4D2WA

Structure of melk in complex with inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
333
structure length
314
Chain Sequence
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCACGALAYAAPELIQGKGSEADVWSMGILLYVLMCGFLPFDDDTAAALVAKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title Fragment-Based Discovery of Type I Inhibitors of Maternal Embryonic Leucine Zipper Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 314
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d2wA00
2VZ6A 4MNFA 4ZJJA 2GSFA 4BCGA 5KKRB 2ZMDA 5FDPA 3C4XA 4QTDA 4FV1A 5CVGA 3ZYAA 4E4MA 5EH0A 5DH3A 5L8LA 3IG7A 3ROYA 1YDRE 2QNJA 4YLLA 3PIZA 4OBPA 1H0VA 3F88A 4CQGA 2RFNA 2IJMA 4KWPA 4Y5QA 3HYHA 2A0CX 3NUYA 3RPYA 4CZYB 1CSNA 4K9YA 4MD7E 5CEIA 1CMKE 3C4WA 3UTOA 2WTDA 3AG9A 3WYXA 3ZBXA 2ITYA 3TJDA 5AIRA 4O2ZA 3VNTA 3GU4A 2RKUA 1UU7A 2BZJA 5DRDA 4WG5A 4DEAA 4JDJA 1Q4LA 1Q5KA 3ORXA 3KN5A 3U6HA 3EN5A 4LRJA 2EXMA 2WZJA 5DT3A 3HP2A 4EK8A 2PL0A 3OZ6A 4YJUA 2HY0A 2WMVA 4YNOA 4CEGA 4KIPA 3O8TA 2QURA 5J7HA 4FZ7A 3FSKA 5AX3A 5LJJA 2RFSA 1OIYA 4TRLA 3FL4A 2WMXA 3CQUA 3SHEA 4YURA 3NYOA 4Y46A 1KOBA 2RSVA 2Z7SA 2OXYA 4OTDA 3UOKA 1DAWA 2WQOA 3DT1A 3FUPA 3DDPA 3TT0A 3DDQA 2R3GA 1Q3DA 3LFEA 2B7AA 3PFQA 3IQ7A 5AR2A 2F7EE 5GJGA 3SW4A 5KHXA 2EVAA 2YIRA 3GXLA 2R7BA 2ZV9A 4RJ6A 1PXPA 3RMFA 3T3VA 4HCTA 3PXZA 2C6MA 2UW9A 1OUYA 2VNYA 3IW6A 4G3EA 5AAFA 4OW8A 1XH5A 2QD9A 4TXCA 2PSQA 5TE0A 4M12A 4MWIA 2FH9A 3T9TA 3CPBA 3FLSA 5L6WL 4YP8A 5HIBA 3MWUA 4NJ3A 2V62A 3AMBA 3G51A 3KF7A 4UEUA 2BTRA 5DHJA 5K0XA 1ZARA 2B9JA 5HBJA 2X7OA 2VN9A 3U4WA 4JS8A 3COKA 3CBLA 4NT4A 2FSTX 2J0IA 5FBNC 2X7GA 3ORPA 4BIDA 4X3FA 4MX9A 5HCXA 4XOYA 1AD5A 2OF4A 3W1FA 2YERA 2ZYBA 3QRJA 4FKPA 3JYAA 2C6KA 3GFWA 4JRNA 5F94A 5L6PA 4LMNA 2CSNA 2ESMA 2WEVA 4DH8A 3FLZA 3GT8A 3C5UA 2BIKB 2EWAA 2I1MA 3OP5A 1SVHA 1K2PA 3IW8A 2ETRA 4Q5EA 3VF8A 3WZJA 4GUBA 4UMRA 4TYJA 3OFMA 4GU6A 4LGDA 1KOAA 3W8LA 4FSRA 3VQUA 3FKOA 3DBEA 1VR2A 3EQGA 4LOPA 3NGAA 3VN9A 2BVAA 2W4KA 3RINA 4YJNA 3FI4A 3NYXA 3OHTA 3MPAA 4JQEA 5AV2A 3OEZA 1MRYA 2UZWE 1GOLA 4O1OA 3NR9A 4RWLA 4C33A 1UU3A 4M0YA 5KZ0A 4K33A 4EWQA 3EMGA 4JAJA 5D7AA 5ANGA 3KXHA 4FG9A 1UA2A 2YIXA 3HMOA 3R21A 1YI4A 1RE8A 5JFVA 4GEOA 4O0WA 2VTSA 4ONAA 3ULZA 3ITZA 2A19B 5AR7A 2C3KA 3D5VA 2HELA 3Q6UA 2WMAA 1Q8WA 4O22A 4Y5HA 4RQVA 5EM5A 3OWPA 4RJ5A 3UNZA 1T45A 5E8XA 3L9NA 5HIEA 4KSQA 4YHJA 5A6OA 4XLIA 2W1HA 4GT3A 3VC4A 3DKGA 4BDIA 5CAPA 1ZYJA 2GNIA 4MXCA 2XCKA 3PJ3A 4E3CA 1KE7A 4UWYA 3CR0A 5IEYA 3LOKA 1W0XC 4UZHA 3UIXA 3IW7A 3BBWA 4Z7GA 4AT4A 4YUQA 4UXLA 4M97A 4GUEA 4YO6A 5CAOA 4KSPA 4XV9A 3UIUA 4PP7A 3C50A 5K4JA 3A2CA 5HU9A 3UMWA 4G6NA 4IJPA 2GS2A 5CF8A 4BWXA 2YM6A 5KUPA 4FZDB 3DXNA 3RI1A 3RK7A 5A4EA 3SA0A 4A9YA 1PF8A 4FV9A 4UZDA 4HVIA 4EK6A 1LUFA 5LVOA 5ANKA 3ENMA 3OROA 2AC5A 1ZOGA 3ROCA 5CF6A 5E8SA 3F3ZA 4I5CA 4TT7A 4IQ6A 3FHRA 3ORTA 3WE8A 4M0ZA 4EQCA 5JH6A 3Q9ZA 2RIOA 5LVLA 3VUMA 2XNEA 5IDNA 5EYMA 3NLBA 4YZMA 2ERZE 4E4NA 3W18A 3ZUUA 3M42A 3CPCA 3RGFA 3HRCA 4BDKA 2J2IB 5HO7A 2NP8A 5AP6A 4RIYA 4EOJA 3TUBA 4Y8DA 3PJCA 3TKHA 3H10A 3IECA 5C8NA 3HV3A 5DVRA 3BI6A 2VWVA 4LUEA 3C0HA 2VO3A 4MD8E 2PVFA 1GNGA 3QCQA 2DQ7X 2XNGA 5CQUA 1CM8A 2QO7A 1Q62A 1JPAA 4BDDA 5A4LA 2WQMA 3NAXA 2PHKA 2ZM4A 3P23A 3Q4TA 5LWNA 3OCTA 4X7QA 4IVDA 2IWIA 2BHEA 4DH5A 3H9RA 4BDHA 4J8MA 5J1VA 5IF1A 3BWFA 1YI6A 2CKEA 2XRUA 2VRXA 2YCFA 4MBJA 2PUUA 4A7CA 4CYIA 3PXRA 2R0IA 4FUXA 4BWPA 2WU6A 2H8HA 4YTCA 2ZB1A 3SDJA 2EB2A 3DBDA 3QTSA 2JIIA 2OSCA 1NY3A 1YWRA 4MXXA 3UC4A 4PMMA 3P9JA 4RA5A 5BVKA 2CN8A 3RZFA 3BKBA 1XHAA 3BX5A 3FI2A 2NRYA 2YCSA 3MIYA 4EL9A 3BYVA 3NYVA 4I3ZA 1SVGA 4JR3A 5IH5A 4GIIA 1U54A 1OKWA 3I0OA 4QP4A 5FTQA 3PIXA 4K6ZA 4BFMA 2A2AA 2W1ZA 5AR8A 4ERWA 3ZU7A 3FKNA 4NEUA 3VBWA 3ZLYA 3BV2A 5LXMA 3UOJA 1IASA 5F95A 1DI8A 4BHNA 2PVNA 5C8MA 4CFNA 4C0TA 4RT7A 2JAVA 3P86A 4GG5A 1XWSA 3R83A 4QP1A 1W98A 3R2BA 3HL7A 4IAFA 4ZSLA 4H3BA 2GS6A 5EM7A 3TL8A 2C6IA 5IA5A 3GCSA 1PMEA 3MSSA 5L3AA 3O50A 4XBRA 3O8PA 2Z7QA 1URWA 4DFNA 3QTZA 5HX8A 4HGEA 4XBUA 3AC8A 2PVHA 3KCFA 5IPJA 4PRJA 4U0IA 3BLHA 4DBNA 2LGCA 4H58A 4Q2AA 3A4OX 4FNYA 5A9UA 4ZAUA 1OKVA 2OFVA 5CT7A 4FTTA 4ZY5A 2VTNA 4C2VA 3RM6A 2X9EA 5HOAA 5B2KA 4FSZA 5CAUA 5HX6A 4DGNA 3QU0A 4QYGA 2Y9QA 2BZIB 4QMPA 4JX7A 1WBOA 4QMVA 1NVQA 3NSZA 3PLSA 5IDPA 3GNIB 2R4BA 4AOTA 4QPMA 4HNFA 1Z9XA 4L52A 4DCEA 5C26A 3L8VA 4I0RA 5DLSA 5JKGA 4ZOGA 3KU2A 3HMMA 3TZMA 3WIGA 4PY1A 1QPCA 1ZMVA 3C0GA 5A4CA 3NNVA 2HZ0A 1W83A 4Y73A 4EQUA 4D0XA 3OT8A 4RJ7A 2J90A 2NPQA 1OGUA 3OD6X 3PXKA 3QL8A 5I3RA 3TNWA 3ZFMA 3IDPA 2I40A 2XMYA 3DBFA 4YZNA 5EKOA 2H96A 2VTLA 2X8DA 1WVXA 4IAIA 4OTQA 3DJ6A 3IO7A 5D11A 3QRKA 5HKMA 3TV6A 3UG1A 3MIAA 1H08A 4IC7A 4MD9E 4DGMA 4EOPA 2XYUA 2VTTA 1YVJA 3AOXA 4QP6A 4X2KA 4E4LA 4GG7A 4CXAA 3ZSGA 3MBLA 2BKZA 2CMWA 2P2IA 3COMA 4EOKA 4C4FA 4IDTA 5LARA 2E9OA 1Q8UA 4YC3A 2WTKC 1UU9A 4FKQA 1VYWA 4NM0A 3EQBA 3RHXA 5TF9A 2RFDA 4Q9ZA 3DTCA 4FT3A 2VTJA 4U80A 4DFXE 4NIFA 3UZTA 1ZXEA 1SYKA 4YTIA 2O65A 5HTIA 3WIKA 2PVRA 3VAPA 4S33A 3ZRMA 4EWHA 3RJCA 3I6WA 3R7GA 4JG8A 4NUSA 3FWQA 2XKCA 