4D1YA

Crystal structure of a putative protease from bacteroides thetaiotaomicron.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
MAKKVAVLAVNPVNGCGLFQYLEAFFENGISYKVFAVSDTKEIKTNSGMVLIVDDVIANLKGHEDEFDALVFSCGDAVPVFQQYANQPYNVDLMEVIKTFGEKGKMMIGHCAGAMMFDFTGITKGKKVAVHPLAKPAIQNGIATDEKSEIDGNFFTAQDENTIWTMLPKVIEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Stability of an Unusual Zinc-Binding Protein from Bacteroides Thetaiotaomicron.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords PUTATIVE PROTEASE I
total genus 51
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d1yA00
3F5DA 4MNTA 2VXOA 5E9AA 5LIRA 3SF8B 1GGKA 3N7TA 4UCFA 1KWGA 1QDLB 3EN0A 2W7TA 4L8YA 4PXYA 2R1UA 4WINA 4XLLA 1SOAA 4P35A 3UOWA 4ZDKA 3UGJA 1GPMA 3TTVA 1JVNA 2R1VB 1PDVA 3P9RA 4BTEA 1SY7A 2R1VA 4L95C 3ZJ4A 2XF2A 3EFEA 2AD5A 3FIJA 3L3BA 4ENPA 1P7ZA 1VCMA 3B3AA 4L8WB 3BHNA 1T0BA 4AUNA 2ZUUA 1CF9A 1FY2A 3B36A 4GE3A 2ABWA 3P9QA 3OT1A 3RHTA 1S1MA 4BIMA 4BFLA 1OY1A 1GGFA 1P80A 3L4EA 4AJ9A 2R1TA 3L18A 4I46A 4N12A 4HCJA 2A9VA 4D1YA 1QWSA 1CE8B 4P34A 3TTTA 4OFWA 2NV2B 1KA9H 1OX6A 3PQ3A 4UZSA 1A9XB 4GE0A 4AULA 1IPHA 1OI4A 3MGKA 1T3TA 4P36A 4R7GA 2VKTA 4QYXA 2OR3A 4N0MA 3CYFA 4Y1RA 1G2IA 2NV0A 2ZUVA 4AUEA 1T36B 2RK6A 3VU3A 4B7AA 2VDJA 3UMMA 4P5PA 4LRUA 3CZ9A 1I7QB 3NOVA 4ENVA 3D54D 2GK3A 4RKWA 2RK4A 2AB0A 3UJNA 1GGEA 4L8FA 2VPIA 1VCNA 3SF8A 2YWBA 4E5VA 2V4UA 3NORA 5IP5A 3CY6A 4MTCA 4P2GA 1P7YA 1KXJA 5K4AA 5SY9A 1PV2A 3ZR4B 4OGGA 4ENWA 5JZOA 3CZAA 4ZGGA 1UCFA 4L7QA 3TTYA 3TTUA 5SY4A 1ONSA 1KWKA 1BXRB 2YWDA 3OT1B 3PQ7A 3UK7A 1QF7A 1Q7RA 3SOZA 4UNIA 1M6VB 1PE0A 2WJZB 5DFAA 4OIFA 2RK3A 4WXYB 4Y0NA 3PQ6A 4K2HA 4OQ4A 1R9GA 4OGFA 4AUMA 1IZZA 3GRAA 4B31A 3NVAA 3PQ5A 4Y1GA 1QVWA 1FYEA 4ZDJA 1J42A 1P81A 3NOQA 1P5FA 4JQSA 3NONA 1CS0B 4ENQA 1VCOA 1I1QB 1OX4B 3PQ8A 4RKYA 4Y1RB 3P9PA 3TTSA 4ZDIA 3EJ6A 2ZUWA 3R76A 3F71A 3TTWA 4B5KA 4ENUA 5SY6A 3EZGA 2ISSD 2ZUSA 2D7JA 3L7NA 3NOOA 1C30B 5BV2P 4LGYA 2IUFA 3KKLA 1IZYA 4MGHA 3WFZA 4ENTA 3R75A 1O1YA 1OX4A 4ENSA 1GG9A 2VRNA 1VHQA 4Y1EA 1Q2UA 1PDWA 3PQ2A 3BWEA 1KEEB 3R74A 4B2YA 3M3PA 2FEXA 3MIIA 3ZJ5A 1OX5A 1L9XA 3TTXA 1I7SB 1QVZA 4GUDA 4L78A 1GPWB 3TQIA 3PQ4A 4I2NA 4OJYA 5SYAA 4QYTA 2LXNA 5JZMA 3EWNA 3ER6A 1JDBC 1N57A 4UOQA 4UOZA 3B38A 2ZUTA 4Y1FA 1GGHA 1GGJA 2R1TB 1C3OB 2H2WA 3CNEA 4S0ZA 1K9VF 4ADSG 3FSEA 4B40A 2GHRA 1WL8A 2YWCA 4E08A 4I4NA 1U9CA 3P9SA 1QVVA 2YWJA 4ENRA
chains in the Genus database with same CATH superfamily
2KW5A 1T8TA 4F8YA 4TV9B 1PWYE 3FX2A 3WYGA 1P8AA 2D2IA 4BN0A 1ZR4A 3GT7A 4XLLA 4JB8A 2CMDA 5DNVA 3SIXA 1LPMA 4MA5A 4TX1A 4RAQA 2WOJA 1Q0LA 6ADHA 2V55B 1FPQA 1V48A 1MG5A 3CJTA 5IMBA 1JQLB 5A4MS 1Z6PA 1BCSB 3FVQA 2MCFA 3N2GA 5FADA 5A2QA 5ITZB 1N2CA 2PO7A 2OO5A 1IN5A 1JLSA 2GEVA 2HSEA 4HUQA 5DM4A 1JSCA 2HDWA 3LL4A 4WUVA 2DMRA 3W2TA 2J9ZB 2YXNA 3T54A 2F9LA 2ZR0A 3VJRA 2VNKA 4EKEA 1J0EA 2Q8NA 3OPQA 3QA3E 2B6NA 2NO9A 3DE0X 5JS7A 1ZKMA 1YSCA 4BNXA 1Y82A 3P7MA 5FPSA 3I3SR 3CZRA 4TUYB 2OXTA 4AKHA 1RZUA 2ZIXB 5FWXB 2ZJ8A 4XUDA 2FX5A 2DR3A 3LRTA 3L6UA 1R4NA 2C0CA 4U9UA 2WIDA 1E2PA 5IFKA 1SEPA 2VATA 2DY0A 2WUVA 1KHTA 1PT5A 1QBKC 3MXTA 1ZX1A 2NUPA 1XCJA 4UMVA 4CT4B 2YYZA 2EDAA 2BMJA 4X1KB 4YJHA 3RUDA 1GTG1 4WBNF 5B3LA 1TQ2A 4MVWA 3RVMA 4OMCA 4ALNA 4IDGA 1WB9A 1M6EX 3WY9A 1DGQA 3E53A 3MIZA 1E0SA 4EJ2A 3TD2A 1QX3A 1IONA 4M46A 3AOEC 3VU0A 2DUNA 4H31A 3A27A 3WMGA 1FNDA 1EP2B 2P8JA 3LBIA 9LDTA 4XSHA 2BGUA 4B09A 1Z3CA 1YBMA 1V8FA 3EVCA 4XVHA 1JAZA 2POQX 1C1DB 3A4NA 3TAUA 4D8UA 4L6IA 1O0CA 1CEYA 3LWDA 3GQVA 1T2UA 3PLRA 3R0QA 3RRYA 3X2EA 1OFTA 4LYJA 4DR1B 4PAQA 5ESXA 3MHTA 1K8XB 1RQRA 2IDKA 2WAOA 3NV7A 3Q5DA 1XVUA 4G65A 4H0NA 4QTXA 4D9NA 1M8GA 3V2UA 5HOQA 1WJGA 4Q7KA 1PE0A 3GAAA 5A1JA 4RD6A 2ZZKA 5IWCA 1U28A 4UM5A 4YJ3B 2PD4A 3WGMA 1AHHA 5T3UA 1ONOA 3R09A 3CURA 3HJNA 7REQB 4RFLA 2A0FA 3WA6A 3WL4A 4WXPA 1T3LA 4Z54A 1C9JA 5JJIA 3FR8A 5DHAA 1E1QA 3DOUA 4R3WA 3ORHA 1X1DA 1SMKA 3OQ1A 4FWBA 4D80A 4D25A 3M81A 2Z4TA 4HBGA 4RJ2A 1NE2A 3GP8A 3T7SA 5K8IA 3BD8A 4RZQA 4AW9A 5CDGA 2JFVA 5DMXA 1JFFB 4FD2A 4IGAA 5L3ZA 3M5CA 4LDQA 4EARA 1VHQA 1TZMA 3GD7A 2R1ZA 2FQXA 1IPEA 2J1LA 5I7RA 3GBVA 2D8AA 2V8BA 1M5TA 5JUWA 4OP3A 3VVMA 1MN6A 3FD8A 3LQFA 1R6DA 5ALYA 1Y1KE 4BE7B 4BU0A 1B93A 2R8XA 4NJEB 5D3MB 3JCZA 1TOAA 4E2YA 1V5FA 5A4KA 5SYAA 1KAQA 3CISA 4FWTA 1GAEO 1RAAA 1BVHA 4IXTA 3GIWA 5AW8A 3ET5A 4OFXA 5KYUB 2OCGA 2VBFA 1CXZA 2C84A 1TE2A 4UM9B 1ZD1A 4ML3A 5FF9A 4WLVA 2OYRA 3F8WA 4QX6A 5BMVB 3RHFA 2DJ5A 5BYJA 1X7WB 2FG5A 1LBQA 4GPIB 1ZGCA 3WZMA 4ZCMA 1ZU5A 4YUWA 1YE8A 2OV4A 4JL8A 3SZ3A 3C3XA 4KAFA 3NEJA 1TGVA 3N7UA 1QDLB 4HTFA 3KOZA 3EMVA 1UBSB 5LWQA 3S5JA 3HVKA 1KJZA 4FR0A 3IBGA 3KP1A 3ZHZA 1UKZA 3OWOA 1U0GA 2PLRA 2UUAB 2GN2A 4G85A 3MVEA 2BFDB 2QBYB 5HIAA 4P5DA 1D2MA 3OOSA 1PTKA 4R83A 3I5YA 2OB2A 3S2ZA 3BK1A 3WLHA 1ZUHA 2WG0A 3VM6A 2JHPA 3LIIA 3SJAA 1FDWA 4BVGA 3GROA 1TLTA 2LDXA 1JVSA 2RHCA 3OIWA 2R1TA 3B3FA 1HYBA 2WY2D 4JXKA 4XRGA 1X19A 5KOHB 5JD6A 1KMQA 4RTMA 1WUIS 4IJMA 1FMFA 3QZUA 4FFSA 4LXXA 3LQKA 4YPFA 2ZS7A 4XTRA 1X1TA 1KKUA 1KO5A 2AZTA 4PS0A 4WJKB 3ME5A 