4D2WA

Structure of melk in complex with inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
333
structure length
314
Chain Sequence
b'MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCACGALAYAAPELIQGKGSEADVWSMGILLYVLMCGFLPFDDDTAAALVAKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title Fragment-Based Discovery of Type I Inhibitors of Maternal Embryonic Leucine Zipper Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 314
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d2wA00
4BDIA 3HMPA 4IANA 5LVPA 3GNIB 3PP0A 1Q3DA 4X2GA 4EZ3A 3SXSA 2F7EE 5L3AA 2R2PA 1WZYA 4FK6A 4C57A 4YURA 3NNWA 2H96A 2QKWB 2YHVA 2UW8A 5LWMA 3GI3A 3TEIA 4DYMA 3ZBXA 4ALVA 4NFNA 2NRYA 5CEQA 3MH3A 2XNGA 5FTQA 1U5RA 4GJ2A 5B2LA 2J0IA 5EDQA 4JAJA 5IEYA 3KULA 1B6CB 4NK9A 1IG1A 5KBQA 4I21A 4USDA 5HIDA 4D0XA 5BQ0A 4I5PA 5LARA 1VYZA 4EKLA 2PE1A 4MD9E 4ZS0A 1M2PA 3QCQA 3PJ3A 3ITZA 3TI1A 2B52A 3TKUA 1BYGA 5HTBA 4WRGA 3NW5A 4IC7A 2YIXA 4XOYA 5EW8A 4LFIA 2W5AA 2I6LA 3KB7A 3PA5A 4TYGA 3V8SA 2WGJA 3ZM4A 2ZV2A 4AT5A 4E4LA 2BMCA 1OL5A 2RG5A 4X3FC 1FVVA 1WBNA 3GEQA 1TQMA 4JG7A 3C1XA 4ZEGA 2X4ZA 2Y6OA 3PZEA 5B2KA 1LPUA 4K18A 2G01A 2IW6A 3CQEA 2WKMA 4J7BA 3IO7A 4ZTQA 4HVIA 3H9FA 2BAKA 5D1JA 3F82A 5AR4A 3QTZA 3R71A 2FSOX 5E90A 3EFKA 4WD5A 4AGWA 4F9WA 2Y4IB 3Q60A 5A14A 2VTQA 3LFCA 3ORZA 4YJSA 5KZIA 3S0OA 4G3DA 3D94A 3R7YA 4PTCA 2ITXA 4NM7A 3N9XA 1KE8A 4W4YA 1SYKA 3R21A 3ANRA 5KMLA 3QRUA 4Q9SA 3IKAA 4YP8A 4A9UA 4F08A 3QYWA 3COHA 1NVQA 4F9CA 1KSWA 4U40A 1H1RA 2JKMA 3CY2A 3SOAA 4E7WA 3F2AA 2ITOA 1U54B 2W1FA 2XJ0A 3A62A 4IAYA 4CYJA 3LVPA 3NUUA 2VTTA 3JYAA 4UB7A 4MXYA 5C8MA 4K1BA 4OTRA 2YEXA 2X4FA 3WF7A 4D2TA 4FIGA 4W8DA 5AUUA 1YVJA 3HV6A 5AV1A 4FV7A 3FI3A 5J87A 3ZC5A 2I40A 3QHWA 2C6KA 3Q4CA 4TZRA 1XBAA 4F0FA 4R3PA 5J5TA 3VAPA 4XG8A 2W1CA 4I23A 2R3PA 3HP5A 3V3VA 3QWKA 1FINA 3QF9A 4PDSA 2JIUA 5E8WA 2F49A 2GNFA 2BDWA 2HELA 4GIIA 2XVDA 3UIUA 4FV3A 2IZSA 4XX9A 4FEQA 4JXFA 5H9BA 4APPA 4KKHA 1ZYLA 2QU6A 2VWUA 2QOIA 3BE9A 3KQ7A 3W2CA 1V1KA 5LMKA 5M56A 1PYXA 2OZOA 4MK0A 4X0MA 4EK3A 4XOZA 1UNLA 2GNJA 3DBCA 5AV3A 4C37A 4QMXA 5ITAA 3R1QA 3RPSA 4NW5A 5HO7A 4GUBA 2GHMA 4CQGA 3FZPA 4FTCA 4O6EA 3JVSA 5C01A 4EK6A 4XV3A 3DKFA 2PTKA 4YJNA 3BI6A 3EQDA 4E4XA 5E8YA 5BVOA 3R8VA 3U6JA 3GU8A 1R3CA 2BTSA 5KUPA 1XKKA 4TRLA 5CAVA 5M44A 5AX9A 3AQVA 4HCVA 3O71A 5AJQA 2B9HA 4I4EA 3RZBA 1QPCA 3R7GA 4ZSEA 2ACXA 1Q24A 4A4XA 3KA0A 2CGXA 3O7LD 4GS6A 5EKNA 4RPVA 3KY2A 3W8LA 2HK5A 2WMQA 3ZCLA 4FKJA 4FT3A 3CR0A 4XG3A 4MNFA 5D7AA 2C0OA 3LJ1A 3V5JA 4BDBA 3VBYA 3RAIA 4IDTA 1YWVA 2QLQA 2ETKA 3EZRA 5ANEA 3ROCA 2YJRA 4ANLA 4BZNA 5K5NA 5CLPA 5JFXA 5C27A 4MXAA 1ZZ2A 4XEYA 4BTKA 3GC0A 5HOAA 2JGZA 2E2BA 4L3PA 2WHBA 3LXNA 3EIDA 2W1IA 3MY5A 4BWKA 2A1AB 3F9NA 1WAKA 4L52A 4C59A 4FKGA 1TVOA 4IX5A 3EQPA 3LXLA 2V5QA 3FYJX 4RRVA 5DN3A 5H8GA 4IQ6A 2X9FA 3ZZWA 4E1ZA 3BHVA 1E1XA 3I81A 2XM9A 4PL3A 4EYJA 5ETAA 5KKRC 2JKKA 4RZVA 4AW1A 4EOSA 2UW0A 3O50A 4YUQA 3HZTA 2YCRA 1VYWA 2AC5A 4ACMA 3JY0A 3UE4A 3UOLA 1ZMVA 4RWJA 1M7NA 5AP7A 4DFNA 4IH8A 3DKGA 3P1AA 5HNBA 4CNHA 2ZB1A 4KNBA 1H0VA 4JBVA 2F4JA 2EXEA 2OXDA 2R64A 4TWOA 4WBBB 5K4IA 2UZUE 4I4FA 4D1ZA 3A7JA 3QXPA 4DITA 4IB0A 4K11A 5CX9A 4I6BA 4AFJA 4D2RA 1WVYA 2GSFA 3DTCA 3NUNA 2VTLA 2PZYA 3W10A 5JRQA 5L2WA 3RM6A 4QMSA 3CC6A 3MIAA 4FODA 4EH4A 4RC4A 3OHTA 4UY9A 4M69A 4ZTRA 1JSUA 2VTAA 3IONA 5CZIA 4PPBA 4JJRA 4XS2A 2EUFB 1CDKA 5F4NA 3CQUA 3W2PA 3QCXA 3FHIA 1ZLTA 4FNYA 4AZSA 4BHZA 1U59A 4PL4A 2VWBA 3A4OX 3FLNC 3MVLA 2OF2A 4X6QC 4DEDA 4DLIA 4AZEA 5L6OA 4BC6A 3BBWA 3G6HA 2X2KA 4FTNA 4QMVA 5FD2A 4QRCA 4EQCA 2W99B 4MQ2A 2W1DA 2QOHA 4NTTA 2IZTA 4RIXA 4FL3A 4RX7A 5IMXA 3NIZA 4TTHB 4FKTA 3V5TA 4L3LA 5J1VA 3A60A 3PXZA 3VUIA 1H07A 4UN0C 1H26A 3ZSIA 2RGPA 4EBWA 5G1XA 4DGLC 5CU6A 1MRUA 5AP6A 3U6IA 4ACDA 4EOQA 5BUJA 1Q3WA 4GT5A 4TNBA 5M53A 3MYGA 3IOPA 1U4DA 4HOKA 4HZSA 1XBCA 3UP2A 5CASA 1Z9XA 4PL5A 3PPZA 3EB0A 4AW0A 3QQFA 2RKUA 4D1XA 2DS1A 3MH0A 3M42A 4IDVA 1U5QA 4AZFA 3OCGA 4F1OA 4NJ3A 5BVKA 4LG4A 4J97A 3AGMA 4QTCA 2UZLA 5I9VA 4JG8A 4XYFA 3QHRA 4MNEB 1KOBA 1H4LA 5HCXA 5ANJA 3H9OA 5HE3A 4QP2A 2HW6A 4AT4A 5JFSA 3CEKA 4E6QA 4WO5A 3Q04A 4I24A 3ZXZA 4F7SA 2XCKA 3PJ8A 1GJOA 1J3HA 3ACJA 3MGYA 4V0GA 4AG8A 3EFWA 5JZJA 3UIBA 4FTJA 1SMHA 1UU3A 4PPAA 5A3XA 4RT7A 1PF8A 3II5A 3JVRA 3PIZA 3R8MA 3T3VA 4MVFA 4EOPA 1MUOA 3NNVA 4CSVA 3S1HA 4O22A 4J96A 1LUFA 2R9SA 4Z7GA 1YWRA 3FE3A 2BRHA 1U46A 2PE0A 1KE6A 5EKOA 3ZSHA 1MP8A 4ZJJA 3KL8A 2CCHA 5TT7A 4L43A 3ZFXA 3MBLA 1SVEA 4QPAA 1ZMUA 4JBOA 2Z60A 3SA0A 3IW4A 4KBCA 2PE2A 4ZTNA 4CMTA 1H28A 3DBFA 4FVPA 4QYYA 5DT3A 1OPKA 4F6UA 1APME 1DI8A 3OP5A 3KXXA 4MWHA 3MY0A 4IWDA 2R3GA 4Z16A 2ONLC 3PA3A 3QRJA 4XH6A 2YLFA 4JG6A 2GCDA 3P78A 5L2QA 5BPYA 5FBOA 1ZYSA 1YHSA 2GMXA 5B0XA 3ZUUA 4OT5A 2O64A 1JNKA 2HAKA 4L44A 5DI1A 5IA5A 3R7UA 2WMAA 3GT8A 3RALA 2JAMA 2WB8A 3PSCA 5K5XA 4LV8A 2VO6A 3Q9WA 5AWMA 5IKWA 4ZIMA 5HLWA 3HMNA 2SRCA 3FMMA 2KTYA 3UQFA 1ZMWA 3GB2A 4BDEA 4Y8DA 2C0TA 4I94A 2O2UA 4JR7A 5ANKA 4D2PA 3NNUA 3LCDA 3VS6A 3PZHA 4CZTA 2OZAA 4IEBA 4RJ3A 3R02A 2JD5A 5J9LA 3E87A 