3VBQA 4YBKA 5FQDC 4IX5A 5A4TA 3ZEWA 2XF0A 3B8RA 4KKGA 3B8QA 4O0UA 5D7VA 2YJRA 3SRVB 3EN9A 1APME 3AT3A 3BGQA 2ERKA 4ZTQA 4F08A 2PWLA 2G2FA 2O2UA 3A60A 3DK3A 5LMBA 4RQKA 3KQ7A 4F0IA 2R3HA 4B7TA 3ORLA 5LVNA 2ZB0A 4YJQA 1WBWA 4D2SA 1R0EA 3NRMA 3OUKA 2C0IA 3PY1A 3VRYA 3FLYA 1TKIA 4YZ9A 5B7VA 4LRKA 3S1HA 4GL9A 2HXQA 4LL5A 4K0YA 3WZDA 4RG0A 3MH3A 4QMQA 3NCZA 4F7SA 2I0YA 4EH2A 4BBFA 5EI6A 1PMUA 2XBJA 4PNIA 1NXKA 5A14A 2J5FA 2PVLA 3NIEA 4RJ8A 5D1JA 3G2FA 4RVLA 1KV2A 3SLSA 5AUYA 3BYMA 5HNIX 4IMYA 4Y72A 4FIEA 4H1JA 5JQ5A 1KE6A 3V51A 2JDOA 4NFNA 3DOGA 4EH8A 2R3RA 3ORKA 3KULA 5HE1A 3E7VA 4G31A 3CXWA 1V0PA 3C4CA 3DKFA 2OIDA 1M2RA 3DZQA 2OI4X 3KMUA 2IZRA 3BYOA 1ZY5A 3F5GA 5JRSA 4C36A 4FX3A 5IUIA 3TKUA 3PP0A 4ZK5A 3OC1A 5HO8A 1PXLA 5IUGA 3VS6A 3I81A 4AZSA 5E90A 4BBEA 1LPUA 1Y91A 5F9EA 5HLWA 4O0XA 4AN2A 1YI3A 4XG6A 3R8ZA 3E5AA 4K77A 2WMTA 4TYHB 4FI1A 3BCEA 3QQJA 5HG9A 1H1QA 1YXUA 3VVHA 3DFAA 1PKGA 4R1YA 2BDFA 3CKXA 4I21A 4Q5HA 5KMLA 3D5WA 2YEXA 3VS4A 3NUNA 4WKQA 4M7IA 5EYCA 1EH4A 5A6NA 3IDCA 2EU9A 2ETMA 3DBQA 4TWNA 4F7JA 3V5QA 5IUHA 3TUDA 5AM6A 4D4VA 4Z7HA 4QYYA 5M56A 5G1XA 2AC3A 5FTOA 3LE6A 4F1MA 2JC6A 1OL5A 2VWUA 4G16A 2OIQA 3QQLA 3VBXA 2XS0A 2R3FA 4X2NA 2WTWA 4FR4A 4FYOA 4AFJA 2PMLX 3MS9A 4NM5A 3QUDA 4H1MA 4UV0A 2QCSA 4M66A 2XEZA 2CLXA 2YJSA 4ALWA 4D1SA 3P78A 4IC8A 3TJCA 4RX7A 1B39A 4JDHA 5CSWA 2VV9A 4RVTA 2P4IA 2UZDA 1YQJA 2VWWA 3PPZA 2BRMA 4NFMA 4TYIA 3UOLA 2PE2A 4NJDA 4ZXTA 3FLWA 4L00A 1WFCA 4J7BA 4QMYA 1J3HA 3C1XA 4OTPA 4CMUA 4V0GB 4BTKA 3LMGA 2WXVA 2NRUA 2CLQA 1CKJA 3H0YA 2XJ2A 3GU6A 4O21A 2B9IA 1XBCA 2ZDTA 1PXOA 3PA3A 2QOCA 3NWWA 3PY3A 4KB8A 2WIPA 4GVAA 4O91A 4EUTA 4QMMA 4F9WA 3FQHA 4X0MA 2G2IA 2QOKA 2R3IA 5CWZA 4G3FA 4RIWB 3R04A 3FZOA 4FKSA 4MNEB 4D4YA 4L44A 3MA3A 4YSMA 3PY0A 4KBAA 5AM7A 4C02A 3JS2A 5DN3A 3RAWA 4IE9A 3AC3A 2Y6MA 3WZKA 1F0QA 4WIHA 4XG8A 3QD3A 1OPJA 1OMWA 2CJMA 4EEVA 2WNTA 4NM7A 5ETAA 3A7GA 4U3YA 4IWOA 4EZ3A 5AAEA 1H07A 2XP2A 2C5XA 4EONA 3W2PA 2UZLA 1IG1A 4D0WA 1STCE 1G5SA 2ITXA 2YFXA 3QAME 4MXZA 4CVAA 3D5UA 3CLYA 4ANMA 5BPYA 5EI8A 4FV4A 3VS2A 2R3QA 4DH1A 3P0MA 2DYLA 2FO0A 1B6CB 1GZOA 5AAGA 2JITA 3F2NA 5ANIA 4X2FA 5HLNA 3HA8A 2QO2A 3EL7A 4GT4A 3VUHA 3DFCB 4R8QA 5BUIA 2ZM3A 2XYNA 4DH7A 4JBOA 1Q61A 5M4CA 3A8XA 1M2QA 2OH4A 1GZ8A 3LCKA 3P4KA 3HKOA 4I94A 4IM3A 4YJVA 5ETFA 3O0GA 5KHWA 4RPVA 3D0EA 4WSQA 3U8WA 2C68A 4CT2A 4GYIA 4TWPA 3TZ9A 3EL8A 2PZIA 4QQJA 5TOZA 4EBVA 4EK5A 3ULIA 2I6LA 2PY3A 4MCVA 3OOMA 1YW2A 5KMJA 1WVWA 2PVKA 1YOJA 2W96B 1YWVA 5BUJA 3CTHA 4E20A 4PL3A 2QVSE 3G6GA 3ZFXA 3DKCA 2PE0A 1DM2A 3GC9A 4MH7A 5KNJA 5JGBA 5CY3A 3DGKA 4ZSEA 2WMSA 2XJ0A 1OKZA 3KY2A 2G1TA 1G3NA 4L7FA 4ACGA 2CGUA 5DEWA 5LCKA 2BUJA 1PHKA 1PY5A 4EJNA 2A4LA 2HYYA 3KL8A 4B4LA 3SOCA 4C62A 3H3CA 2B52A 3EFJA 1JKTA 5H9BA 1H8FA 4ZJIA 5DR9A 3II5A 4EC9A 5DBXA 4NW6A 3G33A 5L8KA 4LOOA 3GQIA 5FXSA 3RPRA 3BU6A 4OTWA 4FVQA 3R7VA 4F6SA 4NKSA 4R5YA 4EHEA 2UV2A 3M2WA 1Y6AA 5BVNA 3FHIA 3Q9WA 2Y0AA 4AP7A 4BL1A 2BPMA 4TW9A 1IEPA 3EB0A 3PP1A 4GIHA 2ZM1A 4PF4A 4XG4A 2OJJA 5BYZA 4EORA 4QTCA 3ZO3A 5B2MA 3CS9A 3FMEA 2GFSA 5CENA 4X2GA 5CU0A 5M51A 4BDAA 4IM0A 2B55A 1BLXA 3QKKA 4F1OA 4L01A 4D9UA 5DE2A 4L53A 2PMNX 2XIZA 4O6EA 5KE0A 4CSVA 3TZ8A 4FKLA 4R6VA 4YBJA 4BVUA 3GU7A 1Y57A 3QTUA 3G5DA 3JPVA 3CKWA 1H27A 4W9XA 4K18A 3PVUA 4BTMA 4E6DA 4CRSA 3RTPA 5E8YA 3FE3A 5CXHA 5CU3A 3EKNA 2VX0A 3AC4A 5CSXA 1BUHA 1XH8A 3O17A 4BIEA 3BHYA 1RDQE 4F0FA 5KMIA 1WAKA 4GJ3A 2F7XE 2QOQA 5HQ0A 3ZZWA 3VS5A 1YOLA 4C37A 3PJ1A 3SAYA 3UG2A 1XO2B 2V5QA 3Q60A 2X1NA 3HP5A 2CCIA 2GNFA 4TL0A 3LCSA 5FEDA 2C4GA 4C4JA 3POOA 5EDPA 5C03A 2XA4A 5C8KA 4IHPA 4CKJA 5EOBA 4ARKA 4DYMA 5DRBA 4ZLYA 2F4JA 2IVUA 3PXFA 3R01A 5E8TA 4D2WA 4ANLA 1L3RE 2UVZA 4U6RA 4FVRA 4U79A 3V5JA 2OZOA 2REIA 3MI9A 3ZCLA 3AGMA 4UX9A 1PW2A 4L6QA 4B8MA 4I6FA 2F7ZE 3FJQE 3EN4A 4I92A 4EOIA 1S9IA 4RC4A 3FPMA 4YPDA 4F63A 4EH3A 5CALA 3MH0A 4BWKA 1WBNA 3C4ZA 4NSTA 3PJ2A 3V5PA 2XNMA 4BGHA 4CTBA 4FT5A 3QZHA 2OW3A 3RNIA 4NH1A 4IB0A 4AA5A 5J9YA 3O7LB 5FRIA 2ZV2A 2BAJA 2QLUA 4MVFA 2HOGA 5TT7A 3RVGA 2FYSA 5FP5A 4C4HA 3D2IA 4MXOA 3S3IA 3FI3A 5AP4A 4IB3A 1MRVA 3CE3A 1SMHA 4EI4A 3E3BX 4V01A 4AZEA 2BILB 5HESA 2IW6A 4FG7A 4E5BA 2YITA 4AT5A 4Y95A 3S4QA 2OWBA 3UIMA 4MYGA 1H26A 3MFTA 3QYZA 1UU8A 3KXZA 3R73A 4HZRA 5FLFA 4AS0A 4X3FC 2CGWA 3PSDA 3LFCA 3HUCA 4IFGA 3TIZA 3JUHA 3LHJA 4WO5A 4QP7A 4BDGA 5LMKA 4RVMA 3QZIA 4CZTA 5AEPA 2WTKB 2Y4IC 4CKIA 4ZTLA 2OO8X 3W2SA 3C7QA 2UZUE 3VJOA 1T46A 3R1QA 3ZBFA 2LAVA 3EN7A 4O0RA 2XK7A 3UO6A 4C4IA 4CKRA 1ZRZA 3LJ2A 4ENYA 1E1XA 5C9CA 2X0GA 3EFLA 2Y6OA 2OJGA 3Q6WA 1JQHA 2QU6A 3MPTA 1PMNA 3LIJA 2UW0A 3EQRA 4LGHA 2FVDA 4D2VA 4JX3A 4JBQA 1KWPA 4PMSA 4F99A 3IW4A 3MJ2A 2WMQA 5ANDA 4ACCA 1ZY4A 3C51A 4FA2A 1W8CA 5BQ0A 4MF1A 3GOKA 4DGLC 5J95A 5E7RA 4BGGA 5ACBC 2WTJA 3MW1A 1Q97A 4A9UA 4QYHA 2VTIA 3I1AA 4ASDA 1VEBA 4IVCA 4NTTA 4CTCA 1AQ1A 1BMKA 4IXPA 3QLFA 2PZ5A 3QLGA 3RK5A 4OTRA 5CSPA 4EZ5A 3BV3A 3FV8A 5HCZA 4HZSA 4H3PA 3QUEA 4FKRA 4J52A 4LI5A 5CT0A 2X4FA 4HVSA 3QA8A 4ZS0A 5IEVA 4IBMA 3PZEA 1REKA 3KN6A 1ZMWA 4J99A 4RA4A 4FIHA 4N0SA 