3V00A 1IRIA 3CZ4A 5B58C 3NRJA 5AXCA 3HC7A 1YS4A 3DBLB 1GZDA 2EFGA 1PL6A 1Z15A 2I5PO 2XB6A 1QO7A 3EYAA 3LVRE 4D3XA 5MN4A 2FXVA 2C31A 1F2TA 4O3MA 1KI2A 3GDHA 3MJCA 1XK7A 5J1SB 4JXXA 2JGNA 3STTA 4AX4A 4Y9SA 4XR4A 5BT8A 5HKOA 2Z4SA 3ACCA 4NU6A 3BG5A 5CEJA 3NP9A 1EEXB 3P52A 4FOTA 2CXTA 3MS2A 1WDMA 4JP3A 5JSQA 2VNSA 1GEEA 4CL2A 3BICA 2GTPA 2V7XA 4BS9A 1ADBA 3R3UA 1D04A 1Z7BA 2QLTA 1DT3A 3O4JA 5ALZA 3EEQA 1ZIOA 2HCTA 3DCYA 1WKVA 1BVRA 4PW0A 3Q0EA 1C7ZA 4U7DA 4NFYA 5ALUA 2DTXA 1T5DX 1RLUA 1R9GA 4OPMA 5F9MA 3UJHA 4R69A 5IJ0A 4UUPA 3RT9A 2F00A 3GRAA 2Y0EA 2B9EA 2X5OA 4HYTA 4M0MA 2VT6A 3TINA 5AVSA 1RHRA 2HXGA 3CW8X 2X0KA 4OP2A 4PSVA 2I22A 3RAJA 2RG7A 3AX6A 3KFLA 5EUQB 1NX6A 1FXWF 1WXQA 3DMYA 1SXQA 3L84A 3EULA 1EFRA 3SOPA 1QCZA 2GVNA 2IC5A 1GQOA 3BPSA 1QRDA 1IFXA 3HBLA 4RSMA 4HFRA 1QAMA 2RJNA 3FNIA 1BWPA 4KMMA 4ZYZA 2UZ1A 5JXGA 3JZMA 1RQNA 1VLJA 4I5DA 3ZXYA 3TL3A 1CRQA 5GY7A 3KLPX 3M1IA 1A7KA 4QDJA 3ZVNA 1PW7A 4RCZA 1I4TD 3CPEA 3UYLA 5J40A 4AMZA 1NF2A 3VU9B 5BPFA 4QJ4A 3T15A 2CCKA 1PZEA 1SXJD 1EHIA 4LZJA 2BMEA 1T5LA 3NYQA 4NY1A 2OLJA 1J7JA 3GLFB 3VNVA 1R8XA 5JDCC 3DZJA 2J3EA 1BTOA 1H3FA 3M6UA 3K6JA 3TD9A 3ZDYB 2BLNA 3ZY6A 5ADHA 1TC2A 1IG0A 3LKVA 3S68A 1U94A 1RT9A 5JNVA 2OAP1 4KFCA 2ZIZA 2AS0A 4FYXA 1EFDN 3OPVA 1JJBA 3DQPA 1DAKA 4K3VA 4L2IB 4PAWA 2Y66A 1G6KA 4I1VA 1K3FA 4I4NA 1MLDA 1IOWA 4IJQA 5AYVA 3RROA 5E2BA 3FHLA 1K2VN 5HM8A 2R47A 4WECA 3VHRA 4A10A 1AGXA 4X5OA 3CA8A 4WK0B 1EIZA 3JASB 5DO9A 2Z83A 1VGQA 5C5IA 1U3GA 1L5SA 1TF2A 1B0ZA 1O89A 3KOWA 4WFQA 3T9EA 1EDEA 2B1QA 2I6SA 1C1HA 2JI8A 4CCSA 1DIBA 1IHYA 1UDWA 2QNRA 4L8WB 1YZ3A 5ALFA 2UYHA 1FY2A 2W22A 4LV6A 1QYRA 4PX3A 4RACA 1KO1A 3T4PA 1ISGA 4K0RA 4Z4IA 1R5JA 2VRCD 4H60A 3HCBA 4L1KA 4X9XA 4XEUA 1Y37A 3L1JA 1IPFA 3WKEA 3WYAA 4V0ME 4B3BA 3MJHA 5K0JA 2IXTA 4GOMD 1QO9A 2G6BA 1K1EA 1T2AA 4EY5A 3RF7A 2XZLA 4JT9A 1NVKA 4N3BA 3LP8A 1A82A 5DTRA 2PS0A 1E8NA 3GUVA 2CVQA 1RBYA 2WHPA 2B1JA 3DGEC 1NULA 4UTPA 2Q5QA 3NWBA 1K8ZB 1YDMA 1KY5A 1JIQA 1ISHA 1TQHA 2H65A 2IWHA 1NYLA 1FLAA 1E4VA 3AR4A 3FI9A 1W0KD 4DV1B 3M1LA 2JK0A 4LRWA 4MMYB 4OHVA 2QPOA 5D8DA 3ADOA 3M6LA 1AS3A 2H1LA 4C88A 3PRJA 2AG5A 4LRTB 1PG2A 2JAPA 3REFA 3CZAA 1CUHA 3OEYA 5I8ZA 2HV8A 1UK6A 1CUJA 1PLJA 2FUEA 3DLPX 4AD8A 5AI5A 3EZYA 2V6FA 1UDRA 3OHMA 3AV3A 3GEPA 1L7AA 1CY7A 2I2WA 4DAEA 2LDBA 3HMKA 2WHXA 3Q7EA 5FTLA 2YQ4A 3RVPA 5CFRA 5LZ4A 2OHHA 4CZ2A 3AY7A 1NSYA 2P5TB 4U8GA 1OC4A 5F7OA 1I9CA 4PCVA 1N5LA 1UXHA 4LWPA 1WULS 3EPLA 3EXEA 4MB6A 2Q6OA 2IXEA 2C54A 1B8UA 3GX1A 3LUCA 3OFKA 5EP3A 5E8JA 4IZ6A 4FWIB 1P5FA 1L8QA 1A8QA 3E7WA 4PC1A 4OFZA 1WZCA 5EWLB 3ZWOA 3K8ZA 2PJRA 2DKNA 2G3YA 5C31A 1DWOA 2AF3C 4MGEA 3KFVA 4DMLA 3CO0S 3Q3JB 4OHKA 4Z2YA 2H0RA 2R79A 3KSAC 1P1HA 5FBLB 4X41A 1YBHA 3U3MA 1P2BA 1ZJJA 5I45A 1PJ8A 2W6ID 1EQUA 1ORTA 4OHFA 4WZBB 3U7EB 3DVAB 5BRNA 3NRBA 3WYDA 2CSUA 4EABA 2IL1A 1KH3A 4ZV7A 5HR5A 1WQ4A 3EY9A 3HP4A 3IQEA 1JEQB 2RHTA 2IY8A 1C50A 2Q3EA 3OQBA 3Q9SA 3KQTA 4FCCA 5ALVA 4CQMA 5G1NA 3ZE9A 3WSWA 2PZBA 3LGSA 3OBBA 1IUKA 2FWRA 1PT6A 3S8YA 3U4MA 1Q1EA 4O4IB 3KQHA 4ZGWA 3FGNA 1FMTA 1F12A 2PWAA 4MPJA 1MVLA 1JSZA 4GFDA 4DCCA 1K6IA 5DNDA 5J23A 4QEDA 2WLSA 1FSPA 2XXJA 4BJ3A 2B3DA 4G5GA 3BIFA 1KYVA 3VSEA 1A4UA 1QVRA 4O4HA 4WNYA 5CAEB 4YUAA 1XEWX 1KTIA 2JAWA 4R2WA 3ZN2A 1T9HA 2EKLA 5E6RB 2I9PA 5K3DA 1ONPA 1RTKA 4M83A 2VP5A 4RTJA 4DCNA 2BFWA 5MN5A 2COKA 1BS1A 2G0TA 3JTMA 2GS9A 3KS9A 4YACA 1OZHA 5AK4A 2R1UA 4TSRA 2XPCA 5JZBA 4YCNA 4DA4A 4CF5A 3SS9X 1FP1D 4A0RA 2EL9A 4RH1A 4ETNA 3GT4A 1MX3A 5I7EA 4DV6B 3MGCA 1IMOA 1X7ZA 4QU9A 1GGNA 3ML1A 4FFDA 1OLOA 3LXMA 4X61A 1F3OA 1EINA 1PVVA 2VJOA 3GP3A 4RMJA 4N5NA 2LR0A 1W25A 1GRNA 4C0AC 2GPJA 4V0LA 4F85A 1KTVA 1DQZA 3B1ZA 3D2CA 2JHFA 3JW8A 4WBSA 2VK2A 4BECA 4KBYA 3H11A 1Z07A 1TL7C 3VISA 4A8TA 4FW8A 4K6CA 3RYHB 3PQCA 4JZKA 1U3TA 1IB6A 3ZWKA 4HVTA 2UUOA 1NVMB 4EEXA 3QU7A 5I4KA 4KKVA 1UOEA 1HDZA 1QOZA 3UGTA 5DHUA 2NQTA 3U7JA 1CUAA 2MWMA 4OAQA 3AR6A 1WAMA 4BFTA 5B7PA 1O7JA 5JBNA 4AG3A 4DDHA 4DRXA 3NMUF 1XPUA 1XROA 4G0XA 3WWPA 3WMWA 4JUAA 1J0CA 2NZ8A 2IW3A 5CFZA 5AVTA 1PF7E 1JKXA 5GZ6A 3AUAA 5LQSA 3I2KA 1VPWA 3OJLA 1KMNA 1F60A 1N6HA 1ID8A 4Q66C 5F12A 4JDUA 1WCV1 2V4UA 5FUXA 5HDBB 4ROSA 5A04A 1NQOA 1VI5A 3BXGA 4NPHA 1CR1A 5FI3A 1JTFA 4BMSA 5LQKA 4XTCS 3HS3A 5KVQA 2F9MA 4EB6B 1ODCA 3VO9A 1L6IA 1R8YA 2VHQA 4C20A 3KOMA 2C1XA 4MPDA 3QJ5A 3AT1A 4CPDA 3LZCA 1HLPA 5AICA 5AUOB 1AX9A 2N46A 3BOSA 3U3ZA 1O2DA 1BU5A 2ATXA 3GC6A 2WFZA 3F3YA 5FO1A 2I67A 3GNSA 1PFQA 1HE1C 4U5XA 3VKVA 2WVAA 3UV7A 4WFIA 4LYGA 4YRTA 2AZ4A 3GLFA 2R3SA 1GTSA 3AEZA 2IEBA 3EEFA 3RJTA 3EC7A 5I7WA 1IVNA 1OKKA 3D6HA 3F71A 3FNBA 4B5KA 4QOEA 2RGGA 1YCHA 2PWZA 1YTLA 1Z6AA 4DQVA 4Z4GA 3MGBA 3T94A 3TLBA 2DPLA 4EVIA 2HPZA 3IMGA 4ND3A 4D9CA 4EHHA 1X1SA 1BVYF 1L5WA 5LYJA 2R7LA 3DO8A 1IBSA 1I2DA 1XALA 2IYEA 3OZWA 4MICA 3TPCA 3Q7RA 4MWEA 2ZPTX 3GAMA 4Y2QA 5TGTA 4NL4H 1MQ9A 1TJPB 1Z45A 2REQB 3GPDG 3CF4A 3TR6A 5KDOA 1F1BA 2X19A 3PUKA 1JIVA 4EW1A 4AYWA 2DHDA 1DMSA 2ZRGA 3C87A 5AI0A 2KQUA 4AYXA 4C05A 5K9ZA 2GAAA 4NNPA 4NHOA 4PSUA 3KJHA 4LN1A 4UARA 1U7XA 3WWZA 3E8SA 3R2JA 