3Q6UA 4V01A 4FBXA 4XHKB 2YAAA 5AUYA 4XG6A 3ZYAA 3QQKA 4F09A 1WFCA 4GMYA 4D5KA 3R7VA 2C6MA 2R3KA 2Y4IC 5FP5A 2JDRA 3P08A 2ZV9A 2YABA 4IAZA 5HE0A 5TR6A 4F9YA 3VHKA 5JMSA 3OY3A 4DH7A 1WVWA 5HG7A 2F2CB 3D9VA 3HVCA 2HY0A 3FPQA 4BZDA 4YR8A 4F1MA 5HU9A 5CNNA 3DNEA 4RWIA 3OF0A 4C58A 3C4FA 2G9XA 5JFWA 1PJKA 1HOWA 3F3VA 5EM8A 5HD4A 3I6UA 4GU9A 1T46A 3CJGA 4BCJA 1YI4A 2Q0NA 2RFEA 3FQSA 4YO6A 4GIHA 2R7IA 3KKVA 4O0VA 2PVLA 3KRJA 3F5PA 5AA9A 1G3NA 4OGRA 3L9MA 5L8JA 5CAQA 2XNNA 2VX0A 2VO3A 4UZDA 3C5UA 2VN9A 3UVRA 3QUDA 2WFYA 3HMOA 3R30A 4R7IA 4YBKA 5CXHA 4DCEA 4EOLA 3VJOA 1WBPA 1T45A 4BCIA 3FKLA 3HECA 1JKSA 4Y46A 3FXZA 2BZJA 2E9VA 2HCKA 2BUJA 1LEWA 2YLEA 4GL9A 4LRJA 4DFZE 2PMLX 2VGPA 3TV6A 3GQIA 5DR2A 3ZUVA 3F5GA 4U9AA 5FM3A 4HGEA 2C6IA 3BCEA 4S33A 5BNJA 2ZMDA 1PKGA 3F61A 3VBWA 2B9IA 4EOKA 4QQ5A 2GFSA 4F0GA 3R1YA 4G2FA 1GIJA 5AUTA 4FA2A 4I22A 4M15A 3FI2A 3LCSA 4FZAB 5ANGA 5HX6A 1R0PA 4ZAUA 3BHTA 4O6LA 2W5HA 3CGFA 5TOZA 4B6LA 5HHWA 2A27A 2J5FA 5CI7A 3RAHA 2A0CX 4AP7A 3T3UA 3OS3A 2BR1A 2FUMA 2X8EA 2JDVA 1OI9A 4KIKA 3VRYA 4MBLA 4NEUA 4C35A 3PY1A 3HEGA 2W9FB 4G3CA 2PVHA 3QQLA 4ZTLA 5JFVA 4I0RA 4AA4A 5EM7A 3TT0A 2XNMA 4C2WA 1TKIA 5IUHA 3DJ6A 5BMMA 3OXTA 4QQJA 1W8CA 3Q52A 4PV0A 1UA2A 1ZXEA 2GNHA 5E8SA 3ZMMA 4BKZA 4F4PA 3BLQA 2QURA 3Q9YA 4RJ8A 5AAFA 3V51A 4BDAA 5J5SA 3TTJA 3T9TA 3O23A 4K9YA 4BIBA 3RPOA 2WO6A 4GEOA 5EYMA 3FL5A 4GRBA 4CFWA 4XMOA 3RKBA 2QOQA 4L7SA 5E91A 3C4ZA 1CKJA 3DFCB 4BBMA 5A54A 3QLGA 3FC2A 5A9UA 3RK7A 3PG1A 4D4RA 3BIZA 3WZJA 2WMRA 3CBLA 1AGWA 3K54A 4GVJA 3W8QA 4BICA 3KFAA 4RJ5A 2P3GX 4YHTA 4ZLYA 2GFCA 5LCKA 2VTNA 5EOLA 2ZAZA 5ICPA 5IF1A 3POOA 3OFMA 4C4HA 3QQUA 4OTWA 4QYHA 4FSTA 4JBQA 1KOAA 5CU3A 2W4KA 3L9PA 3MWUA 2XIXA 3QKKA 1UNGA 4IVCA 2UVYA 5CF4A 2OW3A 2WOUA 2YIYA 5E92A 3PJ1A 4BF2A 4KBKA 2WU6A 4ITJA 3BU3A 3LZBA 4BDJA 4C38A 5GZAA 5AR5A 2QCSA 2J2IB 4QMMA 2V62A 1URWA 1P5EA 2UZWE 4D2SA 5JH6A 3OCSA 4W4VA 4YJOA 1BMKA 5IA0A 4QMLA 5CF6A 5LVNA 3HUBA 4QT1A 3E93A 3ANQA 2OIBA 4ZOGA 4C4GA 1CSNA 1O6KA 3QC9A 5GJGA 2HZNA 1YRPA 4LGDA 1PW2A 1NVSA 2C6TA 5I9UA 3ZTXA 3GFEA 3O2MA 3DJ5A 2GPHA 4ACGA 3ZRKA 4PMSA 3TUBA 4YJQA 3NAXA 1YXXA 4GVAA 3PJCA 3GU7A 2FH9A 4NIFB 4QPSA 4OBQA 1OL6A 1Q8YA 3F6XA 5EM6A 3RP9A 2JIVA 3AC1A 4LUEA 3UODA 4ACCA 4EH6A 3FC1X 1X8BA 2YJSA 1Q61A 4O21A 4LRMA 4Y5QA 2OFUA 3QU0A 3QTXA 4IACA 4BCGA 2A19B 1DAWA 2HYYA 5CT0A 4A9YA 4EOIA 3TKHA 3AT3A 5HEZA 5HZNA 3L8XA 4XRLA 3DCVA 4FGBA 4M13A 3KXHA 3FMEA 3G6GA 4IAAA 4ZZMA 3BPRA 4G3FA 1DM2A 2BCJA 2JDSA 2ONLA 2YM3A 4I0SA 4ZTMA 4L8MA 4IWQA 2QKRA 4N6YA 1ZOEA 2G1TA 4FUXA 4UWYA 4DEGA 4FSYA 3EFLA 5JKGA 3KXGA 4FT0A 1WBTA 4U7ZA 4UYAA 2WNTA 3FZTA 3BYMA 4K0YA 4EK8A 4GK4A 5E8VA 2FYSA 1KE7A 3AC3A 2UW9A 2NO3A 2VNYA 4ITIA 4RIWB 1K3AA 3TV7A 2HWOA 3KRXA 2WMUA 4ERKA 5CSPA 4UXLA 3R63A 4O0UA 3VF9A 2YM6A 4EK5A 4GH2A 1E1VA 4AN3A 3R8ZA 1SM2A 3UMWA 3QFVA 2VWVA 3G9NA 3ZLWA 1BLXA 5HLNA 2R3IA 3E5AA 1LR4A 2X9EA 2R3JA 4DG3E 4L9IA 1Y6BA 3AXWA 4IZ5A 4H3QA 4CQEA 4EORA 3MB7A 3GCQA 1Q8ZA 3ODYX 3QA0A 4MH7A 2WIPA 4EWHA 5IUGA 4CV9A 1W84A 2PMIA 3VN9A 2QC6A 1PXOA 4CT1A 2LAVA 1XH6A 4CFMA 5EHLA 4IIRA 4ANQA 4WT6A 1BKXA 4FV1A 4GUEA 3UBDA 4JR3A 4UX9A 4YLKA 3W1FA 4RG0A 4LL0A 3KGAA 3NYOA 3CY3A 3L8SA 3F88A 2BIKB 5FLFA 4L00A 2IO6A 4UMRA 5I9XA 4EUTA 1OIRA 3AD6A 3DK3A 3OOMA 3TIZA 4BTJA 2RSVA 4DEAA 3DDQA 1QPJA 4I6QA 3HA8A 3F3TA 4ERWA 1WVXA 4I6FA 3F7ZA 3IK3A 4U3YA 5DR9A 4ID7A 1NY3A 1ERKA 3N51A 1HCLA 5BUEA 2YA9A 3MVHA 4IFGA 3K5UA 5EYKA 2WMXA 2XMYA 4G5PA 2E9NA 2Z7LA 3GCSA 4IBMA 3OWKA 5G6VA 4UWBA 3NS9A 3W16A 4O1PA 3JY9A 1SVHA 4QTBA 3R9DA 5HVKA 3PXQA 4FZDB 4F7JA 3AMYA 4IX6A 4CZYB 2NP8A 3NIEA 5CS6A 5I0BA 4RA5A 2RG6A 3LXKA 3T9IA 2E9OA 4EHGA 1BX6A 3SHEA 2BFXA 4DG2E 2HIWA 3O8UA 3R01A 5HGIA 4EWQA 4RC2A 1W82A 3R7OA 2ZMCA 1ZARA 3GENA 3Q4UA 4L53A 4B0GA 2BRMA 3DK6A 4NT4A 4EOOA 4EC9A 2CGUA 4IB3A 4K8AA 4BWPA 3BE2A 4UMUA 4ZZOA 2X7GA 3ZO1A 3DQWA 3NPCA 3E63A 4WIHA 3TNQB 3VS5A 4TYHA 4AW5A 4FIFA 5JGBA 3MSSA 4OLIA 2X6DA 1F0QA 3RMFA 3QKLA 2ITZA 2VV9A 3OEZA 4QYGA 5J9ZA 3U6HA 5HNGA 4K2RA 3CCNA 4M0YA 4YNEA 3LQ5A 2WQMA 4RJ7A 3DBQA 3M11A 4E5WA 1Q99A 3AOXA 4UEUA 1VR2A 2QOBA 5TE0A 3O8TA 4IAFA 2W06A 3MTLA 5AR7A 2VWIA 1H24A 1JPAA 2RL5A 4NM0A 4YNOA 1GOLA 2E9UA 3KU2A 3BU5A 4FOCA 3QKMA 4UYNA 3CKXA 5J8IA 2OICA 1XH5A 1PXIA 2YCQA 1OMWA 3EQHA 4M97A 4KB8A 5DOSA 4L6QA 3EL7A 3CTQA 3PVBA 4OBPA 2ESMA 1NA7A 3BHHA 1DAYA 2R3QA 4U5JA 3ZONA 4W8EA 1OZ1A 5A4QA 1JSVA 3SW7A 3BGQA 5K3YA 3UZPA 3FLZA 1B39A 1YXUA 2C1BA 4RIOA 5KMMA 1GIIA 3CJFA 1H01A 3FMKA 3PVGA 4PNIA 4DFYA 3DU8A 3DJ7A 3ORNA 4XG2A 4HYSA 2OBJA 4K6ZA 4M7IA 3NW7A 4YHFA 3JPVA 2XNBA 4JL9A 4WNPA 5ANOA 3GFWA 2PUUA 4FOBA 5AR3A 2AC3A 5CENA 2GQGA 4FV5A 4IJPA 4G17A 5F95A 5EG3A 4ZY5A 5EFQA 1E9HA 2VRXA 3BHUA 5AIKA 1Z57A 4FTLA 3COMA 4GK2A 4WA9A 5FXQA 5CSXA 3VUTA 3D7TA 3O8PA 2DYLA 4HGTA 4IX3A 3FXXA 3QX4A 1MRVA 5EDPA 1Q41A 3LCOA 4CVAA 2C69A 4G6OA 4KINA 5HICA 4FTAA 4ALWA 2C3JA 1QMZA 1W83A 4MBIA 2I0VA 5CU4A 1ZY4A 4AOIA 4U41A 4X2KA 3ZEWA 5F1ZA 3EOCA 3OUNB 1XQZA 3UTOA 4AUAA 3G0FA 4DLJA 1XH4A 3OWPA 4HYIA 4OTDA 3CXWA 3IECA 3H0YA 3FXWA 3K5VA 4RSSA 3DB6A 