3F5XA 3I4BA 4D1XA 3VW6A 2PE1A 5DWRA 3FAAA 4FKOA 3MFSA 2XNPA 4HYIA 4FG8A 5LWMA 2UUEA 2PZRA 4DG3E 3K2LA 5JGAA 1AGWA 4B99A 3ZHPC 1PXIA 3R9DA 3V6RA 3QKMA 3EN6A 4WG4A 4BHZA 2XM9A 4XRJA 5H8EA 3VS0A 3ACKA 4BTJA 4S30A 3WOWA 1KE9A 1JWHA 2QQ7A 2UW6A 4XUFA 4AW2A 4BCIA 3VHKA 4J8NA 3G9LX 2Z7LA 1QPDA 4FF8A 2HW6A 4PDOA 3UQGA 1P4OA 4FTIA 4KBKA 4ITIA 4BDJA 5HE3A 1YXTA 4CLJA 3BHVA 4L68A 4M68A 2XIYA 1E9HA 4FV7A 4N4SA 4W4VA 4I23A 4EOMA 3ZONA 4UB7A 3R63A 5AUTA 4XRLA 2WIHA 3BWJA 4RMZA 4JT3A 4WUAA 3FMNA 1URCA 2WHBA 2XIXA 3UE4A 4QMSA 1FGKA 1FVRA 3EZRA 3KRLA 5A3XA 1FQ1B 1MQ4A 2QOOA 3PJ8A 4JR7A 5BMMA 2W1IA 2YDIA 4S2ZA 5E8ZA 3B2WA 3FXZA 2C3LA 2E9VA 4KKHA 4QMLA 4AGCA 3CJGA 3MY0A 1QPEA 2BTSA 1H4LA 3IDBA 3UBDA 1O6YA 2PVYA 4PTEA 5DNRA 1QPJA 4JDKA 4YLJA 3VBVA 4ZJVA 5GJFA 2B54A 3ZDUA 2W1GA 3G90X 4EH7A 2C3IB 2HW7A 2VNWA 2WTCA 3LFQA 5CU4A 1FOTA 3FLQA 3NNWA 1KSWA 3ZO4A 2BDJA 3BBTB 3V8WA 3BEGA 3RAIA 2UZBA 1OPLA 3TNQB 4MBIA 1J1CA 2R3NA 4OTFA 4U9AA 5J7BA 1XBBA 3P1AA 2WQBA 3FQEA 5HG7A 4F65A 4C38A 1E1VA 2XCHA 3E8EA 3EFKA 4S34A 3UVRA 2RG5A 5L8JA 5AMNA 4GK2A 4CFMA 2F9GA 2XK8A 3G0FA 4HCUA 5EHYA 4QNYA 3DY7A 3DU8A 4BTFA 5CEPA 4IAYA 4MXAA 3CD8A 2FUMA 4AW0A 2R2PA 3CP9A 4A9RA 3HRBA 3R30A 5AWMA 3Q2MA 5JZNA 3W8QA 3WI6A 2J0KA 4PV0A 3TKIA 2RG6A 2ZVAA 2UW7A 3ACJA 4KS7A 4RIWA 4YGAA 3U6JA 3PPKA 4MNEA 4FV6A 2P55A 4MEDA 4DEEA 5D41A 1PMVA 2GU8A 4E5WA 2BFXA 3KRRA 4RFZA 4J95A 3WZEA 3VBTA 1LR4A 3U87A 3RK9A 2GDOA 5BVWA 4GFMA 4G3DA 1UKHA 2XVDA 3QZGA 2E9NA 2JDTA 4IAKA 2VO0A 2Z60A 4QTEA 4YU2A 5H8BA 3IONA 3CJFA 2C6LA 4FV3A 5LVPA 4L43A 1P5EA 3MY1A 3ORZA 4BGQA 4ASEA 1OL7A 3I5ZA 3FZPA 4CNHA 1BL7A 2BMCA 1XR1A 5JMSA 4I0TA 3W33A 4BICA 5IH6A 3R71A 2FSMX 4FTAA 1WZYA 1BX6A 4X6QC 4YMJA 2I0VA 3F3WA 4E73A 2OICA 3G6HA 3DKOA 4M67A 2GTNA 3GU8A 1TVOA 5A46A 3VS7A 3I5NA 5I0BA 4ITJA 4X3JA 4MWHA 4LQMA 5F1ZA 3OBGA 4QYEA 1ZYSA 4IX4A 2O5KA 2Y4PA 3QD2B 4KBCA 4USDA 5CVHA 4EHGA 1UVRA 4G2FA 4DGOA 3HMNA 3ELJA 1K3AA 3H30A 4U45A 2JFLA 4BCPA 1MUOA 5L6OA 2BHHA 2UZVA 3NDMA 3OG7A 2BR1A 4C3PA 3OWLA 4DEGA 2C5VA 5EW3A 3ZUVA 4ALVA 3W55A 3ETAA 4OAVB 5L2SA 4JG7A 4CLIA 4IX3A 1W7HA 5HVYA 1P4FA 3F82A 1OZ1A 3HEGA 4NU1A 2YLEA 3ZRLA 3A7IA 4L7SA 4UMQA 4ANQA 3GUBA 4BBMA 2W06A 2WOUA 4XG3A 1GJOA 2YAAA 3B2TA 3LXLA 4RC2A 5EM6A 3R8MA 3KKVA 4MF0A 1M17A 3WARA 3S0OA 2XKEA 5DGZA 4NW5A 5KBRA 1BYGA 1YWNA 5H8GA 4U7ZA 4OLIA 2RL5A 3C4FA 5HE2A 1ZMUA 3WF8A 3WF5A 3HV7A 4P4CA 2E9UA 3QQKA 1J91A 3QA0A 3ZH8A 2HXLA 4QMNA 1ZYCA 3FZSA 1PJKA 3OUNB 4W9WA 5AP7A 3EFWA 2BFYA 3G0EA 3KXGA 4FUYA 3FC2A 5EHOA 1GY3A 3QD4A 2YN8A 3QQHA 4IWPA 4TKSA 5FP6A 2GHLA 5BVEA 3UP2A 3CY2A 2SRCA 2C0TA 4EUUA 4IM2A 4C8BA 3FMHA 5CASA 4BB4A 3O8UA 2YCQA 3C9WA 4KKEA 5DIAA 1YRPA 5E91A 3O23A 4BCFA 5BVDA 3A7HA 2J0LA 4OTGA 5ANJA 1M14A 2XZSA 1H1WA 4RVKA 4O1PA 4OTHA 4F7LA 4J96A 3TEIA 4DG0E 3IOKA 3DZOA 2WELA 4JAIA 3SXRA 4TYGA 3GCPA 2HIWA 2UW5A 4QPSA 3LFNA 1JKSA 2OZAB 2ITTA 4I4EA 3R22A 4EYJA 4R7IA 1ZWSA 5CYIA 3UO5A 4G6OA 2OBJA 3R1NA 4RWJA 1S9JA 5K5XA 2PZPA 4AGUA 5JK3A 4RIXA 4R3RA 3OW3A 3GB2A 2WPAA 2ITNA 4TWCA 2PMIA 2UZEA 4XH6A 5K3YA 2X2LA 4IZ7A 3RWQA 4HW7A 2VWIA 3R7EA 4I24A 4KIKB 4RZVA 4XS2A 4O96A 2XBAA 1SVEA 4AOJA 4FIGA 3K54A 3NPCA 4WUNA 4CFWA 2YACA 1KE8A 2BRBA 3P7AA 2OFUA 2V7OA 3R8VA 2W1EA 3QCYA 4EZ7A 2BZKB 2QOIA 2WFYA 5CAVA 3PRFA 4RX9A 3A8WA 5C27A 4BYJA 1M7QA 1UNLA 3E88A 3ZLXA 3QD0A 1JKKA 4B8LA 4LUDA 4KIOA 4BI0A 4IVAA 4C59A 4ZZNA 2IZUA 4YJTA 4X21A 4XCUA 4TNBA 1Q41A 2B9FA 3KK8A 3QRUA 3W2QA 1U5QA 1OITA 2HAKA 2J0JA 5T6KA 4ACMA 4B6LA 4EH4A 2VTRA 1GZKA 3I0QA 4O0TA 4QT1A 5HE0A 3VUKA 5IA0A 2YCRA 4IW0A 2ONLA 3A7FA 3MV5A 1SNXA 4FIIA 3VRZA 4FTRA 4E5AX 3NS9A 5HU3A 4EHZA 4BCJA 1H01A 3W2CA 4FTQA 2YIQA 2BDWA 2C1BA 5DOSA 4BZOA 4EOSA 3LCDA 5HHWA 5IU2A 3CGFA 4D5HA 4USFA 1K9AA 5D10A 4JNWA 4PWNA 5KMKA 2QLQA 4ZTSA 4ERKA 3QHWA 1MQBA 2Y4IB 2PK9A 4EKLA 3NW6A 4NCTA 3I7BA 3O51A 3FMMA 1DS5A 2G2HA 4TZRA 1ZLTA 1P2AA 3RCJA 1YHVA 5AA8A 3JY0A 5AIKA 5L4QA 3KB7A 1H25A 2H34A 4ZZMA 3MN3A 4BDEA 5BMSA 5M57A 1A06A 3T9IA 5HO6A 4WNMA 4IADA 4U5JA 1YXXA 3CEKA 2X81A 4PPCA 2IVTA 1R3CA 3UPZA 3Q4UA 1FMKA 4DTKA 3EHAA 1GIJA 4IB5A 4IVBA 3LFSA 5AX9A 3OTUA 2PVJA 1YKRA 5CNNA 5ICPA 4ZLOA 5CF4A 4XYFA 2BALA 4QTBA 4MBLA 1JVPP 4FKIA 4UN0C 3PG1A 2VGPA 2VO6A 2W1CA 2OK1A 2WMUA 2RFEA 2W5BA 4GU9A 3VW8A 5IA2A 5IH4A 3C13A 4FTUA 3SOAA 3DB8A 2BZHB 5CTPA 2QODA 4F70A 4U8ZA 3RALA 2PVMA 3E63A 4FL3A 4I41A 4IWDA 2IW8A 4BCKA 3LXKA 4PTCA 2X6EA 4DAWA 3OVVA 3TUCA 5FWKK 3VHEA 3M11A 3AD4A 3QYWA 4FNXA 3D15A 1O6KA 3CD3A 5EOLA 1UV5A 2XNBA 2VWZA 3WZUA 4Q9SA 2ITQA 3EQHA 1JKLA 3QTQA 4LGGA 3CY3A 5DG5A 2C5NA 2BAQA 2EUFB 3UYTA 1GIIA 2XRWA 4U42A 4QP2A 4QQTA 3H9FA 5D9HA 4LG4A 3VWAA 2YM8A 2WMRA 3D7ZA 3R0TA 4A07A 4XP3A 4I93A 4M8TA 2OJ9A 4EKKA 2W1FA 3OXIA 3QTWA 3DJ7A 4F9YA 3VIDA 3S00A 2JBOA 3W16A 3TV4A 1IRKA 5DR2A 4V04A 4CCUA 2VGOA 4W4WA 3AC2A 4BCNA 3P7BA 4GVJA 4U43A 4FBXA 1XJDA 2X39A 1FVVA 3GCQA 4U81A 3KRWA 4YJPA 4M13A 3NX8A 5DA3A 5BNJA 2PZYA 4OGRA 3FXXA 4W8EA 3EIDA 3Q9XA 4R1VA 3RHKA 1XH7A 1GAGA 1XKKA 1HCLA 3NW7A 4RIYB 2QOBA 2JKOA 3S2PA 2WD1A 5I9VA 5M53A 3WF9A 4EHVA 1M7NA 4CMOA 5FDXA 