 3IO7A 3PPKA 3DFAA 4HCUA 4DINA 2C3JA 3F7WA 1F0QA 3FMNA 3KMWA 3R1YA 5ANEA 4HYHA 5EH0A 5HIDA 3R9NA 1KWPA 3KRXA 3TT0A 4DEBA 3LHJA 2YHVA 4H3BA 4QYFA 2A4LA 1W82A 3CTHA 3S4QA 3C1XA 5D10A 3WE4A 3OUNB 5J9LA 4RWLA 5AP3A 4IADA 3Q5ZA 3SKCA 5CEOA 3KXNA 2VGPA 2J0MB 4BFMA 4WNPA 4IM0A 4IAFA 5HO7A 3PA4A 3UJGA 1KE6A 2XK4A 4M12A 3BE2A 4YZNA 3QHWA 3S1HA 3QZHA 5B2LA 2LAVA 4R3CA 2QOFA 4TYEA 4ZAUA 4HW7A 2FH9A 3IOKA 2LGCA 3ORKA 3KN6A 4NH1A 3S2PA 4EQCA 3KA0A 5AP0A 5CXZA 3PRFA 4KBCA 5CEKA 3KVXA 2JLDA 4E8AA 4EI4A 3E92A 4BI2A 3DT1A 4RC2A 5HVYA 4FGBA 5CU3A 4YHFA 3DKOA 2DS1A 4JX3A 4AXAA 1H1WA 2YM7A 4WRSA 2IWIA 4HYSA 5IA2A 3MGYA 3FPQA 3CY3A 3V5WA 4F9BA 1Q3DA 4FSQA 2W96B 5IQHA 2WMBA 4GIIA 3OY1A 1P4FA 4YPDA 4L7SA 3NEWA 5IUIA 5H9BA 4KS7A 4FNZA 2C0OA 2VWVA 5DT3A 3VUKA 3LAUA 2VTLA 1LEZA 1RQQA 3NIEA 5CTPA 2YM5A 4FTJA 2QC6A 1W0XC 3AGLA 4GUEA 4QNYA 4UZHA 4E4NA 5M4CA 2XNBA 3E8CA 4F64A 4JBQA 3TUBA 4YTCA 4RWKA 3MFRA 5LOHA 2NRUA 4CFVA 2W1FA 4UBAA 4IQ6A 3KL8A 5AADA 4J52A 3CD3A 3RBWA 5KBQA 2DWBA 2W0JA 2GS2A 2BRNA 3CE3A 4FIJA 2WKMA 4H3PA 3DB8A 1OL1A 1SVHA 3A7GA 4G9CA 4H1JA 4ASXA 4A4OA 4BKZA 3PTGA 4H3QA 4IAIA 2W9FB 4NW6A 4O21A 5ANDA 3R7IA 5A4CA 1MUOA 2VTTA 4AT5A 4DH7A 5AA9A 3GC7A 3FEGA 3LQ3A 3S0OA 1Q41A 2YIWA 3ANQA 4HYIA 4UYNA 4BDFA 3LFQA 4FOBA 4ZMEA 2YM8A 3H4JA 1JWHA 2X7FA 2IO6A 4NM5A 5F9EA 2YDIA 4TYIA 3UO5A 3DBCA 2J0JA 5EHLA 3GU7A 3UP2A 4G3GA 4FKQA 4V0GB 3A8XA 4DEAA 3QX2A 4OTFA 4ACCA 4AP7A 4BCGA 3CJFA 1HCLA 2CHLA 5LWMA 4EC8A 1Q5KA 3TN8A 4FV2A 4KKEA 4O7WA 1SNXA 3ZSIA 4M66A 5CVHA 4FIIA 4E93A 3WARA 1O6LA 2WPAA 1VEBA 3NS9A 4E4MA 4ZJVA 1YXTA 3D9VA 3ZO2A 4TT7A 3QTQA 2ITQA 4UALA 4IJ9A 1PF8A 3LCKA 4GJ3A 4RFZA 3LCSA 4R3RA 2GFCA 2IZUA 3H30A 4OTRA 1OKVA 2BAKA 4GIHA 2J6MA 5CWZA 4X2FA 4DT9A 2J0KA 4DH3A 4PRJA 4EZ7A 2KULA 3P1AA 4TWNA 1JLUE 3FLSA 5E1SA 3G0FA 3E3BX 2ITVA 4A9TA 1FGIA 2ZDTA 3C5UA 4UY9A 4ARKA 4EYMA 3R7GA 2GQGA 2GTMA 2P33A 3I79A 1JKSA 2OICA 4H39A 4ZSGA 3G0EA 3KC3A 5CANA 3OBJA 4ZZMA 4FA2A 4XOYA 3ZC6A 4H1MA 1OGUA 4QQCA 3R30A 3BV3A 4TNBA 5CEQA 1J7UA 4KUJA 2IVVA 4I6HA 4O7YA 1T45A 3GC0A 3LJ2A 4BIEA 1Y6BA 2OF2A 4GK2A 4MHAA 1G5SA 4CFWA 5DMZA 3UNKA 4CKRA 3LFBA 3V51A 3VWAA 4BZNA 5IQIA 3R1NA 4XG7A 5AR5A 4PUZA 3ZEWA 4KABA 4ZJJA 5AA8A 4FK6A 3ZXZA 5BX0A 2W5AA 3PXZA 4M0YA 3ZUTA 4Z7GA 4K1BA 2CKPA 1PXMA 3KKVA 4JI9A 4W9XA 4FYNA 5HVKA 4IB5A 5H8BA 3EQIA 4QMVA 4B0GA 4R1YA 3FQEA 2VGOA 3PZEA 3Q4CA 3DXPA 2VNYA 4K6ZA 3UIMA 2HW7A 4G3EA 1H01A 3MVMA 5A6OA 2PHKA 3V5LA 2VTPA 3ATSA 1YWRA 3R00A 4FR4A 5AUUA 3SRVA 3DTWA 4MK0A 4FG8A 3UOKA 3EL7A 3E93A 3F69A 3PJCA 4ANSA 4CT2A 3R9HA 4CCBA 4EH4A 1GZOA 3LJ1A 1OIRA 3QYZA 2UZLA 4QMWA 4QQ5A 4XHKB 5L6WL 3GFEA 2JKOA 1H07A 4C38A 2CNVA 3FI2A 3TUCA 5ANOA 1FBNA 2ITOA 2WIPA 1ZMWA 3PPJA 4FTRA 4EKKA 4YUQA 4N4SA 1W98A 2E9UA 5ANKA 4QP4A 3CBLA 4MXOA 5HX6A 5K9IA 3R1SA 5B0XA 2RFSA 3COKA 1K2PA 1OIYA 2JGZA 2YCFA 3HMOA 3QCXA 3BGZA 4FV8A 2XYUA 4GU9A 4KSQA 4Q5HA 4YO4A 4K77A 4XG8A 4IVAA 5LMAA 5LCKA 1SVEA 2QOBA 4KB8A 4QYHA 4DGNA 5I0BA 2JKMA 2ZM1A 4I20A 3DK3A 3MFTA 5DPVA 4AZTA 4FEUA 2WEIA 4KSPA 3PG3A 3FLYA 4YJOA 3O50A 3LFCA 4RVMA 2XCHA 3WZJA 4YSMA 5EK7A 3OTUA 4E6AA 4O7LA 4C36A 2PUUA 5AUTA 2FYSA 3OT8A 2Z8CA 4UWYA 5AR3A 1OM1A 2R3LA 4C4JA 4DG2E 3L1SA 3BRBA 1J3HA 5M57A 1STCE 2C6MA 3DTCA 4EOJA 4QP1A 3ZO3A 2I7QA 4FKSA 1O6YA 2FSOX 5FQDC 3NVKI 1R0EA 2QO2A 4AOTA 2QG5A 2X9FA 3NYXA 4ZJIA 4JIAA 1ZMUA 2JDSA 4YJQA 1WVYA 2NO3A 2XP2A 4QP8A 3FMHA 4L01A 3SOCA 1P4OA 4EK3A 2A1AB 5HE2A 2BRHA 5AUVA 4EHEA 4UMRA 4O0VA 3EOCA 4I94A 4WBOA 4WOVA 4CMTA 4C34A 4PF4A 3AD4A 5EW8A 3EQHA 5AUXA 4IB0A 2VTJA 4J96A 4IW0A 4PMPA 4ZLYA 3UG2A 4HGEA 4LYNA 3A60A 2VWUA 2WQMA 3BHVA 3MIYA 2QKRA 4FSYA 4I21A 5TOZA 3WIGA 3MJ2A 5DEYA 5KKRB 4D0WA 5TR6A 1Q99A 5ETIA 4QMQA 3ROCA 3PY3A 4G34A 2ITZA 3QTRA 2WMVA 2AC5A 1NXKA 3GOKA 4F0IA 3MH0A 5CVFA 4YLLA 3QYWA 3VS1A 3I5ZA 3R9DA 3NPCA 5EYDA 4EH3A 4IX5A 2QR8A 3O2MA 3KU2A 4R77A 2UZEA 4MBJA 4G6NA 4ASZA 1WBWA 2XA4A 4OTGA 2PL0A 3EZRA 3AC1A 2C1BA 3AD5A 4YBKA 3REPA 