1G2PA 2ZCJA 4DFDA 1KFCB 4X7RA 3VTFA 1GGJA 1SWWA 1ZSVA 1F7VA 2O2YA 1M72A 2R96A 1UM9A 1EFRD 5T4FA 5I9LA 4CQLB 4CHGA 2GH1A 3TEMA 2GD0A 3QV2A 1ABBA 4NCAA 3CN7A 3JVVA 5K3FB 4HVCA 1NXVA 4N03A 1NW4A 4N40A 2I6GA 1EDBA 2ZXEA 3IP9A 4IH1A 4X84A 5F4BA 2O3TA 4KR9A 3BAFA 3TUIC 4BFCA 5EFZA 2DJIA 4CFZA 4CKEA 3C8MA 3O8DA 3AZPA 3V42A 1GRVA 1KDVA 2BMAA 2WP0A 1UXOA 3EHDA 4IGKA 4R16A 5DT9A 3FYUB 2Q9UA 3EQ9A 2GNAA 3VO2A 4KB5A 3UV6A 4PSDA 4PC7A 2Z5FA 4OHWA 1BHO1 2JD2A 5ENZA 3ZE7A 3ZH9B 3OZ7A 4BASA 5KZMB 4HS4A 5KPJA 2HA6A 4QGHA 2EJTA 2PX3A 1L1RA 2X8WA 1Q1NA 3G8DA 2GHTA 4M4SA 3SLGA 5EQDA 4MGKR 5L51A 5T67A 4H6WA 1HQYE 1E6EA 5IT4A 5K8JB 5K2MA 3KRTA 4REQA 5F76A 2V74B 1JU3A 1OX6A 1ZD4A 3EXFA 1A9XB 1YAHA 1SFRA 4UDYX 4YFVA 3IB6A 1GQQA 4R7GA 1YQ9A 3L7KA 5DM1A 2O23A 4IIJA 4LDPA 4Y1RA 1RFGE 2VJYA 1OBCA 3T1YB 4BNIA 5JZVA 2WF7A 2H1IA 3QX8A 3U3RA 1AKQA 1DHRA 4FZ5A 5DBOA 5I7VA 3OAAA 1LD3A 2QGZA 1L1QA 2VHZA 4YP6A 1ML3A 5FPKA 2XCSB 3WP1B 1YL6A 3BMNB 1IWPB 3AHDA 2QTNA 3AVYA 1C0IA 1L5RA 2QDKA 3WLQA 4CMAA 1KI9A 3ESXA 2A9FA 3UFXB 1SKYE 4KLCA 5E3JA 3SOZA 5AI4A 4I4TB 4R9VA 3SHTA 3PGVA 4GUAA 3E2MA 4F92B 5FYQA 2FZLA 2Z6QA 5MHTA 4U7TB 3AY6A 4DCJA 4NAUA 4ZJPA 3H7AA 2OAQ1 1HE8B 5KWIA 3ECSA 3OLXA 1WQ1R 3WFJA 3FPCA 5CT8A 2QRVA 4IXWA 1G5PA 3NEPX 1PNVA 3QE4A 3C3AA 4MI1A 4ND7A 4WFJA 1ZO8A 5JCOC 5KIAA 3K70C 1JR6A 3RVRA 3THSA 1US8A 3IQXA 2VAPA 2EERA 2G1UA 4OJQA 2Q2NA 2H2FA 3F9CA 3ABQB 1W96A 5K99A 3HQ4O 1A04A 1C30B 2R2AA 2WICA 3O8QB 4CKCB 2BZ0A 3COWA 4BB9A 5CNIA 4ZAWA 2WG2A 4YMVA 1OX4A 2BFBA 3A37A 3GQBA 1JDSA 1EJBA 3TCNA 1CR4A 1EUYA 1GO2A 2P4SA 3K0EA 4QC2A 4V24A 5LQMA 3UWMA 1U0EA 2K2WA 4IGIA 3SFVA 4CI9A 1O6ZA 2VP4A 1E0JA 3K8YA 1HNWB 1OX5A 2P2YA 2FN9A 1ZP6A 4R1TA 4TS9A 3UHPA 4AP5A 1T36A 4BNUA 5KYWA 1HH4A 3HY3A 1TEHA 4V1CI 4CMEA 1NC1A 3W3AH 3QX3A 3WTBA 3I3OA 3MS4A 2H9YA 2PGOA 3VV2A 5GM2A 1JE0A 3PNOA 4C4ZA 4C6TA 4DZZA 5B30A 2NU7B 1PZNA 2IHKA 3QPDA 4TVOA 4K3UA 4EM6A 3VYRB 4KYUA 1H22A 1XSEA 3IV9A 3OX1A 1A0OA 4IWNA 1SBTA 3L6EA 4JENA 4NH0A 4R6XA 4EGQA 1Q0ZA 1SGWA 2II6A 3PCTA 2O5RA 3VNQA 3WIVA 1VJ5A 2L42A 3AR9A 2LGJA 4OIMA 3PLAE 1EB8A 3GLIA 2OA0A 2PL9A 1VE6A 3K30A 3SM9A 5CD1A 2O2XA 3IPAA 5CXXA 2GN6A 4KLZA 2AXQA 4QUKA 5HXAA 2QRPA 4HDMA 3PXUA 4L27A 4TTRA 4ETWA 4M49A 5J4LA 2X5XA 2EEPA 3AUJB 2F67A 5I7AA 1XZAA 4UBOA 3DLAA 2VPWA 4U7WA 1C4WA 2HA7A 3M89A 1E96A 1Q1ZA 1H94A 1ZCAA 1SOWA 4AXXA 5JROA 3PGJA 3O90A 3ENVA 4OFWA 5HQ3B 1GARA 2GFQA 2HO5A 2VLIA 3OIGA 2J5BA 2X2EA 3S44A 2FK8A 2HIHA 3EG9B 3N0VA 1FSZA 1PHRA 2OVBA 3P9NA 3UWSA 2P3SA 2FMIA 1TJ5A 4Q37A 3RJZA 3DOFA 2SECE 3DLIA 4RVOA 2AFIE 2IIPA 3OWXA 2X0DA 4JV5B 4EI8A 3NVKI 5CJPA 1FNCA 4JYCA 5J9FA 3LIPA 3F6RA 2WMOB 3SDSA 3TK1A 3DB2A 3ZW9A 2G5TA 2MHCA 3TCKA 2AI2A 3P4UA 3A3PA 1WETA 4GGOA 1SWVA 2FY8A 1IAVA 3EXG1 3HKCB 1X9IA 2DGDA 3A1NA 5KKAA 5CB6A 5JHHB 2WU0A 4C5CA 2P5SA 4UNIA 1E9FA 4M89A 2AL7A 1JLLA 4A2CA 4RFSB 1DAPA 3CSSA 5J1TB 5HQJA 2M1XA 4ZV9A 1E1DA 3VBCA 4EHBA 4G8DA 5KYXA 1Z8NA 5ECGC 4BEVA 3D0QA 5ALIA 3WRXA 1FX1A 3C16C 4R1OA 3UKOA 1HXHA 3UG6A 5A0VA 1YHYA 1T2CA 3STHA 1QHNA 1T3GA 2NUBA 3NTUA 1XJ5A 4ZVVA 5B3JC 5F51A 4MRNA 3D8TA 3PPWA 2HQ1A 1RCFA 3HU2A 4PXSA 2D7JA 3EQ7A 2QTGA 3AXSA 1DEOA 2BHSA 3NDIA 2ID8A 2C3MA 4PZUA 1MA0A 2GOYA 4M1KA 1GCIA 4RJLA 2I4NA 3GEIA 3AKZA 4IDHA 3D3JA 4JVLA 4Q1CA 4KZKA 1Y5MA 4O0LA 1QUFA 3KLNA 5FTKA 3ZDQA 4HNSA 4JB2A 1E1RD 2C00A 5L3VA 1C7JA 1XQ9A 4QULA 2C3PA 3CTMA 2FZCA 4N5IX 5A5DA 4A6XA 3UB4A 4X3OA 4PYKA 4RENA 3G0HA 1RJEA 2QVZX 4HH3C 1TVKA 4PICA 4RLHA 1QNLA 4OATA 4JEIA 1OZ0A 3R8XA 3I34X 3GUHA 2BI8A 4ES6A 4A0SA 2R1TB 4GL2A 2TMDA 2WKQA 4J90A 5BQPA 1RP1A 3K94A 2PT6A 3E03A 4FT2A 4UVGA 2HU7A 3SQDA 3IQIX 2F59A 3LQ2A 5EINA 3JSXA 4MNTA 2BTQA 3SHWA 5GWXA 5EHGA 1TIPA 3DP7A 2QJFA 2Q3MA 4B4KA 4A36A 3ENZA 1BKSB 3BILA 4BQIA 3C5CA 3I05A 3FPGA 2EW2A 1WUYA 3G2OA 4F7DA 2HHHB 2HHJA 2DFNA 3UC9A 1P1RA 2O8EA 3WLTA 5B2EA 2CJWB 3FBWA 1NMZA 1WU8A 4HZUB 2HTFA 3ADCA 1S7GA 3CH4B 3CLVA 3GCXA 4ZT7A 5IJ9A 3LP6A 3H83A 2IXFA 4MS4A 5AJUA 3BHIA 3OP1A 3U44A 1E92A 521PA 3QWFA 4CLOB 3QEAZ 1KS2A 2I87A 2XQIA 4M9RA 3IUPA 1DX4A 4LQCA 2OB1A 1EWQA 4X6UA 3OQOA 3QHAA 1C0PA 1PR1A 3I6IA 2WUFA 4X0EA 4FFLA 1NMYA 4HEA1 3KXLA 1NOJA 4G5XA 4IFEA 4B47A 1E6KA 1YI8A 1N2BA 4BBZA 2NV0A 2WMYA 3C6BA 3ZHQA 1EX6A 1XWWA 1MRZA 4J3JA 3IODA 2O2EA 5HF9A 5CLFA 3P4XA 3U1TA 1SD1A 4RDIA 3WGLA 1C1YA 2I8CA 3AWDA 2YZNA 3AERB 3EXIA 4FC6A 2AG8A 1ZJ5A 1NR1A 3K8QA 4F12A 4M0EA 1NBMD 2C78A 2Q21A 2I33A 4NE9A 3JQBC 4AZVA 5KOJB 1WTCA 2PSJA 2I71A 4Q4AB 3DVQX 3W4JA 1Y8ZA 2CWDA 5JEDA 3LE8A 2HAEA 2VZLA 4IWXA 3MPUA 1M74A 1V26A 1DG3A 3ACDA 5H3HA 4A0QA 4DBLE 5JY6A 2HR1A 2XVYA 1T0UA 2NT3A 4LSGA 4I8XA 1ENYA 2FZKA 3D1LA 4JXZA 3CUSA 3I32A 2XBLA 3AM3A 4XEHA 1VMKA 1UFVA 3DF9A 3GJQA 2Z2JA 2FWNA 2O5EA 3CWZA 3H1PA 5FWYA 4TRMA 1ZJ6A 2HKIA 2ZS9A 5EHIA 2G1AA 5JYEA 1I7PA 1T35A 3BFJA 3TZKA 4V39A 5T41A 2OCXA 4HB0A 3F4LA 4YQZA 1G7TA 1RLMA 2GEUA 5DIZA 4BO9A 4DBVO 3WLSA 1O97D 3I92A 3WO1A 4CN9A 1ACMA 4L5JA 1VE5A 1SJ9A 1Z6YA 3A8TA 1HOTA 4MMXB 4WDRA 2OV2A 4KXNA 3UPTA 2YJ4A 3UAYA 3H97A 4FEYA 2NM0A 3RVSA 4BP9A 2W2MA 2C1ZA 1BD3A 2QZPA 2H1FA 3EQ8A 3SQOA 