2AYPA 1VJYA 2VO7A 1ZZLA 3GU5A 3CTQA 3TACA 4GK3A 5KCVA 3TG1A 5K5NA 2B1PA 2XIRA 4U41A 3R8UA 3UPXA 2ITZA 2XKDA 4E93A 3BLRA 3NW5A 5JSMA 4L3JA 4XG9A 5FGKA 1YOMA 3AD5A 4DFYA 4RJ4A 3TCPA 5LOHA 4AQCA 4FTKA 1TQMA 3FZTA 4GYGA 4TY1A 3OY3A 1OVEA 4D1ZA 1FVTA 5J5SA 4GFOA 2R7IA 4WHZA 1F3MC 5I9UA 4F9BA 3OT3A 1QL6A 4C61A 4BDBA 2UZOA 5EW8A 4FSYA 1V0OA 2BROA 3PVWA 3TNHA 3AMYA 4DEBA 3UVPA 3BELA 4YR8A 3G9NA 4Z3VA 4MQ1A 3ZDIA 3AT4A 2OU7A 2ITUA 4KD1A 4V05A 1LP4A 3PYYA 3BQRA 4EH5A 4ZZOA 4AW5A 3HVCA 3LCOA 2HZ4A 2W4OA 4XHKB 3FZRA 4NKAA 2WEIA 4AN9A 3V6SA 2Y7JA 4IANA 1UNGA 4YZCA 4XLVA 2VWYA 3IK3A 4WT6A 3RPOA 5M4IA 1Q3WA 3GEQA 4AOIA 1R39A 5CANA 4YC8A 4AGWA 4I5MA 5F20A 2WMWA 1J1BA 4YPSA 1V1KA 3ZC5A 3GOPA 4XOZA 2W4JA 4JL9A 3BEAA 4BI2A 3ZSIA 4CRLA 2WKMA 3TZ7A 2YWPA 2P2HA 4XNEA 2EXCX 2XEYA 4FKGA 4MKCA 3HV4A 4O27B 3KGAA 3PE2A 4M84A 2YIYA 2WAJA 4HVHA 4C58A 2W5AA 5HTCA 5E1EA 3TV7A 1OB3A 2E2BA 2W05A 4JRVA 2GHMA 2RGPA 4ASZA 3AC1A 3MA6A 5EW9A 4AUAA 4QMXA 4BCMA 4OT5A 4FTMA 3MVMA 2HK5A 2ETKA 2UVXA 4TWOA 3LM0A 2B4SB 3TI1A 4EOQA 1R0PA 4CFXA 4PPAA 4RFMA 2G01A 4UXQA 1IA8A 4QP9A 4AE9A 4PL4A 1WCCA 4MTAA 3WF7A 3EQPA 4PUZA 4RGJA 4RX5A 3UNKA 2W9FB 5E1SA 5CI7A 3I79A 5HLPA 2XK3A 1HOWA 4IAAA 5J9ZA 3QC9A 4AN3A 4AGDA 3R9NA 4XG2A 3V5TA 3KA0A 3TIYA 5BUEA 4JOAA 5CXZA 1OL2A 5L2TA 4FEQA 3DS6A 5H2UA 3F3UA 5CNOA 1UNHA 1UWHA 3NNUA 5GZ9A 5HGIA 4HCVA 3TWJA 3N9XA 4PMPA 4DEDA 3TXOA 4L45A 5T3QA 4J98A 3BZ3A 5L2IA 3DQWA 3PXYA 3H9OA 3ZXTA 2ZAZA 3LQ5A 3U6IA 2V55A 4CYJA 4R3PA 3Q4ZA 2GFCA 3KFAA 2GS7A 3F5PA 3GC0A 5TKDA 4BN1A 4DLJA 1QCFA 2OF2A 5AV0A 4FKWA 3WBLA 5LMKC 5T68A 3MY5A 4WRSA 5FEEA 3LQ8A 2EB3A 2OJIA 3OOGA 2R0UA 3BU3A 3LCTA 4FSTA 5EK7A 3V04A 4BF2A 4E26A 4X2JA 1OPKA 4WBOA 4E4XA 5AADA 3LLTA 2GHGA 3CC6A 2DS1A 3C4EA 3DB6A 5HICA 4DLIA 5A4QA 3CQWA 3EKKA 4D58A 4PX6A 5IMEA 3R1YA 4L3LA 2CPKE 2W9ZB 4C2WA 1LEWA 1LEZA 3W2RA 4EOLA 4F9AA 3KXNA 5AJQA 5ANEA 2R5TA 3NZ0A 2OG8A 3LFAA 5IA1A 3LW0A 2VTHA 3WF6A 2ITOA 3ZXZA 3BRBA 4JVGA 2JIUA 4FMQA 4M69B 5HD4A 3Q53A 3U9CA 4YC6A 5FXRA 4B9DA 3MPMA 2WGJA 3V3VA 3ZFYA 5A54A 2BRHA 3COHA 3UQFA 3HA6A 3OCSA 3VO3A 2C0OA 4QPAA 2GMXA 2QHMA 3QRIA 5AP2A 3R9HA 3EYGA 5TO8A 3UNJA 4H3QA 5AUUA 3RCDA 1YXVA 3BHTA 3FMDA 5M44A 2J50A 2R3JA 4PMTA 5EYDA 3DA6A 3UYSA 1F5QA 4R7HA 3RAKA 4K11A 4ZLZA 1PKDA 3QCSA 3ZOSA 3NCGA 4KIQA 2YM5A 5K0KA 1VZOA 4NM3A 3U9NA 3JXWA 5FEQA 3BE2A 4XX9A 4I4FA 3EOCA 3D9VA 4GS6A 3ZM4A 1R1WA 3MVLA 4OAUC 2XNNA 2RF9A 2WOTA 3QRTA 5HTBA 4QQCA 4D5KA 4FNZA 1PXKA 3H4JA 2F49A 2ZV7A 4D9TA 3I6UA 2JFMA 3PA4A 4IZAA 3SXFA 4RWKA 3ZC6A 3UQCA 3MTLA 4OR5A 3HZTA 3F3VA 4D4SA 5CEOA 2OZAA 3F7WA 4FODA 2QR7A 4XEYA 3KULB 4ANBA 5EM8A 3EH9A 3ZRKA 3PXQA 5E8WA 1JSVA 4I22A 3NAYA 4YJRA 2XIKA 3R8LA 3U51A 5HBEA 4AFEA 4GMYA 4XV1A 2UW8A 4FTOA 4RC3A 2CHLA 4RSSA 4WOVA 3MFUA 3PG3A 5EG3A 2GNHA 3QXOA 5EHLA 4KIKA 2O63A 3R2YA 2R3LA 5GZ8A 4KRDA 4E8AA 3S95A 4BCQA 3SRVA 4XV3A 4AA4A 3IOPA 4QMTA 2XUUA 2XK9A 2R64A 2VX1A 3BGPA 5BVOA 1KV1A 1ZYLA 4G3CA 4NZWB 4UMTA 4MHAA 2QO9A 4AW1A 4RWIA 4G9RA 3UVQA 3CIKA 2GNJA 3H0ZA 4OBQA 3IS5A 5DFPA 3RZBA 1JOWB 1U4DA 2ACXA 4E7WA 4UY9A 4D55A 5AR3A 4FZAB 3UOHA 4L42A 2BIYA 3JVRA 4WNKA 1Q8YA 3TN8A 3VUIA 3L9PA 3DAKA 3W10A 5C01A 4DG2E 1XH9A 3F2AA 3PPJA 5EFQA 4G5JA 4ZTMA 1ZOEA 4BCHA 2J7TA 4P90A 5E92A 3ANRA 3OCGA 4W4XA 5I9XA 5IZFA 4K8AA 1PXNA 4ZTRA 1OL1A 1YHSA 3QKLA 3VUTA 4AZTA 2YDJA 3LVPA 3AMAA 3UIBA 1FPUA 3ERKA 2OIBA 5FXQA 5CEKA 3DPKA 4U97A 3QTXA 1U59A 2KTYA 4J71A 3QF9A 4OT6A 3FKLA 5FG8A 1QMZA 4JBPA 3ZLSA 2YISA 2OKRA 3O2MA 3DAJA 1TQIA 3NYNA 4YTHA 2PTKA 3LPBA 4HOKA 4CFFA 2R3MA 4J97A 4MAOA 1REJA 4D28A 1OIRA 1BKXA 2P0CA 4FTCA 3HNGA 4G1WA 4A9TA 3E92A 4L67A 4CV9A 4TYHA 1Q8ZA 4P7EA 1ZZ2A 5K9IA 4JDIA 2QG5A 3Q5ZA 2C30A 3FDNA 5HEZA 3A99A 2HCKA 3KRJA 3AQVA 3KXMA 4F0GA 1H24A 4AWIA 5CSVA 5J5TA 4C35A 3A7JA 3DQXA 4G3GA 4AZVA 3FYKX 4PDSA 3R7OA 5KBQA 3GBZA 3HV5A 4L9IA 3IW5A 1R78A 4H39A 4BC6A 4UMUA 1WVYA 1P14A 4E6CA 3HGKA 2P3GX 3QUPA 3BHHA 3DAEA 2WTVA 4FT0A 4UBAA 3UP7A 3I7CA 4ID7A 3QGWA 4C34A 3REPA 3DNDA 4G9CA 4QP3A 4I5HA 3WILA 3A61A 5M4UA 2UW3A 1BI8A 2JLDA 3OCBA 2YM3A 5FM2A 5HCYA 3P5KA 4TPTA 3A4PA 4I20A 4FK3A 1XH6A 5AP1A 3LJ1A 3O71A 3GVUA 5FBOA 5ACKA 3FY2A 2H6DA 3PUPA 4GT5A 2XNOA 4TTHB 4AT3A 3GCUA 3OY1A 4FC0A 3FZ1A 4DITA 5HG5A 4LV5A 5CF5A 2VTAA 1JLUE 5ANOA 4BCOA 3KVXA 1CKIA 2V7AA 5HIDA 4FTLA 2FSLX 2G9XA 3Q5IA 4M3QA 4YZDA 4V0GA 1OIUA 1SNUA 1CKPA 3GGFA 4FKJA 4GFGA 4L3PA 3R7IA 3O7LD 3HUBA 3LFFA 5AA9A 4DN5A 4ALUA 4M14A 3ALNA 2ITVA 4ZTHA 4GCJA 2VU3A 4HVDA 2G15A 4USEA 4HYHA 5EKNA 2AUHA 5JT2A 3R7YA 4ITHA 3QQFA 4QMOA 2QOFA 4AZWA 4AE6A 4EBWA 3ZTXA 5GNKA 3V5WA 5C1QB 3QQGA 4K2RA 1M52A 1Y6BA 2O0UA 1WBSA 4EK3A 5JFXA 4IFCA 3KCKA 3OEFX 3AT2A 3BYSA 4RLLA 3SC1A 4FSUA 4D2PA 2YAKA 1NVRA 4QRCA 3MDYA 2J9MA 3SD0A 5LCJA 3ODYX 2J5EA 4BZNA 1W82A 3LXPA 3ZO2A 2O64A 3ORMA 2HY81 4EYMA 4IB1A 4IWQA 4NTSA 4KS8A 2GTMA 3T3UA 4BKJA 5IA3A 3UDBA 4L46A 4WNPA 2I0EA 2JKKA 3BYUA 3ZUTA 3QQUA 1W84A 5J79A 1V0BA 5D12A 4FV8A 4FT7A 1OKYA 3FMLA 4XP0A 3BGZA 5CSHA 5J1WA 3PA5A 2V0DA 3ORIA 2QOHA 3RNYA 2C5YA 4WBBB 1Q8TA 2X8IA 2VTQA 4TYEA 3MB6A 3KVWA 