4CTBA 2BFXA 5BUEA 5E90A 2VTIA 4BCFA 4V01A 4FZ7A 4H36A 5CNNA 2B1PA 1FMKA 3P7BA 5LVOA 2XEYA 3EJ1A 3K5VA 2Z7SA 2FSMX 4W4WA 3R7VA 4F1OA 3D94A 3LMGA 4IVCA 4XG3A 4ALVA 1ND4A 3DNDA 4RGJA 2GNJA 3QTUA 3WF9A 3RHXA 4YJNA 2VTHA 4AZSA 3ZLXA 2Y9QA 4DFYA 2GNLA 2PVHA 4BDKA 3JPVA 1TKIA 4MTAA 5L2WA 5JT2A 1XBAA 1J7IA 4E1ZA 3LXLA 2GFSA 3OVVA 3KXXA 3KFAA 3QKKA 2OZAB 2Y7JA 4FF8A 3OBGA 3Q96A 2QURA 3LW0A 4CLJA 2RIOA 4DLIA 5JQ5A 2QOLA 3LM0A 2QOIA 2R64A 3R6XA 4O0XA 2X4ZA 4JXFA 3B8QA 3D7TA 4AOJA 3P79A 2R0IA 3H9FA 5E1EA 2BDFA 3ZTXA 4IM2A 3NUNA 3RM6A 3WF6A 3FZTA 3UQGA 2WAJA 2XKDA 1G3NA 3M11A 2YN8A 4XV2A 5E8WA 3BYSA 4CMUA 5TKDA 3JR1A 5C1QB 2Q0BA 4EBWA 2GMXA 3GGFA 1NW1A 3RAWA 3KN5A 5EHYA 4JRNA 4MF1A 2B4SB 4R7IA 3I7CA 3TZ9A 4O82A 2XNNA 2FB8A 3FY0A 5C01A 2JEDA 3E8NA 4K18A 3OP5A 3GB2A 4J98A 4U41A 4YO6A 3W2RA 2OIQA 5L6PA 3VUGA 1MRUA 4IX6A 2W4JA 4U81A 2FO0A 1JKLA 2BUJA 4L52A 3F3ZA 3RALA 4AE6A 2HZIA 1JVPP 1LP4A 5AV1A 4ZZNA 1IASA 3W18A 2ITWA 4R78A 4RIYA 3F66A 4BI0A 5C8KA 4YJVA 4BZDA 3UC4A 2WXVA 1UNLA 1YHVA 5A46A 3F5XA 2QLQA 3H0ZA 4PMSA 4A9RA 5EQYA 4L00A 3NIZA 2QO7A 4BYJA 3BPRA 1YDTE 3H0YA 3OUKA 1R78A 2BZHB 3D7TB 3IW5A 3NUPA 5E91A 3KCFA 1U59A 3ACJA 4MXXA 5DR2A 2WMTA 4MNEA 5KMJA 2DUVA 4O81A 3VIDA 4WNMA 3EWHA 5JMSA 1UU9A 3KULA 5EW3A 3D15A 4RC4A 3BCEA 2RG5A 3EKNA 5ETFA 3FC2A 4PL3A 3R8LA 4UMPA 3TNPC 4F7LA 3H9RA 4M67A 3QQJA 4C3PA 4FV6A 1FOTA 3CQUA 4M14A 2FSTX 3QZFA 2W05A 4HPTE 3FMKA 4NL0A 3BHUA 2R3RA 3OW4A 2PUNA 2BRGA 4B8MA 4C37A 4AW2A 5HG8A 1FQ1B 1S9JA 4PDOA 3IGOA 3PA5A 3WF7A 3WIKA 2J4ZA 4BVUA 5FDPA 2W5HA 1J1CA 4GKIA 3ZEPA 3EQFA 3OWKA 3R8VA 3QRUA 2V5QA 3ERKA 4WT6A 4ASEA 1JOWB 4FTMA 2VWYA 3QTZA 3R7UA 4U80A 3RWPA 2JKKA 4OBOA 3N4UA 1H08A 3MA6A 2V0DA 3KY2A 3EYGA 2VTNA 2WU7A 4RLKA 4AW0A 4IZ7A 2HWOA 2OFUA 5T3QA 4FKLA 4BHNA 4DH8A 2EU9A 3HVCA 3S00A 4RX8A 1HCKA 2RFEA 4L46A 1QPJA 2P2HA 2YCQA 3NAYA 4KS8A 3ZZWA 5LCJA 4TNDA 1WBTA 4C0TA 4CFMA 3UMXA 4ZSAA 3P5KA 3CP9A 1TQPA 3VW6A 3DQWA 1UU8A 5E8ZA 4KRDA 3UZRA 5ICPA 4YC3A 4BTJA 3NCGA 4ORKA 1ERKA 4M8TA 4BDEA 3G33A 4Z55A 4JNWA 4MXAA 4F6WA 1DS5A 3KULB 2GPHA 3R2YA 2AC3A 4CYJA 3QA8A 1GAGA 4DFZE 4O7VA 5JFSA 1Y6AA 3VS6A 3MIAA 5LVNA 2REIA 3SGCA 2PE0A 1OECA 4FZFB 3VS7A 2XH5A 4U3ZA 4G1WA 4ENYA 2QR7A 3IW6A 4R6VA 4Y73A 2X2LA 3Q3BA 3FMDA 2XNEA 3R22A 3W1FA 4AW5A 2XM9A 2V55A 3OOGA 4NIFB 3IW4A 2R2PA 4HGSA 4PL4A 4TYGA 5E8XA 3D5VA 1OIQA 2R7IA 2UVZA 4BTKA 2QOCA 3Q60A 4APPA 4NM7A 4PPBA 1PYXA 3TTJA 1KOAA 1UV5A 1URCA 2XIRA 3CTJA 1KE8A 4JR3A 4YZ9A 4IEBA 4RWJA 4ZEGA 5AR7A 2X0GA 4PP9A 5BVKA 4XBRA 3BE9A 1TVOA 3LMHA 1PXJA 5EYMA 1APME 3FXZA 2F4JA 5CI7A 3EYHA 3MTLA 4WG5A 4RIXA 2OLCA 5DN3A 4BGGA 2GS6A 1WFCA 4L3LA 1ZZ2A 3QCYA 3FSKA 4QMSA 2VO3A 5IH5A 3SAYA 3K5UA 3LIJA 2BRBA 5CI6A 3QUEA 3VQHA 4CKIA 2VWXA 4DH5A 1G8SA 3GOPA 4FTOA 5HBJA 4O7TA 2IVUA 2YACA 3ZONA 3PJ1A 4DLJA 1YWVA 1XWSA 3FMMA 2BAJA 3TNHA 3ZSHA 2F49A 3MWUA 2EXMA 5H8EA 4L43A 3IDBA 4IE9A 1J91A 3F7ZA 3GCQA 3FMEA 4LL5A 5CQUA 4I3ZA 4D4RA 5IF1A 1IA9A 4EH5A 3PSDA 3W33A 2H8HA 4LOQA 4RVLA 1YHWA 3VQUA 2C6TA 5AUZA 1SM2A 2VNWA 4GFOA 5LXMA 2VRXA 4UMQA 4UX9A 3POZA 1AQ1A 3ULIA 5HE0A 4RX5A 4KIPA 1PHKA 2JDOA 4JJRA 4ZS0A 2PMNX 3HV5A 3PE1A 4G31A 1M2RA 4FOCA 2CDZA 4GK3A 4YSJA 3VVHA 4O27B 2FUMA 4RFYA 1PRYA 3R04A 2YM6A 4XJ0A 3FXWA 4B99A 4BRXA 5LVPA 5GIPE 4DG3E 4L67A 4JQEA 5CSWA 2YDKA 1H27A 3JXWA 4TYHB 4MQ2A 2DQ7X 3EN6A 3FY2A 4PTEA 2BVAA 4AFJA 3UIUA 3QZIA 4QP7A 2YLEA 4YJRA 3TWJA 4L3JA 3FQSA 1U4DA 4TY1A 5F20A 3RAKA 5L2TA 1MP8A 2UW0A 2C0IA 4FSRA 4TWPA 3BKBA 5EM7A 3I81A 1KSWA 3G6GA 4D2RA 4QTDA 3AC2A 4U43A 3NSZA 5EKOA 1YWNA 4NT4A 2UVYA 3ZRMA 2YZLA 3C7QA 4AZEA 4MVFA 3VS4A 3TACA 4AGDA 4FIGA 5AV4A 4AZWA 3QFVA 5A9UA 2ITUA 3COHA 4QMTA 4EHGA 4C4IA 5CF6A 1KV2A 4TL0A 4BWKA 4YHJA 5HIBA 4FKJA 3LJ0A 3OHTA 4PDSA 5DR9A 4EQMA 3HP5A 5CEPA 5F94A 1UU7A 5JFXA 2BTSA 3Q9YA 3PG1A 5E9EA 3CC6A 3MDYA 3PLSA 4GL9A 4FKGA 4YU2A 2PVNA 4U6RA 3RI1A 3R9RA 2J0LA 5CT0A 2PVMA 1WCCA 3PP0A 4EH8A 1WVXA 3OY3A 4J1RA 3HDNA 2W1HA 3DB6A 3G9NA 