4BMNA 4E21A 3SLRA 3WYFA 3ZDRA 4PWZA 1VFNA 1Z6GA 4A92A 3OZVA 2YZ7A 1XZNA 3MOIA 3Q1KA 1K63A 3ZHSA 1TIKA 4QARA 3VPAA 4HP8A 2ERYA 1U5BA 3MSXA 1J8DA 4J3NA 3C2QA 1R8SA 4UBNA 1RFLA 3MWEB 1HV8A 4L0DA 1NVGA 1IZ8A 1R4NB 1E3WB 3DMHA 3IOYA 3IQGX 1G20B 3NEAA 4N0QA 4WK6A 3C70A 1EQAA 3LHSA 1JDBC 4IKEA 1ZW1A 5KTKA 2V6JA 3H1TA 2HLDD 3WNVA 3U6KA 4UMDA 3HP1A 4MIOA 3V2HA 3A2LA 4G6ZA 5KS2A 1A3CA 3TECE 2WTEA 4LTNA 3I42A 1SUFA 1TEZA 1DX6A 3EGEA 1ZEMA 4CCYA 1OH6A 1O8CA 1VP9A 3SEQA 3EZFA 5TGDA 4Z4EA 2VN8A 4US2R 2W11A 2GK7A 2GJ4A 2QTRA 1DJOA 4IRUB 1JDZA 3A9TA 4WLEA 4OBWA 1ZMOA 5EE0A 5AUQA 3RBZA 2JVIA 3A36A 4CKXA 1CLEA 2V9CA 3V1YA 3MAGA 4W5HA 2YQZA 1PJRA 1VIAA 1ZOSA 3HU3A 3MWLA 4O1MA 5D01A 3BDAA 3SR4A 1TCVA 4Q9JA 1DKNA 5E6RA 3ZZMA 4C4YA 1UMDA 4V0NA 1B8OA 2YJ3A 5JS2A 4TXHA 5BOSB 1KI8A 1E63A 3IYLW 3FFXA 1E89A 4G8BA 4JU8A 3VJKA 3QPUA 1TM7E 3DZDA 5FTJA 4EY8A 2P75A 1BEZA 4WN9A 1I3MA 5CVJA 5CFNA 1Q21A 5GV7A 2B25A 3CGGA 4FE7A 4RD3A 2P9CA 4HPJB 3AEXA 1RAIA 3BT7A 2Y4OA 4U7PB 3QI2A 3TIIA 1DOHA 4A8JA 3ZLUA 4G9BA 1AG9A 2ZBDA 4CQMB 4HAIA 3T5TA 4RBNA 3DAPA 3WLIA 2DFVA 3V9AA 4MB0A 5KUTA 2BEKA 1GV0A 3DCJA 4LXTA 5CT5A 3HR4A 4A6EA 3CR8A 4URZR 1KEWA 1NUQA 2ID9A 5TEWA 1U6IA 4GRDA 2GCOB 4KQEA 4LDAA 4LMAA 3KEMA 4H4EA 2IP2A 3RREA 1SQFA 1UCFA 4HLNA 2P65A 1D7OA 5LDGA 4CUZA 3DV9A 3VKUA 3N8GA 3M5WA 2B2XA 2ZETA 3NBXX 1F0PA 3PNVA 3KYBA 1AUXA 4CT0A 5JVDA 1E2GA 2FFAA 2VDRB 2WM8A 5K0ZA 1RMTA 5IABA 3QVTA 3LT2A 1OTHA 4JI7B 1C9KA 1M10A 3KKEA 1CJBA 3EDQA 1YS1X 2C1EA 3OEWA 1NQXA 3EVFA 1QIFA 3EXHB 3UCFA 2XXBA 4QOGA 4MEAA 1WO8A 2H48A 4M38A 4BVJA 2VTKA 1YJBA 4JJ4A 5LLSA 1KK3A 2XTJA 3A4MA 5AKLA 2H1SA 3RS2A 3V1LA 3IC5A 2ICAA 1MH9A 2NOAA 1XTSA 3JZFA 3O5AA 2M6RA 4FT4A 4GRIA 4ND8A 3CSDA 3RFTA 4M9CA 1FFGA 5TQ2B 4BRZA 5F3DA 1FYDA 2W2OA 1WMFA 2YC2C 3GVCA 3MB5A 4FFOA 5EA2A 4TV9F 2WP8J 2JA1A 5F7XA 1CJMA 2M9MA 1S4QA 2VQSA 4ZVLA 3TJRA 3AERA 3H4IA 2X0FA 3WHLA 3MQ2A 3BSSA 5M04A 3NG1A 3M3PA 3THXA 4OY3A 1YR1A 4PLYA 4GWKA 3P0IA 4MS3A 4NMHA 5I9TA 5HVNA 2CT8A 1BDIA 1BRTA 4R1QA 3KAJA 3AESA 2CK3A 3A6LA 2VG8A 1JZSA 1LSJA 2I2CA 2YMMA 2IWRA 5KJFA 2NX2A 1PK7A 1MDFA 5E7IA 1BWSA 1P2FA 4I2VA 4KODA 5GADl 1WCYA 1DAOA 2NTNA 2C20A 1QUEA 4OM7A 2H1HA 4HMQA 3WV5A 3HHPA 4JSTA 5HS4A 2IUSA 2IYPA 2YZGA 5EQJB 1H2FA 5CCXA 1C2YA 1TJ4A 1Y63A 3LXUX 3LQ1A 5KKNB 1QQBA 1P3DA 4C2BA 3I4LA 4ZVKA 4ZANA 4F91B 4X1IB 2UXCB 1FDOA 1QCDA 1QJ4A 5HDQA 2O3SA 4LJ7A 4OO3A 3U4GA 4FYIA 3CE9A 5KC8A 3T5CA 2VDKB 1XYVA 2ODEA 4ISBA 1IHUA 3P8ZA 3A11A 4AY6A 1JYEA 2C94A 4RDCA 3ZJ4A 1P8JA 5CRIA 4GP6A 2Z95A 2Z5VA 3ASZA 3GFRA 2EGHA 1X1AA 3KCNA 4NXMB 3ANMA 5AH0A 2P0EA 3VVCA 3TQOA 2F8TA 4WOKA 4EYQA 4IXDA 1D2AA 1ORVA 3GJ3A 1ZMRA 2DRIA 5EWJA 4C0WA 4PV7A 1QTQA 4K0KB 2DWCA 1VLZA 2A59A 2WYUA 2XVZA 2YMPA 3K20A 4FXPA 4G37A 3UJ6A 1H0RA 2FCRA 3QF4A 4JD5A 1CX9B 3S2SA 5I51A 1BS2A 2X0IA 3ND9A 4C04A 3KHUA 2I54A 2G72A 1PNOA 1PJ4A 1T3TA 3EYWA 3F9IA 4FR5A 4IJVA 3KSDO 2GZ2A 1OREA 1XNGA 3HXLA 1I1OA 1MNQA 1IXSB 2G1JA 4HKTA 5TVGA 5H0IA 3U81A 4BP3A 4DLBA 2VDJA 3UK2A 2BEJA 3VHXB 4RVFA 3LI2A 5LUBA 4WY2A 1ENOA 4MRVA 2GILA 1UFKA 1TTQB 2CLSA 2WYWA 2C5LA 3AF5A 3MGAA 4WVLA 1L4KA 1XL0A 4U5QA 3CBQA 4O4JA 3U6BA 1A8UA 1S2OA 2X4IA 3FHTA 4R40A 3QUCA 4IIEA 4ZT2A 5TSDA 3I6YA 3DMTA 1R4ZA 1BXRA 1Y0BA 2HV9A 3EIHA 3LU1A 3SX2A 3U4AA 3UPUA 2Y6VA 2ZUCA 2QB5A 1CKEA 1QB8A 4MQBA 1XMSA 2C2YA 5JCPA 1P75A 2YZ2A 4CETA 3UWKA 1RJDA 3P0JA 4OIFA 2FXIA 3DBOB 4D3SA 5E9WA 1DJLA 4HLQB 1P7VA 2IUEA 4EB8A 1SOVA 1MOQA 4RF5A 2WPDD 4OMDA 3LF2A 3IUEA 3QM1A 4U2BA 1R0ZA 2OM2A 5DNAA 1R9MA 1WUJS 4XQCA 3THXB 1VPEA 4ZV4A 3B3JA 4IZHA 4BBPA 1CJSA 4HNRA 1P7CA 2F1HA 5AKEA 4L6CA 3JX9A 3A2MA 1N3YA 4F46A 2C77A 1WMAA 2Z8YA 1KJNA 3ZI7A 1JU9A 1O0BA 2FDCA 2LBPA 1R0KA 1G3RA 3OCWA 3R0JA 4EG8A 3HB1A 3T1OA 3UA4A 4UC0A 4UCQA 1AUQA 3G49A 4GG1A 4HF7A 4BNKA 4AY2A 3NT5A 2HMTA 4B0OA 4B35A 3HL0A 2WBLC 2ZYDA 1ZZEA 1T9AA 2FPPB 5ADVA 4XLTA 4X8HA 1XZGA 4ZI7B 4JYAB 1JBEA 2WA1A 3B5IA 2IIBA 3FZQA 4EH1A 1Z5VA 2HRZA 5IAEA 5C4IA 3HGTA 3KZNA 4PZYA 2PUDA 2X22A 1DC4A 1SC4A 3DS8A 4H1UA 3N75A 2IX9A 5P8WA 4DIDA 4B2IA 3O7WA 5C8VA 4ZVMA 1BHSA 2P9YA 1N25A 3OMWA 4R2LA 4NOLA 1E3IA 5LMZA 2EXXA 3ACBA 2YJZA 3Q7TA 4ZQEA 1C3XA 1TW2A 3X3HA 8MHTA 3AJ8A 2D5AA 3J80A 5BN3B 1UPUA 1EE9A 2QJOA 5D87A 3ND5A 1S2DA 3IL2A 1Y81A 5CTJA 2Q62A 1JHXA 2VUUA 2VQDA 1S2LA 5EE3A 4TTVA 5EIHA 3H8SA 1SXGA 3QITA 4J8PA 4D9KA 4EHJA 1PEYA 1TUBA 3CUYA 1N7GA 4X71A 3ZBUA 1YO6A 1YQUA 3OZUA 3IAS1 2PT9A 1D6MA 3RWBA 4J07A 4HG2A 3RM3A 2JLWA 2CMHA 1QWOA 1BGXT 4BYMA 1WCIA 4KNWA 1XXLA 3UY4A 3RVNA 3OFJA 2ZJ2A 2YCLA 4CDNA 1M34A 2PZEA 4E07A 3LQRA 4E5MA 5AVJA 3WL5A 4BFUA 1YQQA 5LZ8A 5IK2D 4TKUA 4K46A 4CRWB 4H1WA 4MWZA 5BP7A 4KHPB 2RGXA 2O2SA 1YCGA 1KPIA 3SYMA 5A1TA 1XGKA 2CJPA 3C39A 3HM2A 4J0JA 4B6SA 1T6XA 2VNHA 3QVGA 5KMGA 1BSVA 1J2RA 2Z6UA 5DI9A 1GITA 1H8HA 1S4MA 4JHXA 5ERXA 4A03A 3W5AA 2M6KA 2AXEA 5JSZB 3AG6A 5EGNA 3EWAA 1NXSA 4ZEOA 2CDNA 2R751 1T36B 2G5CA 5KYWB 1YRHA 4FHEA 3WYBA 9ABPA 4WZAB 4YX9A 5EZQA 5DYTA 5KB3A 2PMWB 1ZOIA 3KQYA 2NXWA 1UANA 1XWFA 3S2IA 2O14A 4CUKA 2PMEA 2HIGA 4EJMA 5JZOA 2OXEA 4IOLA 2YV2A 3OY7A 2HD4A 5P21A 1UBMS 