3QTIA 4FKUA 4LRMA 4ZSGA 3GP0A 5GHVA 4G6LA 4C3RA 3QC4A 1I09A 4PDPA 3DV3A 2JKQA 1SM2A 4IEBA 3DBCA 4FTJA 5AR4A 3ALOA 4GW8A 1JNKA 1OUKA 4ENXA 2W5HA 3RPSA 4TNDA 4C57A 4GSBA 3E8CA 4AZFA 3QZFA 5AUVA 5CEQA 3Q96A 5TR6A 5GJDA 4FNWA 3A62A 3I60A 3L8SA 4QOXA 2XJ1A 3D7TB 3ENHA 2GPHA 3IGGA 1FMOE 3E3PA 4QD6A 3VUGA 4DH3A 3M1SA 1O9UA 1H1PA 2C6OA 4F1TA 4RIOA 4IDVA 3HX4A 4FOBA 2VWXA 3QTRA 2YLFA 3GCVA 3W32A 4FSNA 3V8TA 2F2CB 5CLPA 4CT1A 2W7XA 3DLZA 3GI3A 5CZHA 2XK6A 2YM4A 3QWKA 5AP5A 4RLKA 5KMNA 3EQDA 3NNXA 3RWPA 5I4NA 1Y8YA 2YA9A 4AF3A 5AUZA 5H3QA 4K1BA 2A1AB 3VS3A 2B53A 4PNKA 5DI1A 4F6UA 4Y83A 1RJBA 2HWOA 4QO9A 4APCA 3CCNA 2I0HA 3FXWA 4ANSA 3E87A 4QMZA 3F5UA 2BRGA 3D94A 4HGTA 2ZDUA 4FSQA 2QKWB 3V01A 3DNEA 2JKMA 4BIBA 3OS3A 1UKIA 4IZ5A 2CDZA 2JAMA 3OBJA 3PSCA 4ZTNA 4DGGA 1JSUA 3SW7A 2C5OA 2QR8A 3SX9A 1U5RA 2GCDA 4R3CA 3BE9A 3HLLA 1ZOHA 2W0JA 1XBAA 4OBOA 2FA2A 3SKCA 2JDSA 2W1DA 3Q4CA 1FINA 4QMWA 3MGYA 4I0SA 5L2WA 4ZP5A 5KKRC 3WYYA 1PYXA 2C6EA 3KK9A 5G6VA 4RX8A 3FY0A 3FMJA 4O2PA 4A06A 4FKVA 4I1ZA 4JLCA 2WO6A 5HD7A 3OXTA 5AP0A 4F7NA 4YO4A 4QNAA 2VX3A 2C69A 1FGIA 2ONLC 4J1RA 2J6MA 4CCBA 3L8XA 2UZTA 1MP8A 3V8SA 1H0WA 1ERKA 3Q52A 1PXMA 4DEIA 1Z5MA 2HZNA 4I6HA 3BU5A 4G34A 4L8MA 4JI9A 4LL0A 4U40A 4CFUA 4O0VA 1OIQA 4UYAA 3RAHA 4YNEA 5JN2A 4BDFA 4MQ2A 5CQWA 4NCTC 3RM7A 5AUXA 4UMPA 4S31A 4FVPA 4CD0A 2BAKA 4BYIA 3QGYA 4FICA 2B9HA 2XKFA 3F61A 3OWKA 3PTGA 3D4QA 4D2TA 4FSWA 4MXYA 5KZIA 4DHFA 2JEDA 3L1SA 3TNIA 2CGXA 4JJRA 4KABA 3ZLWA 2A27A 2C1AA 2X4ZA 3FBVA 3KXXA 5J87A 1DI9A 4ACHA 3GFEA 3Q04A 4QP8A 4EH6A 3NUSA 4MK0A 4PL5A 1H00A 4CQEA 2Z7RA 4YZBA 5ETCA 5HNBA 4DC2A 3R6XA 3F6XA 4IX6A 5DEYA 2EXEA 3F69A 3HDNA 4YHTA 5BX0A 4O38A 3SQQA 4N6YA 3LXNA 4M15A 3HRFA 4M69A 1PXJA 2JIVA 2W99B 1HCKA 3KRXA 2WQEA 3CTJA 3T8OA 2H9VA 3D2KA 3OWJA 4E6AA 3C0IA 4X3FB 2F2UA 3AC5A 4HGLA 2NO3A 5L2QA 3PRIA 3BQCA 4FOCA 3HDMA 3MYGA 3F7ZA 2R3KA 2C6DA 5EI2A 5IISA 3NIZA 4FZ6A 3HV6A 1CTPE 4RJ3A 5F4NA 4P2KA 4Z9LA 5FD2A 4A9SA 2QU5A 3FSFA 4I6QA 3ET7A 3VS1A 4YTFA 2YZAA 4FIFA 5CS6A 5AV4A 4ZY6A 5HNGA 2IO6A 4EOOA 5DT4A 2DWBA 1YHWA 3QXPA 3UC3A 3EQIA 4JXFA 2BCJA 4WG3A 4QYFA 3PWDA 4ZY4A 5JEBA 3ZZEA 5HG8A 3ZMMA 3DCVA 3SVVA 3GC7A 4I5PA 4W8DA 4A4OA 5BYYA 5BVFA 3K5UA 3SXSA 1JAMA 3VULA 2QONA 2VAGA 3EYHA 3THBA 4EK4A 3EJ1A 2YDKA 4IAZA 5JFWA 3BPRA 3UGCA 1B38A 4S32A 4CZUA 5B2LA 5ITAA 5I3OA 3PE1A 3EWHA 4N6ZA 3ZS5A 3IGOA 3Q9YA 2JGZA 2X2KA 1NVSA 1RW8A 5AR5A 3PVBA 1O6LA 2DUVA 4KINA 3WE4A 3ZEPA 2O8YA 4ZSAA 2J51A 2XM8A 5LMAA 3FQSA 4YJSA 3F3TA 4FTNA 3RP9A 3MTFA 4WRGA 3O96A 2X2MA 3VJNA 4IZYA 4JIAA 2HZIA 5HBHA 2IZSA 3KC3A 4P5QA 5IKWA 4ZEGA 2QKRA 2WU7A 3KMMA 4XJ0A 1BL6A 2X6DA 3L9MA 4BKYA 4O6LA 4LOQA 4XV2A 4AX8A 5EDRA 4QMUA 4ZSJA 3DTWA 4CMTA 5KX8A 3EZVA 4C7TA 3R02A 4RFYA 4E1ZA 3MVJA 5K4IA 3MJ1A 4TN6A 1GIHA 2YABA 5CVFA 2R3PA 5DPVA 3HMPA 4KAOA 4Y85A 4JQ8A 3R00A 3AD6A 2VTOA 4F64A 4FSMA 5M55A 1Y8GA 3MFRA 2QI8A 4PTGA 2FB8A 3POZA 3UODA 5IA4A 4Z55A 4XMOA 5E8UA 1VYZA 3E8DA 4FV2A 3QCXA 5JFSA 4HPTE 1GZNA 2XH5A 4PPBA 3QWJA 4HYUA 4U3ZA 2Y8OA 1OECA 3PSBA 4NK9A 3QBNA 1I44A 2OXXA 5AUWA 3LZBA 2QOLA 3F66A 3KF4A 4JBVA 4EH9A 3Q32A 3QALE 4BDCA 3P79A 4FK6A 1ZYDA 2JBPA 4R5SA 4WD5A 3VBYA 2ZMCA 2HWPA 4FV0A 5DR6A 3ZO1A 4C4GA 3PIYA 1ATPE 4O0SA 4F09A 1H1RA 1PYEA 2FGIA 3KMWA 2X8EA 5CI6A 1WBTA 3E62A 2GQGA 2Z8CA 2V22A 2CGVA 4ASXA 3U4UA 4DFLA 1X8BA 2QHNA 2PMOX 4HVGA 4LYNA 4UWCA 3UO4A 2IW9A 4RZWA 4IH8A 2IZTA 1YDSE 3V5LA 4LM5A 4C4EA 3FC1X 3FMKA 3AGLA 3EQCA 2KULA 3K3JA 1KE5A 3GC8A 4D2RA 1XQZA 4JIKA 2IN6A 4YSJA 3VQHA 4GV1A 5I5ZA 4U44A 3JY9A 3P7CA 3PWYA 4ZIMA 3TNPC 2VUWA 3UJGA 1Q99A 3COIA 3D5XA 2C6TA 4AU8A 2UVYA 3QHRA 4FIJA 4IACA 4DEHA 1JBPE 3Q3BA 4YJOA 3HECA 3NUUA 4HPUE 4AAAA 2JD5A 4G5PA 4D4RA 2R9SA 2X9FA 4XP2A 4EQMA 3AXWA 4BZDA 4ANOA 2YHVA 2ITWA 2YIWA 5ETIA 4UYNA 4IJ9A 4QQ5A 4ANNA 1UWJA 5DMZA 4UALA 4CFVA 2IVSA 3OTVA 5HVKA 3TTIA 3IKAA 3PVGA 3K5VA 2WTIA 3JVSA 5CX9A 2UZNA 4X6RA 3D83A 5KO1A 4O0YA 4WA9A 2VTMA 4AXAA 2HENA 3LAUA 2VWBA 4QTAA 3DLSA 3MVHA 4PQNA 4H36A 2JDVA 2QC6A 4CV8A 3D14A 3OMVA 3BLQA 1U54B 4FT9A 4RRVA 4FGBA 4N70A 4FV5A 5I9WA 4I6BA 5J9LA 1A9UA 1Q24A 4KA3A 1WBPA 3P08A 4YHFA 3N51A 5IMXA 5JZJA 2GNGA 1U46A 5HZNA 2IVVA 4E6QA 2X7FA 5CAQA 3TTJA 1H28A 2CCHA 2ZV8A 4GJ2A 5GZAA 2XK4A 3CQEA 4HGSA 3OW4A 2WB8A 3QX2A 4OTIA 5EYKA 1YXSA 3LM5A 3PZHA 3RBWA 2OGVA 5CZIA 2VD5A 2O3PA 2JDRA 3EQFA 1XH4A 4AG8A 5M4FA 3UZPA 3GENA 5B0XA 4KRCA 2ITPA 4F6WA 4GK4A 4Z16A 4ACDA 2OXDA 4BKZA 2VTPA 4LV8A 4II5A 3QFVA 5AV3A 2WMBA 3ODZX 5J8IA 3GQLA 5CU6A 3FPQA 4B0GA 2YM7A 2WQNA 2C47A 3FL5A 5CU2A 3VUDA 3OF0A 3L9LA 4FL1A 4P5ZA 1DAYA 2C3JA 3IPHA 2OH0E 4UWBA 2Q0NA 2ZOQA 4AACA 5KMOA 3BIZA 1SZMA 4HYSA 5IG1A 2R3OA 3F9NA 1JSTA 5AP3A 4HJOA 1OM1A 3MB7A 5AV1A 1MRUA 4G17A 3R7UA 3MH2A 4BI1A 5HVJA 3KEXA 4EC8A 1WMKA 5IEXA 2J0MB 5LVMA 4FL2A 3R28A 5LQFA 2J4ZA 4OUCA 3DK7A 4C3FA 1IR3A 3E8NA 3CGOA 4IIRA 4RBLA 4FYNA 4WSYA 1WBVA 5JRQA 1CDKA 3ZSHA 3E93A 4PP9A 3W2OA 2OJFE 2F57A 3DJ5A 4FZFB 2CN5A 4NWMA 2UW4A 2FSOX 3K3IA 3D7TA 5DT0A 3RPVA 4WNOA 4KNBA 3VF9A 4DFZE 2Q0BA 3BHUA 2E9PA 1M2PA 4A4LA 3FLNC 4LFIA 3NUXA 4APPA 3LFBA 4F4PA 2XB7A 1BI7A 1Z57A 4LMUA 4NIFB 2GNLA 4BRXA 3MH1A 4FKTA 2BRNA 1RQQA 3ANQA 3LJ0A 4RIXB 5JGDA 4JG6A 4HNIA 4XG7A 3LFDA 2Z2WA 3E64A 4J53A 2ZJWA 5HORA 5KMMA 3L8PA 5FM3A 3R8PA 3ORNA 1YDTE 5JQ8A 4W4YA 2W17A 2P33A 1NA7A 5E8VA 4YLKA 4JQ7A 3NEWA 3R9OA 4AA0A 5I9YA 3E7OA 3R1SA 5CEMA 1H1SA 3NUPA 5I9ZA 4A4XA 1ZAOA 3UMXA 3OXZA 1OL6A 3QX4A 4GH2A 3RKBA 3DK6A 5EDQA 5HI2A 1OI9A 4F9CA 4GRBA 3SV0A 3FYJX 3HMIA 1TQPA 4DINA