4D2WA 5KMLA 5E4HA 5FUTA 2PWLA 3KXHA 4EONA 4MH7A 3OCGA 3JY0A 3HV6A 4QMOA 2B55A 3Q2JA 4QTCA 5A4EA 4Q9ZA 4Z16A 2X6DA 5HBHA 3RJCA 4IDTA 4J53A 5FBOA 3KK9A 3W32A 3F5PA 3HZTA 4APCA 4RJ5A 2NPQA 2ETKA 2PVKA 2G2HA 3NUSA 4BWPA 4YMJA 4GFMA 2XZSA 2C1AA 2X7OA 3C5IA 5E7RA 2F2CB 3GT8A 1XHAA 5IDPA 2GNFA 5KMOA 5F4NA 4LL0A 4EOSA 3QHRA 2VZ6A 3QLFA 3R0TA 5CQWA 4FEWA 3QQGA 4IXPA 4O38A 4F6UA 3SG9A 4IBMA 3PXKA 4EEVA 3QRTA 3SW7A 4HZRA 5E8VA 2Q0NA 5DEWA 2OXYA 2EWAA 4LUEA 1VYZA 2QODA 4MYGA 1PMUA 2IPXA 3RCDA 2H34A 3ACKA 4TPTA 4B8LA 3VO3A 4YC6A 4PTGA 1OPLA 4CD0A 1Q8YA 3MPTA 2G01A 3QX4A 4D2SA 4FT0A 4L42A 4DE4A 1ZYSA 3PFQA 3VJNA 3C0GA 3FKLA 5CF4A 3IECA 1ZWSA 1URWA 4PPAA 3VBTA 3JVRA 3SQQA 2QNJA 4UMTA 4Y5QA 5L2IA 5AX9A 4CT1A 4EOLA 3MBLA 4BCOA 4RSSA 3AXWA 5FXQA 4AOIA 4CFFA 3PZHA 3HV3A 3IQ7A 4DCEA 3CSVA 5HESA 4BCPA 3ZBXA 4OAVB 4FGRA 5C27A 3F88A 4F9AA 3HL7A 4M3QA 4MD9E 3ZLSA 4CFUA 4M15A 4OBPA 5L8JA 3ZSGA 3VBVA 4FL2A 1Y8GA 4MXZA 2XB7A 3OOMA 3R7YA 1P5EA 3NX8A 2ERKA 4XP0A 5AP5A 5C26A 3FQHA 5M06A 4G5JA 2E9VA 2RFDA 4IC8A 3HDMA 4NCTC 4RIOA 3MW1A 1GIHA 4DYMA 1RDQE 4XP2A 4PY1A 1FINA 2W5BA 2CGXA 4LV8A 4ZLZA 5JEBA 3K3JA 2VTRA 2C30A 2A2AA 3OT3A 4U0IA 3UO6A 3LFEA 5ANGA 2Q83A 5M09A 2B9HA 2ONLA 3PSCA 1JQHA 3TDVA 4XS2A 5GJFA 2C3KA 3GU6A 4JG7A 4JLCA 4AN3A 4BTFA 3E3PA 4FL3A 1XBCA 3VRYA 2WTKC 3UIXA 4V0GA 4V04A 3Q4TA 5I9ZA 3CKXA 1DI9A 4X6QC 4BHZA 1QPEA 4MKCA 4QT1A 3ZCLA 5J79A 3L8PA 4XV3A 4C62A 1W8CA 5AP2A 4U7ZA 4XNEA 3GUBA 1Q8ZA 1QPDA 2ERZE 3TM0A 5FWKK 2IW9A 3T3VA 3CLYA 2W1GA 4O0UA 4F63A 5K4IA 2UZWE 5JH6A 1YXXA 4WRGA 3BELA 3OEZA 5IA4A 1BL6A 4X6RA 1H24A 4CKJA 1T46A 2AUHA 3K54A 3OC1A 4WUAA 5CALA 3BBWA 3QTSA 4TYJA 3VUTA 4D4YA 1B38A 5KX8A 5EHOA 5HTBA 5JFWA 2G9XA 2OXDA 2OKRA 4O6LA 4U79A 3BX5A 3GQIA 4H05A 1GIJA 3BHHA 3TXOA 4M7IA 2C69A 4RC3A 2E9NA 3KVWA 3HRFA 3ZU7A 5DHJA 2VWZA 2GQSA 1ZLTA 3V5PA 5F1ZA 3N4TA 1GNGA 1R1WA 3VF8A 2FGIA 3BI6A 2ZJWA 3PP1A 3PY1A 3U8WA 4AA5A 4BDHA 4BL1A 1ZOGA 1QMZA 3BWJA 3BIZA 2E2BA 3WBLA 5IKWA 4EOMA 4B4LA 2NRYA 4E73A 3OMVA 4ANQA 3T9IA 3FV8A 1CKIA 5ACBC 4OUCA 5EI6A 4QTBA 4UMUA 4OTWA 2WMAA 3ODZX 3DU8A 3L8XA 3LLAA 4ACGA 4ZMFA 4O84A 3FYKX 4XV9A 3LFSA 3N51A 4NU1A 2HIWA 2VN9A 2C47A 1WZYA 2PVYA 2V7OA 4YLJA 2C3LA 5G1XA 3W10A 1OI9A 4GSBA 3P23A 4QMLA 5EI8A 4R3PA 2JDTA 4BCMA 4MWIA 2HY0A 3LVPA 1B39A 2EUFB 1VR2A 3NW7A 4KKGA 5CSVA 2YCRA 5IEVA 5HKMA 4L6QA 4L7FA 1JPAA 3UPZA 3MSSA 3QC9A 3DXQA 4NSTA 3O8PA 5TE0A 3VUDA 3U55A 3OWJA 3D5UA 3Q4ZA 2IZRA 2YITA 2CN8A 3JUHA 4AUAA 2UZBA 3RK5A 3EQGA 1IG1A 2J2IB 2QLUA 3R21A 5HLWA 5GINE 5DG5A 4B6LA 3RCJA 3MY1A 1P14A 3V3VA 3OCTA 4S30A 2G15A 4FTNA 4R7HA 2WFYA 3S95A 3BGPA 3C0IA 1FVVA 1SZMA 4FTQA 4PPCA 2XKFA 3R8PA 5FM3A 1YXVA 3A62A 3U4UA 4HJOA 2C68A 1O9UA 5AM6A 4GV1A 3A4PA 4ZTNA 2X7GA 3CIKA 4S34A 2YIYA 5DR6A 3QXPA 3MVHA 3UOHA 2YM3A 4GCJA 4DTBA 3FWQA 2I0VA 1XH9A 1DM2A 4FSNA 4KWPA 3R1QA 3OS3A 2CCIA 3AC4A 3BU5A 2B53A 4O7SA 5CLPA 4FG9A 4G17A 4EWQA 3UDBA 2BKZA 2J51A 4CLIA 4XRJA 4D58A 4GW8A 5DRDA 1SYKA 2GNIA 2G1TA 4BIBA 2R5TA 4ERWA 2PMLX 2RSVA 4OTDA 4C33A 2YDJA 5EDRA 5EDPA 3EQDA 3V5TA 3ZZEA 3HAMA 3R7EA 4EOOA 3NUYA 2XNOA 4OTIA 5DOSA 5LMKC 2OSCA 2GU8A 5HVJA 3RPSA 4E6CA 4E3CA 3QC4A 4C4HA 1RW8A 1YI3A 2XYNA 3KGAA 4PDPA 4E20A 4DCAA 3LCDA 2VX0A 3R02A 4ITJA 4LRMA 4ALWA 4KINA 5CU6A 2GHLA 5CVGA 4QMYA 3T9TA 1W83A 3W16A 2VV9A 1HOWA 3TKUA 2X81A 5KBRA 2OH0E 3FUPA 2YAKA 3WF8A 4A4XA 3VN9A 1YXUA 4CV9A 2BALA 3ZDUA 4KNBA 5KO1A 2R9SA 5CSXA 5FTOA 4FG7A 5CASA 3QQFA 5AV0A 3QWKA 4ZTRA 3NYNA 4C7TA 1YHSA 4GUBA 3ROYA 3EN9A 3TEIA 3DXNA 4S31A 3RNYA 5IQBA 2I1MA 3PLAE 3CTQA 1IRKA 4ZOGA 4LRKA 1GZKA 4JBVA 3HV4A 4W4YA 4O2PA 4JAIA 3AC5A 4FX3A 2OWBA 5A4LA 1Z9XA 4P5QA 4L8MA 2UW6A 5G6VA 2BR1A 3MFSA 5AM7A 2JBOA 4OT6A 1NA7A 3R8MA 3GI3A 4O7NA 2IVTA 4L44A 2HCKA 4AX8A 3G5DA 4U45A 4DF3A 4X21A 3TDWA 2W9ZB 2FA2A 3ZHPC 5KCVA 5IUHA 3HNGA 5D41A 3BQRA 4RX9A 1YW2A 4RQVA 5J5TA 3C50A 2WMWA 2RKUA 5I3OA 1XH5A 1M7QA 3MPMA 3QUDA 3ZRLA 4E6DA 3PWYA 3LPBA 4JOAA 1Q8TA 3OWLA 4DH1A 