3EMGA 4IVAA 1YDSE 3UMXA 2UVZA 2IVVA 4D55A 5LMBA 4Q2AA 3OW4A 2Y8OA 4BDDA 3IW5A 5IEVA 3DBDA 4S30A 5AP0A 3I0OA 1JAMA 2VAGA 3QD3A 3TUDA 2V7OA 3NW6A 2R3LA 5KMJA 4U3ZA 3ZUTA 1PXLA 2CGWA 3ZOSA 2QHNA 4ZSLA 5FWKK 3RINA 4ZLOA 4L68A 4MBJA 4GYGA 4RGJA 4ANBA 4FL1A 2OIQA 3G90X 3MFTA 1CTPE 3GC7A 3HV3A 1UVRA 4FMQA 3SQQA 3C0GA 5DLSA 3ENMA 4FTKA 4PQNA 4OTGA 3FKNA 2ZM3A 3EQRA 2OJFE 2OU7A 3OOGA 2VWZA 4I20A 3CP9A 4QP8A 4EONA 4MXZA 2X2MA 3ROYA 3FI4A 3TXOA 2ITQA 4E8AA 3PSBA 5CEKA 3ERKA 3EYHA 4F63A 4KIPA 1PYEA 3OXIA 2JEDA 3KK8A 3ZLYA 4QTEA 3LFQA 3HYHA 2YZAA 3L9NA 3OD6X 3PWYA 4IMYA 3NYNA 3UZTA 4D9UA 3RPYA 4CKRA 5AUZA 4IE9A 2QODA 2G15A 2QO7A 1WBWA 2OI4X 2QOLA 5CSHA 5A4CA 2O63A 3FAAA 1ZYJA 2UZBA 4R5SA 3L8PA 2QG5A 3G51A 3QTUA 4EQUA 4R3RA 5L6WL 3IDCA 2GU8A 3C0HA 2PZPA 4CYIA 5EW9A 3UC3A 2HZIA 3R8PA 3W2OA 4U80A 1JKLA 4NZWB 5CNOA 4H1JA 4GFMA 3ORLA 3I79A 2XKCA 1OPJA 2BVAA 3FLSA 3AC2A 3LQ8A 3E3BX 1CKPA 4NCTA 3U87A 3UYSA 4IAKA 2VWWA 4BI0A 4YU2A 4JNWA 4DH8A 4QPMA 3GOPA 4G5JA 3NUSA 3QZIA 3PRIA 2BDFA 4FKPA 4WG4A 3CQWA 3UNJA 1UU9A 2W1HA 4NSTA 4GU6A 4NW6A 3E92A 2VU3A 5DNRA 3RNYA 4A7CA 4AS0A 1S9JA 1OVEA 4M67A 1JBPE 2VWXA 3I4BA 3IGOA 4I5HA 2XJ2A 4L42A 3UNZA 3HMMA 3MS9A 3L8VA 5BVEA 5DA3A 3KF7A 4NKAA 3EL8A 2OWBA 3BQRA 4H3BA 4EK4A 4EQMA 3SAYA 1YW2A 2X6EA 1SVGA 3Q96A 3COIA 3HRCA 4C61A 4F6WA 3NUYA 1NXKA 3EN7A 1KV1A 3FWQA 4H3PA 5HG8A 3VHEA 3I7BA 5JRSA 4CV8A 2WTDA 2XK3A 2YDIA 5E1EA 4FKUA 2WAJA 2WQOA 3B2TA 3C51A 4M0ZA 5I3OA 3R83A 3RPRA 1JKKA 1UKHA 3LMGA 3W2SA 5B2MA 3SXRA 5HTCA 4PY1A 1QPDA 2QO9A 4O0YA 3V5QA 1R78A 2VTJA 1L3RE 2HY81 3ZHPC 3GXLA 3A7IA 2OO8X 5J95A 4K77A 3KXZA 4AN2A 1XWSA 1S9IA 2OJ9A 3VQUA 2ETRA 3G33A 3RGFA 3VF8A 4YZNA 5DGZA 4BBFA 2IWIA 5CANA 4AZTA 2R3NA 3EWHA 3K3IA 1URCA 4QOXA 4U81A 1OL7A 1BL6A 4BCHA 3SXFA 1VZOA 2OK1A 4ITHA 4E5BA 5GZ9A 2QOFA 5AUXA 5KE0A 4BKJA 3H4JA 2VWYA 3MFUA 3S2PA 1V0OA 2R3MA 3FJQE 2PWLA 4JDHA 5DPVA 3DAJA 4PTGA 3VUMA 5AAGA 2IVSA 3PLSA 4EUUA 4PX6A 4QMQA 3ZLXA 1XH7A 3O0GA 2QOOA 3ZH8A 2ZM1A 4FG7A 4DGNA 2QR7A 4R1VA 4CLJA 4YTFA 4F70A 5IPJA 2IZUA 1PXKA 5KBRA 2GS6A 3R2BA 3KRRA 4ZXTA 3PJ2A 3DS6A 5JQ5A 3NWWA 4FNXA 4LOPA 4AE9A 3KN6A 4NJDA 5EI2A 4R1YA 2G2FA 4X3FA 4E73A 4EEVA 4EH2A 5M4FA 5CAPA 3VS4A 2PVKA 3A7GA 3P4KA 1UWJA 2C3KA 2W0JA 3R6XA 4QMTA 1XH9A 2R3HA 4JT3A 2VX3A 3EN6A 3ZU7A 3VIDA 4BKYA 5JEBA 3RTPA 3DPKA 2ZV7A 2ETMA 3OMVA 2Z7SA 4QP1A 4JRVA 2WQNA 2YCSA 2BIYA 4IHPA 4F6SA 4APCA 4MAOA 3HX4A 3GQLA 1OPLA 5EHYA 3E8DA 2X7OA 3I0QA 3M1SA 5ACKA 4BRXA 2X8IA 2GS7A 3S4QA 1ZRZA 3A7HA 5JK3A 3CS9A 2FO0A 1ZY5A 3OW3A 4YMJA 3CKWA 4FTRA 3SD0A 4KABA 3BELA 2B9JA 3C4CA 1R1WA 1PHKA 3BYOA 2WXVA 3FLWA 4DGOA 4PDPA 4QMOA 5HCYA 5BX0A 4FSRA 2GNGA 3FHRA 1OUKA 1Q5KA 5F9EA 1B38A 4FR4A 2PK9A 4YTHA 5DRDA 3R7IA 3WYYA 5AV4A 4PMMA 5AA8A 1IEPA 5AR2A 3DK7A 2EVAA 4OTPA 3TCPA 1PMNA 3FZSA 3IDBA 4R5YA 3UQGA 2VTPA 4XP3A 3A8XA 4LMNA 4XP0A 2PVRA 4HPTE 1O6LA 3NNXA 5DE2A 5HTIA 5KHWA 4Y5HA 3RAWA 3Q9ZA 3TL8A 1YOLA 4A9SA 4BDKA 3QZHA 5EYCA 4JOAA 4ZY6A 4WOVA 2QD9A 5H3QA 4L01A 3QUPA 2OKRA 3MH2A 5KMIA 5DT0A 3W32A 3TNIA 4QMWA 4YJRA 4AGCA 3I60A 2R3RA 3IW8A 4X6RA 4C02A 4CD0A 2WTCA 2XKFA 3H10A 3RBWA 1JQHA 4KRDA 5D10A 5FTOA 4ZZNA 2BAQA 2OJJA 4CMUA 4F9BA 4QP4A 2FVDA 4CTCA 4FC0A 3OBJA 3UG1A 4J52A 2YISA 1FOTA 3TKIA 4ZJVA 2C6OA 2O65A 3TNWA 4EHEA 3LHJA 2F57A 3DXNA 3PG3A 4FV8A 2XBJA 3SDJA 3ZRMA 3QUEA 1P14A 4DGGA 3TZ9A 3LFEA 4IXPA 3A99A 3ZFYA 4YO4A 3H30A 4HVGA 1DI9A 5IMEA 3D5UA 4EH5A 2Z7RA 3R2YA 3DQXA 2CGVA 4TT7A 5J9YA 3GC8A 5GHVA 2UW5A 4FIJA 3DGKA 4RJ6A 1R0EA 1F3MC 3MIYA 1K9AA 4Z7HA 4FTIA 3UIXA 3I6WA 2WTJA 4FKWA 1JKTA 3QRIA 3DB8A 1OIQA 4FKVA 4I6HA 4JAIA 4AX8A 1SZMA 2QHMA 1PMEA 3BWJA 3MTFA 4WSYA 2XIKA 4X2FA 4KIQA 5L2IA 2F7ZE 1BUHA 4EHVA 3BYVA 1FVRA 3HLLA 5CSWA 3FLYA 3NYXA 5DIAA 3F5XA 3ORTA 3P5KA 5K9IA 3QCSA 3VWAA 4BCNA 2J0KA 1TQPA 5FDPA 3NR9A 2WTKB 4DH3A 3FMJA 1H1PA 3L9LA 2R0IA 2QR8A 3SRVA 3QWJA 4ASEA 2B4SB 3TACA 4RBLA 3MA3A 4RIXB 4F65A 3V6SA 4A06A 3FQEA 4BGHA 3OCTA 4BDGA 3F69A 4BCFA 2BALA 3WZKA 4MXOA 3MPMA 4RA4A 4XG9A 4QP6A 4ENYA 5BUIA 3UOKA 5M4CA 2XYNA 4BI2A 2YERA 5IH6A 2I0YA 4HVSA 1OIUA 2HW7A 4QTDA 4BGQA 3E8EA 5LJJA 5JN2A 2C5OA 4FSNA 3QD2B 2JKQA 4YJUA 2ZJWA 1W7HA 2QOCA 2PZRA 3RCDA 3DKOA 3MJ2A 4PP7A 3EYGA 4FSMA 3FLQA 4M66A 4YC3A 3OVVA 4F64A 3NRMA 5L8KA 4J8MA 3VUDA 3VJNA 1KWPA 2VO0A 2IZRA 4LGGA 4FTUA 1OKWA 3DOGA 4S31A 1XJDA 4O1OA 2YDKA 5A6NA 2JDOA 3HA6A 3HL7A 3HV7A 5GJFA 2Z7QA 4BDHA 3V04A 3GVUA 2J0LA 3ELJA 4RIWA 3ZDUA 2WEIA 2XS0A 4Q5EA 4RLKA 4UV0A 4EL9A 5HI2A 1XH8A 5M4IA 2XIZA 4QMZA 1V0PA 3D83A 1Y91A 5I4NA 2V22A 4D2WA 3R9HA 4RIYA 3SC1A 5HVJA 3FUPA 3EJ1A 1WMKA 3V5PA 2ITYA 3HUCA 4XLIA 5KMNA 3ZC6A 2CKEA 1GZKA 3OWLA 4DH5A 4BBEA 3OUKA 4U97A 3ZO4A 2C5YA 1WBOA 2XF0A 4E4MA 4D4VA 4TL0A 1FMKA 2OGVA 4W4WA 3BZ3A 2OIDA 4ZTSA 4U6RA 5IDPA 2RFDA 4YJTA 4GFGA 4NUSA 2C6DA 3TN8A 2XJ1A 3GU4A 2I0EA 4YZMA 3VS1A 5C1QB 5IZFA 2YACA 3QALE 4BYIA 1JWHA 2JAVA 5CAOA 5D12A 3C4XA 4TYIA 4MXXA 3KN5A 4FK3A 3AT2A 5AP5A 5IEXA 5A4TA 4FIIA 1M17A 1PXJA 5B7VA 5CQWA 2UW4A 3F3UA 4XV2A 3RCJA 4BTFA 4F7LA 3DLZA 5ANIA 4BCQA 4B8LA 4PWNA 2YDJA 2QVSE 2H8HA 