1V47A 4FYJA 1VG9B 3QELB 3F7MA 3MINB 4LRYA 5IUKC 4QM7A 1LSOA 4HC4A 3ENKA 1H6AA 3GLRA 5IKPA 2R25B 1NONA 4GC9A 4XGNA 1XIVA 1VSBA 1FEZA 3DL0A 4EBBA 3WLLA 5H68A 1J56A 2CXHA 1YZVA 1U3WA 3VNAA 2VYFA 3P96A 4OAOA 2GD6A 4HUJA 3UJDA 4F1KA 4Y2XA 1SVUA 2ILVA 2WKPA 5A3RA 5AIAA 3QP9A 5AM1A 3JYHA 1FYEA 4JYZA 4WCVA 3MF4A 3Q9UA 4K9NA 1ESDA 1CZNA 2C7PA 2D54A 1X14A 2QR3A 1UKEA 1RWQA 3A1FA 4KN9S 4EKIA 3TN7A 4RY9A 2RGAA 2ZB8A 3HR8A 2OVFA 2FLKA 2JGKA 4RL6A 3ZPXA 3IS3A 4XDHA 3WB0A 1MB2A 5GVRA 2QP3A 4UNRA 1CR2A 1U0NA 4WCFB 3SYLA 3EGWA 2JGDB 3TW6A 1TUIA 3EDRA 2IU0A 1E9AA 2JBWA 5BYKA 1I30A 5JEEA 4F6LA 4AMGA 1J5EB 3O8LA 3NVDA 1UBNA 3BXOA 3FJ1A 1F2DA 5EZYF 1MUUA 1CU1A 2HC9A 2O0MA 4KQ6A 1JSXA 1KK2A 1W29A 2X4DA 3VRHA 3T3OA 4EG3A 3HJTA 1NUUA 1LBTA 1NY6A 5L6LB 1XZDA 4DANA 1BE1A 3KHKA 1J1IA 3DOIA 3RUIA 3O2SB 4PINA 2V65A 4PO3X 1TTTA 4B0PA 4FCWA 2ZSHA 4P0TA 1FMLA 4Y0AA 3CIOA 4BC1A 3UWDA 7ABPA 1RRPA 3UM9A 1C29B 2PSFA 3M4ZA 1JYFA 2AK3A 3RSQA 1KMMA 1TMKA 2OQVA 4X44A 3ICQB 4RIEA 1E8DA 2Z57A 1ZNWA 4LPKA 1ATZA 3FW1A 1XQXA 2JS7A 4M0FA 5EL0A 1ZN8A 1ZWLA 2BKXA 2Q3DA 4LECA 4D8XA 1GFZA 1OI2A 1TT5B 4R1UA 4NFHA 3O3NB 4Y7CA 5C5EA 1VRVA 2EFCB 3LHKA 5T4HA 3LY9A 2ZJYA 4BYGA 3QWHA 1S8FA 3KPWA 4GZ3A 1PR2A 4CBVA 4DMKA 3BMQB 1TC1A 3R3WA 3BRWD 4AO7A 1FRNA 1KYIA 1MF7A 3GLSA 3LOUA 4KUGA 4I4TF 1V2HE 4DKXA 3H9CA 2PZ8A 5PNTA 5D1HA 4A8PA 1GKIA 1RYMA 3R0IA 1UXGA 1W35A 4YVFA 1OXXK 5JDIC 3GA5A 1KHHA 4GBMA 1EM6A 4A73A 2A30A 5ALGA 1LDNA 4MKRA 5LKAA 3BE6A 1DX9A 2X0JA 2ZBPA 3QOWA 2NU6B 4DLTA 2XE4A 4HX5A 4U6QA 1USUA 4CW7A 2VTBB 2IKQA 2Q7XA 4P4UA 1B7GO 1JT9A 1WXIA 1VKOA 2BC9A 2AW3A 1UJ4A 2F4NA 1KF0A 2OXFA 2J3LA 2P3QA 3EFBA 2RBEA 4P36A 4QDUA 2IITA 3IULA 4RHCA 5CIQA 1FDTA 3D8RA 4FGLA 5B3JA 3U40A 2LKCA 2H4WA 3ZLTA 1IN1A 3RFXA 1E6LA 2Q45A 1Y1LA 3HVUA 3O95A 4FQ7A 1KK0A 1BW9A 3JAKB 3U9SA 1GDHA 5IULC 2H29A 4ZYYA 5BN3A 2VSXA 5FORA 1Q1AA 3VNRA 1B0PA 3ZQKA 1Z56C 3WMXA 2L69A 1GQ2A 1ZMTA 2HBZA 3X1MA 1RI2A 3G2HA 2ZTLA 2P3OA 4G25A 5LZ7A 4DQXA 4B3TB 1ISRA 2XZDA 3HB9A 13PKA 3G6KA 1B3RA 2DB3A 1Z5PA 3WAKA 4DDMA 4AO8A 2OYSA 1PHPA 4DY6A 1A95A 3B52X 1DB3A 2BH2A 4GLJA 3BE4A 4YUVA 4C0QC 4LMBA 3AEUB 1VE7A 1XQ1A 7REQA 2MJLA 3QXXA 1GG8A 4Q47A 4RH0A 5C1OA 4E14A 2HA0A 1UODA 2X8LA 2BR4A 2Y76A 1DZ3A 3BTUA 1CQJA 3LT1A 3DJFA 4NFSA 3STXA 4BKPA 2F3UA 3D6FA 2P41A 4ZO6A 3RG2A 2O8BA 2VZ9A 2V7WA 1BXGB 4WRRA 3TB6A 3JYPA 5H9WA 2VHUA 4GMXA 1H5QA 1FJHA 2QN6A 3RU3A 1YI0A 4DREA 5JATA 5JI2E 1AKWA 4OK3A 1EWVA 1UWLA 2NYVA 2EZ4A 2ZWPA 3AFOA 2HPVA 4NNJA 4QPJC 3ROPA 5AVYA 2HF7A 1U90A 1THTA 1J09A 2NACA 2IPXA 4V2UA 1ECCA 3HDJA 1G60A 3LJKA 4U2CA 3NKFA 3S28A 2XDQA 1SR8A 1DVRA 3I0NA 4EYKA 2H5IA 5DGHA 4CKWB 4DS3A 2NU8B 4ZO7A 4NBSA 2B34A 4Q9DA 2GETA 5AKZA 2PGJA 4UHKA 2JFGA 5TT0A 2WYIA 5ULLA 3S2FA 4B3GA 1JLLB 1NF9A 4G01B 3S5UA 1EFCA 2B99A 2IYLD 1Q0RA 2WWHA 1F38A 3KOUA 2ONJA 1EZ1A 2D3TA 3QPBA 3KQKA 3RU7A 3F0TA 5GMOA 4U7JA 5JZMA 1LLDA 4IXNA 1G291 3ESCA 3WRWA 4OLHA 4YT4A 1QHFA 3I5MA 3FOCA 1N2GA 4X1OA 3IBYA 5C2JB 1TZ2A 2ZZNA 3IVMA 3MK31 4CM3A 1LZLA 2ZUFA 3FCUB 3MNFA 3MJRA 4TKMA 4B48A 3PKZA 1Z7GA 2FZGA 2PYDA 3T4XA 3KQNA 3ZV7A 2AWNA 2ERCA 5A3JA 1SBIA 1RCTE 4D3FA 1Z7WA 4AS2A 3FPLA 4ZAZA 4MAFA 1LK7A 1LA2A 4HQ6A 3TQCA 1G20E 4UVEA 1L7MA 1V1MB 2GCEA 4URUR 4XCVA 3L4JA 2ZBGA 3DHNA 3LVQE 1PK9A 2BGMA 1KETA 3WJ2A 1SN7A 1FUKA 5J2TA 4G41A 1NW7A 3U9LA 4YR7A 3I1JA 1FYFA 4NU5A 4D1YA 1JFTA 2I1LA 1CDDA 2ZRQA 5FL3A 3W5HA 4AG5A 1E60A 5JD3A 1PV4A 2BGNA 3CO5A 4HZUA 3HR7A 4H08A 3CUEF 5KDLA 1BOOA 4HDRA 4P84A 3LCCA 4CG0A 2NG1A 4KR3A 2B8JA 2C9CA 2DBZA 2W90A 4OQFA 4UBLA 1HZJA 3UB3A 5CB4A 2SKCA 1X1RA 4TLAA 3U39A 1LI4A 1XZMA 4KDFA 3GCZA 3L7CA 5B64A 5FTMA 3M4XA 2KYRA 4Q4LA 3TG8A 4L8FA 3NYWA 5BSMA 1MTOA 1SBHA 2X3YA 1ISFA 2RHWA 4A4DA 3NNSA 1I5OA 1SUCA 4K7JA 1FVHA 1AF4A 2RB4A 3SF0A 2JI6A 2C5FA 2ZSKA 3ZU5A 1KEPA 3QLTA 3EIEA 3G2LA 5M7EA 1SEVA 1ZCZA 3E35A 5ISMA 1RRFA 4W5TA 1HL7A 3O8BA 4ZP1A 2F1OA 1O6BA 2Q1WA 4LRQA 3OVMA 5K7SA 4DA7A 1WG8A 2PKXA 3OC0A 3R0VA 1CULC 4I7EA 2X6RA 4H3SA 1NQTA 2CXXA 1Y1SA 1P4RA 2IRWA 2OD7A 2PS1A 3FZGA 3PSHA 4ZCQA 3NKLA 1N2JA 1M2VA 4MUKA 4B1FA 4ZJYA 3GMDA 2XV1A 1U0JA 4H77A 4NBLA 2FPOA 5GZ1A 2FX2A 3NAZA 5TV2A 3LX8A 3RW9A 4MITA 2IF2A 1XTKA 3H2YA 3NONA 3J7TA 3V7UA 3UBMA 3FCYA 3LLMA 4DV4B 3IUBA 5F78A 2R6DA 3LRPA 4DKJA 4RKEA 5A62A 3KPJA 2NQ2C 4MRSA 1KYYA 1V37A 1G8PA 2QMYA 1NJSA 3BMNA 2OCDA 4LGYA 3CF6R 5JNRA 1FDIA 1MO4A 5IM4F 4M88A 3PD7A 5EUCA 2WMDA 3T1NA 4AIRA 3IAM1 4GP9A 5EFOA 5LXTF 1EUCB 4Y1EA 1SHLA 3CFYA 2P2DA 4H1VA 1IQRA 4KO2S 4WEQA 1UJBA 2YNMD 3IDOA 4RA9A 3MIIA 3EGIA 3UENA 4AKSA 2ZI5A 4Q01A 3DE5X 2RMKA 2X7JA 1DLIA 3MQFA 4NYIQ 5G1OA 3J81A 1CZKA 1M75A 3ZHUA 2JJMA 1DJPA 3FKJA 4RGYA 1ORWA 2DFLA 1LB1B 3NTRA 2W43A 4N8SA 5IBCA 4M9XA 5BSFA 2UVPA 4C5BA 1KZ1A 2J3JA 4EA8A 2R4TA 3PTAA 2FW1A 4B6JA 3ZXXA 4J4TA 4L8LA 1FTWA 1DXHA 2YJ5A 2E4YA 5C53B 4A0HA 5C3UA 2XNDA 3I2FA 1NBIA 3CCBA 3O93A 3WLFA 4TS3A 1QPGA 3VC1A 1I3KA 4JBYA 2GEFA 1KWGA 1JEDA 2HRQA 2RAFA 1ZG3A 2VDUE 1C9EA 4N5LA 3TFQA 2GO1A 1X1BA 1MABA 1F48A 1VLHA 1IHOA 2OGUA 1XD2B 5DHPA 5DHFA 5IX8A 3TF5A 4O4IF 1N6KA 4GGMX 4J91A 4D7AA 3TDNA 4NSNA 