4BIDA 4E5AX 1DAWA 2JIIA 4BC6A 4LM5A 4R7BA 3LOKA 5J1WA 1V0OA 1A06A 1OB3A 5AJQA 4BDCA 3QL8A 5M56A 4AZVA 3EN7A 1F5QA 4L3PA 4ZSLA 4AE9A 4OW8A 4QMPA 4RLLA 4GG5A 5D7AA 4E4XA 1M52A 2OJFE 4J95A 5BUJA 3Q4UA 1GJOA 3L9PA 3PE2A 2IN6A 3ZH8A 2UZUE 4PL5A 5IDNA 5D7VA 4DFBA 2OO8X 3FZOA 3MI9A 4DN5A 4IWOA 4HNIA 5KZ0A 1ZMVA 2B9JA 3TV4A 3OCSA 4F7SA 4CSVA 5KNJA 4XG4A 4I23A 4LUDA 4AT4A 4X3FC 2HY81 4OTPA 1XQZA 1Z57A 3MA3A 4CMOA 5L3AA 3DZOA 4S33A 3TKHA 3SX9A 2OG8A 5FEEA 3W2PA 4F1MA 1YVJA 2OZAA 2WTWA 3FLNC 3V8WA 4ASDA 4W8EA 3MB6A 1NVRA 5ANJA 1L3RE 3VBXA 3RMFA 4FKRA 4I0RA 3VNTA 2WMRA 3DK7A 3O0GA 3D7ZA 3Q6UA 4AGWA 4U44A 2Y6OA 3CPBA 3QAME 3NZ0A 5LQFA 4XX9A 2VX3A 1KV1A 3GU5A 3KEXA 3QRJA 3EQBA 3QQUA 4NKAA 5I9VA 4EH9A 4FSUA 4IWPA 3E8DA 2XM8A 3E62A 3O8TA 4USDA 5DLSA 2UVXA 3HMNA 4U40A 5H3QA 5J5SA 5KMKA 1BI7A 4M0ZA 3PSBA 2IVSA 4YBJA 1I44A 3DBEA 5AMNA 4JT3A 4PNIA 3W55A 3E7OA 1WBVA 3LXNA 4BB4A 2WQNA 4HVGA 3C4ZA 4J71A 4R5YA 5T6KA 5CU2A 3FSFA 2OGVA 3ORNA 4O1OA 2VTOA 3ID6C 1BL7A 3ITZA 3JVSA 5DT4A 3VW8A 3UQFA 2B7AA 2CJMA 4MD8E 5IA1A 4GMYA 4FMQA 3R71A 3MVJA 4MQ1A 4DBNA 4FTIA 1YRPA 4MNFA 4FZAB 2PY3A 2UZOA 2YIRA 3BZ3A 3AT3A 5IA0A 2JDRA 4M84A 4RVKA 4RJ8A 3RP9A 2ZMCA 1KE5A 2V62A 4L45A 3PIYA 4O0YA 4ACMA 4P90A 4B7TA 4PP7A 4FKVA 2CNUA 3O7LB 1OUKA 5EI2A 3GC8A 3C4CA 3FL4A 3RK7A 3FMJA 3R8UA 2VWWA 5KE0A 1H0WA 1R0PA 2C4GA 2PVRA 5M51A 5B7VA 2UV2A 3BYVA 2BZKB 3MFUA 3OF0A 2WTJA 3QD0A 4AW1A 1E9HA 4EBVA 2R3IA 3ORIA 3NUAA 4HOKA 2WTDA 3DAJA 3DDQA 4BKJA 5CSHA 4HVHA 5I3RA 4JBPA 3LZBA 4RIWB 4C2WA 4I0TA 4Z3VA 5C03A 4Q9SA 3HA6A 1Z5MA 3B2TA 4EHZA 2J90A 5IU2A 5M53A 3VS3A 4LGHA 3UOJA 1OKWA 4ID7A 2C5XA 1Q3WA 3MN3A 5J1VA 1JSVA 4I92A 3Q9WA 5J9YA 3NUXA 3II5A 4IAYA 5FP5A 2WO6A 5IQEA 4QNAA 3ZMMA 4TRLA 3ZLYA 3E5AA 4FIFA 4BDAA 5CAOA 2ZYBA 3IG7A 2V22A 4AN2A 2Z7QA 3MV5A 4FKPA 4FV4A 2BIKB 3UE4A 1OL7A 3C13A 5DE2A 3SC1A 2OW3A 4X2JA 1BLXA 3V04A 3VJOA 2QG7A 1M17A 5HU9A 3LCOA 3I5NA 4OTHA 2C5VA 3ZUVA 2F7EE 4QP3A 3RNIA 2G2FA 3OZ6A 4D55A 4ZTLA 4J7BA 3UYSA 4EOPA 5J95A 4YJTA 3F6XA 4BN1A 1ZZLA 3ETAA 5LWNA 2PYWA 4HVIA 1MQ4A 1OKYA 3NNUA 4O0TA 4F9WA 2WTVA 3C4EA 4QMZA 4BR3A 1OPJA 3NMUF 4ZIMA 5IQDA 2WD1A 2BHEA 2HXLA 3O51A 2X8EA 2Y0AA 2Y4IC 4QYGA 5ACKA 3LQ5A 4FKOA 4EYJA 4X3JA 5K0XA 4D5KA 5JFVA 3U87A 2ZV7A 2BIYA 3QQKA 3UG1A 5H2UA 2JKQA 3CKWA 3TJDA 4NIFA 3IK3A 4IIRA 2HZ4A 3ORPA 5AV3A 2VD5A 4PX6A 2WTKB 3G6HA 3NCZA 3QD4A 2PK9A 3PXRA 4S32A 3VUMA 1H1PA 1UVRA 4XRLA 4IX4A 4I1ZA 5CYIA 5IQGA 5AP1A 2YM4A 3GCSA 5HG5A 5IA3A 3MYGA 3WZKA 4AN9A 3WYXA 3ZUUA 1REJA 3F5UA 3IS5A 4JDHA 5CT7A 4EL9A 5BVOA 2RFNA 4ITIA 3MB7A 4W4VA 2XJ1A 3T8OA 4G2FA 5AP6A 5F95A 5CS6A 2IW8A 4ZTMA 5HORA 2QVSE 3SXRA 3A7IA 2VTSA 5EOLA 4ZTQA 1PMNA 3ORLA 4ENXA 4ZSEA 4FTUA 4DGLC 3PUPA 4CG9A 2JBPA 4K11A 3VUIA 4A06A 3W2SA 3ZLWA 4KIOA 4BTMA 1H1QA 3BGQA 4HYUA 4S2ZA 4FVRA 4YJPA 3FXXA 3F3WA 3V5JA 3ZM4A 5GZAA 1A9UA 4ZLOA 4UB7A 2W06A 4DFLA 3TNQB 3C4XA 3Q53A 3D5WA 3RINA 2RL5A 4JR7A 4Y46A 3HX4A 4K9YA 3BHYA 4E7WA 3CQWA 5CAVA 2X8IA 2SRCA 3CR0A 4QTAA 5JSMA 2WQEA 2VTMA 2O8YA 3QQHA 3WYYA 3GCVA 4FI1A 5JK3A 2OK1A 3QQLA 3MTFA 4Y5HA 3RPYA 2UW3A 2ESMA 4A9UA 4C2VA 3R63A 2CKQA 5EM8A 3UP7A 2RGPA 4C4EA 4QYEA 2HXQA 5A3XA 2QHNA 2CSNA 3FBVA 4RJ6A 1GIIA 3A99A 3IW7A 3I60A 1PY5A 3R2BA 2GSFA 4O1PA 4ZK5A 3P0MA 2XNPA 3U4WA 3WI6A 3ZDIA 1OMWA 2RF9A 3CEKA 3L9LA 3QA0A 2Y8OA 4U3YA 3RPRA 3P86A 4HGTA 5HEZA 1WAKA 4Z7HA 5HNIX 4AF3A 2A19B 4TYHA 2ITXA 2JDVA 5GJDA 5HI2A 4Y95A 2WMXA 3EB0A 4IZYA 2OJGA 4FV1A 4JIKA 4FZ6A 5HG7A 5M44A 3Q2MA 4NFNA 3WE8A 5L6OA 4FEVA 4G16A 4LFIA 3BYOA 4R5SA 5HBEA 4CEGA 2ACXA 3ZO4A 5J87A 2H9VA 3KK8A 1H1RA 4WBBB 3AC8A 2BILB 5AX3A 4JDKA 4GVAA 1YOMA 3R9OA 1U5QA 2WB8A 5DRBA 2WELA 3QGWA 5FEDA 5FXRA 3Q04A 2WOUA 2QKWB 4GT3A 4BZOA 3A7FA 1PXKA 2UW5A 3QD3A 3THBA 4NYEA 2QOOA 4FTKA 3SG8A 1FVRA 3QALE 2EXCX 5BNJA 4AWIA 4NKSA 5DYJA 4F0FA 2WQBA 5AUWA 5CEMA 3P9JA 2B0QA 4AZFA 4EUTA 2IJMA 2UZTA 2GDOA 2HK5A 3KRJA 4BCQA 5A54A 4HVSA 3HMMA 5FRIA 3U9NA 3I1AA 1Q61A 2BTRA 1M7NA 