4AF3A 4GV1A 4ZSGA 3L1SA 4MYGA 1H1QA 2WQBA 3BGZA 3BV3A 4QMNA 2OZAB 3LFNA 4X7QA 4LL5A 4TW9A 1BL7A 2NPQA 4P5QA 3SVVA 4S34A 4DBNA 2UZEA 3COKA 3KVWA 3O17A 4I41A 3MPTA 4L46A 3SX9A 4AU8A 3ORKA 3R9NA 4FTTA 2PVJA 5E8UA 5EHOA 4MQ1A 1H8FA 3R00A 3ACKA 3QQGA 3VBVA 2JFLA 5TF9A 1TQIA 3QQHA 4L45A 4QP9A 2AUHA 4I0TA 2JLDA 2IW8A 5AX3A 2O3PA 5C03A 4EZ7A 4J71A 4WBOA 2FSLX 1J1CA 4TWNA 4YZDA 2ITUA 2W7XA 2XZSA 5AP3A 3VO3A 4TN6A 2HWPA 5M51A 3QGYA 3WYXA 4I5MA 3F7WA 5K0XA 1MQBA 4AGUA 5A4LA 2H9VA 5I9YA 1FVTA 3W18A 1SNUA 4IM0A 2HXQA 5FEQA 2G2IA 4I93A 4H1MA 3MI9A 4QD6A 5J1WA 2QI8A 4FTOA 4KWPA 3UVQA 5CAUA 5IDNA 5KO1A 3RK5A 5IH4A 4D58A 2B9FA 2JC6A 4KSQA 3I7CA 4IWOA 4N0SA 2A4LA 4JQEA 4DGMA 4O91A 3RVGA 5HE1A 3MW1A 2UVXA 4E3CA 4I3ZA 1Q8TA 2XK4A 1VJYA 3V01A 2ITTA 3TUCA 4BCOA 3LFFA 2GNLA 2Y7JA 1P4OA 2HZ0A 4BYJA 3LFBA 4EOJA 3UC4A 1FGKA 1M2QA 3SOCA 4Y73A 4OBOA 3FPMA 1OITA 2GDOA 1RQQA 4XG7A 4B9DA 2VTOA 5EYDA 4W9WA 3DA6A 5DEYA 2OSCA 3PXYA 3NZ0A 5DEWA 4JIAA 5FG8A 2VTMA 4XG4A 3GU5A 3BRBA 2YAKA 2UW7A 4N6ZA 4Z55A 4DN5A 4QP3A 5DRBA 3OT3A 5E8TA 1FGIA 3AC8A 2BROA 3PTGA 2EXCX 4IM2A 1Y6AA 3CLYA 3ORXA 2WTWA 5CI6A 3FY2A 4FYNA 2BPMA 3H9RA 3QYZA 2WMSA 4Q5HA 4CTBA 1MQ4A 4YLLA 3W55A 5CEOA 1OL1A 4BB4A 3NAYA 2JKOA 5A4EA 4C3PA 4FTMA 1CKIA 3WILA 4FI1A 2J4ZA 4FV2A 5KNJA 1OB3A 4E6DA 4WG3A 2JFMA 3VS0A 4LOQA 1H25A 1YWNA 2GTMA 2QLUA 4ZLZA 4TYEA 3C50A 4LGHA 4E20A 3MV5A 3V8TA 3BYSA 2IN6A 4TKSA 1RE8A 2JDTA 4DG0E 4MXCA 1QCFA 5E1SA 2OG8A 1U54A 5DG5A 3QCYA 3PSDA 1LP4A 2BHEA 4I1ZA 5C8KA 2E9PA 4FKOA 1PXMA 3I5ZA 1ZOGA 2R7BA 4RMZA 4ASZA 4BCKA 4YC6A 2W9ZB 4O27B 4YZBA 4CEGA 3E8CA 4L67A 4R6VA 4UMTA 5M57A 2Y4PA 4RFZA 2XKDA 3MB6A 3MDYA 2OXYA 3BKBA 5KCVA 5CTPA 5AR8A 3WOWA 5CSVA 4KKGA 3ZXTA 3Q3BA 4G3GA 3ORIA 4O38A 2YM7A 3S00A 3KRLA 1OGUA 3R22A 4OT6A 5HIBA 2UUEA 3UDBA 2XNOA 2EB2A 3KXNA 4HPUE 4D9TA 1PMVA 2JBOA 3QTWA 4EH7A 3PRFA 4M12A 2ITVA 2OJGA 4RX9A 1OKZA 3P7AA 4G1WA 2PHKA 5ANDA 4AWIA 2PVMA 5AM6A 2CLQA 4FX3A 4LRKA 2AYPA 2UV2A 5AMNA 5J7BA 4W4XA 2JITA 2X8DA 2XH5A 3E62A 4FUYA 4Y83A 3ZEPA 3VC4A 3DAKA 4AA5A 3EZVA 1OM1A 5EW3A 3WBLA 4QNYA 4Y85A 3IS5A 3EQIA 4BN1A 4IZAA 3RWQA 3LCKA 4M8TA 3EN9A 3P0MA 5KZ0A 5IU2A 4X21A 1GNGA 3UPXA 4AN9A 5BVDA 1RW8A 4RZWA 4PNKA 3VS3A 3EQBA 1AD5A 3LOKA 2VTRA 3OG7A 4KS7A 3KMUA 4OAUC 3D7ZA 1K2PA 4FVRA 2R4BA 5DBXA 3QXOA 3GCUA 4H39A 4MF0A 5FEDA 3FSFA 3OT8A 2J9MA 1OL2A 2XYUA 3MH1A 3DZQA 4RC3A 1JLUE 2PZIA 2WD1A 2WTKC 3R73A 4GG7A 5CWZA 5C26A 5HD7A 3A61A 1YI6A 1WBVA 3TJCA 3QTSA 1PXNA 2QO2A 3AD5A 3BX5A 2ERKA 2RF9A 4YGAA 3UOJA 1CMKE 2J7TA 4PDOA 3VUKA 3ORMA 2P0CA 3U4UA 4PPCA 4AQCA 1OUYA 2CSNA 1A9UA 4BI1A 4E6CA 4EI4A 2BTRA 3Q5IA 2W17A 4GFOA 4FF8A 4HW7A 5HNIX 3IDPA 4CKJA 4FNWA 2WEVA 5E7RA 5HE2A 5CXZA 2CN8A 3FMLA 1UV5A 3NLBA 4HVDA 2EB3A 5HG9A 4OUCA 3SLSA 4PMPA 3C4EA 4IC8A 4C4FA 5LOHA 4RJ4A 2IJMA 4C4EA 3OTVA 4C3FA 4ANOA 2ZM4A 2GNIA 4D2VA 3KC3A 1IRKA 2XRWA 5EM5A 5HKMA 4C0TA 3P79A 1KE5A 3VBTA 4RVLA 4GT3A 1H27A 4Z3VA 3PYYA 3JS2A 4YPDA 2BHHA 3ENHA 5AADA 4IW0A 1Y8YA 2ZV8A 4FV6A 3QC4A 4JQ7A 3MVJA 3PY0A 4TXCA 4XBRA 2GS2A 4BVUA 5IH5A 5EOBA 1IASA 3REPA 4UMPA 4X3JA 1Q97A 2QOKA 3NEWA 2VTSA 3BLRA 4FKIA 4WRSA 1J1BA 4G9CA 4FKSA 3VS7A 4AOTA 4DHFA 4WHZA 4KAOA 1O6YA 1REJA 1Q8WA 4PTEA 4RLLA 5DWRA 4GYIA 4AT3A 4C36A 2XIRA 5BVNA 5EK7A 4NWMA 1I09A 2XP2A 4O2ZA 3R7EA 2A2AA 4AXAA 4CCBA 4FTQA 5K0KA 3TZMA 4TPTA 5H2UA 3HMIA 4A07A 5FXSA 4FSWA 4LV5A 2C5XA 4RQVA 3W2RA 4YTCA 2XBAA 5AAEA 3WZDA 3DLSA 3PFQA 5CY3A 4XBUA 4E4NA 1M14A 2IVTA 4FSQA 4U0IA 2Z8CA 2FGIA 5JQ8A 4E93A 4TY1A 4KKEA 5HCZA 2OF4A 1P2AA 3Q53A 4KD1A 3RNIA 3MN3A 4D4YA 4OTIA 4AZWA 3Q6WA 4CMOA 4GCJA 4HYHA 4MEDA 1H08A 3NSZA 2VTIA 4KIOA 4MD7E 3R8LA 5J7HA 2DWBA 1P4FA 3K2LA 3QD0A 4QMPA 3ZFMA 4A4OA 4BDFA 4IM3A 3OBGA 3B8QA 3QTRA 3DBEA 3R04A 4NTSA 4LUDA 3G2FA 4P5ZA 4DFXE 3NYVA 5ETFA 4QYEA 2YM8A 4M84A 4BGGA 2EU9A 3CTHA 4CRSA 4NM3A 4MNEA 4D0WA 5HLPA 4O96A 2C68A 1I44A 4Z9LA 3D5XA 3SW4A 3BU6A 4O0RA 4BCMA 5CEIA 3E8NA 2WPAA 4TYHB 3ORPA 3NGAA 1NVRA 1PY5A 4D5HA 4S32A 5AP1A 3E3PA 1BI7A 3IQ7A 3R9OA 3RHXA 2J6MA 4A4LA 2J5EA 5LWNA 3LW0A 5HU3A 3KULB 3RAKA 3TV4A 3NUXA 3PIYA 5JGAA 3UOHA 4E6AA 5IG1A 5L2SA 2ITWA 4QO9A 5HIEA 4FSZA 1M52A 2HENA 2Y9QA 4U42A 4YZCA 3ETAA 5AUWA 3TWJA 3Q2MA 3TZ7A 5A46A 4C33A 4F7NA 3UPZA 1VEBA 3TNPC 2C0IA 3HP2A 4P90A 5DT4A 3UYTA 4KBAA 4FZ7A 4CKIA 1OECA 2EXMA 4GK3A 3MFRA 4MKCA 1PKDA 1Q62A 2RIOA 3Q9XA 4D4SA 3DT1A 4GSBA 3VBQA 3HDNA 4F1TA 3GCPA 3EKNA 2YIRA 2R3OA 2CDZA 3W33A 2XNEA 4FIEA 4DEHA 2C47A 4QQCA 4E5AX 5L4QA 1Q8UA 3MPAA 3WIGA 2WZJA 4ACHA 5M55A 3DDPA 2REIA 4ONAA 4H36A 1R39A 4CFXA 3P7CA 1YXSA 3PUPA 1A06A 5JZNA 1UNHA 3VBXA 4EBVA 3R1SA 5AEPA 3E88A 4RVMA 3HRBA 4IAIA 3HRFA 4GW8A 3GGFA 3ODZX 4J99A 5BMSA 3QL8A 2G2HA 3LFDA 3KCFA 3C13A 4QP7A 5BVFA 2XB7A 3LJ2A 4BL1A 2Z2WA 3D7TB 3MA6A 5DR6A 3IPHA 3WZUA 4EC8A 5IUIA 4DEIA 3LE6A 4JBPA 3OY1A 5L2TA 1UU8A 3ZDIA 4U45A 3H3CA 3LM5A 3QBNA 3HKOA 4PMTA 3AMAA 4R8QA 4WUAA 1Z5MA 4BTMA 4Y95A 4ZSAA 1ZOHA 4GT4A 4DTKA 4TNDA 4DFLA 5FEEA 2X81A 4RX8A 2I1MA 2XK6A 5L6PA 3CPCA 1RJBA 1RDQE 4HCUA 5D7VA 4P7EA 4UMQA 4CFUA 3UNKA 2BILB 2KULA 3ZSGA 3FMHA 4FG9A 