3FJOA 3JPYA 4JR1A 5JCZA 1V6AA 5JW6A 5L53A 4H3VA 3TM5A 1R0CA 2HCFA 2KPOA 3WDMA 1WKBA 3EZ7A 5TMDA 1VB3A 3L4SO 4MB2A 2I55A 2XB2A 1RYNA 1Z8FA 3H8VA 4S1NA 4TS1A 5LJIA 3B51X 5ALPA 3T7JA 2QTTA 4HCJA 1DQYA 3V7YA 4ZJZA 1NPDA 2NV6A 1SVIA 4ZVUA 3GJ4A 3G2IA 1GPJA 5DEIA 2GKOA 4J7UA 3D0KA 4JVOA 3QE2A 5AVUA 3AP1A 5AOVA 2OR3A 3D1JA 1TM3E 1NRIA 3H7IA 1UP4A 3RUPA 3VI3B 2C4UA 2AHOA 2PDAA 1QG4A 3RC9A 5DNUA 1LJLA 3MBKA 3K9QO 2HA5A 5CJJA 3CX3A 4BJHB 4ZGBA 1GNTA 1YK1A 1PBTA 3NV9A 2HJ9A 2I76A 2CFCA 4HB4A 1LI7A 5K1ZA 5EHXA 5CLIA 4FCTA 2GYUA 1N0WA 4IIVA 5HCNA 2R7AA 3UCXA 4CMKA 1TGYA 3JQEA 2DC1A 1HM5A 3V7WA 4P9NA 4YCCA 5LLDA 4WERA 4Q93A 3KVRA 3UUWA 3SVTA 3YASA 3CE6A 3EVBA 5AFSA 5CDSA 3RSZA 1V1MA 5F7ZA 5AIBA 2ES4A 3DPSA 5IW8A 1FFAA 1G7SA 4WMLA 5FL7D 1OLUA 5DCUA 4MRAA 5G3YA 2N75A 1JILA 3RSLA 1IY1A 3AINA 4YV7A 1Q0TA 1YVPA 3B85A 1WMBA 3FM9A 3KL4A 3V4ZA 5TLSA 5AXDA 1KRHA 3L8DA 1F5NA 1EHYA 4RX1A 1MDBA 1DUSA 3V1NA 1XZQA 3N8KA 4BNWA 4JBLA 1I33A 4LYYA 1G38A 5HFJA 1U3FA 3KE9A 4IFBA 3ZGZA 2NMVA 4BZXA 5KWJA 4KR7A 3TXYA 1J9EA 1Q7TA 2Z08A 3ZBTA 4C5AA 3BQMB 3P9XA 4C43A 3GLGE 2I4OA 3AR7A 1CP3A 2E37A 5FBHA 2CLDX 2FFRA 2ZROA 4P2BA 1PDWA 2WFLB 1K98A 3BWEA 1ZVJA 2AE2A 5HF8A 4NZZA 3O6VA 1I3LA 2IGBA 2ONKA 2ZI7A 2OG2A 3AUSA 3Q3VA 4UATA 3WXBA 4FNAA 1DAGA 1P9NA 1JALA 1VYUA 1I10A 3DXXA 3ZC3A 3DH0A 2JANA 2HK8A 1XLTA 3PSAA 4I5EA 2OO3A 1JJAA 1ZRHA 3QKIA 1IK6A 1UEIA 2C2OA 4IHJA 4Z1OA 1C41A 4C0XA 1T4DA 3UH0A 3TPFA 2QKYA 4BQEA 3ZHTA 3C48A 4HQ0A 2DWUA 1V9LA 3E4CA 2Q6IA 4BMCA 4NVRA 5DWDA 1SUDA 1QVVA 1YT5A 3IDZA 4JKIA 4HDNA 4ZVPA 1ZQ9A 1FQOA 4J2OA 4F72A 2YV1A 3FCAA 3I9V6 1N5IA 6CHYA 1VYHA 1EFUA 2GCNA 1CUCA 1MB3A 1O5TA 1UBGA 2W7TA 5CB4F 3PXXA 1A72A 5CNKA 3FOFC 3GFFA 4NEGA 2OCAA 2DWPA 1R1DA 1HO3A 4FJ1A 1BS9A 3NETA 1JFSA 3FA2A 2GPNA 4GC5A 4HS9A 3D8NA 3AHIA 3LAWA 4RKFA 2ZUUA 1IN4A 1W0KA 3GRZA 2B6HA 3PIRA 5CVUA 2VTBA 1GYRA 1JUDA 1K0FA 1OGIA 2XCLA 1JYSA 1XWIA 3PFFA 4D98A 1FNNA 3E6AA 1A8SA 1EYZA 4PGFA 4ZXFA 4CIAA 3DMRA 5A3SA 3OLWA 1NVTA 1TJ3A 1XZBA 4DNPA 1DFIA 2Y1WA 1JHOA 3RS0A 2ZUDA 3ROMA 1PSZA 1LPOA 2RH9B 1NJ2A 1U11A 4J49A 4QKQA 1EFKA 2GM5A 3CKMA 1IHXA 5ARDA 5K51A 4DUZB 3GB9A 1CUXA 2QQ5A 2E1PA 3B2QA 1T9BA 4WBNA 3OFND 4Q3AA 3DE7X 3X1XA 3ORRA 4RVUA 4AWXA 3MLAA 1T2NA 3WKBA 2I7TA 2Q29A 2XEDA 2FOIA 1YC2A 3K1TA 4PWYA 4EEZA 1DAHA 1ZMBA 2QMEA 2HUNA 3NORA 4BLQA 2B0JA 1GU7A 1LNZA 1N2SA 1VXOA 4M9ZA 3ZGOA 1Z2CA 1LVGA 3AM4A 2Q8PA 4XJVA 5IM4A 1PAUA 3PQ7A 4J29A 3FPJA 4I6EA 5AI6A 2HBQA 5JO9A 4D9JA 1X42A 5INTA 2GHQA 4XWTA 1SC1A 2ORWA 1O08A 3CLKA 4J1TC 1G21A 1QKJA 1SOUA 3KL2A 1GZ4A 4EAAA 1C3JA 3B2EA 4P3PA 4ARUA 1RJWA 1K66A 4TTTS 4OJKA 3FSGA 4YMIA 1BKDR 3TMKA 4RK5A 2CV0A 4L3OA 5HUQA 4JQSA 4KV7A 3W9YA 4DSNA 3ER9A 2OFOA 1I1QB 1KPGA 1BDMA 1W46A 3PQ8A 5CYGA 1ZK1A 3IA7A 1U8FO 3FSRA 3KJNA 4EFDA 3OECA 4ENUA 3UUGA 4D96A 5JG7A 5A5EA 1WY7A 1UINA 3OE1A 4OLFA 1QHXA 1P31A 1R0YA 3ZCQA 4BP8A 1RYZA 1OZFA 2IZ1A 1MO5A 3ETHA 2QZSA 4BO6A 3S7TA 2IYQA 2PZAA 2Q4EA 3NIDB 4L3VA 3RRZA 5IAKA 1LEHA 2ZRIA 3VMFA 5HYVA 3L0IB 1VA5A 1ENZA 5H8WA 5F9FA 4I1YA 1GFIA 2OV1A 3BCUA 3GH1A 2AZMA 4QFMA 4UXJA 5CM9C 2A3NA 3RVJA 2ZITA 1E0KA 1QZTA 1WM1A 4Q9KA 5CDFA 3VKHA 5IAGA 4EHKA 1NFRA 3W5UA 1XDBA 1Y3AA 1K92A 3F9RA 4LAFA 4DA8A 2EFEB 4MW0A 3DEKA 2X8JB 2WYHA 3EF3A 4PGHA 4N8EA 3EF1A 1EVEA 1ABEA 1HE4A 4CTMA 4GKKB 1N75A 2UUPA 4RZ3A 5LB4A 4Z51A 1XLUA 3N5CA 4JLUA 2AGVA 4C01A 2B83A 3P9SA 3SC2B 4L9SA 2K6GA 3QOYA 1Z0JA 5DJ5A 3GDOA 4DY4A 1KI3A 4NCHA 4BX9A 4YRKA 3MTQA 4K6HA 2JAUA 4M86A 4NZPA 4PVCA 1HE2A 5E2IA 4RVGA 4AN4A 2P68A 4R1SA 2K5UA 4D4IA 1LPNA 1NOIA 3E5MA 4MRPA 4MVYA 3EHEA 2QZ9A 1MPTA 1U2ZA 5LP6B 3SXUA 5I3CA 2RB5A 2JLAA 1PT8A 4PU0A 4FEAA 1EM8B 5FWYB 2XE7A 1FLNA 2PEYA 2H63A 3IQZA 1GSHA 4Y6RA 1ZOOA 1NJ1A 2C5GA 5A6SA 5CK4A 4BZWA 3GLFE 4PPYA 4IVRA 3HACA 1P4HA 3DEFA 4W63A 1SBZA 4ILKA 2YY6A 1SURA 4N12A 1K5GA 3P2KA 1NLMA 3C15C 1YASA 3E1KA 5LQAA 3TDMA 3O2NA 3DZHA 2JD1A 2XWBF 3RTAA 4EECA 1EESA 3TQRA 1BNCA 2P0AA 2X40A 3AKEA 3WOHA 2DULA 5HG0A 1B8NA 2E0IA 3BC1A 3W8NA 5CFPA 5GPBA 4I5IA 2A1IA 5AVZA 2P40A 2X1HA 1TAGA 3PQFA 3V5NA 1T1SA 4OI2A 2FJUA 2OPHA 3U7FB 5FQNA 1WY5A 2P4HX 3DTVD 2QV0A 4MKIA 2A6PA 3CLTC 3OD5A 1YJ5A 1XZ8A 4RIIA 1G7RA 4I1IA 2CVPA 3JARB 3QPAA 4OU5A 5GM1A 1NVVR 3KLBA 2X1MA 1DDIA 1JN0A 2AC4A 4NDNE 5JV5A 1YDHA 2CJYA 3F74A 1WDTA 1ZH0A 4JR2A 1Y5LA 4Q3DA 1M34B 2VWHA 1CYEA 4F6RB 2OM6A 4BNJA 1M0WA 2IODA 1G8HA 4RMHA 3MUOA 1SCQA 2RAVA 1GCAA 4PPNA 1LNSA 821PA 2C4HA 5DOVA 3QV1A 5A9SA 5LQRA 3NVAA 2C7VA 2XDQB 1OWOA 4I66A 5WRFA 3A6ZA 1UBRS 1P81A 3RJMA 3DDCA 1YOBA 3DG9A 1KZHA 3VC2A 2NUTA 1RQXA 5E3HA 1QYIA 4E70A 4Z4FA 3DMGA 1ODSA 4PGGA 2SICE 4HD8A 3D5TA 5IWAB 1CIPA 1NFQA 2EKDA 2Q1TA 4J1SA 4ZVNA 2P62A 1KDRA 1K97A 4EF6A 3AHHA 3F1LA 3LOPA 4GBED 2CVFA 4F3YA 1RC0A 4ZOLB 4P58A 1B8VA 2BH9A 1EE1A 4XDYA 4P7FA 1NW3A 1B00A 2QTWB 4YAJA 3ZNPA 3RUEA 4YI3A 4B33A 4E88A 2IYAA 1LY1A 3DMFA 4INPA 1SKUA 2R6GA 5LPNA 1ULTA 3H2GA 3WKDA 2HSGA 3EY4A 4PZAA 3ZKAA 4AO6A 4B4UA 4K9MA 3LY8A 4XOUA 4D43A 1HLDA 4E2ZA 4ARZA 3SQNA 4BFWA 1T4MA 1KSHA 3HP7A 1L5HB 2NADA 1CVIA 1II0A 3TLZA 4TKLA 3MTAA 1XU4A 4PE5B 4DA6A 2VYQA 4MKGA 