chains in the Genus database with same CATH superfamily
2VZ6A 4MNFA 4ZJJA 2GSFA 4BCGA 5KKRB 2ZMDA 5FDPA 3C4XA 4QTDA 4FV1A 5CVGA 3ZYAA 4E4MA 5EH0A 5DH3A 5L8LA 3IG7A 3ROYA 1YDRE 2QNJA 4YLLA 3PIZA 4OBPA 1H0VA 3F88A 4CQGA 2RFNA 2IJMA 4KWPA 4Y5QA 3HYHA 2A0CX 3NUYA 3RPYA 4CZYB 1CSNA 4K9YA 4MD7E 5CEIA 1CMKE 3C4WA 3UTOA 2WTDA 3AG9A 3WYXA 3ZBXA 2ITYA 3TJDA 5AIRA 4O2ZA 3VNTA 3GU4A 2RKUA 1UU7A 2BZJA 5DRDA 4WG5A 4DEAA 4JDJA 1Q4LA 1Q5KA 3ORXA 3KN5A 3U6HA 3EN5A 4LRJA 2EXMA 2WZJA 5DT3A 3HP2A 4EK8A 2PL0A 3OZ6A 4YJUA 2HY0A 2WMVA 4YNOA 4CEGA 4O4FA 4KIPA 3O8TA 2QURA 5J7HA 4FZ7A 3FSKA 5AX3A 5LJJA 2RFSA 1OIYA 4TRLA 3FL4A 2WMXA 3CQUA 3SHEA 4YURA 3NYOA 4Y46A 1KOBA 2RSVA 2Z7SA 2OXYA 4OTDA 3UOKA 1DAWA 2WQOA 3DT1A 3FUPA 3DDPA 3TT0A 3DDQA 2R3GA 1Q3DA 3LFEA 2B7AA 3PFQA 3IQ7A 5AR2A 2F7EE 5GJGA 3SW4A 5KHXA 2EVAA 2YIRA 3GXLA 2R7BA 2ZV9A 4RJ6A 1PXPA 3RMFA 3T3VA 4HCTA 3PXZA 2C6MA 2UW9A 1OUYA 2VNYA 3IW6A 4G3EA 5AAFA 4OW8A 1XH5A 2QD9A 4TXCA 2PSQA 5TE0A 4M12A 4MWIA 2FH9A 3T9TA 3CPBA 3FLSA 5L6WL 4YP8A 5HIBA 3MWUA 4NJ3A 2V62A 3AMBA 3G51A 3KF7A 4UEUA 2BTRA 5DHJA 5K0XA 1ZARA 2B9JA 5HBJA 2X7OA 2VN9A 3U4WA 4JS8A 3COKA 3CBLA 4NT4A 2FSTX 2J0IA 5FBNC 2X7GA 3ORPA 4BIDA 4X3FA 4MX9A 5HCXA 4XOYA 1AD5A 2OF4A 3W1FA 2YERA 2ZYBA 3QRJA 4FKPA 3JYAA 2C6KA 3GFWA 4JRNA 5F94A 5L6PA 4LMNA 2CSNA 2ESMA 2WEVA 4DH8A 3FLZA 3GT8A 3C5UA 2BIKB 2EWAA 2I1MA 3OP5A 1SVHA 1K2PA 3IW8A 2ETRA 4Q5EA 3VF8A 3WZJA 4GUBA 4UMRA 4TYJA 3OFMA 4GU6A 4LGDA 1KOAA 3W8LA 4FSRA 3VQUA 3FKOA 3DBEA 1VR2A 3EQGA 4LOPA 3NGAA 3VN9A 2BVAA 2W4KA 3RINA 4YJNA 3FI4A 3NYXA 3OHTA 3MPAA 4JQEA 5AV2A 3OEZA 1MRYA 2UZWE 1GOLA 4O1OA 3NR9A 4RWLA 4C33A 1UU3A 4M0YA 5KZ0A 4K33A 4EWQA 3EMGA 4JAJA 5D7AA 5ANGA 3KXHA 4FG9A 1UA2A 2YIXA 3HMOA 3R21A 1YI4A 1RE8A 5JFVA 4GEOA 4O0WA 2VTSA 4ONAA 3ULZA 3ITZA 2A19B 5AR7A 2C3KA 3D5VA 2HELA 3Q6UA 2WMAA 1Q8WA 4O22A 4Y5HA 4RQVA 5EM5A 3OWPA 4RJ5A 3UNZA 1T45A 5E8XA 3L9NA 5HIEA 4KSQA 4YHJA 5A6OA 4XLIA 2W1HA 4GT3A 3VC4A 3DKGA 4BDIA 5CAPA 1ZYJA 2GNIA 4MXCA 2XCKA 3PJ3A 4E3CA 1KE7A 4UWYA 3CR0A 5IEYA 3LOKA 1W0XC 4UZHA 3UIXA 3IW7A 3BBWA 4Z7GA 4AT4A 4YUQA 4UXLA 4M97A 4GUEA 4YO6A 5CAOA 4KSPA 4XV9A 3UIUA 4PP7A 3C50A 5K4JA 3A2CA 5HU9A 3UMWA 4G6NA 4IJPA 2GS2A 5CF8A 4BWXA 2YM6A 5KUPA 4FZDB 3DXNA 3RI1A 3RK7A 5A4EA 3SA0A 4A9YA 1PF8A 4FV9A 4UZDA 4HVIA 4EK6A 1LUFA 5LVOA 5ANKA 3ENMA 3OROA 2AC5A 1ZOGA 3ROCA 5CF6A 5E8SA 3F3ZA 4I5CA 4TT7A 4IQ6A 3FHRA 3ORTA 3WE8A 4M0ZA 4EQCA 5JH6A 3Q9ZA 2RIOA 5LVLA 3VUMA 2XNEA 5IDNA 5EYMA 3NLBA 4YZMA 2ERZE 4E4NA 3W18A 3ZUUA 3M42A 3CPCA 3RGFA 3HRCA 4BDKA 2J2IB 5HO7A 2NP8A 5AP6A 4RIYA 4EOJA 3TUBA 4Y8DA 3PJCA 3TKHA 3H10A 3IECA 5C8NA 3HV3A 5DVRA 3BI6A 2VWVA 4LUEA 3C0HA 2VO3A 4MD8E 2PVFA 1GNGA 3QCQA 2DQ7X 2XNGA 5CQUA 1CM8A 2QO7A 1Q62A 1JPAA 4BDDA 5A4LA 2WQMA 3NAXA 2PHKA 2ZM4A 3P23A 3Q4TA 5LWNA 3OCTA 4X7QA 4IVDA 2IWIA 2BHEA 4DH5A 3H9RA 4BDHA 4J8MA 5J1VA 5IF1A 3BWFA 1YI6A 2CKEA 2XRUA 2VRXA 2YCFA 4MBJA 2PUUA 4A7CA 4CYIA 3PXRA 1TZDA 2R0IA 4FUXA 4BWPA 2WU6A 2H8HA 4YTCA 2ZB1A 3SDJA 2EB2A 3DBDA 3QTSA 2JIIA 2OSCA 1NY3A 1YWRA 4MXXA 3UC4A 4PMMA 2IF8A 3P9JA 4RA5A 2CN8A 5BVKA 3RZFA 3BKBA 1XHAA 3BX5A 3FI2A 2NRYA 2YCSA 3MIYA 4EL9A 3BYVA 3NYVA 4I3ZA 1SVGA 4JR3A 5IH5A 4GIIA 1U54A 1OKWA 3I0OA 4QP4A 5FTQA 3PIXA 4K6ZA 4BFMA 2A2AA 2W1ZA 5AR8A 4ERWA 3ZU7A 3FKNA 4NEUA 3VBWA 3ZLYA 3BV2A 5LXMA 3UOJA 1IASA 5F95A 1DI8A 4BHNA 2PVNA 5C8MA 4CFNA 4C0TA 4RT7A 2JAVA 3P86A 4GG5A 1XWSA 3R83A 4QP1A 1W98A 3R2BA 3HL7A 4IAFA 4ZSLA 4H3BA 2GS6A 5EM7A 3TL8A 2C6IA 5IA5A 3GCSA 1PMEA 3MSSA 5L3AA 3O50A 4XBRA 3O8PA 2Z7QA 1URWA 4DFNA 3QTZA 5HX8A 4HGEA 4XBUA 3AC8A 2PVHA 3KCFA 5IPJA 4PRJA 4U0IA 3BLHA 4DBNA 2LGCA 4H58A 4Q2AA 3A4OX 4FNYA 5A9UA 4ZAUA 1OKVA 2OFVA 5CT7A 4FTTA 4ZY5A 2VTNA 4C2VA 3RM6A 2X9EA 5HOAA 5B2KA 4FSZA 5CAUA 5HX6A 4DGNA 3QU0A 4QYGA 2Y9QA 2BZIB 4QMPA 4JX7A 1WBOA 4QMVA 1NVQA 3NSZA 3PLSA 5IDPA 3GNIB 2R4BA 4AOTA 4QPMA 4HNFA 1Z9XA 4L52A 4DCEA 5C26A 3L8VA 4I0RA 5DLSA 5JKGA 4ZOGA 3KU2A 3HMMA 3TZMA 3WIGA 4PY1A 1QPCA 1ZMVA 3C0GA 5A4CA 3NNVA 2HZ0A 1W83A 4Y73A 4EQUA 4D0XA 3OT8A 4RJ7A 2J90A 2NPQA 1OGUA 3OD6X 3PXKA 3QL8A 5I3RA 3TNWA 3ZFMA 3IDPA 2I40A 2XMYA 3DBFA 4YZNA 5EKOA 2H96A 2VTLA 2X8DA 1WVXA 4IAIA 4OTQA 3DJ6A 3IO7A 5D11A 3QRKA 5HKMA 3TV6A 3UG1A 3MIAA 1H08A 4IC7A 4MD9E 4DGMA 4EOPA 2XYUA 2VTTA 1YVJA 3AOXA 4QP6A 4X2KA 4E4LA 4GG7A 4CXAA 3ZSGA 3MBLA 2BKZA 2CMWA 2P2IA 3COMA 4EOKA 4C4FA 4IDTA 5LARA 2E9OA 1Q8UA 4YC3A 2WTKC 1UU9A 4FKQA 1VYWA 4NM0A 3EQBA 3RHXA 5TF9A 2RFDA 4Q9ZA 3DTCA 4FT3A 2VTJA 4U80A 4DFXE 4NIFA 3UZTA 1ZXEA 1SYKA 4YTIA 2O65A 5HTIA 3WIKA 2PVRA 3VAPA 4S33A 3ZRMA 4EWHA 3RJCA 4O4BB 3I6WA 3R7GA 4JG8A 4NUSA 3FWQA 2XKCA 3VBQA 