2YCSA 4C58A 5L2QA 4C4GA 5DNRA 3H9OA 1PYEA 1TQIA 3EN5A 5IMXA 2J5FA 3C4WA 4TWOA 3DKGA 3O8UA 5DIAA 3WILA 1RE8A 1I09A 1OITA 3CCNA 4O83A 1G8AA 2PMOX 3CS9A 3DJ7A 4JDJA 2JFLA 3K2LA 3UODA 4YURA 3T3UA 4C59A 5KHWA 4OLIA 5AR8A 3ZXTA 4XG9A 2PVFA 4KD1A 1A48A 2C6EA 3UVQA 5IQFA 4XEYA 4FV7A 4D0XA 1FGKA 1OL5A 1CSNA 3D2IA 3IOPA 1NY3A 2O2UA 4AA4A 2GS7A 5AR4A 1H1SA 4LRJA 3UIBA 3M42A 4TTHB 4DGGA 4NWMA 3LLTA 5KKRC 4FEQA 4FKUA 4MWHA 4XLVA 4YJUA 2WGJA 3UVRA 3PXFA 4CQGA 1KUTA 4GYIA 4I22A 4EJ7A 4IHPA 3BEGA 1ZY5A 3PVUA 4P2KA 5FEQA 3DAEA 1V0BA 3F3UA 5JRQA 2BZIB 3OD6X 2ITTA 3KB7A 1IR3A 2R4BA 3GBZA 3PJ3A 4KAOA 4D2PA 4EJNA 3PJ2A 4EZ3A 4RWIA 2BDJA 2HWPA 1K9AA 5BVWA 4XMOA 4C8BA 4UN0C 5BVFA 2B52A 2PVLA 3M1SA 1Y91A 3GC9A 1U5RA 3PVWA 4IWDA 3ZC5A 4YC8A 4C3RA 5I9YA 3NWWA 5K5NA 2YJSA 3Q9XA 4FNWA 4I93A 4KKHA 4I41A 4RA5A 3ULZA 2VUWA 3NLBA 2Z7RA 3P7CA 4JRVA 5FG8A 4FBXA 2PULA 4XH6A 3LKMA 2E9PA 4IB3A 4RJ4A 2XVDA 4GJ2A 5FBNC 3QF9A 2G2IA 3JS2A 1Q4LA 4FVPA 2XK9A 2VWIA 3BHTA 4QPAA 4N57A 1U46A 5C9CA 2UZVA 4KRCA 5EDQA 4IB1A 3L9MA 4FL1A 4J99A 4WNOA 3ENMA 3Q5IA 4C4FA 2ETMA 3TG1A 2P55A 2R3JA 2CLQA 2R3GA 4GH2A 2F7ZE 4I4FA 3C4FA 4BI1A 1OPKA 1Q62A 4A07A 2W4OA 4KIKA 3G9LX 4OTQA 2X6EA 4IMYA 3ORTA 1OBDA 2EXEA 5FDXA 2CKOA 4L9IA 4CGAA 4IANA 2I40A 2XBAA 4UV0A 5HQ0A 4O86A 5C4KA 3QCQA 1MRYA 3QWJA 3A7JA 4MCVA 3F9NA 2C6IA 2Y6MA 3PXYA 3QRIA 4WD5A 3FKNA 3ZRKA 4ACDA 3OG7A 3MH1A 3GXLA 3NNWA 3DV3A 3GU8A 3QGYA 3LMIA 2PTKA 4HPUE 4F9CA 5DGZA 2JFMA 3KQ7A 3NYVA 2W1ZA 2XJ2A 3PWDA 2QOQA 4MXYA 4RX7A 3AC3A 4G3DA 4N6YA 4F7JA 3CPCA 3U54A 4RZVA 3MVLA 3M2WA 2YA9A 4FT9A 4BCHA 2VWBA 3HUCA 3LQ8A 2YZAA 4FNXA 3G90X 5HNGA 5DT0A 3N9XA 1PXIA 4EOQA 2YIQA 4W8DA 4EH7A 4OAUC 4JDIA 3NYOA 5EOBA 4YGAA 5JZNA 4IAKA 5HGIA 1FPUA 2Z2WA 1ZARA 4HCVA 2WOTA 3TZMA 3VAPA 3WF5A 4M68A 2IG7A 1RJBA 3GENA 3V01A 4X3FB 5E8SA 5GJGA 1PJKA 2EB2A 5M4FA 3MY0A 3FKOA 4NUSA 5GZ8A 2X2MA 5CF8A 5AUYA 4IC7A 3F2RA 1NVQA 2HELA 1JBPE 2XCKA 3OXIA 2R3PA 4EQUA 5AP4A 4DEIA 1IAHA 4GT4A 4RZWA 5CENA 3EFJA 3QU0A 4EOKA 2QU5A 3UZTA 4DA5A 2GTNA 2R3MA 4KIKB
chains in the Genus database with same CATH superfamily
2R3KA 3C9WA 3OXZA 4RVTA 3KF7A 3EL8A 3HRCA 2WMUA 3KREA 4DGMA 1REKA 4U5JA 4D9TA 2W7XA 1LPUA 1UWHA 2XNGA 1Y8YA 4EK8A 3PPZA 3U6HA 1JAMA 3G2FA 3IKAA 4I4EA 2UZDA 2BAQA 3HKOA 4YZBA 4C57A 4QYYA 4O91A 3UVPA 4YPSA 3O7LD 5CAQA 3NVMB 2HOGA 4XG2A 1TFFA 2BKKA 4FKIA 4NK9A 5E8YA 3H3CA 2V7AA 3MH2A 3V6SA 5ITAA 1YI4A 5LJJA 3TZ7A 5EM6A 4BBMA 4FIHA 1BYGA 4LOOA 3QD2B 1ZRZA 3SD0A 4IM3A 4X2GA 4EHVA 3HP2A 3IGGA 4XG6A 2A0CX 3EKKA 4XCUA 2XNMA 5BQ0A 2YWVA 1ZOHA 1AGWA 3DS6A 2J5EA 3DBFA 3RAHA 1H4LA 4QP2A 4PDYA 3A8WA 4E5WA 4FV5A 4D1SA 4IX3A 4F1TA 5JGBA 4BDIA 1OBGA 3VS0A 2CN5A 2W1CA 4O6EA 3VHEA 4IAZA 3TL8A 3WZDA 3ET7A 4BCKA 4FIEA 5FTGA 1IEPA 2C5NA 3U6IA 5I9WA 4MD7E 2W1IA 3LFNA 4FV9A 1PXNA 4O0SA 4QQTA 4JBOA 3NAXA 4X7QA 2FSLX 4OT5A 4BBFA 5B2MA 4DGOA 2BRMA 2XJ0A 2F57A 4YZCA 3DOGA 2B54A 2B9IA 2QQ7A 4N6ZA 5E8UA 1E1VA 1ZY4A 5GNKA 5GZ9A 4QPMA 5KMMA 5DA3A 3MESA 5HU3A 1W7HA 4FTTA 4O7ZA 2BHHA 5C4LA 3PRIA 1ZAOA 4WG3A 4AGUA 5LVMA 3D14A 3NRMA 4U8ZA 3AMBA 2QOHA 2WU6A 3HYHA 2HYYA 4MAOA 4AS0A 4BCIA 3PYYA 4Y8DA 4AGCA 3G51A 1P2AA 2WHBA 3MPAA 4E4LA 1QPCA 4AFEA 3PIXA 1UU3A 3TUDA 1PKGA 3FLZA 4D2VA 4TXCA 3IDCA 2XAOA 5HHWA 3IW8A 4UYAA 3O96A 4IVDA 3UNJA 1R3CA 4ANMA 5IQCA 3DDPA 4M69A 4ALUA 5TO8A 4U42A 3A61A 2C6KA 3W0PA 4YTIA 2RG6A 4J8NA 3AG9A 3GQLA 2VO6A 4DITA 4DBXA 3Q9ZA 2GQRA 4IH8A 4I0SA 4LI5A 2PSQA 4G3FA 3SDJA 5LARA 4E5BA 1JSTA 4BDGA 4W9WA 3CGOA 3I6UA 4GK4A 3UBDA 3HUBA 5KMIA 2IEWA 2WZJA 2QD9A 3UOLA 4GEOA 4F7NA 2X1NA 3EMGA 2NP8A 5IZFA 5E92A 2HZ0A 4DTAA 4M13A 4FTLA 5IA5A 5A4QA 4ZS4A 3B8RA 3TV6A 2X9EA 2H96A 4ANLA 1PW2A 2J50A 1PKDA 5DBXA 4MXCA 4EOIA 3DY7A 3LXPA 2Y4IB 4FKTA 2YFXA 4O22A 3ZFYA 4BBEA 2XANA 4CFNA 3KRRA 3W8LA 4FE2A 2CGUA 3ELJA 3VS5A 4FTAA 3UMWA 3BLAA 1NVSA 3UDTA 2I0EA 3AMAA 4P4CA 4ZP5A 1PXLA 4K8AA 4LG4A 3ORXA 1H0VA 5H8GA 4IDVA 4U97A 4WSYA 3UTOA 4M69B 1XR1A 2C3IB 2JC6A 4HNFA 