3WWYA 1AIPA 1KZ6A 4BKMA 4DUPA 2XZOA 1U2PA 2BUBA 2BL4A 1NUHA 1OFVA 1T5HX 2OBMA 3A2NA 2YVKA 1DKPA 4B40A 1WHSA 2EBUA 4Q4CA 3FMFA 3HZOA 1NRWA 1RI5A 2DBRA 5IP5A 3B48A 1KYZA 2Z2XA 1TF7A 2HSZA 2CZGA 4MYUA 2ZIEA 4GNRA 4MO9A 4ZEWA 4Z6KA 1YTUA 2VJDA 2J5RA 2ENWA 3HY6A 2RI1A 2OE2A 3NT2A 4ND5A 4NNOA 1G5IA 1LQ2A 3K7EA 5DBEX 5C3MA 3KLMX 5AVQA 4P35A 4TLLB 4OQPA 1FLVA 1QTNA 4G5YA 1RIFA 1JVNA 4KLRA 5CP8A 3RSCA 4AP9A 4EKNB 2C5EA 4LIPD 2A58A 2IQ5A 4I50B 3O38A 1QO0D 2XGOA 1YAJA 3BHNA 1PR3A 3PDWA 4G4SO 4UFPA 5C8YB 5ILGA 4MWBA 5CX1B 1P5RA 4YHHB 2IS1A 2JARA 2NTJA 4KVGA 4K1XA 1R0XA 4E46A 4JVMA 2VUTA 1NNSA 1WUKS 2UVDA 2YYAA 1KQNA 2CY0A 4FB5A 4DDUA 4DEXA 4AI6A 3L8FA 1IEVA 3QMVA 1XDUA 3FCSB 3OCUA 3DBHB 2OUIA 2FF5A 3QE0A 4FSHA 4IKOA 3UMRA 4BIIA 3KJEA 2FDXA 4LFCB 3VHXA 1HLFA 3HBJA 2BM9A 3PDJA 4KLAA 4CKEB 1AO3A 1ESCA 1NBME 2WIFA 3H6KA 1XTPA 3L41A 2JB9A 1NTRA 2IV2X 4M8NE 3GJZA 3KBBA 3O4GA 1PGQA 4HTFB 2OAEA 3QVKA 4HXGA 4E13A 5L3QB 1JKFA 2VJAA 5A9SB 2CE7A 3RTDA 2E4AA 1L4YA 3I9KA 1F0KA 4TXLA 4CLRA 3BTSA 4LK3A 3IIEA 3GDFA 3DT8A 4XIJA 1YRAA 5EZYB 3RANA 1I5RA 5HS6A 5CURA 1XJWA 3LO8A 1U99A 1RLIA 4K1LA 4ZRDA 5EPOA 4ZI5A 1D9ZA 1Y3HA 4EFNA 4ZEMA 2NYRA 2VI5A 4DADA 4LVOA 4NZNA 4IIJF 2I9KA 1Q19A 2I8LA 1QC5A 1XLTC 2NXJA 2X6QA 4JUCA 3HA3A 3DOCA 3TR5A 4L9WA 3KVOA 2WZDA 3CF2A 2Q9BA 4LTDA 4EFKA 3T8YA 4QSMA 1N0IA 5F5LA 3JD2A 3KAKA 4ND4A 5A5GA 1E9RA 2WWFA 3D3NA 2WQ7A 4ZT4A 1NKSA 1J2TA 1PLKA 1P6QA 1F2UB 2CXSA 4X1IA 1I2MA 5KCMA 2BFFA 1NVBA 4XB2A 1JFVA 3D5EA 3W8RA 1Y5NA 3TLCA 1P1IA 3F4BA 1FTQA 3B1WA 3K2EA 2XHEA 4B8WA 3HZRA 3KOXA 3A6KA 4Y2GA 1BEUB 2C42A 3K2BA 4U7GA 3TCXB 1KDYA 2QF7A 5AI9A 3WIDA 3ZU4A 3LPLA 3UTCA 2BZSA 1GN8A 1NN3A 2WJIA 2PRSA 4CU2A 3H9QA 1NMEA 4YDRA 5EHNA 2YHUA 3ILXA 3QMPA 4BVKA 3FTCA 5AW7A 4EOGA 5KOIA 4ACBA 3IHKA 3WHPA 2Z09A 3DM5A 1SPBS 3PR1A 4G0MA 5I7OA 3H2JA 3HSSA 1T1RA 3H19A 3AF1A 4CL0A 2I8AA 2VNJA 4QQKA 1JA9A 1GOTA 3FDXA 5UKDA 2X6TA 4GXRA 5EESA 3D8SA 2WJYA 2CF5A 5K3CA 1SCIA 3Q3EA 5J4KA 2RKOA 2PR7A 4D45A 1NNUA 3RADC 3FSEA 3QG5A 3N07A 4BCBA 4O1IA 2RHJA 1VG0B 2PZJA 4RPJA 3O8QA 4X91A 5GGXA 3UQZA 3E22A 4JGGA 5JNTA 3EVTA 2Z1MA 3FYHA 2GVDC 3JVIA 1R6BX 2DT5A 2QN3A 1S3GA 2IS6A 2VDLB 3MRSA 4G26A 3DCIA 5BSEA 2OGWA 4M0KA 2R1VB 3P9RA 2HGZA 2DFPA 4CM6A 4BO5A 3O82A 2FSFA 1GPKA 5A9RA 3VH3A 1L4NA 1FP7A 2GQ0A 1EAYA 5DSZA 2OXIA 4TKUB 3D6JA 3S1SA 1M5RA 2QL9A 4H7JA 2QTZA 3PVCA 1IJEA 1SUAA 3ZWNA 5IXSA 1PJAA 2WC1A 4FPXA 1IZ7A 1DKOA 2AMFA 2HA2A 3E70C 4MS4B 3QKUA 5COAA 1TMOA 2Q0QA 2QMQA 4TTIA 2FW9A 4OYHA 1BMTA 2DY1A 4KO3S 4TYWA 1U04A 2PH3A 3GNQA 2YWXA 1FS5A 1XMXA 4X63A 4WKCA 3HO8A 2B4RO 3PVSA 3V8PA 3AC0A 4E4YA 1Y48E 2YV4A 3CT6A 4XASA 5JSFA 2KHZA 2ECQA 3TGWA 3WK5A 2PKWA 4JYPA 4KXQA 1R74A 1KVSA 2UV8A 1PX0A 3PF8A 5J5CA 2ZFUA 2FHPA 3CCFA 3MLBA 4L9RA 4AKGA 3QVUA 3TGLA 3FRHA 1KQ3A 3PDCA 4M55A 4MQLA 3O1IC 5T4EA 5K8VA 3A6DA 2OL4A 3TOZA 3VPDA 2VDPB 3OPYB 4GKVA 2QP9X 1PEKE 3RD5A 2QN7A 1X7YA 4BN5A 2YXPX 1Y7PA 3I2JA 1PV2A 3WP0A 3HCPA 1Q0PA 2AJLI 2J33A 2G6TA 1C3OA 1GQYA 3RUFA 1BX3A 3OLVA 4TRRA 5IG2A 2ECOA 4YP1A 3DMTC 1T25A 2GDZA 4HLUC 3ZG6A 4LF6B 3QXHA 1I4OA 4LJSA 3SSMA 3DCNA 4XYLA 4QAJA 2ZRHA 4IIGA 2XKKA 4MUBA 1VJDA 1U0SY 3ETCA 5EKXA 5DF1A 5H4HA 1I0ZA 4WXHA 2F4VB 2P6MA 1RBMA 1FMCA 4DXAA 3MBOA 4H0CA 1LPBB 4LXQA 5NULA 2CV1A 1BJKA 1WCXA 3JQPA 5HF5A 5BUQA 1XPOA 5E1OA 4WD3A 4GMFA 4HDKB 2QUIA 2K4MA 3LF1A 3N8NA 4IJ5A 1QTRA 5A7FA 2AI1A 2R8ZA 3SYTA 3EJ6A 1JTVA 4MKXA 5E1MA 4C7MA 4J16C 3IE0A 2WR8A 4UE6A 2QIOA 3D3QA 2GN0A 2JZNA 3BN3A 4ZMBA 4JUDX 5FLKA 1W36D 3LWNA 2YCBA 2AR9A 4WKPA 5DN6A 4MCJA 3EC1A 1LPPA 1NBAA 2JFPA 4B3IA 1WCWA 2AYZA 1U7ZA 3B8EA 3FNHA 3IJPA 4JXJA 1Y42X 5EKDA 5LNK1 2QY9A 1GR1A 2ADOA 1VL1A 4YQYA 4KE9A 1G1MA 5KWSA 2DPGA 4ZVOA 3VTKA 2OCIA 1A69A 1FMJA 5HKKD 3DPIA 4MGIR 4Z1MD 3AU9A 3EEBA 3HXOA 3VFDA 2W5UA 2NP6A 3UT5B 3WJAA 1IJKA 2A67A 4OI1A 2X41A 3X1DA 1I94B 4D9HA 4LKOA 1E4OA 2Y0CA 1KERA 1XQ6A 2P9QA 4PO8A 2FPKA 5BN4B 621PA 2YY7A 1C1DA 3CNEA 2CDAA 3EBOA 3PB3A 3MW8A 4PZ0A 4F3CA 4EI7A 1U9CA 3LT4A 1DTEA 4C7KA 4ZZIA 1PK8A 4OL0A 2NO6A 1EDOA 3L77A 3L92A 3D2LA 3NHJA 1JSLA 2ZU6A 3GGGA 5DX1A 4YUZA 5IDWA 4DR3B 3MERA 3RWMB 3MT8A 4WACA 1M2OA 3BCRA 3L40A 1VSVA 2IQIA 3FDJA 1JKJB 3IXMA 1DQNA 3V46A 2YINC 3MJDA 4CG3A 3W5IA 3MUNA 2QAIA 1DTSA 2HCRA 3GMIA 5FPHA 1E0DA 4US0R 1UJ2A 2WUDA 1MAAA 2C3YA 3I58A 3HU1A 3T6KA 2V5AA 1MVOA 1V35A 3ZTTA 5BWCA 2IEDA 4L5CA 2PPLA 4LOLA 3NFRA 4LY3A 4DLPA 2ZSEA 1N9ZA 3TYXA 3ND7A 3WKAA 2ADMA 3ICOA 3SZOA 4BMXA 3RYHA 3STYA 2R6HA 4ZVSA 3ZYCA 1FJGB 2HI0A 2QLMA 2O0LA 3PFGA 3FCCA 3S29A 1TVCA 5DI3B 4ZK2A 4TTJA 4KO8A 1ODIA 4ICIA 1SUWA 4DCOA 4C4OA 5D86A 4TTQA 2E3JA 2IYFA 2ZG6A 1EVQA 4X00A 1NUAA 3DV2A 5JCJD 1JIIA 5HA5A 3R7BA 4GP7A 3WYNA 1Z5NA 2I2XB 4PLFA 1J2YA 4GZMA 1X15A 3WLAA 2XUGA 3QOFA 4HDKA 4DR6B 3TZBA 3AG5A 2AMYA 4IVNA 4DYDA 5BVGA 4I3HA 2W70A 3RRBA 2YWGA 3TNYA 4DQLA 5LXTB 5G02A 1Z08A 2JIDA 3OMLA 3LCJA 2FPWA 2QSUA 5DULA 1A96A 3AL3A 2P27A 3UVEA 5K3EA 1N33B 4BLPA 2K7ZA 3UOAB 3WNZA 1IJBA 2QG4A 4NBKA 2J3QA 2PL1A 2FDRA 3CW2A 2H0AA 2JKZA 3E0QA 3HJUA 3MWFA 3NJ8A 1QIDA 4RYDA 5U1PA 3R7AA 3U44B 3MN1A 2XI4A 1R37A 