2HXLA 4EYMA 4FNZA 3K3JA 3WF5A 4WG5A 1YOMA 4AE6A 3VUHA 4D28A 1ZWSA 2PMOX 3ALNA 3E7OA 4XNEA 4QMUA 4D1SA 4UXQA 5EH0A 2DQ7X 3THBA 3VS2A 4MX9A 5IA4A 4FICA 5BYYA 3BV2A 4G3EA 4TWPA 5D9HA 4FYOA 3AC4A 4H58A 2XK8A 4U43A 5CZHA 4NH1A 1XR1A 2YCFA 5FBNC 1FQ1B 2YIQA 4EH9A 4WKQA 3GCVA 4L7FA 1YOJA 2W1EA 5FGKA 3IW6A 3UGCA 3I5NA 5LVOA 5FRIA 4EHZA 4HZRA 4NU1A 5DHJA 5I3RA 2QU5A 2F2UA 1QL6A 3D5WA 3LXPA 5CU2A 3WE8A 5CYIA 4J98A 4HJOA 3KCKA 4B4LA 1ATPE 3VULA 5IA1A 4ENXA 2C1AA 3PWDA 4BIDA 1YXVA 4FT7A 3V6RA 2B1PA 3LCTA 2R5TA 5CVHA 1PXPA 2QNJA 4IJ9A 4DINA 2W5BA 3TZ8A 4DAWA 2C3IB 2PVFA 2XK7A 4LOOA 1MRYA 2B53A 3HGKA 4E26A 3D14A 3VRZA 1JOWB 2C30A 2Y0AA 2ZVAA 5AM7A 3ALOA 2I0HA 3FDNA 2H34A 5E8XA 4U79A 4C62A 4RQKA 2EWAA 4ZTHA 3DKCA 4QMYA 2JIIA 2YITA 2WQEA 3UJGA 3PVUA 1JSTA 2JBPA 2V0DA 3FV8A 3B2WA 1O9UA 4YPSA 4BCPA 4C2VA 5HORA 3FZRA 2WU7A 4JDJA 4JI9A 4XV9A 5LQFA 3UO5A 3QRKA 3FZOA 3CGOA 3PXRA 4FV0A 3FBVA 3LAUA 3SKCA 5ETCA 2C6LA 3G9LX 4R7HA 4W9XA 2WIHA 3QTIA 4FKLA 4FV4A 3FZ1A 4UZHA 5HQ0A 1GAGA 3D15A 1YDTE 3U8WA 3LIJA 3U51A 4LQMA 1IR3A 3QZFA 2IW9A 4IVDA 3R28A 3S3IA 3CE3A 3WI6A 4EKKA 4A9TA 2C3LA 4HNIA 3KF4A 4ASXA 4DEBA 3EQGA 4AZVA 3VW6A 5HG5A 5T6KA 5AUVA 3AD4A 4UALA 3R8UA 4EJNA 4JDIA 2YWPA 3MVMA 3OC1A 2HZ4A 4FIHA 2PVNA 5CT7A 1YXTA 4XP2A 3EN4A 5JSMA 1YDRE 5DVRA 2XCHA 4J1RA 4C4IA 4OAVB 2PVYA 2WMTA 1ZYDA 5CEMA 3OROA 4BZOA 5GNKA 3VW8A 4C3RA 2OH0E 1XHAA 4F9AA 3D2IA 3O51A 4RWLA 2X39A 5FP6A 2C6EA 2R3FA 5EI6A 3G0EA 3C4WA 3BBTB 5K4JA 3ZO2A 2BZKB 3NCGA 4LI5A 3TG1A 3V8WA 4CFNA 4BHNA 4S2ZA 2BAJA 4AA0A 3POZA 1AQ1A 3NDMA 4M69B 4TWCA 4O0TA 3PPJA 1ZAOA 1OIYA 4GJ3A 5IA2A 2ERZE 4J53A 3H0ZA 2BZIB 4JLCA 5LCJA 3OWJA 4N4SA 3D2KA 2FB8A 4V05A 2XIYA 2P33A 5BVWA 2X0GA 2BDJA 1JVPP 1FPUA 3KEXA 1STCE 4JX7A 4MD8E 4YC8A 4DEEA 2ZDUA 4FSUA 4FVQA 3HNGA 3DAEA 3R1NA 4U8ZA 4IFCA 4Q9ZA 3PA4A 5T3QA 1DS5A 2FSTX 4N70A 1HCKA 2CPKE 2GHLA 2VGOA 4AOJA 3OZ6A 4EOMA 3PP1A 5C8NA 2O5KA 4IZYA 4RFMA 3R0TA 3W2QA 1W98A 3QX2A 1H0WA 3KK9A 1GZOA 4MWIA 4ZP5A 3RPVA 3OXZA 5T68A 4MHAA 3FY0A 2Y6MA 2R0UA 2X2LA 3LFAA 4O0SA 3AT4A 3FMNA 4TYJA 3TNHA 4YSMA 3U4WA 3QRTA 3PIXA 4IB1A 4PRJA 2BKZA 1WBSA 3NCZA 3PE1A 4NIFA 5TKDA 4BIEA 4HCTA 5I9ZA 1M7QA 2C5VA 3LPBA 3E7VA 2FA2A 2J0JA 3FYKX 3MFSA 3EKKA 4U44A 3VQHA 3QQJA 3BEAA 2UW6A 4EH8A 2W1ZA 3EN5A 4NKSA 1PMUA 3VVHA 2PMNX 3QGWA 2BRNA 2VD5A 2YN8A 2ZB0A 4A9RA 3UG2A 4WUNA 4B8MA 3GOKA 3I1AA 3FQHA 4KA3A 4LYNA 3E64A 4F99A 5J79A 1H1SA 3MY1A 2J51A 4X3FB 1Y57A 1QPEA 3PPKA 4ZJIA 4KRCA 2XK9A 3UO6A 2B55A 5BYZA 4G6NA 5F20A 3M2WA 5AP4A 1REKA 4FKRA 3V5WA 4I92A 3D5VA 4CXAA 4V0GB 5CF5A 2QONA 3BEGA 3FKOA 2W96B 3KVXA 1OKVA 3FSKA 4IADA 2PY3A 5ETIA 4AGDA 4FZFB 4AW2A 2X1NA 3PVWA 3NUPA 3Q32A 2C5NA 3D0EA 1XO2B 5KMKA 2WTIA 4XCUA 3KMWA 3RJCA 4P4CA 4QTAA 3OEFX 2ZOQA 2UZNA 1IA8A 3P7BA 4M3QA 4ALUA 5LMAA 1ZYCA 4L3JA 4WSQA 2P2IA 2UW3A 1W0XC 5I5ZA 2B54A 4I5CA 5HO6A 3UVPA 2UZOA 4B99A 4HGLA 3B8RA 3A8WA 4G9RA 4R3CA 2CHLA 3QD4A 3TJDA 2OH4A 3DFAA 4G31A 4EZ5A 3EQFA 3PXKA 4RWKA 3KXMA 1OKYA 3BYUA 4JX3A 4RVKA 4YZ9A 4FT5A 2ZDTA 4JVGA 3P23A 3QTQA 2ZYBA 3AMBA 5GJDA 4C7TA 2VNWA 3S95A 3WE4A 2P4IA 1SNXA 3LLTA 4LM5A 1Y8GA 4PF4A 3FMDA 5TO8A 4IVBA 2YM4A 3LM0A 3VNTA 5HBJA 2BRBA 3V5LA 2NRUA 2PL0A 2H6DA 4AFEA 5CEPA 4FL2A 5IISA 3IW7A 5HBEA 2OJIA 4NFMA 4UBAA 2WMWA 4CZUA 4OTHA 5AV0A 4K33A 3ZLSA 4QQTA 4ANNA 3F5UA 2V7AA 1YHVA 4BFMA 5CVFA 3ET7A 3GP0A 4FKQA 1UKIA 4ASDA 4LMUA 1V0BA 4ZK5A 1GY3A 4II5A 3UP7A 3RWPA 2WELA 4M14A 4CCUA 3T8OA 4O0WA 1GZ8A 4OTQA 2XUUA 1Q4LA 3PY3A 3QA8A 2YFXA 4CFVA 3P9JA 3AG9A 3KRWA 3DTWA 3DNDA 3O96A 3SV0A 2CCIA 1UU7A 4YBJA 2CN5A 4YLJA 3HV4A 5H8EA 2XEZA 3O7LB 3OCBA 4ANSA 2XRUA 1M2RA 2P55A 3BLHA 4MTAA 4XUFA 3UQCA 2O0UA 4ARKA 3C7QA 4HNFA 3LFSA 2WTVA 4OTFA 1XBBA 2YIWA 1LEZA 1EH4A 4RVTA 5IA3A 4Y72A 3TTIA 2VTHA 1FMOE 4YSJA 3F3WA 5AIRA 3RI1A 3QZGA 4JRNA 4YHJA 2FSMX 5C9CA 5LXMA 2B7AA 3PXFA 5CALA 1BI8A 3AGLA 3BHYA 3F66A 5HX8A 5JT2A 3SRVB 2DUVA 4DH1A 4USFA 5FXRA 4YTIA 4MCVA 3FL4A 4WNOA 4JDKA 4CLIA 3EHAA 5H8BA 3JUHA 3DY7A 5LVLA 3DV3A 2CLXA 2QQ7A 3Q4ZA 4HVHA 5L8LA 4O0XA 1KE9A 2IVUA 2OXXA 3DZOA 2GHGA 5HESA 2XEYA 2X7FA 3HDMA 3IG7A 4F0IA 4IZ7A 1ZZLA 4FT9A 4B7TA 5LMKC 2LGCA 3IGGA 2VO7A 4CRLA 3U9NA 2W4OA 4NM5A 5FDXA 5M4UA 2J0MB 2OFVA 2RFNA 3VUGA 4X2JA 4OW8A 5EI8A 3RHKA 4IX4A 4XV1A 4JS8A 1F5QA 3QLFA 1KV2A 5HBHA 3WF6A 3ZBFA 4AAAA 3U9CA 4UWCA 2XA4A 5DH3A 1YI3A 2P2HA 3WF9A 4USEA 3QAME 4X2NA 1WCCA 2F7XE 2VUWA 2Q0BA 4O2PA 4FV9A 3CD8A 4XRJA 3WZEA 3GC9A 4KIKB 3RK9A 2J50A 2XKEA 3P86A 5D41A 3WARA 2UZTA 1GZNA 2RFSA 4DC2A 5F94A 3ULZA 2BZHB 3C0IA 3F2NA 3KMMA 4J8NA 2BRGA 3JXWA 4ANMA 3CD3A 2XM8A 2PZ5A 3D4QA 4MF1A 2F9GA 3Q4TA 4IB5A 4RIYB 3WIKA 4C8BA 2J90A 4FZ6A 5FQDC 4AACA 3IOKA 2WMVA 4RX5A 4HYUA 4KS8A 3CTJA 1G5SA 2VX1A 2BFYA 4G6LA 5FM2A 4BDCA 3C9WA 2W05A 4KSPA 3GU6A 3BWFA 4OR5A 5A6OA 2ITNA 3CPBA 1YKRA 1GIHA 5JGDA 2W1GA 3RZFA 1H00A 3EH9A 5ACBC 3BQCA 4YJPA 5DFPA 5DMZA 4PP9A 2GTNA 3CIKA 3EQCA 3F3ZA 4GG5A 4ZY4A 4EH3A 4NCTC 3HV5A 4BWXA 3AC5A 3ZZEA 1CM8A 5CF8A 3A7FA 2YM5A 3Q5ZA 2HOGA 5AV2A 2VZ6A 4JQ8A 3TIYA 3MJ1A 2ITPA 5CVGA 3ZS5A 3GBZA 4G16A 1H1WA 5D11A 3ULIA 5HO8A 2UZDA 2W4JA 3LJ0A 4WNMA 4V04A 3PE2A 5E8ZA 4XJ0A 4XLVA 4PUZA 3BGPA 2WOTA 4G34A 5CU0A 3OTUA 2V55A 5LVMA 4WNKA 5EDRA 4C4JA 4C34A 2PSQA 3A4PA 3ZO3A 1YHWA 3G5DA 4YJVA 2UZVA 5HVYA 4FG8A 1UWHA 2CJMA 2XNPA 4JIKA 4CT2A 2WMBA 2C4GA 4P2KA 5KKRB 4J95A 3UIMA 1YQJA 3A2CA 4CFFA 3NX8A 5GZ8A 4M68A 3ZRLA 2O8YA 4QNAA 4ZSJA 5I9WA 5KX8A 4HGSA 5CQUA 5AP2A 3WF8A 2CMWA 3UO4A 3RM7A 5KMOA 3EFJA 4RFYA 3GUBA 4QYFA 5KHXA 1J91A 4IWPA