3RAIA 5HTCA 4QD6A 4Y83A 4NM0A 5L8LA 3P78A 4DT8A 4EK6A 4RQKA 1WVWA 4OR5A 3U51A 2ZM4A 4I6QA 3KRWA 2YAAA 2PUIA 1YDRE 4ZXTA 3WZUA 5HX8A 4FICA 4WNKA 5K3YA 4EH2A 4WIHA 4JG8A 5J7BA 2OF4A 2WQOA 5HCZA 3TCPA 2QU6A 1JKTA 5CEIA 1JNKA 3FZSA 4Y72A 5HE1A 3RHKA 5JZJA 5HG9A 3E63A 3SA0A 5AV2A 2O63A 4BDDA 3LCTA 5CXHA 1J7LA 1SVGA 3W0OA 4I5PA 2R3NA 3IONA 4FSWA 3NW6A 4USFA 3NR9A 2J7TA 3ORZA 1IAJA 5E8TA 4JG6A 5KMNA 2XF0A 3NNVA 5CX9A 3VRZA 1CDKA 2XUUA 1FMOE 4I24A 3I6WA 3LFAA 3U9CA 3UYTA 4QTEA 5BYLA 3QTWA 1J1BA 3PY0A 4D9UA 4AACA 3SLSA 5AEPA 3DFCB 2O5KA 3O23A 2GNHA 4BICA 1WBSA 3POOA 5AR2A 1IA8A 4II5A 3A7HA 4YP8A 3KF4A 3RTPA 3UGCA 4GG7A 5AAFA 3W2QA 2Z60A 2XBJA 3D4QA 1UNHA 3DA6A 3FI8A 2OJ9A 3CGFA 4UXLA 3O17A 4IZ5A 2OFVA 4LV5A 1ATPE 5TF9A 1OIUA 3F2AA 4CFXA 3WOWA 4XLIA 2VTAA 4NTSA 4USEA 4WA9A 1R39A 2I0HA 4I5HA 3RPVA 4O7RA 3AOXA 5HIEA 1H00A 4PQNA 3TKIA 2R3QA 1YOJA 2YERA 3BLQA 3FAAA 3TZ8A 4TWCA 2QOKA 4ERKA 5HLPA 2I0YA 4EORA 3OFMA 2IZTA 4YNEA 3FHRA 5IQAA 2GHGA 4GS6A 4GKHA 2UW7A 5IPJA 1ZXEA 2YWPA 1PMVA 2CLXA 3VF9A 4DTKA 3MS9A 3RKBA 4DFUA 2IZSA 3QKMA 1UWJA 2QI8A 4FYOA 3PDTA 4IFCA 5M08A 3E87A 1QL6A 3D0EA 4ONAA 5AAGA 4BF2A 5HNBA 5L8KA 2OU7A 4YLKA 2PE2A 1L8TA 4DDIA 1XH8A 3JYAA 4YHTA 2BCJA 2HZNA 2C6LA 2XK3A 3ZFMA 4EC9A 2ZVAA 1NT2A 1KOBA 5FLFA 4ANNA 1QCFA 4PTCA 3EHAA 4XP3A 5CU0A 4RJ7A 3TIZA 2NNWB 3DZQA 3P7AA 4NFMA 3D83A 2XKCA 3FZRA 5M4UA 4BYIA 3L9NA 4JAJA 3EH9A 1B6CB 2ITNA 4NW5A 3RZFA 5EQEA 1H8FA 4I6FA 4X2NA 5D9HA 3SRVB 5EQPA 2Z7LA 4HZSA 4QP9A 4D1XA 4ZY5A 2WTCA 3UO4A 5CAPA 2OXXA 3PXQA 3CQEA 4AA0A 3EQRA 3P4KA 5AWMA 4BCNA 2JAVA 4QMUA 3BWFA 1VZOA 4M97A 1CKPA 1VYWA 1XBBA 2J0IA 2PZYA 4FV3A 2P0CA 4C02A 3ZYAA 4QMNA 3RWQA 5AAEA 3BEAA 2P4IA 3UQCA 3RK9A 3AT2A 4G3CA 3SVVA 2X8DA 4EK5A 5AFVA 4V05A 2EVAA 4D4SA 4QDVA 2C0TA 4MF0A 5HCXA 3WZEA 4WG4A 1YKRA 3GEQA 3K3IA 4F4PA 1VJYA 4LGDA 4D2TA 4GT5A 4AT3A 2J9MA 1LUFA 2HENA 2UUEA 3R01A 3V5QA 3ZM9A 3OW3A 3P08A 4IFGA 4RIWA 4BGQA 1GY3A 1M14A 4C35A 4Q5EA 4N0SA 2CCHA 3E64A 1VLRA 3LFFA 4ZSJA 4EWHA 5EFQA 3UNZA 3AQVA 4A7CA 3QUPA 3PA3A 1OUYA 4RJ3A 3UPXA 3R83A 1Q8UA 3TI1A 1Q97A 2E9OA 3DLZA 2Y4PA 3NFFB 2CMWA 4K0YA 2PVJA 2ITPA 3A2CA 3DJ5A 2YEXA 3BLRA 3SOAA 3UDSA 2C5OA 1W2CA 3RVGA 2OI4X 4LGGA 5BYZA 2ZDUA 2B9FA 3C51A 1SMHA 3EIDA 1UKIA 5M55A 5CZIA 3L8VA 4N70A 2W17A 3HRBA 1JKKA 3FDNA 2C6DA 4K2RA 4UZDA 3SHEA 5J9ZA 2XIXA 3PIZA 4D4VA 2C5YA 4H58A 3GP0A 3NDMA 5JRSA 4RMZA 2R0UA 4DEGA 3QXOA 5AIKA 3EN4A 2JIUA 4D5HA 4F0GA 3EFLA 3EQCA 3BU3A 2XEZA 4RBLA 4TW9A 3B2WA 3OEFX 2BZJA 4QOXA 4FUXA 1CKJA 4DAWA 4GYGA 4QMMA 4X2KA 4ZZOA 4J8MA 3OROA 4NCTA 3CXWA 2BPMA 4UEUA 2JITA 5HCYA 1YQJA 3Q6WA 4FSTA 3NNXA 2VX1A 3FMLA 4BDBA 4WSQA 5CZHA 2X4FA 3ALOA 2PE1A 2A27A 2OIBA 4A4LA 2HAKA 2CPKE 2C6OA 3NGAA 4F99A 5EYKA 4TN6A 3QKLA 3LXKA 3ZS5A 3ORMA 1UKHA 4UXQA 3VUHA 4J97A 2I6LA 3KXZA 4IWQA 3ZO1A 4E6QA 5C8NA 5KUPA 3FE3A 4BCJA 1EH4A 1YXSA 1MRVA 4NTTA 4IJPA 4RA4A 2ONLC 3KXMA 3Q32A 4ZTHA 2OJIA 3QRKA 1E1XA 3HAVA 1V0PA 4P5ZA 4U9AA 3BBTB 2ZV2A 1XH7A 4NJDA 5EM5A 1CMKE 3DK6A 3FI4A 1O6KA 3I7BA 2PUPA 4DHFA 2PPQA 4DHZA 3MY5A 3SXSA 4F6SA 4XUFA 3OCBA 4DC2A 1WBPA 4CQEA 3Q52A 3R7OA 4L68A 3G15A 1U54A 2Z02A 5K4JA 3BLHA 3CY2A 3FJQE 2YJRA 1H26A 3ALNA 1ZYCA 2KTYA 3RPOA 2WEVA 1OL6A 5DH3A 1Q8WA 4AG8A 4LOPA 4F70A 1GZNA 2QCSA 3HECA 4ANOA 5HD7A 4BWXA 4MX9A 3FLQA 5HO8A 3V8SA 4I6BA 4WHZA 3R8ZA 3AD6A 1YDSE 3MH3A 2ZV8A 1XH6A 5IH4A 4I5CA 4CRSA 3F3VA 4RPVA 5HD4A 3HMIA 4ANBA 3IDPA 3ZOSA 3W2OA 3W8QA 1Q24A 4JS8A 3W2CA 1KE7A 4CV8A 3BV2A 3FYJX 4FT7A 3NW5A 3UC3A 3F82A 2X2KA 4QRCA 5HO6A 4D28A 4EK4A 1WBOA 4RT7A 4PMMA 4QO9A 1PXOA 1JSUA 2DYLA 3BQCA 4LMNA 2VAGA 2XK7A 2WIHA 2VU3A 4QP6A 2CKEA 4O0RA 5ETAA 3QBNA 4O4BB 3V8TA 3BYUA 2VO0A 2ZV9A 5FP6A 3V6RA 1UA2A 4W4XA 2BMCA 4NEUA 4G9RA 5ETCA 5D11A 2JIVA 2OH4A 3QTXA 3SW4A 4CXAA 3A4OX 4A9SA 3DKFA 3ATTA 4XV1A 4CTCA 3P5JC 1U54B 1ZYDA 2R7BA 1OVEA 4TZRA 5EG3A 2F2UA 4C3FA 2OIDA 4EZ5A 3DBQA 2XK6A 3KRLA 2XIZA 5BVDA 3PFYA 2F7XE 3PVGA 4IAAA 1CM8A 3HA8A 3PVBA 