4D3FA

Bcsired from bacillus cereus in complex with nadph
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
284
Chain Sequence
b'KSVTVIGLGPMGQAMADVFLEYGYSVTVWNRTSSKADQLVAKGAIRVSTVNEALAANELVILSLTDYNVMYSILEPVSENLFGKVLVNLSSDTPEKARKAAKWLEDRGARHITGGVQVPPSGIGKSESYTYYSGDRVVFEAHRETLEVLTSSDYRGEDPGLAMLYYQIQMDIFWTAMLSYLHALAIANANGITAEQFLPYASAMMSSLPKFVEFYTPRLDEGEHPGDVDRLAMGLASVEHVVHTTQEAGIDIALPATVLEVFRRGMKTGHASDSFTSLIEIFKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMINE REDUCTASE
molecule tags Oxidoreductase
source organism Bacillus cereus
publication title Structure, Activity and Stereoselectivity of Nadph-Dependent Oxidoreductases Catalysing the S-Selective Reduction of the Imine Substrate 2-Methylpyrroline.
pubmed doi rcsb
total genus 114
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2014-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4d3fA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d3fA01
3M1AA 4J2HA 3V2UA 4DVJA 3ZH2A 3I5MA 4I9UA 4A03A 2D0IA 1TEHA 5EIOA 1MV8A 1P1IA 1SOWA 3QWFA 1W0CA 2B5VA 4YJHB 1ONNA 3JQ7A 2PTGA 1U3UA 1OAAA 2JKVA 3I1JA 4F45A 5JAMA 1F17A 1PX0A 3OEYA 2PZKA 4E13A 4PRKA 1XG5A 2AG5A 2G17A 3GNQA 3TZKA 4ALNA 1LDBA 1MX3A 3H9JA 1NQAO 4EGFA 3NTOA 4W9NC 3RROA 2D8AA 1GCUA 4OO3A 4ND5A 2B69A 4RZHA 3UGKA 3ASVA 3ETEA 2V7PA 2VWPA 3AK4A 4QXMA 2DAPA 1HYEA 2EP7A 4E5MA 5DCUA 2J3HA 1HDXA 1K6IA 5F5NA 4QUKA 1EVJA 1YBMA 5BSGA 4TZTA 2AEMA 5JAZA 4J4BA 3WTBA 2VHXA 4JK3A 4BQPA 2C54A 4UULA 4S3MA 3H2ZA 4IDBA 3C1AA 1OBFO 3I9OA 1HSOA 1GQYA 1Q0QA 3ORFA 1ZCJA 1Q2XA 2NACA 3RUIA 3W6ZA 3U4HA 1A72A 1K2WA 3I9LA 1R0LA 4E5KA 4BKUA 2JD2A 4H15A 2JAHA 4WCDA 3OF2A 1BG6A 2Y0CA 5IZCC 4E12A 1WDLA 3PLRA 3DOOA 3C3XA 1GYQA 2OFPA 4PZDA 1NQTA 4OHUA 3FBTA 4IY1A 3UF0A 4ZQFA 2JHFA 2FR0A 1JVSA 2X5KO 2CVOA 3BMCA 4FC7A 1I2BA 4OKIA 1U7TA 1JKIA 1K6JA 2GSDA 3EW7A 2I66A 2NWQA 5AXBA 3DBVO 4BMNA 4RDHA 1AN9A 4IMRA 2YYYA 4E2XA 5KJ6A 3SC4A 3PIDA 1HE5A 4PFJA 1K6XA 3JYPA 3OJLA 3WMXA 3STHA 1NQ5A 4TRRA 5DBGA 4OOFA 4UVEA 4ZU3A 2G82A 2OBYA 1TB4A 3VH2A 3GK3A 2Q2WA 4B3JA 2DBZA 3PXXA 3GGGA 4J1QA 1DSSG 1E1KA 5H82A 5AOVA 1HE4A 4BO5A 3I3OA 2I9PA 3ZWYA 4GBJA 2IXBA 1H5QA 3G1TA 3ZU5A 4CMJA 5ER6A 4R1NA 1UXIA 4ESOA 4YBZA 3KZVA 4DYDA 4QECA 4RPGA 2O50A 1DC5A 3FHLA 1E6WA 3FTNA 4P4GA 2EKQA 3H6KA 3ADOA 2WE7A 4LVUA 4Z9FA 4W7IA 3TNLA 3FNGA 2ZYGA 2EP5A 4F46A 2Z5LA 2W98A 1DO8A 1N8KA 5T5QA 2WTBA 2JAPA 3PZRA 4BKQA 1LNQA 4NU5A 4E5NA 2V6BA 4NFSA 3AUUA 4CLEA 1YDWA 4ONEA 3BA1A 3JTMA 3OIFA 4U6QA 1WMBA 4XDZA 3KSZO 1DFIA 