chains in the Genus database with same CATH superfamily
4BDIA 3HMPA 4IANA 5LVPA 3GNIB 3PP0A 1Q3DA 4X2GA 4EZ3A 3SXSA 2F7EE 5L3AA 2R2PA 1WZYA 4FK6A 4C57A 4YURA 3NNWA 2H96A 2QKWB 2YHVA 2UW8A 5LWMA 3GI3A 3TEIA 4DYMA 3ZBXA 4ALVA 4NFNA 2NRYA 5CEQA 3MH3A 2XNGA 5FTQA 1U5RA 4GJ2A 5B2LA 2J0IA 5EDQA 4JAJA 5IEYA 3KULA 1B6CB 4NK9A 1IG1A 5KBQA 4I21A 4USDA 5HIDA 4D0XA 5BQ0A 4I5PA 5LARA 1VYZA 4EKLA 2PE1A 4MD9E 2A98A 4ZS0A 1M2PA 3QCQA 3PJ3A 3ITZA 3TI1A 2B52A 3TKUA 1BYGA 5HTBA 4WRGA 3NW5A 4IC7A 2YIXA 4XOYA 5EW8A 4LFIA 2W5AA 2I6LA 3KB7A 3PA5A 4TYGA 3V8SA 2WGJA 3ZM4A 2ZV2A 4AT5A 4E4LA 2BMCA 1OL5A 2RG5A 4X3FC 1FVVA 1WBNA 3GEQA 1TQMA 4JG7A 3C1XA 4ZEGA 2X4ZA 2Y6OA 3PZEA 5B2KA 1LPUA 4K18A 2G01A 2IW6A 3CQEA 2WKMA 4J7BA 3IO7A 4ZTQA 4HVIA 3H9FA 2BAKA 5D1JA 3F82A 5AR4A 3QTZA 3R71A 2FSOX 5E90A 3EFKA 4WD5A 4AGWA 4F9WA 2Y4IB 3Q60A 5A14A 2VTQA 3LFCA 3ORZA 4YJSA 5KZIA 3S0OA 4G3DA 3D94A 3R7YA 4PTCA 2ITXA 4NM7A 3N9XA 1KE8A 4W4YA 1SYKA 3R21A 3ANRA 5KMLA 3QRUA 4Q9SA 3IKAA 4YP8A 4A9UA 4F08A 3QYWA 3COHA 1NVQA 4F9CA 1KSWA 4U40A 1H1RA 2JKMA 3CY2A 3SOAA 4E7WA 3F2AA 2ITOA 1U54B 2W1FA 2XJ0A 3A62A 4IAYA 4CYJA 3LVPA 3NUUA 2VTTA 3JYAA 4UB7A 4MXYA 5C8MA 4K1BA 4OTRA 2YEXA 2X4FA 3WF7A 4D2TA 4FIGA 4W8DA 5AUUA 1YVJA 3HV6A 5AV1A 4FV7A 3FI3A 5J87A 3ZC5A 2I40A 3QHWA 2C6KA 3Q4CA 4TZRA 1XBAA 4F0FA 4R3PA 5J5TA 3VAPA 4XG8A 2W1CA 4I23A 2R3PA 3HP5A 3V3VA 3QWKA 1FINA 3QF9A 4PDSA 2JIUA 5E8WA 2F49A 2GNFA 2BDWA 2HELA 4GIIA 2XVDA 3UIUA 4FV3A 2IZSA 4XX9A 4FEQA 4JXFA 5H9BA 4APPA 4KKHA 1ZYLA 2QU6A 2VWUA 2QOIA 3BE9A 3KQ7A 3W2CA 1V1KA 5LMKA 5M56A 1PYXA 2OZOA 4MK0A 4X0MA 4EK3A 4XOZA 1UNLA 2GNJA 3DBCA 5AV3A 4C37A 4QMXA 5ITAA 3R1QA 3RPSA 4NW5A 5HO7A 4GUBA 2GHMA 4CQGA 3FZPA 4FTCA 4O6EA 3JVSA 5C01A 4EK6A 4XV3A 3DKFA 2PTKA 4YJNA 3BI6A 3EQDA 4E4XA 5E8YA 5BVOA 3R8VA 3U6JA 3GU8A 1R3CA 2BTSA 5KUPA 1XKKA 4TRLA 5CAVA 5M44A 5AX9A 3AQVA 4HCVA 3O71A 5AJQA 2B9HA 4I4EA 3RZBA 1QPCA 3R7GA 4ZSEA 2ACXA 1Q24A 4A4XA 3KA0A 2CGXA 3O7LD 4GS6A 5EKNA 4RPVA 3KY2A 3W8LA 2HK5A 2WMQA 3ZCLA 4FKJA 4FT3A 3CR0A 4XG3A 4MNFA 5D7AA 2C0OA 3LJ1A 3V5JA 4BDBA 3VBYA 3RAIA 4IDTA 1YWVA 2QLQA 2ETKA 3EZRA 5ANEA 3ROCA 2YJRA 4ANLA 4BZNA 5K5NA 5CLPA 5JFXA 5C27A 4MXAA 1ZZ2A 4XEYA 4BTKA 3GC0A 5HOAA 2JGZA 2E2BA 4L3PA 2WHBA 3LXNA 3EIDA 2W1IA 3MY5A 4BWKA 2A1AB 3F9NA 1WAKA 4L52A 4C59A 4FKGA 1TVOA 4IX5A 3EQPA 3LXLA 2V5QA 3FYJX 4RRVA 5DN3A 5H8GA 4IQ6A 2X9FA 3ZZWA 4E1ZA 3BHVA 1E1XA 3I81A 2XM9A 4PL3A 4EYJA 5ETAA 5KKRC 2JKKA 4RZVA 4AW1A 4EOSA 2UW0A 3O50A 4YUQA 3HZTA 2YCRA 1VYWA 2AC5A 4ACMA 3JY0A 3UE4A 3UOLA 1ZMVA 4RWJA 1M7NA 5AP7A 4DFNA 4IH8A 3DKGA 3P1AA 5HNBA 4CNHA 2ZB1A 4KNBA 1H0VA 4JBVA 2F4JA 2EXEA 2OXDA 2R64A 4TWOA 4WBBB 5K4IA 2UZUE 4I4FA 4D1ZA 3A7JA 3QXPA 4DITA 4IB0A 4K11A 5CX9A 4I6BA 4AFJA 4D2RA 1WVYA 2GSFA 3DTCA 3NUNA 2VTLA 2PZYA 3W10A 5JRQA 5L2WA 3RM6A 4QMSA 3CC6A 3MIAA 4FODA 4EH4A 4RC4A 3OHTA 4UY9A 4M69A 4ZTRA 1JSUA 2VTAA 3IONA 5CZIA 4PPBA 4JJRA 4XS2A 2EUFB 1CDKA 5F4NA 3CQUA 3W2PA 3QCXA 3FHIA 1ZLTA 4FNYA 4AZSA 4BHZA 1U59A 4PL4A 2VWBA 3A4OX 3FLNC 3MVLA 2OF2A 4X6QC 4DEDA 4DLIA 4AZEA 5L6OA 4BC6A 3BBWA 3G6HA 2X2KA 4FTNA 4QMVA 5FD2A 4QRCA 4EQCA 2W99B 4MQ2A 2W1DA 2QOHA 4NTTA 2IZTA 4RIXA 4FL3A 4RX7A 5IMXA 3NIZA 4TTHB 4FKTA 3V5TA 4L3LA 5J1VA 3A60A 3PXZA 3VUIA 1H07A 4UN0C 1H26A 3ZSIA 2RGPA 4EBWA 5G1XA 4DGLC 5CU6A 1MRUA 5AP6A 3U6IA 4ACDA 4EOQA 5BUJA 1Q3WA 4GT5A 4TNBA 5M53A 3MYGA 3IOPA 1U4DA 4HOKA 4HZSA 1XBCA 3UP2A 5CASA 1Z9XA 4PL5A 3PPZA 3EB0A 4AW0A 3QQFA 2RKUA 4D1XA 2DS1A 3MH0A 3M42A 4IDVA 1U5QA 4AZFA 3OCGA 4F1OA 4NJ3A 5BVKA 4LG4A 4J97A 3AGMA 4QTCA 2UZLA 5I9VA 4JG8A 4XYFA 3QHRA 4MNEB 1KOBA 1H4LA 5HCXA 5ANJA 3H9OA 5HE3A 4QP2A 2HW6A 4AT4A 5JFSA 3CEKA 4E6QA 4WO5A 3Q04A 4I24A 3ZXZA 4F7SA 2XCKA 3PJ8A 1GJOA 1J3HA 3ACJA 3MGYA 4V0GA 4AG8A 3EFWA 5JZJA 3UIBA 4FTJA 1SMHA 1UU3A 4PPAA 5A3XA 4RT7A 1PF8A 3II5A 3JVRA 3PIZA 3R8MA 3T3VA 4MVFA 4EOPA 1MUOA 3NNVA 4CSVA 3S1HA 4O22A 4J96A 1LUFA 2R9SA 4Z7GA 1YWRA 3FE3A 2BRHA 1U46A 2PE0A 1KE6A 5EKOA 3ZSHA 1MP8A 4ZJJA 3KL8A 2CCHA 5TT7A 4L43A 3ZFXA 3MBLA 1SVEA 4QPAA 1ZMUA 4JBOA 2Z60A 3SA0A 3IW4A 4KBCA 2PE2A 4ZTNA 4CMTA 1H28A 3DBFA 4FVPA 4QYYA 5DT3A 1OPKA 4F6UA 1APME 1DI8A 3OP5A 3KXXA 4MWHA 3MY0A 4IWDA 2R3GA 4Z16A 2ONLC 3PA3A 3QRJA 4XH6A 2YLFA 4JG6A 2GCDA 3P78A 5L2QA 5BPYA 5FBOA 1ZYSA 1YHSA 2GMXA 5B0XA 3ZUUA 4OT5A 2O64A 1JNKA 2HAKA 4L44A 5DI1A 5IA5A 3R7UA 2WMAA 3GT8A 3RALA 2JAMA 2WB8A 3PSCA 5K5XA 4LV8A 2VO6A 3Q9WA 5AWMA 5IKWA 4ZIMA 5HLWA 3HMNA 2SRCA 3FMMA 2KTYA 3UQFA 1ZMWA 3GB2A 4BDEA 4Y8DA 2C0TA 4I94A 2O2UA 4JR7A 5ANKA 4D2PA 3NNUA 3LCDA 3VS6A 3PZHA 4CZTA 2OZAA 4IEBA 4RJ3A 3R02A 2JD5A 5J9LA 3E87A 3Q6UA 4V01A 4FBXA 4XHKB 