3HV7A 3DNEA 5BMSA 4OGRA 4DFXE 3IPHA 4ITHA 5DWRA 4F08A 5CSPA 5FTQA 5CY3A 3QLGA 2UZNA 4RFMA 2P3GX 4RIYB 5KHXA 3COIA 3KMMA 2VO7A 4PMTA 3BU6A 2XS0A 4FC0A 2IF8A 2GNGA 3HLLA 4FT5A 2XRUA 4DFNA 3F2NA 5CF5A 4FNYA 4MBLA 5M07A 5FM2A 4RG0A 1MQBA 4NM3A 5KZIA 1ZOEA 4CRLA 3DBDA 3KXGA 5LVLA 4G6OA 1ZYJA 2PMIA 4EUUA 1XMMA 3RZBA 1K3AA 1V1KA 3QTIA 5FGKA 2W99B 4MNEB 3AMYA 4BKYA 4XOZA 5IISA 4FKWA 2WMSA 2PU8A 1LR4A 2WTIA 3UZPA 2EB3A 3N4VA 5K5XA 5GIOE 5DVRA 3E8EA 5BYYA 4GFGA 2X39A 4GRBA 1S9IA 2UW8A 4WKQA 4AAAA 5J7HA 5D1JA 2BROA 1XKKA 4CCUA 3R73A 5J8IA 1TQMA 4JQ8A 4X0MA 4AU8A 1CTPE 4FSMA 2JD5A 4HGLA 4F09A 4UWBA 4FSZA 4Y85A 4QDEA 2XKEA 3F61A 3LM5A 5GHVA 1PXPA 4FODA 1AD5A 4KBKA 3S3IA 3HMPA 4YNOA 4ZY4A 2OBJA 2W1EA 5L4QA 3ENHA 2VTQA 2O64A 5LMBA 3EZVA 4LMUA 4BY9E 5LMKA 3HEGA 2X0PA 3ZFXA 3EFWA 3GCPA 4IVBA 4CG8A 2P2IA 2R3OA 3FI3A 4WUNA 5A4TA 3ANRA 4YZMA 3RM7A 3L8SA 4A9YA 3PJ8A 4D1ZA 3FPMA 2YLFA 3ODYX 3U6JA 3I0QA 4XYFA 3OWPA 5A6NA 4YJSA 4DEHA 4FTCA 3HGKA 4QQJA 5M4IA 4E26A 3KMUA 3GNIB 2UW4A 5ANIA 2UW9A 1X8BA 3KIOC 3QZGA 4UWCA 3AGMA 3EFKA 1ZYLA 2O0UA 5CU4A 4CZUA 4R8QA 1OL2A 3ZBFA 4O2ZA 4ZY6A 4BDJA 2O65A 2PZIA 4B9DA 5BPYA 1KE9A 5HE3A 4CZYB 4RRVA 4AXDA 3W0SA 2F9GA 2ZMDA 2ITYA 2W1DA 5BUIA 4EH6A 5IG1A 5IEXA 5I9UA 3TJCA 5JGDA 3F3TA 2WNTA 2PZ5A 3GCUA 4FZDB 3VBWA 4ACHA 5IUGA 1YI6A 4PWNA 1GOLA 4FV0A 4I5MA 4DG0E 1G8JA 2H6DA 2CNQA 5AIRA 4O4EA 5HZNA 3D5XA 2OZOA 3OTVA 4FEXA 5HICA 4C61A 4IZAA 4OBQA 4TKSA 2R3FA 1LEWA 3CD8A 3NUUA 1XH4A 3H10A 5BVEA 4Z9LA 5IH6A 1DI8A 2GCDA 3CJGA 1BMKA 3OXTA 2ZB1A 2QO9A 5HTIA 3FLWA 1M2PA 3R28A 1BKXA 5K0KA 4HVDA 2XIYA 4GU6A 4RIXB 3TNIA 4L53A 2JAMA 3E7VA 3D2KA 4FT3A 5T68A 3SV0A 1M2QA 2WMQA 5JGAA 2ZOQA 1BX6A 3SXFA 4JVGA 1FVTA 5EYCA 4BGHA 4NZWB 4O96A 1F3MC 4XBUA 3VBYA 3DQXA 1W2DA 2W4KA 4BJJA 3DCVA 4YZDA 3I0OA 3BYMA 3AT4A 5TT7A 5EKNA 5DI1A 3LE6A 2XRWA 3DKCA 4DEEA 5I4NA 1ST4A 1DAYA 4CVAA 1GZ8A 5B2KA 1WMKA 4X3FA 5IMEA 4MBIA 3DLSA 4FUYA 3VBQA 5IEYA 5BVNA 4NJ3A 1SNUA 2IW6A 4O4FA 2QHMA 4CYIA 1OKZA 4FVQA 4QMXA 4DDGA 3F5GA 3EQPA 4FK3A 4R1VA 5FXSA 2R3HA 5DFPA 5EW9A 2PZPA 1WBNA 2XK8A 3DPKA 4K33A 5L2SA 3VHKA 1XO2B 3FZ1A 1H28A 2HW6A 4EKLA 1W84A 2BFYA 4F65A 5JKGA 5AP7A 3FZPA 3KCKA 4JQ7A 4KIQA 2ZM3A 4WO5A 4GVJA 4CZTA 2ETRA 2FVDA 4YR8A 1Y57A 2BDWA 2ZB0A 3COMA 3DGKA 3FHIA 4HCTA 4O0WA 5HOAA 4DEDA 1BI8A 2XIKA 4KBAA 3GVUA 4ZTSA 2CGVA 4KA3A 4F9YA 2YISA 4CNHA 2CGWA 1XJDA 3FC1X 2PZRA 4JL9A 2OJJA 5FD2A 1YOLA 2X0QA 3VULA 4Q2AA 5CAUA 3VC4A 2XMYA 4AQCA 4PV0A 5BMMA 3RGFA 2QONA 3QCSA 4LQMA 4G5PA 5HLNA 3I4BA 1BUHA 1PMEA 3VS2A 4MEDA 5D12A 5C8MA 5A14A 4QPSA 5JQ8A 3JY9A 3TNWA 3TIYA 3O71A 4G6LA 5CNOA 4PNKA 4QEBA 5I9XA 5I5ZA 1OZ1A 2YABA 3LFDA 3MJ1A 2ZAZA 3TV7A 2YIXA 3FL5A 1H25A 1UNGA 3DAKA 4O4CA 3C0HA 4YTHA 4YTFA 3E88A 2AYPA 3GFWA 3DJ6A 3GU4A 4JX7A 4IACA 4P7EA 5JN2A 3TTIA 2GHMA 2O3PA 3IO7A 3PPKA 3DFAA 4HCUA 4DINA 2C3JA 3F7WA 1F0QA 3FMNA 3KMWA 3R1YA 5ANEA 4HYHA 5EH0A 5HIDA 3R9NA 1KWPA 3KRXA 3TT0A 4DEBA 3LHJA 2YHVA 4H3BA 4QYFA 2A4LA 1W82A 3CTHA 3S4QA 3C1XA 5D10A 3WE4A 3OUNB 5J9LA 4RWLA 5AP3A 4IADA 3Q5ZA 3SKCA 5CEOA 3KXNA 2VGPA 2J0MB 4BFMA 4WNPA 4IM0A 4IAFA 5HO7A 3PA4A 3UJGA 1KE6A 2XK4A 4M12A 3BE2A 4YZNA 3QHWA 3S1HA 3QZHA 5B2LA 2LAVA 4R3CA 2QOFA 4TYEA 4ZAUA 4HW7A 2FH9A 3IOKA 2LGCA 3ORKA 3KN6A 4NH1A 3S2PA 4EQCA 3KA0A 5AP0A 5CXZA 3PRFA 4KBCA 5CEKA 3KVXA 2JLDA 4E8AA 4EI4A 3E92A 4BI2A 3DT1A 4RC2A 5HVYA 4FGBA 5CU3A 4YHFA 3DKOA 2DS1A 4JX3A 4AXAA 1H1WA 2YM7A 4WRSA 2IWIA 4HYSA 5IA2A 3MGYA 3FPQA 3CY3A 3V5WA 4F9BA 1Q3DA 4FSQA 2W96B 5IQHA 2WMBA 4GIIA 3OY1A 1P4FA 4YPDA 4L7SA 3NEWA 5IUIA 5H9BA 4KS7A 4FNZA 2C0OA 2VWVA 5DT3A 3VUKA 3LAUA 2VTLA 1LEZA 1RQQA 3NIEA 5CTPA 2YM5A 4FTJA 2QC6A 1W0XC 3AGLA 4GUEA 4QNYA 4UZHA 4E4NA 5M4CA 2XNBA 3E8CA 4F64A 4JBQA 3TUBA 4YTCA 4RWKA 3MFRA 5LOHA 2NRUA 4CFVA 2W1FA 4UBAA 4IQ6A 3KL8A 5AADA 4J52A 3CD3A 3RBWA 5KBQA 2DWBA 2W0JA 2GS2A 4DHIB 2BRNA 3CE3A 4FIJA 2WKMA 4H3PA 3DB8A 1OL1A 1SVHA 3A7GA 4G9CA 4H1JA 4ASXA 4A4OA 4BKZA 3PTGA 4H3QA 4IAIA 