3AIKA 3VKFA 3IAXA 1H6CA 2J8ZA 5IU6A 2WDZA 1AV6A 1O5OA 4FI3C 3W5DA 4TWAA 3EZLA 5KYKA 1E4YA 3T7EA 4ESOA 4H7HA 3RVLA 3KO8A 4FFVA 1MH1A 1V39A 1U0BB 2C9OA 3MRTA 1L4UA 2UZ1B 2O1SA 5CW1A 1R6AA 4A8JC 2ST1A 2JRLA 3H4TA 2BJHA 4JLKA 1OYVA 4L07A 2B4TO 2O2IA 3TI9A 1XUOA 1RRMA 1MVNA 1W1WA 2ISSD 3Q9LA 3RTGA 3WRYA 4RULA 2ZULA 3LUHA 3OA2A 1X0XA 4J16A 2I7CA 1XZHA 3R5FA 3WMRA 4PYLA 2FSPA 2Y9PB 2HRRA 4P53A 1WPGA 4DPMA 4GYWA 3N2IA 1TUEA 3PWKA 2IIQA 3OY2A 1OQAA 1Y7LA 2B36A 3MBIA 4RORA 2HRCA 5CLHA 3VO8A 2R6ZA 3DFUA 1YVUA 5D7BA 4IO1A 4Z0PA 3AM1A 1Z2PX 3NM5A 1DRJA 1KYQA 2AFRA 4LYDA 1E2EA 3G8AA 4L51A 1LH0A 3ITKA 4G1UC 1DHTA 1ZJYA 2UZ4A 4IEFB 1L4FA 2PV7A 2FLWA 2VP9A 5BNFA 3N1UA 4IH9A 1QGDA 1JHZA 1W5TA 2JPDA 1N9KA 3ISTA 2O3RA 1L7RA 1X94A 3RPEA 2FR1A 1NIJA 2XRZA 3R9IA 1K9VF 1NXXA 2GHRA 1N2XA 4FR2A 2A4KA 1QG0A 3IV6A 4U3JA 5KWVA 1R5BA 4BO7A 3H2KA 1RCUA 1IBCA 4NZOA 2XUQA 1DRWA 1HZZA 1AA6A 1W52X 4UREA 1QQ6A 1ABFA 3MMPA 1CRZA 4EYSA 4ETMA 1Q7CA 1J06A 2J9GA 3SEFA 3NTXA 3C4JA 1T3HA 4B4OA 3W6OA 4W5RA 3MEQA 5JNWA 4IKPA 3DL2A 1ULBA 3KQMA 4N8DA 3F97A 4BZQA 3N39C 3LLCA 3JD3A 1R10A 3PVZA 4X3PA 3P4YA 3E3LA 4UXIA 3WK4A 3R23A 4PN3A 2QR5A 2QN9A 3LYAA 1D4AA 3V4RA 1ZM4A 4L4XA 2B8EA 3A1EA 4FN4A 3V7FA 1IE3A 4DEYA 4ESHA 4PHTA 2A9VA 2R6FA 4RSRA 3DQQA 4FVTA 1Q2XA 1UBTS 1Z06A 4MR8A 5DX0A 5AW3A 4N18A 2PXAA 4IDAA 3VOAA 3ORQA 3T1TA 2FMFA 3I9JA 1CIVA 3KD2A 1CDZA 1JS1X 3RGGA 2XE8A 2Q2WA 3FDFA 2OQRA 4TMYA 2O8FB 1KSFX 5LFAA 1PUJA 3OPMA 1Z7YA 1JPNA 2BDTA 2L17A 4H15A 4QBTA 1TPZA 4CQLA 4UZFA 3CVWA 3U61B 3EG9A 4JI3B 3WJ7A 1E18A 3FHOA 2E21A 3CEMA 4HDQB 4UNSA 3VOTA 4BO1A 1WMEA 4HUTA 2PN1A 5DLEA 3M0EA 4Z0NA 2RD2A 2I2AA 3LW7A 2BPOA 2CLMB 3TQHA 1JEAA 1XKTA 5B37A 4BL5A 4C4SA 2R7KA 4D44A 2RGNA 1AKEA 1SVWA 4PHHA 4XPZA 4E1BA 4LF5B 3W2IA 4PQEA 2CUNA 1Y6QA 3GPCA 1YKSA 5LZ5A 5LP6A 3PRKE 2G9VA 3K15A 5E95A 6PFKA 4GOXA 3OQIB 1MQ8B 4LPSA 2ECFA 1RRGA 5DGXA 2D1YA 4JJGA 2QMOA 3I72A 3KUXA 3PQ5A 4QOIA 4YA6A 3ZIUA 3KTDA 3NGLA 4KGZA 2JVJA 1H2RS 4L9AA 2IPNA 1WF3A 1CY6A 4DW8A 1YHZA 1L4HA 2ZYUX 4FDUA 4ZHQF 5ARCA 5C9ZA 1VIYA 3WB1A 2BDUA 4UE3S 3UA3A 4WKOA 1TECE 1TO2E 1U2TA 3FUUA 4ZTBA 2EKZA 1Q0UA 3PTLA 1I2BA 1YGYA 4I19A 4IWYA 1W5EA 5CA0F 1RWPA 2GLUA 5HTKA 3GRVA 3GWGA 1QH0A 1UEJA 4M53A 2EATA 4PFJA 4DLAA 2EQAA 8ATCA 3KCQA 5AESA 3KWLA 3HEMA 3DKPA 1ORHA 2A7QA 1VZ3A 2BHTA 2OZVA 3EG5A 3F78A 4LXYA 1A9RA 1JT2A 3TRIA 3VNBA 4QTZA 1W4AA 2HA3A 2O2GA 4AB1A 2FFJA 4AVYA 2DOKA 4R8KA 3ZX5A 1ZH4A 3AIOA 3AF3A 1MOPA 1O96A 1UOQA 2PT7A 3LKDA 2PUCA 5DWVA 3EIXA 4TZTA 4RK4A 2GZDA 2WAYA 3TQSA 1U5CA 2RCYA 3FVRA 4JBGA 3NM6B 4ETIA 5BV0A 1Y9JA 4H7IA 1MBZA 1VOTA 1CE8A 4HZGA 5F73A 1M1YE 3TLMA 3H8WA 1U1EA 1RQPA 2H4HA 4OTZA 5JRZA 3N53A 4DLVA 2P2SA 4E5PA 2HF8A 3U2QA 4FJ0A 1W85A 1C30A 4D26A 1HMPA 5EUMA 5SV2A 3GPLA 4AMUA 4JCOA 3VSDA 3VMMA 4LRSB 4UCFA 3W2HA 3EN0A 1JW9B 4QYIA 2O7VA 5HIJA 2O8BB 1HDYA 1GPMA 1QSGA 1FDUA 3SWWA 1IZ9A 2DPMA 4JYMA 4MPRA 2WFAA 1HRKA 4YAWA 1ZEJA 1YBVA 3K2QA 3IE1A 1NGSA 3AO0B 4PAOA 2V58A 4C07A 1D8AA 1X6VA 4YROA 1CJUC 2WF6A 3UPDA 5EJ7A 2YJNA 3M9LA 1T3SA 1C8BA 4BLRA 2J41A 3L4EA 1O0SA 3NHBA 3SU8A 2ZQ5A 1HURA 2J48A 1LV8A 5KHAA 1RHJA 4JU9A 1N5OX 4HQNA 4IUYA 4P0PB 4OG2A 4ATNA 4F04A 4H9GA 3G2MA 2XQJA 1R6TA 2BF4A 4LUCA 5JSHA 1OA0A 4QVGA 4Z4CA 1U8UA 2EIXA 2O7NA 4NPAA 3AILA 3DLBA 4DHWA 5GGYA 2JIPA 5JJLA 5I8WA 3SBXA 2X1LA 1OTYA 2Q6KA 1AGYA 1QKKA 1J1UA 2PBZA 1U7DA 2ZBFA 3AVTA 1FFBA 1MMFB 5CVCA 4A8JB 3MJ4A 1DC3A 4DOMA 5H4GA 2NIPA 4O4HB 1XA4A 1K2WA 2G83A 3OLZA 4OB6A 5IBPA 4YJ2F 4REQB 3TFOA 1I2ZA 3BQNB 3CKLA 3K5WA 1KSGA 3JRWA 2SBTA 2XGGA 5DT2A 2B69A 4HNQA 3ONWA 4RIHA 4EA7A 4PYQA 1G2QA 3ITDA 3ZCXA 1A1VA 2GAIA 3KJFA 3TUJC 1DXQA 4DWOA 1Y1QA 4JLNA 2WWYA 2EGUA 1MFPA 2CW5A 1K5HA 2XE6A 1RAFA 4LWQA 4OP1A 1U0TA 1YZHA 3ZXUB 1KEUA 4RKYA 3N2ZB 3UJBA 2FEAA 5DTIA 4KEAA 3AW8A 5FIUA 2CNWA 3IR7A 4J0EA 3UAGA 5A4AA 3ZV4A 1FSSA 1CEQA 4FOPA 4UBKA 1QU3A 1SUEA 2FPGB 4ARIA 2IHJA 3A9SA 2HMWA 3G2NA 3DEIA 1N5JA 4KI7A 4V38A 3R75A 3SBOA 3WMFA 4C0LA 3U5ZB 1W76A 4I5FA 4EHAA 1H66A 1YZKA 3PEVA 1Q2UA 3EGDA 5GONB 4QBFA 5CH3A 1VG1A 3X44A 3KM0A 4GX0A 1BE0A 5ECYA 4HH0A 3WDLA 4WXRA 3BRWA 2Z04A 2IDZA 4A82A 3JS5A 4AC9A 5JS6A 2WB4A 2Q5IA 1U2GA 3HXMA 4N76A 1H2BA 2G9UA 4IDOA 4KDRA 1B74A 1G19A 1JAHA 2QUBA 4JWTA 4FIZA 5EJMA 3RDPA 3W9UA 5FFNA 1JG6A 4C3VA 5E4JA 2G4VA 1L8OA 2BLLA 4JX8A 2B5OA 1TIBA 4AKTA 2XUIA 1AN0A 4Q15A 2IOFA 4YV0A 1H93A 4M21A 4NABA 5ED0A 1BIFA 2VHEA 3RF6A 3D31A 1WE2A 2Q1SA 2YWCA 1DT5A 4JJ6A 4UEJA 4DC1A 2F8SA 4OSEA 1EP9A 1DP4A 1RJGA 5J4HA 1OIVA 5EKSA 3NW9A 4JP1A 1DFHA 3K9GA 5JCXA 2ZRBA 3C3PA 4RF2A 2C9DA 1DCFA 3S40A 4UD6A 2X8AA 4IX1A 3WGKA 3DAFA 3F90A 3O4IA 3H2ZA 3DDNA 3Q1LA 2P2LA 5DRYA 2CLKB 1SY7A 3OZGA 2L2QA 1C14A 2J4FA 2R8RA 2WNHA 1R8QA 3OM1A 4TSFD 4AZ3B 4MDHA 2PE5A 1W7AA 1G8JA 1J39A 1BAPA 5CH5A 5L45A 4YC7A 2A5JA 1Y5RA 2VBCA 4MVXA 4ZIRB 1T9ZA 1U9IA 4I99A 1TNDA 2XMSA 3HSKA 4TYQA 2O0HA 4GICA 2YHAA 3ZHCA 1QAOA 3NBAA 5AW2A 1CRWG 1XTQA 2OHFA 2PX8A 3ZEIA 2C2XA 1UBLS 1VRCA 3OMXA 4RV4A 4KRFA 3EODA 3F47A 2H8KA 3UMGA 1REQA 1J99A 1TLLA 3BJEA 4WDQA 3B1VA 4HOYA 3S4YA 1DQPA 4UCWA 4WVFA 1ZFNA 2Z58A