2YAAA 5AUYA 4XG6A 3ZYAA 3QQKA 4F09A 1WFCA 4GMYA 4D5KA 3R7VA 2C6MA 2R3KA 2Y4IC 5FP5A 2JDRA 3P08A 2ZV9A 2YABA 4IAZA 5HE0A 5TR6A 4F9YA 3VHKA 5JMSA 3OY3A 4DH7A 1WVWA 5HG7A 2F2CB 3D9VA 3HVCA 2HY0A 3FPQA 4BZDA 4YR8A 4F1MA 5HU9A 5CNNA 3DNEA 4RWIA 3OF0A 4C58A 3C4FA 2G9XA 5JFWA 1PJKA 1HOWA 3F3VA 5EM8A 5HD4A 3I6UA 4GU9A 1T46A 3CJGA 4BCJA 1YI4A 2Q0NA 2RFEA 3FQSA 4YO6A 4GIHA 2R7IA 3KKVA 4O0VA 2PVLA 3KRJA 3F5PA 5AA9A 1G3NA 4OGRA 3L9MA 5L8JA 5CAQA 2XNNA 2VX0A 2VO3A 4UZDA 3C5UA 2VN9A 3UVRA 3QUDA 2WFYA 3HMOA 3R30A 4O4EA 4R7IA 4YBKA 5CXHA 4DCEA 4EOLA 3VJOA 1WBPA 1T45A 4BCIA 3FKLA 3HECA 1JKSA 4Y46A 3FXZA 2BZJA 2E9VA 2HCKA 2BUJA 1LEWA 2YLEA 4GL9A 4LRJA 4DFZE 2PMLX 2VGPA 3TV6A 3GQIA 5DR2A 3ZUVA 3F5GA 4U9AA 5FM3A 4HGEA 2C6IA 3BCEA 4S33A 5BNJA 2ZMDA 1PKGA 3F61A 3VBWA 2B9IA 4EOKA 4QQ5A 2GFSA 4F0GA 3R1YA 4G2FA 1GIJA 5AUTA 4FA2A 4I22A 4M15A 3FI2A 3LCSA 4FZAB 5ANGA 5HX6A 1R0PA 4ZAUA 3BHTA 4O6LA 2W5HA 3CGFA 5TOZA 4B6LA 5HHWA 2A27A 2J5FA 5CI7A 3RAHA 2A0CX 4AP7A 3T3UA 3OS3A 2BR1A 2FUMA 2X8EA 2JDVA 1OI9A 4KIKA 3VRYA 4MBLA 4NEUA 4C35A 3PY1A 3HEGA 2W9FB 4G3CA 2PVHA 3QQLA 4ZTLA 5JFVA 4I0RA 4AA4A 5EM7A 3TT0A 2XNMA 4C2WA 1TKIA 5IUHA 3DJ6A 5BMMA 3OXTA 4QQJA 1W8CA 3Q52A 4PV0A 1UA2A 1ZXEA 2GNHA 5E8SA 3ZMMA 4BKZA 4F4PA 3BLQA 2QURA 3Q9YA 4RJ8A 5AAFA 3V51A 4BDAA 5J5SA 3TTJA 3T9TA 3O23A 4K9YA 4BIBA 3RPOA 2WO6A 4GEOA 5EYMA 3FL5A 4GRBA 4CFWA 4XMOA 3RKBA 2QOQA 4L7SA 5E91A 2X0PA 3C4ZA 1CKJA 3DFCB 4BBMA 5A54A 3QLGA 3FC2A 5A9UA 3RK7A 3PG1A 4D4RA 3BIZA 3WZJA 2WMRA 3CBLA 1AGWA 3K54A 4GVJA 3W8QA 4BICA 3KFAA 4RJ5A 2P3GX 4YHTA 4ZLYA 2GFCA 5LCKA 2VTNA 5EOLA 2ZAZA 5ICPA 5IF1A 3POOA 3OFMA 4C4HA 3QQUA 4OTWA 4QYHA 4O4DA 4FSTA 4JBQA 1KOAA 5CU3A 2W4KA 3L9PA 3MWUA 2XIXA 3QKKA 1UNGA 4IVCA 2UVYA 5CF4A 2OW3A 2WOUA 2YIYA 5E92A 3PJ1A 4BF2A 4KBKA 2WU6A 4ITJA 3BU3A 3LZBA 4BDJA 4C38A 5GZAA 5AR5A 2QCSA 2J2IB 4QMMA 2V62A 1URWA 1P5EA 2UZWE 4D2SA 2X0QA 5JH6A 3OCSA 4W4VA 4YJOA 1BMKA 5IA0A 4QMLA 5CF6A 5LVNA 3HUBA 4QT1A 3E93A 3ANQA 2OIBA 4ZOGA 4C4GA 1CSNA 1O6KA 3QC9A 5GJGA 2HZNA 1YRPA 4LGDA 1PW2A 1NVSA 2C6TA 5I9UA 3ZTXA 3GFEA 3O2MA 3DJ5A 2GPHA 4ACGA 3ZRKA 4PMSA 3TUBA 4YJQA 3NAXA 1YXXA 4GVAA 3PJCA 3GU7A 2FH9A 4NIFB 4QPSA 4OBQA 1OL6A 1Q8YA 3F6XA 5EM6A 3RP9A 2JIVA 3AC1A 4LUEA 3UODA 4ACCA 4EH6A 3FC1X 1TZDA 1X8BA 1Q61A 2YJSA 4LRMA 4O21A 2OFUA 4Y5QA 3QU0A 3QTXA 4IACA 4BCGA 2A19B 1DAWA 2HYYA 5CT0A 4A9YA 4EOIA 3TKHA 3AT3A 5HEZA 5HZNA 3L8XA 4XRLA 3DCVA 4FGBA 4M13A 3KXHA 3FMEA 3G6GA 4IAAA 4ZZMA 3BPRA 4G3FA 1DM2A 2BCJA 2JDSA 2ONLA 2YM3A 4I0SA 4ZTMA 4L8MA 4IWQA 2QKRA 4N6YA 1ZOEA 2G1TA 4FUXA 4UWYA 4DEGA 4FSYA 3EFLA 5JKGA 3KXGA 4FT0A 1WBTA 4U7ZA 4UYAA 2WNTA 3FZTA 3BYMA 4K0YA 4EK8A 4GK4A 5E8VA 2FYSA 1KE7A 3AC3A 2UW9A 2NO3A 2VNYA 4ITIA 4RIWB 1K3AA 3TV7A 2HWOA 3KRXA 2WMUA 4ERKA 5CSPA 4UXLA 3R63A 4O0UA 3VF9A 2YM6A 4EK5A 4GH2A 1E1VA 4AN3A 3R8ZA 1SM2A 3UMWA 3QFVA 2VWVA 3G9NA 3ZLWA 1BLXA 5HLNA 2R3IA 3E5AA 1LR4A 2X9EA 2R3JA 4DG3E 4L9IA 1Y6BA 3AXWA 4IZ5A 4H3QA 4CQEA 4EORA 3MB7A 3GCQA 1Q8ZA 3ODYX 3QA0A 1W2FA 4MH7A 2WIPA 4EWHA 5IUGA 4CV9A 1W84A 2PMIA 3VN9A 2QC6A 1PXOA 4CT1A 2LAVA 1XH6A 4CFMA 5EHLA 4IIRA 4ANQA 4WT6A 1BKXA 4FV1A 4GUEA 3UBDA 4JR3A 4UX9A 4YLKA 3W1FA 4RG0A 4LL0A 3KGAA 3NYOA 3CY3A 3L8SA 3F88A 2BIKB 5FLFA 4L00A 2IO6A 4UMRA 5I9XA 4EUTA 1OIRA 3AD6A 3DK3A 3OOMA 3TIZA 4BTJA 2RSVA 4DEAA 3DDQA 1QPJA 4I6QA 3HA8A 3F3TA 4ERWA 1WVXA 4I6FA 3F7ZA 3IK3A 4U3YA 5DR9A 4ID7A 1NY3A 1ERKA 3N51A 1HCLA 5BUEA 2YA9A 3MVHA 4IFGA 3K5UA 5EYKA 2WMXA 2XMYA 4G5PA 2E9NA 2Z7LA 3GCSA 4IBMA 3OWKA 5G6VA 4UWBA 3NS9A 3W16A 4O1PA 3JY9A 1SVHA 4QTBA 3R9DA 5HVKA 3PXQA 4FZDB 4F7JA 3AMYA 4IX6A 4CZYB 2NP8A 3NIEA 5CS6A 5I0BA 4RA5A 2RG6A 3LXKA 3T9IA 2E9OA 4EHGA 1BX6A 3SHEA 2BFXA 4DG2E 2HIWA 3O8UA 3R01A 5HGIA 4EWQA 4RC2A 1W82A 3R7OA 2ZMCA 1ZARA 3GENA 3Q4UA 4L53A 4B0GA 2BRMA 3DK6A 4NT4A 4EOOA 4EC9A 2CGUA 4IB3A 4K8AA 4BWPA 3BE2A 4UMUA 4ZZOA 2X7GA 3ZO1A 3DQWA 3NPCA 3E63A 4WIHA 3TNQB 3VS5A 4TYHA 4AW5A 4FIFA 5JGBA 3MSSA 4OLIA 2X6DA 1F0QA 3RMFA 3QKLA 2X0OA 2ITZA 2VV9A 3OEZA 4QYGA 5J9ZA 3U6HA 5HNGA 4K2RA 3CCNA 4M0YA 4YNEA 3LQ5A 2WQMA 4RJ7A 3DBQA 3M11A 4E5WA 1Q99A 3AOXA 4O4BB 1VR2A 4UEUA 2QOBA 5TE0A 3O8TA 4IAFA 2W06A 3MTLA 5AR7A 2VWIA 1H24A 1JPAA 2RL5A 4NM0A 4YNOA 1GOLA 2E9UA 3KU2A 3BU5A 4FOCA 3QKMA 4UYNA 3CKXA 5J8IA 2OICA 1XH5A 1PXIA 2YCQA 1OMWA 3EQHA 4M97A 4KB8A 5DOSA 4L6QA 3EL7A 3CTQA 3PVBA 4OBPA 2ESMA 1NA7A 3BHHA 1DAYA 2R3QA 4U5JA 3ZONA 4W8EA 1OZ1A 5A4QA 1JSVA 3SW7A 3BGQA 5K3YA 3UZPA 3FLZA 1B39A 1YXUA 2C1BA 4RIOA 5KMMA 1GIIA 3CJFA 1H01A 3FMKA 3PVGA 4PNIA 4DFYA 3DU8A 3DJ7A 3ORNA 4XG2A 4HYSA 2OBJA 4K6ZA 4M7IA 3NW7A 4YHFA 3JPVA 2XNBA 4JL9A 4WNPA 5ANOA 3GFWA 2PUUA 4FOBA 5AR3A 2AC3A 5CENA 2GQGA 4FV5A 4IJPA 4G17A 5F95A 5EG3A 4ZY5A 5EFQA 1E9HA 2VRXA 3BHUA 5AIKA 1Z57A 4FTLA 3COMA 4GK2A 4WA9A 5FXQA 5CSXA 3VUTA 3D7TA 3O8PA 2DYLA 4HGTA 4IX3A 3FXXA 3QX4A 1MRVA 5EDPA 1Q41A 3LCOA 4CVAA 2C69A 4G6OA 4KINA 5HICA 4FTAA 4ALWA 2C3JA 1QMZA 1W83A 4MBIA 2I0VA 5CU4A 1ZY4A 4AOIA 4U41A 4X2KA 3ZEWA 5F1ZA 3EOCA 3OUNB 1XQZA 3UTOA 4AUAA 3G0FA 4DLJA 1XH4A 3OWPA 4HYIA 4OTDA 3CXWA 3IECA 3H0YA 