4YBKA 5FQDC 4IX5A 5A4TA 3ZEWA 2XF0A 3B8RA 4KKGA 3B8QA 4O0UA 5D7VA 2YJRA 3SRVB 3EN9A 1APME 3AT3A 3BGQA 2ERKA 4ZTQA 4F08A 2PWLA 2G2FA 2O2UA 3A60A 3DK3A 5LMBA 4RQKA 3KQ7A 4F0IA 2R3HA 4B7TA 3ORLA 5LVNA 2ZB0A 4YJQA 1WBWA 4D2SA 1R0EA 3NRMA 3OUKA 2C0IA 3PY1A 3VRYA 3FLYA 1TKIA 4YZ9A 5B7VA 4LRKA 3S1HA 4GL9A 2HXQA 4LL5A 4K0YA 3WZDA 4RG0A 3MH3A 4QMQA 3NCZA 4F7SA 2I0YA 4EH2A 4BBFA 5EI6A 1PMUA 2XBJA 4PNIA 1NXKA 5A14A 2J5FA 2PVLA 3NIEA 4RJ8A 5D1JA 3G2FA 4RVLA 1KV2A 3SLSA 5AUYA 3BYMA 5HNIX 4IMYA 4Y72A 4FIEA 4H1JA 5JQ5A 1KE6A 3V51A 2JDOA 4NFNA 3DOGA 4EH8A 2R3RA 3ORKA 3KULA 5HE1A 3E7VA 4G31A 3CXWA 1V0PA 3C4CA 3DKFA 2OIDA 1M2RA 3DZQA 2OI4X 3KMUA 2IZRA 3BYOA 1ZY5A 3F5GA 5JRSA 4C36A 4FX3A 5IUIA 2X0PA 3TKUA 3PP0A 4ZK5A 3OC1A 5HO8A 1PXLA 5IUGA 3VS6A 3I81A 4AZSA 5E90A 4BBEA 1LPUA 1Y91A 5F9EA 5HLWA 4O0XA 4AN2A 1YI3A 4XG6A 3R8ZA 3E5AA 4K77A 2WMTA 4TYHB 4FI1A 3BCEA 3QQJA 5HG9A 1H1QA 1YXUA 3VVHA 3DFAA 1PKGA 4R1YA 2BDFA 3CKXA 4I21A 4Q5HA 5KMLA 3D5WA 2YEXA 3VS4A 3NUNA 4WKQA 4M7IA 5EYCA 1EH4A 5A6NA 3IDCA 2EU9A 2ETMA 3DBQA 4TWNA 4F7JA 3V5QA 5IUHA 3TUDA 5AM6A 4D4VA 4Z7HA 4QYYA 5M56A 5G1XA 2AC3A 5FTOA 3LE6A 4F1MA 2JC6A 1OL5A 2VWUA 4G16A 2OIQA 3QQLA 3VBXA 2XS0A 2R3FA 4X2NA 2WTWA 4FR4A 4FYOA 4AFJA 2PMLX 3MS9A 4NM5A 3QUDA 4H1MA 4UV0A 2QCSA 4M66A 2XEZA 2CLXA 2YJSA 4ALWA 4D1SA 3P78A 4IC8A 3TJCA 4RX7A 1B39A 4JDHA 5CSWA 2VV9A 4RVTA 2P4IA 2UZDA 1YQJA 2VWWA 3PPZA 2BRMA 4NFMA 4TYIA 3UOLA 2PE2A 4NJDA 4ZXTA 3FLWA 4L00A 1WFCA 4J7BA 4QMYA 1J3HA 3C1XA 4OTPA 4CMUA 4V0GB 4BTKA 3LMGA 2WXVA 2NRUA 2CLQA 1CKJA 3H0YA 2XJ2A 3GU6A 4O21A 2B9IA 1XBCA 2ZDTA 1PXOA 3PA3A 2QOCA 3NWWA 3PY3A 4KB8A 2WIPA 4GVAA 4O91A 4EUTA 4QMMA 4F9WA 3FQHA 4X0MA 2G2IA 2QOKA 2R3IA 5CWZA 4G3FA 4RIWB 3R04A 3FZOA 4FKSA 4MNEB 4D4YA 4L44A 3MA3A 4YSMA 3PY0A 4KBAA 5AM7A 4C02A 3JS2A 5DN3A 3RAWA 4IE9A 3AC3A 2Y6MA 3WZKA 1F0QA 4WIHA 4XG8A 3QD3A 1OPJA 1OMWA 2CJMA 4EEVA 2WNTA 4NM7A 5ETAA 3A7GA 4U3YA 4IWOA 4EZ3A 5AAEA 1H07A 2XP2A 2C5XA 4EONA 3W2PA 2UZLA 1IG1A 4D0WA 1STCE 1G5SA 2ITXA 2YFXA 3QAME 4MXZA 4CVAA 3D5UA 3CLYA 4ANMA 5BPYA 5EI8A 4FV4A 3VS2A 2R3QA 4DH1A 3P0MA 2DYLA 2FO0A 1B6CB 1GZOA 5AAGA 2JITA 3F2NA 5ANIA 4X2FA 5HLNA 3HA8A 2QO2A 3EL7A 4GT4A 3VUHA 3DFCB 4R8QA 5BUIA 2ZM3A 2XYNA 4DH7A 4JBOA 1Q61A 5M4CA 3A8XA 1M2QA 2OH4A 1GZ8A 3LCKA 3P4KA 3HKOA 4I94A 4IM3A 4YJVA 5ETFA 3O0GA 5KHWA 4RPVA 3D0EA 4WSQA 3U8WA 2C68A 4CT2A 4GYIA 4TWPA 3TZ9A 3EL8A 2PZIA 4QQJA 5TOZA 4EBVA 4EK5A 3ULIA 2I6LA 2PY3A 4MCVA 3OOMA 1YW2A 5KMJA 1WVWA 2PVKA 1YOJA 2W96B 1YWVA 4O4EA 5BUJA 3CTHA 4E20A 4PL3A 2QVSE 3G6GA 3ZFXA 3DKCA 2PE0A 1DM2A 3GC9A 4MH7A 5KNJA 5JGBA 5CY3A 3DGKA 4ZSEA 2WMSA 2XJ0A 1OKZA 3KY2A 2G1TA 1G3NA 4L7FA 4ACGA 2CGUA 5DEWA 5LCKA 2BUJA 1PHKA 1PY5A 4EJNA 2A4LA 2HYYA 3KL8A 4B4LA 3SOCA 4C62A 3H3CA 2B52A 3EFJA 1JKTA 5H9BA 1H8FA 4ZJIA 5DR9A 3II5A 4EC9A 5DBXA 4NW6A 3G33A 5L8KA 4LOOA 3GQIA 5FXSA 3RPRA 3BU6A 4OTWA 4FVQA 4FRFA 3R7VA 4F6SA 4NKSA 4R5YA 4EHEA 2UV2A 3M2WA 1Y6AA 5BVNA 3FHIA 3Q9WA 2Y0AA 4AP7A 4BL1A 2BPMA 4TW9A 1IEPA 3EB0A 3PP1A 4GIHA 2ZM1A 4PF4A 4XG4A 2OJJA 5BYZA 4EORA 4QTCA 3ZO3A 5B2MA 3CS9A 3FMEA 2GFSA 5CENA 4X2GA 5CU0A 5M51A 4BDAA 4IM0A 2B55A 1BLXA 3QKKA 4F1OA 4L01A 4D9UA 5DE2A 4L53A 2PMNX 2XIZA 4O6EA 5KE0A 4CSVA 3TZ8A 1W2FA 4FKLA 4R6VA 4YBJA 4BVUA 3GU7A 1Y57A 3QTUA 3G5DA 3JPVA 3CKWA 1H27A 4W9XA 4K18A 3PVUA 4BTMA 4E6DA 4CRSA 3RTPA 1W2DA 5E8YA 3FE3A 5CXHA 5CU3A 3EKNA 2VX0A 3AC4A 5CSXA 1BUHA 1XH8A 3O17A 4BIEA 3BHYA 1RDQE 4F0FA 5KMIA 1WAKA 4GJ3A 2F7XE 2QOQA 5HQ0A 3ZZWA 3VS5A 1YOLA 4C37A 3PJ1A 3SAYA 3UG2A 1XO2B 2V5QA 3Q60A 2X1NA 3HP5A 2CCIA 2GNFA 4TL0A 3LCSA 5FEDA 2C4GA 4C4JA 3POOA 5EDPA 5C03A 2XA4A 5C8KA 4IHPA 4CKJA 5EOBA 4ARKA 4DYMA 5DRBA 4ZLYA 2F4JA 2IVUA 3PXFA 3R01A 5E8TA 4D2WA 4ANLA 1L3RE 2UVZA 4U6RA 4FVRA 4U79A 3V5JA 2OZOA 2REIA 3MI9A 3ZCLA 3AGMA 4UX9A 1PW2A 4L6QA 4B8MA 4I6FA 2F7ZE 3FJQE 3EN4A 4I92A 4EOIA 1S9IA 4RC4A 3FPMA 4YPDA 4F63A 4EH3A 5CALA 3MH0A 4BWKA 1WBNA 3C4ZA 4NSTA 3PJ2A 3V5PA 2XNMA 4BGHA 4CTBA 4FT5A 3QZHA 2OW3A 3RNIA 4NH1A 4IB0A 4AA5A 5J9YA 3O7LB 5FRIA 2ZV2A 2BAJA 2QLUA 4MVFA 2HOGA 5TT7A 3RVGA 2FYSA 5FP5A 4C4HA 3D2IA 4MXOA 3S3IA 3FI3A 5AP4A 4IB3A 1MRVA 3CE3A 1SMHA 4EI4A 3E3BX 4V01A 4AZEA 2BILB 5HESA 2IW6A 4FG7A 4E5BA 2YITA 4AT5A 4Y95A 3S4QA 2OWBA 3UIMA 4MYGA 1H26A 3MFTA 3QYZA 1UU8A 3KXZA 3R73A 4HZRA 5FLFA 4AS0A 4X3FC 2CGWA 3PSDA 3LFCA 3HUCA 4IFGA 3TIZA 3JUHA 3LHJA 4WO5A 4QP7A 4BDGA 5LMKA 4RVMA 3QZIA 4CZTA 5AEPA 2WTKB 2Y4IC 4CKIA 4ZTLA 2OO8X 3W2SA 3C7QA 2UZUE 3VJOA 1T46A 3R1QA 3ZBFA 2LAVA 3EN7A 4O0RA 2XK7A 3UO6A 4C4IA 4CKRA 1ZRZA 3LJ2A 4ENYA 1E1XA 5C9CA 2X0GA 3EFLA 2Y6OA 2OJGA 3Q6WA 1JQHA 2QU6A 3MPTA 1PMNA 3LIJA 2UW0A 3EQRA 4LGHA 2FVDA 4D2VA 4JX3A 4JBQA 1KWPA 4PMSA 4F99A 3IW4A 3MJ2A 2WMQA 5ANDA 4ACCA 1ZY4A 3C51A 4FA2A 1W8CA 5BQ0A 4MF1A 3GOKA 4DGLC 5J95A 5E7RA 4BGGA 5ACBC 2WTJA 3MW1A 1Q97A 4A9UA 4QYHA 2VTIA 3I1AA 4ASDA 1VEBA 4IVCA 4NTTA 4CTCA 1AQ1A 1BMKA 4IXPA 3QLFA 2PZ5A 3QLGA 3RK5A 4OTRA 5CSPA 4EZ5A 3BV3A 3FV8A 5HCZA 4HZSA 4H3PA 3QUEA 4FKRA 4J52A 4LI5A 5CT0A 2X4FA 4HVSA 3QA8A 4ZS0A 5IEVA 4IBMA 3PZEA 1REKA 3KN6A 1ZMWA 