2W9FB 4NW6A 4O21A 5ANDA 3R7IA 5A4CA 1MUOA 2VTTA 4AT5A 4DH7A 5AA9A 3GC7A 3FEGA 3LQ3A 3S0OA 1Q41A 2YIWA 3ANQA 4HYIA 4UYNA 4BDFA 3LFQA 4FOBA 4ZMEA 2YM8A 3H4JA 1JWHA 2X7FA 2IO6A 4NM5A 5F9EA 2YDIA 4TYIA 3UO5A 3DBCA 2J0JA 5EHLA 3GU7A 3UP2A 4G3GA 4FKQA 4V0GB 3A8XA 4DEAA 3QX2A 4OTFA 4ACCA 4AP7A 4BCGA 3CJFA 1HCLA 2CHLA 5LWMA 4EC8A 1Q5KA 3TN8A 4FV2A 4KKEA 4O7WA 1SNXA 3ZSIA 4M66A 5CVHA 4FIIA 4E93A 3WARA 1O6LA 2WPAA 1VEBA 3NS9A 4E4MA 4ZJVA 1YXTA 3D9VA 3ZO2A 4TT7A 3QTQA 2ITQA 4UALA 4IJ9A 1PF8A 3LCKA 4GJ3A 4RFZA 3LCSA 4R3RA 2GFCA 2IZUA 3H30A 4OTRA 1OKVA 2BAKA 4GIHA 2J6MA 5CWZA 4X2FA 4DT9A 2J0KA 4DH3A 4PRJA 4EZ7A 2KULA 3P1AA 4TWNA 1JLUE 3FLSA 5E1SA 3G0FA 3E3BX 2ITVA 4A9TA 1FGIA 2ZDTA 3C5UA 4UY9A 4ARKA 4EYMA 3R7GA 2GQGA 2GTMA 2P33A 3I79A 1JKSA 2OICA 4H39A 4ZSGA 3G0EA 3KC3A 5CANA 3OBJA 4ZZMA 4FA2A 4XOYA 3ZC6A 4H1MA 1OGUA 4QQCA 3R30A 3BV3A 4TNBA 5CEQA 1J7UA 4KUJA 2IVVA 4I6HA 4O7YA 1T45A 3GC0A 3LJ2A 4BIEA 1Y6BA 2OF2A 4GK2A 4MHAA 1G5SA 4CFWA 5DMZA 3UNKA 4CKRA 3LFBA 3V51A 3VWAA 4BZNA 5IQIA 3R1NA 4XG7A 5AR5A 4PUZA 3ZEWA 4KABA 4ZJJA 5AA8A 4FK6A 3ZXZA 5BX0A 2W5AA 3PXZA 4M0YA 3ZUTA 4Z7GA 4FJVA 4K1BA 2CKPA 1PXMA 3KKVA 4JI9A 4W9XA 4FYNA 5HVKA 4IB5A 5H8BA 3EQIA 4QMVA 4B0GA 4R1YA 3FQEA 2VGOA 3PZEA 3Q4CA 3DXPA 2VNYA 4K6ZA 3UIMA 2HW7A 4G3EA 1H01A 3MVMA 5A6OA 2PHKA 3V5LA 2VTPA 3ATSA 1YWRA 3R00A 4FR4A 5AUUA 3SRVA 3DTWA 4MK0A 4FG8A 3UOKA 3EL7A 3E93A 3F69A 3PJCA 4ANSA 4CT2A 3R9HA 4CCBA 4EH4A 1GZOA 3LJ1A 1OIRA 3QYZA 2UZLA 4QMWA 4QQ5A 4XHKB 5L6WL 3GFEA 2JKOA 3TYKA 1H07A 4C38A 2CNVA 3FI2A 3TUCA 5ANOA 1FBNA 2ITOA 2WIPA 1ZMWA 3PPJA 4FTRA 4EKKA 4YUQA 4N4SA 1W98A 2E9UA 5ANKA 4QP4A 3CBLA 4MXOA 5HX6A 5K9IA 3R1SA 5B0XA 2RFSA 3COKA 1K2PA 1OIYA 2JGZA 2YCFA 3HMOA 3QCXA 3BGZA 4FV8A 2XYUA 4GU9A 4KSQA 4Q5HA 4YO4A 4K77A 4XG8A 4IVAA 5LMAA 5LCKA 1SVEA 2QOBA 4KB8A 4QYHA 4DGNA 5I0BA 2JKMA 2ZM1A 4I20A 3DK3A 3MFTA 5DPVA 4AZTA 4FEUA 2WEIA 4KSPA 3PG3A 3FLYA 4YJOA 3O50A 3LFCA 4RVMA 2XCHA 3WZJA 4YSMA 5EK7A 3OTUA 4E6AA 4O7LA 4C36A 2PUUA 5AUTA 2FYSA 3OT8A 2Z8CA 4UWYA 1OGYA 5AR3A 1OM1A 2R3LA 4C4JA 4DG2E 3L1SA 3BRBA 1J3HA 5M57A 1STCE 2C6MA 3DTCA 4EOJA 4QP1A 3ZO3A 2I7QA 4FKSA 1O6YA 2FSOX 5FQDC 3NVKI 1R0EA 2QO2A 4AOTA 2QG5A 2X9FA 3NYXA 4ZJIA 4JIAA 1ZMUA 2JDSA 4YJQA 1WVYA 2NO3A 2XP2A 4QP8A 3FMHA 4L01A 3SOCA 1P4OA 4EK3A 2A1AB 5HE2A 2BRHA 5AUVA 4EHEA 4UMRA 4O0VA 3EOCA 4I94A 4WBOA 4WOVA 4CMTA 4C34A 4PF4A 3AD4A 5EW8A 3EQHA 5AUXA 4IB0A 2VTJA 4J96A 4IW0A 4PMPA 4ZLYA 3UG2A 4HGEA 4LYNA 3A60A 2VWUA 2WQMA 3BHVA 3MIYA 2QKRA 4FSYA 4I21A 5TOZA 3W0RA 3WIGA 3MJ2A 5DEYA 5KKRB 4D0WA 5TR6A 1Q99A 5ETIA 4QMQA 3ROCA 3PY3A 4G34A 2ITZA 3QTRA 2WMVA 2AC5A 1NXKA 3GOKA 4F0IA 3MH0A 5CVFA 4YLLA 3QYWA 3VS1A 3I5ZA 3R9DA 3NPCA 5EYDA 4EH3A 4IX5A 2QR8A 3O2MA 3KU2A 4R77A 2UZEA 4MBJA 4G6NA 4ASZA 1WBWA 2XA4A 4OTGA 2PL0A 3EZRA 3AC1A 2C1BA 3AD5A 4YBKA 3REPA 4CTBA 2BFXA 5BUEA 5E90A 2VTIA 4BCFA 4V01A 4FZ7A 4H36A 5CNNA 2B1PA 1FMKA 3P7BA 1W2FA 5LVOA 2XEYA 3EJ1A 3K5VA 2Z7SA 2FSMX 4W4WA 3R7VA 4F1OA 3D94A 3LMGA 4IVCA 4XG3A 4ALVA 1ND4A 3DNDA 4RGJA 2GNJA 3QTUA 3WF9A 3RHXA 4YJNA 2VTHA 4AZSA 3ZLXA 2Y9QA 4DFYA 2GNLA 2PVHA 4BDKA 3JPVA 1TKIA 4MTAA 5L2WA 5JT2A 1XBAA 1J7IA 4E1ZA 3LXLA 2GFSA 3OVVA 3KXXA 3KFAA 3QKKA 2OZAB 2Y7JA 4FF8A 3OBGA 3Q96A 2QURA 3LW0A 4CLJA 2RIOA 4DLIA 5JQ5A 2QOLA 3LM0A 2QOIA 2R64A 3R6XA 4O0XA 2X4ZA 4JXFA 3B8QA 3D7TA 4AOJA 3P79A 2R0IA 3H9FA 5E1EA 2BDFA 3ZTXA 4IM2A 3NUNA 3RM6A 3WF6A 3FZTA 3UQGA 2WAJA 2XKDA 1G3NA 3M11A 2YN8A 4XV2A 5E8WA 3BYSA 4CMUA 5TKDA 3AKJA 3JR1A 5C1QB 2Q0BA 4EBWA 2GMXA 3GGFA 1NW1A 3RAWA 3KN5A 5EHYA 4JRNA 4MF1A 2B4SB 4R7IA 3I7CA 3TZ9A 3W0MA 4O82A 2XNNA 2FB8A 3FY0A 5C01A 2JEDA 3E8NA 4K18A 3OP5A 3GB2A 4J98A 4U41A 4YO6A 3W2RA 2OIQA 5L6PA 3VUGA 1MRUA 4IX6A 2W4JA 4U81A 2FO0A 1JKLA 2BUJA 4L52A 3F3ZA 3RALA 4AE6A 2HZIA 1JVPP 1LP4A 5AV1A 4ZZNA 1IASA 3W18A 2ITWA 4R78A 4RIYA 3F66A 4BI0A 5C8KA 4YJVA 4BZDA 3UC4A 2WXVA 1UNLA 1YHVA 5A46A 3F5XA 2QLQA 3H0ZA 4PMSA 4A9RA 5EQYA 4L00A 3NIZA 2QO7A