3FXWA 3K5VA 4RSSA 3DB6A 3EMGA 4IVAA 1YDSE 3UMXA 2UVZA 2IVVA 4D55A 5LMBA 4Q2AA 3OW4A 2Y8OA 4BDDA 3IW5A 5IEVA 3DBDA 4S30A 5AP0A 3I0OA 1JAMA 2VAGA 3QD3A 3TUDA 2V7OA 3NW6A 2R3LA 5KMJA 4U3ZA 3ZUTA 1PXLA 2CGWA 3ZOSA 2QHNA 4ZSLA 5FWKK 3RINA 4ZLOA 4L68A 4MBJA 4GYGA 4RGJA 4ANBA 4FL1A 2OIQA 3G90X 3MFTA 1CTPE 3GC7A 3HV3A 1UVRA 4FMQA 3SQQA 3C0GA 5DLSA 3ENMA 4FTKA 4PQNA 4OTGA 3FKNA 2ZM3A 3EQRA 2OJFE 2OU7A 3OOGA 2VWZA 4I20A 3CP9A 4QP8A 4EONA 4MXZA 2X2MA 3ROYA 3FI4A 3TXOA 2ITQA 4E8AA 3PSBA 5CEKA 3ERKA 3EYHA 4F63A 4KIPA 1PYEA 3OXIA 2JEDA 3KK8A 3ZLYA 4QTEA 3LFQA 3HYHA 2YZAA 3L9NA 3OD6X 3PWYA 4IMYA 3NYNA 3UZTA 4D9UA 3RPYA 4CKRA 5AUZA 4IE9A 2QODA 2G15A 2QO7A 1WBWA 2OI4X 2QOLA 5CSHA 5A4CA 2O63A 3FAAA 1ZYJA 2UZBA 4R5SA 3L8PA 2QG5A 3G51A 3QTUA 4EQUA 4R3RA 5L6WL 3IDCA 2GU8A 3C0HA 2PZPA 4CYIA 5EW9A 3UC3A 2HZIA 3R8PA 3W2OA 4U80A 1JKLA 4NZWB 5CNOA 4H1JA 4GFMA 3ORLA 3I79A 2XKCA 1OPJA 2BVAA 3FLSA 3AC2A 3LQ8A 3E3BX 1CKPA 4NCTA 3U87A 3UYSA 4IAKA 2VWWA 4BI0A 4YU2A 4JNWA 4DH8A 4QPMA 3GOPA 4G5JA 3NUSA 3QZIA 3PRIA 2BDFA 4FKPA 4WG4A 3CQWA 3UNJA 1UU9A 2W1HA 4NSTA 4GU6A 4NW6A 3E92A 2VU3A 5DNRA 3RNYA 4A7CA 4AS0A 1S9JA 1OVEA 4M67A 1JBPE 2VWXA 3I4BA 3IGOA 4I5HA 2XJ2A 4L42A 3UNZA 3HMMA 3MS9A 3L8VA 5BVEA 5DA3A 3KF7A 4NKAA 3EL8A 2OWBA 3BQRA 4H3BA 4EK4A 4EQMA 3SAYA 1YW2A 2X6EA 1SVGA 3Q96A 3COIA 3HRCA 4C61A 4F6WA 3NUYA 1NXKA 3EN7A 1KV1A 3FWQA 4H3PA 5HG8A 3VHEA 3I7BA 5JRSA 4CV8A 2WTDA 2XK3A 2YDIA 5E1EA 4FKUA 2WAJA 2WQOA 3B2TA 3C51A 4M0ZA 5I3OA 3R83A 3RPRA 1JKKA 1UKHA 3LMGA 3W2SA 5B2MA 3SXRA 5HTCA 4PY1A 1QPDA 2QO9A 4O0YA 3V5QA 1R78A 2VTJA 1L3RE 2HY81 3ZHPC 3GXLA 3A7IA 2OO8X 5J95A 4K77A 3KXZA 4AN2A 1XWSA 1S9IA 2OJ9A 3VQUA 2ETRA 3G33A 3RGFA 3VF8A 4YZNA 5DGZA 4BBFA 2IWIA 5CANA 4AZTA 2R3NA 3EWHA 3K3IA 1URCA 4QOXA 4U81A 1OL7A 1BL6A 4BCHA 3SXFA 1VZOA 2OK1A 4ITHA 4E5BA 5GZ9A 2QOFA 5AUXA 5KE0A 4BKJA 3H4JA 2VWYA 3MFUA 3S2PA 1V0OA 2R3MA 3FJQE 2PWLA 4JDHA 5DPVA 3DAJA 4PTGA 3VUMA 5AAGA 2IVSA 3PLSA 4EUUA 4PX6A 4QMQA 3ZLXA 1XH7A 3O0GA 2QOOA 3ZH8A 2ZM1A 4FG7A 4DGNA 2QR7A 4R1VA 4CLJA 4YTFA 4F70A 5IPJA 2IZUA 1PXKA 5KBRA 2GS6A 3R2BA 3KRRA 4ZXTA 3PJ2A 3DS6A 5JQ5A 3NWWA 4FNXA 4LOPA 4AE9A 3KN6A 4NJDA 5EI2A 4R1YA 2G2FA 4X3FA 4E73A 4EEVA 4EH2A 5M4FA 5CAPA 3VS4A 2PVKA 3A7GA 3P4KA 1UWJA 2C3KA 2W0JA 3R6XA 4QMTA 1XH9A 2R3HA 4JT3A 2VX3A 3EN6A 3ZU7A 3VIDA 4BKYA 5JEBA 3RTPA 3DPKA 2ZV7A 2ETMA 3OMVA 2Z7SA 4QP1A 4JRVA 2WQNA 2YCSA 2BIYA 4IHPA 4F6SA 4APCA 4MAOA 3HX4A 3GQLA 1OPLA 5EHYA 3E8DA 2X7OA 3I0QA 3M1SA 5ACKA 4BRXA 2X8IA 2GS7A 3S4QA 1ZRZA 3A7HA 5JK3A 3CS9A 2FO0A 1ZY5A 3OW3A 4YMJA 3CKWA 4FTRA 3SD0A 4KABA 3BELA 2B9JA 3C4CA 1R1WA 1PHKA 3BYOA 2WXVA 3FLWA 4DGOA 4PDPA 4QMOA 5HCYA 5BX0A 4FSRA 2GNGA 3FHRA 1OUKA 1Q5KA 5F9EA 1B38A 4FR4A 2PK9A 4YTHA 5DRDA 3R7IA 3WYYA 5AV4A 4PMMA 5AA8A 1IEPA 5AR2A 3DK7A 2EVAA 4OTPA 3TCPA 1PMNA 3FZSA 3IDBA 4R5YA 3UQGA 2VTPA 4XP3A 3A8XA 4LMNA 4XP0A 2PVRA 4HPTE 1O6LA 3NNXA 5DE2A 5HTIA 5KHWA 4Y5HA 3RAWA 3Q9ZA 3TL8A 1YOLA 4A9SA 4BDKA 3QZHA 5EYCA 4JOAA 4ZY6A 4WOVA 2QD9A 5H3QA 4L01A 3QUPA 2OKRA 3MH2A 5KMIA 5DT0A 3W32A 3TNIA 4QMWA 4YJRA 4AGCA 3I60A 2R3RA 3IW8A 4X6RA 4C02A 4CD0A 2WTCA 2XKFA 3H10A 3RBWA 1JQHA 4KRDA 5D10A 5FTOA 4ZZNA 2BAQA 2OJJA 4CMUA 4F9BA 4QP4A 2FVDA 4CTCA 4FC0A 3OBJA 3UG1A 4J52A 2YISA 1FOTA 3TKIA 4ZJVA 2C6OA 2O65A 3TNWA 4EHEA 3LHJA 2F57A 3DXNA 3PG3A 4FV8A 2XBJA 3SDJA 3ZRMA 3QUEA 1P14A 4DGGA 3TZ9A 3LFEA 4IXPA 3A99A 3ZFYA 4YO4A 3H30A 4HVGA 1DI9A 5IMEA 3D5UA 4EH5A 2Z7RA 3R2YA 3DQXA 2CGVA 4TT7A 5J9YA 3GC8A 5GHVA 2UW5A 4FIJA 3DGKA 4RJ6A 1R0EA 1F3MC 3MIYA 1K9AA 4Z7HA 4FTIA 3UIXA 3I6WA 2WTJA 4FKWA 1JKTA 3QRIA 3DB8A 1OIQA 4FKVA 4I6HA 4JAIA 4AX8A 1SZMA 2QHMA 1PMEA 3BWJA 3MTFA 4WSYA 2XIKA 4X2FA 4KIQA 5L2IA 2F7ZE 1BUHA 4EHVA 3BYVA 1FVRA 3HLLA 5CSWA 3FLYA 3NYXA 5DIAA 3F5XA 3ORTA 3P5KA 5K9IA 3QCSA 3VWAA 4BCNA 2J0KA 1TQPA 5FDPA 3NR9A 2WTKB 4DH3A 3FMJA 1H1PA 3L9LA 2R0IA 2QR8A 3SRVA 3QWJA 4ASEA 2B4SB 3TACA 4RBLA 3MA3A 4RIXB 4F65A 3V6SA 4A06A 3FQEA 4BGHA 3OCTA 4BDGA 3F69A 4BCFA 2BALA 3WZKA 4MXOA 3MPMA 4RA4A 4XG9A 4QP6A 4ENYA 5BUIA 3UOKA 5M4CA 2XYNA 4BI2A 2YERA 5IH6A 2I0YA 1W2DA 4HVSA 1OIUA 2HW7A 4QTDA 4BGQA 3E8EA 5LJJA 5JN2A 2C5OA 4FSNA 3QD2B 2JKQA 4YJUA 2ZJWA 1W7HA 2QOCA 2PZRA 3RCDA 3DKOA 3MJ2A 4PP7A 3EYGA 4FSMA 3FLQA 4M66A 4YC3A 3OVVA 4F64A 3NRMA 5L8KA 4J8MA 3VUDA 3VJNA 1KWPA 2VO0A 2IZRA 4LGGA 4FTUA 1OKWA 3DOGA 4S31A 1XJDA 4O1OA 2YDKA 5A6NA 2JDOA 3HA6A 3HL7A 3HV7A 5GJFA 2Z7QA 4BDHA 3V04A 3GVUA 2J0LA 3ELJA 4RIWA 3ZDUA 2WEIA 2XS0A 4Q5EA 4RLKA 4UV0A 4EL9A 5HI2A 1XH8A 5M4IA 2XIZA 4QMZA 1V0PA 3D83A 1Y91A 5I4NA 2V22A 4D2WA 3R9HA 4RIYA 3SC1A 5HVJA 3FUPA 3EJ1A 1WMKA 3V5PA 2ITYA 3HUCA 4XLIA 5KMNA 3ZC6A 2CKEA 1GZKA 3OWLA 4DH5A 4BBEA 3OUKA 4U97A 3ZO4A 2C5YA 1WBOA 2XF0A 4E4MA 4D4VA 4TL0A 1FMKA 2OGVA 4W4WA 3BZ3A 2OIDA 4ZTSA 4U6RA 5IDPA 2RFDA 4YJTA 4GFGA 4NUSA 2C6DA 3TN8A 2XJ1A 3GU4A 2I0EA 4YZMA 3VS1A 5C1QB 5IZFA 2YACA 3QALE 4BYIA 1JWHA 2JAVA 5CAOA 5D12A 3C4XA 4TYIA 4MXXA 3KN5A 4FK3A 3AT2A 5AP5A 5IEXA 5A4TA 4FIIA 1M17A 1PXJA 5B7VA 5CQWA 2UW4A 3F3UA 4XV2A 3RCJA 4BTFA 4F7LA 3DLZA 5ANIA 4BCQA 4B8LA