4J99A 4RA4A 4FIHA 4N0SA 3F5XA 3I4BA 4D1XA 3VW6A 2PE1A 5DWRA 3FAAA 4FKOA 3MFSA 2XNPA 4HYIA 4FG8A 5LWMA 2UUEA 2PZRA 4DG3E 3K2LA 5JGAA 1AGWA 4B99A 3ZHPC 1PXIA 3R9DA 3V6RA 3QKMA 3EN6A 4WG4A 4BHZA 2XM9A 4XRJA 5H8EA 3VS0A 3ACKA 4BTJA 4S30A 3WOWA 1KE9A 1JWHA 2QQ7A 2UW6A 4XUFA 4AW2A 4BCIA 3VHKA 4J8NA 3G9LX 2Z7LA 1QPDA 4FF8A 2HW6A 4PDOA 3UQGA 1P4OA 4FTIA 4KBKA 4ITIA 4BDJA 5HE3A 1YXTA 4CLJA 3BHVA 4L68A 4M68A 2XIYA 1E9HA 4FV7A 4N4SA 4W4VA 4I23A 4EOMA 3ZONA 4UB7A 3R63A 5AUTA 4XRLA 2WIHA 3BWJA 4RMZA 4JT3A 4WUAA 3FMNA 1URCA 2WHBA 2XIXA 3UE4A 4QMSA 1FGKA 1FVRA 3EZRA 3KRLA 5A3XA 1FQ1B 1MQ4A 2QOOA 3PJ8A 4JR7A 5BMMA 2W1IA 2YDIA 4S2ZA 5E8ZA 3B2WA 3FXZA 2C3LA 2E9VA 4KKHA 4QMLA 4AGCA 3CJGA 3MY0A 1QPEA 2BTSA 1H4LA 3IDBA 3UBDA 1O6YA 2PVYA 4PTEA 5DNRA 1QPJA 4JDKA 4YLJA 3VBVA 4ZJVA 5GJFA 2B54A 3ZDUA 2W1GA 3G90X 4EH7A 2C3IB 2HW7A 2VNWA 2WTCA 3LFQA 5CU4A 1FOTA 3FLQA 3NNWA 1KSWA 3ZO4A 2BDJA 3BBTB 3V8WA 3BEGA 3RAIA 2UZBA 1OPLA 3TNQB 4MBIA 1J1CA 2R3NA 4OTFA 4U9AA 5J7BA 1XBBA 3P1AA 2WQBA 3FQEA 5HG7A 4F65A 4C38A 1E1VA 2XCHA 3E8EA 3EFKA 4S34A 3UVRA 2RG5A 5L8JA 5AMNA 4GK2A 4CFMA 2F9GA 2XK8A 3G0FA 4HCUA 5EHYA 4QNYA 3DY7A 3DU8A 4BTFA 5CEPA 4IAYA 4MXAA 3CD8A 2FUMA 4AW0A 2R2PA 3CP9A 4A9RA 3HRBA 3R30A 5AWMA 3Q2MA 5JZNA 3W8QA 3WI6A 2J0KA 4PV0A 3TKIA 2RG6A 2ZVAA 2UW7A 3ACJA 4KS7A 4RIWA 4YGAA 3U6JA 3PPKA 4MNEA 4FV6A 2P55A 4MEDA 4DEEA 5D41A 1PMVA 2GU8A 4E5WA 2BFXA 3KRRA 4RFZA 4J95A 3WZEA 3VBTA 1LR4A 3U87A 3RK9A 2GDOA 5BVWA 4GFMA 4G3DA 1UKHA 2XVDA 3QZGA 2E9NA 2JDTA 4IAKA 2VO0A 2Z60A 4QTEA 4YU2A 5H8BA 3IONA 3CJFA 2C6LA 4FV3A 5LVPA 4L43A 2A98A 1P5EA 3MY1A 3ORZA 4BGQA 4ASEA 1OL7A 3I5ZA 3FZPA 4CNHA 1BL7A 2BMCA 1XR1A 5JMSA 4I0TA 3W33A 4BICA 5IH6A 3R71A 2FSMX 4FTAA 1WZYA 1BX6A 4X6QC 4YMJA 2I0VA 3F3WA 4E73A 2OICA 3G6HA 3DKOA 4M67A 2GTNA 3GU8A 1TVOA 5A46A 3VS7A 3I5NA 5I0BA 4ITJA 4X3JA 4MWHA 4LQMA 5F1ZA 3OBGA 4QYEA 1ZYSA 4IX4A 2O5KA 2Y4PA 3QD2B 4KBCA 4USDA 5CVHA 4EHGA 1UVRA 4G2FA 4DGOA 3HMNA 3ELJA 1K3AA 3H30A 4U45A 2JFLA 4BCPA 1MUOA 5L6OA 2BHHA 2UZVA 3NDMA 3OG7A 2BR1A 4C3PA 3OWLA 4DEGA 2C5VA 5EW3A 3ZUVA 4ALVA 3W55A 3ETAA 4OAVB 5L2SA 4JG7A 4CLIA 4IX3A 1W7HA 5HVYA 1P4FA 3F82A 1OZ1A 3HEGA 4NU1A 2YLEA 3ZRLA 3A7IA 4L7SA 4UMQA 4ANQA 3GUBA 4BBMA 2W06A 2WOUA 4XG3A 1GJOA 2YAAA 3B2TA 3LXLA 4RC2A 5EM6A 3R8MA 3KKVA 4MF0A 1M17A 3WARA 3S0OA 2XKEA 5DGZA 4NW5A 5KBRA 1BYGA 1YWNA 5H8GA 4U7ZA 4OLIA 2RL5A 3C4FA 5HE2A 1ZMUA 3WF8A 3WF5A 3HV7A 4P4CA 2E9UA 3QQKA 1J91A 3QA0A 3ZH8A 2HXLA 4QMNA 1ZYCA 3FZSA 1PJKA 3OUNB 4W9WA 5AP7A 3EFWA 2BFYA 3G0EA 3KXGA 4FUYA 3FC2A 5EHOA 1GY3A 3QD4A 2YN8A 3QQHA 4IWPA 4TKSA 5FP6A 2GHLA 5BVEA 3UP2A 3CY2A 2SRCA 2C0TA 4EUUA 4IM2A 4C8BA 3FMHA 5CASA 4BB4A 3O8UA 2YCQA 3C9WA 4KKEA 5DIAA 1YRPA 5E91A 3O23A 4BCFA 5BVDA 3A7HA 2J0LA 4OTGA 5ANJA 1M14A 2XZSA 1H1WA 4RVKA 4O1PA 4OTHA 4F7LA 4J96A 3TEIA 4DG0E 3IOKA 3DZOA 2WELA 4JAIA 3SXRA 4TYGA 3GCPA 2HIWA 2UW5A 4QPSA 3LFNA 1JKSA 2OZAB 2ITTA 4I4EA 3R22A 4EYJA 4R7IA 1ZWSA 5CYIA 3UO5A 4G6OA 2OBJA 3R1NA 4RWJA 1S9JA 5K5XA 2PZPA 4AGUA 5JK3A 4RIXA 4R3RA 3OW3A 3GB2A 2WPAA 2ITNA 4TWCA 2PMIA 2UZEA 4XH6A 5K3YA 2X2LA 4IZ7A 3RWQA 4HW7A 2VWIA 3R7EA 4I24A 4KIKB 4RZVA 4XS2A 4O96A 2XBAA 1SVEA 4AOJA 4FIGA 3K54A 3NPCA 4WUNA 4CFWA 2YACA 1KE8A 2BRBA 3P7AA 2OFUA 2V7OA 3R8VA 2W1EA 3QCYA 4EZ7A 2BZKB 2QOIA 2WFYA 5CAVA 3PRFA 4RX9A 3A8WA 5C27A 4BYJA 1M7QA 1UNLA 3E88A 3ZLXA 3QD0A 1JKKA 4B8LA 4LUDA 4KIOA 4BI0A 4IVAA 4C59A 4ZZNA 2IZUA 4YJTA 4X21A 4XCUA 4TNBA 1Q41A 2B9FA 3KK8A 3QRUA 3W2QA 1U5QA 1OITA 2HAKA 2J0JA 5T6KA 4ACMA 4B6LA 4EH4A 2VTRA 1GZKA 3I0QA 4O0TA 4QT1A 5HE0A 3VUKA 5IA0A 2YCRA 4IW0A 2ONLA 3A7FA 3MV5A 1SNXA 4FIIA 3VRZA 4FTRA 4E5AX 3NS9A 5HU3A 4EHZA 4BCJA 1H01A 3W2CA 4FTQA 2YIQA 2BDWA 2C1BA 5DOSA 4BZOA 4EOSA 3LCDA 5HHWA 5IU2A 3CGFA 4D5HA 4USFA 1K9AA 5D10A 4JNWA 4PWNA 5KMKA 2QLQA 4ZTSA 4ERKA 3QHWA 1MQBA 2Y4IB 2PK9A 4EKLA 3NW6A 4NCTA 3I7BA 3O51A 3FMMA 1DS5A 2G2HA 4TZRA 1ZLTA 1P2AA 3RCJA 1YHVA 5AA8A 3JY0A 5AIKA 5L4QA 3KB7A 1H25A 2H34A 4ZZMA 3MN3A 4BDEA 5BMSA 5M57A 2AQXA 1A06A 2X0OA 3T9IA 5HO6A 4WNMA 4IADA 4U5JA 1YXXA 3CEKA 2X81A 4PPCA 2IVTA 1R3CA 3UPZA 3Q4UA 1FMKA 4DTKA 3EHAA 1GIJA 4IB5A 4IVBA 3LFSA 5AX9A 3OTUA 2PVJA 1YKRA 5CNNA 5ICPA 4ZLOA 5CF4A 4XYFA 2BALA 4QTBA 4MBLA 1JVPP 4FKIA 4UN0C 3PG1A 2VGPA 2VO6A 2W1CA 2OK1A 2WMUA 2RFEA 2W5BA 4GU9A 3VW8A 5IA2A 5IH4A 3C13A 4FTUA 3SOAA 3DB8A 2BZHB 5CTPA 2QODA 4F70A 4U8ZA 3RALA 2PVMA 3E63A 4FL3A 4I41A 4IWDA 2IW8A 4BCKA 3LXKA 4PTCA 2X6EA 4DAWA 3OVVA 3TUCA 5FWKK 3VHEA 3M11A 3AD4A 3QYWA 4FNXA 3D15A 1O6KA 3CD3A 5EOLA 1UV5A 2XNBA 2VWZA 3WZUA 4Q9SA 2ITQA 3EQHA 1JKLA 3QTQA 4LGGA 3CY3A 5DG5A 2C5NA 2BAQA 2EUFB 3UYTA 1GIIA 2XRWA 4U42A 4QP2A 4QQTA 3H9FA 5D9HA 4LG4A 3VWAA 2YM8A 2WMRA 3D7ZA 3R0TA 4A07A 4XP3A 4I93A 4M8TA 2OJ9A 4EKKA 2W1FA 3OXIA 3QTWA 3DJ7A 4F9YA 3VIDA 3S00A 2JBOA 3W16A 3TV4A 1IRKA 5DR2A 4V04A 4CCUA 2VGOA 4W4WA 3AC2A 4BCNA 3P7BA 4GVJA 4U43A 4FBXA 1XJDA 2X39A 1FVVA 3GCQA 4U81A 3KRWA 4YJPA 4M13A 3NX8A 5DA3A 5BNJA 2PZYA 4OGRA 3FXXA 4W8EA 3EIDA 3Q9XA 4R1VA 3RHKA 1XH7A 1GAGA 1XKKA 1HCLA 3NW7A 4RIYB 2QOBA 2JKOA 3S2PA 2WD1A