2YDXA 4TRMA 1IPFA 2BGMA 1YJ8A 4WECA 3NJ4A 3LVFO 1KY4A 4AJEA 4DXHA 4OSOA 5I7SA 3JQBA 5A9SB 5CDGA 5TGDA 5C5IA 5LDHA 1NFFA 3NYWA 2E37A 1O89A 4FC6A 1Y8QB 1PJCA 1A4IA 3VPXA 1NPYA 4OJNA 2NU6A 2A94A 2GDZA 5JY1A 2RHRA 1D8AA 2LDXA 4IJKA 4Q3EA 3WYBA 1GUFA 1RM3A 2E48A 3L4BC 3V8BA 3PVZA 4XQGA 2HSDA 5B1YA 1QYCA 5B4UA 1C0PA 3VHRA 3SVTA 3G1UA 2AA3A 5KCZA 1BDMA 1UZLA 4RVDA 1YOVA 3UCXA 2DKNA 1DRVA 4BO8A 1H0KA 3UCEA 5DULA 4Q9NA 3OIGA 3NJ8A 3GGPA 3JQCA 3AU8A 4XIJA 1XSEA 1SEPA 2ZB7A 3NT5A 1Y8RB 2HAEA 3LU1A 4NBRA 5DOVA 2CF5A 1HDGO 4FFPA 5I7EA 4NNJA 1LBEA 3WGZA 3C7CB 3KLMX 3T7CA 4CM9A 5DN9A 1PZFA 4OKNA 1KC3A 4KMSA 1CERA 3NAQA 2FR1A 1HDRA 3BXXA 3WBFA 4D79A 1FF9A 5IDXA 1C0LA 3MJSA 3QRWA 3A9WA 4S1VA 1T24A 1DDOA 3I6QA 2C20A 4U0JA 2VRCA 4X54A 2P9GA 3C1TA 3H3JA 4PLCA 1VE9A 1NASA 2PFGA 2VUSA 4YR9A 2XXJA 1HT0A 1JQBA 1WW8A 4II3A 4EJMA 1HKUA 3JQAD 4OH1A 4CLRA 2VZ9A 3FNFA 2YDYA 2NVWA 4UUNA 1Y9AA 1RPNA 4MVJI 1TT7A 4PG4A 3RU9A 1DIGA 2PKQP 4W7HA 2Q1UA 4CUZA 3EAGA 4RLSA 1FDWA 2C5EA 3C7DB 3RQSA 3HADA 4FBGA 4HP8A 4PCVA 4TMFA 3O38A 2GN8A 1Z73A 1KETA 3AUAA 1KOLA 4IINA 5A06A 2OXIA 1KEWA 3E8XA 3E82A 1LLCA 3WGIA 1YONA 3ZHYA 4E6PA 1KERA 5CG1A 5I9LA 5DZSA 1O9BA 4DIOA 5JBIA 3Q2KA 4DBVO 5LDGA 1QYVA 1SPXA 4GKVA 1U28A 3VZSA 1J0XO 3PGJA 4E3ZA 5L9AA 1D3AA 2C29D 1U1IA 3DAFA 4YYZA 3O9ZA 2VWGA 2PKRA 4A27A 2VWQA 1NVTA 4BOYA 3JD2A 3NDJA 2R6JA 4DRYA 3KV3O 1YDEA 1SB8A 2HU2A 4BUCA 4R41A 5A3VA 4R69A 1LRLA 1EQUA 3DBLA 3GN1A 2JCYA 1M66A 2EIHA 2Q49A 3HDHA 3JV7A 1A9YA 4WLEA 4NBTA 1TXGA 2GCGA 1NXQA 3M1LA 4EEXA 1E6UA 1T1RA 2C07A 3DHNA 1LRKA 4BNNA 3PTZA 1P9LA 1ZXBA 2DU8A 2QZZA 5EN4A 4TKMA 3GG9A 2OZPA 4JN6B 4UUOA 3ZWWA 1GFSA 4WE3A 2C0CA 3HB4X 2GO1A 4NR0A 3UKOA 3VC7A 3KO8A 4YT8A 5I8ZA 1HE3A 3ONDA 4HNGA 4CODB 1E7YA 3PHHA 3VKVA 1FMCA 5DCWA 4RZIA 1R12A 4HUJA 2F00A 3RVDA 4BIIA 4WLUA 1GUZA 1FK8A 3IDSA 4J7UA 4XYMA 2OOSA 2QIOA 2W2KA 4JBGA 4RPJA 1H6DA 1M67A 1B3RA 3VZRA 2DLDA 3PDUA 1B3BA 4BNYA 5JPIA 1E7RA 3GOHA 2BI7A 1GYRA 4M54A 2AE1A 3IP1A 4DUPA 1R4MA 2PV7A 3GT0A 4XIYA 5L45A 3F4LA 4R5HA 1ENZA 2UUOA 2QHXA 4Y9DA 1M2WA 5LC1A 1JLLA 1PJSA 3Q1LA 4NIMA 4JCOA 5CEFA 1O95A 1GPJA 3GHYA 4XR4A 2QYTA 4ZQHA 5C7LO 4AJOA 5IZ4A 4XR9A 3DOJA 1NAIA 3H8VA 4IQ0A 4TWRA 2Y68A 1XA0A 5TNXA 1BRMA 1MXHA 1M6WA 3AU9A 4N7RA 4TROA 4IXTA 4EBFA 2B5WA 2GGSA 2ZTVA 2B0JA 2EF1A 3TN7A 1R4MB 3GUCA 1PQWA 3WQRA 3L4SO 4J1TA 3RFVA 4DIBA 2X5JO 4J9VA 1UAGA 3WXBA 5BSFA 3C8MA 4IQGA 3WYCA 1GZ3A 2OHXA 4ZN6A 4B8ZA 3KRTA 4J91A 3ZWNA 3WGGA 2QQ5A 4FJ1A 4CLHA 1SMKA 4KDEA 4MP6A 3D5QA 1ISMA 2CY0A 2WE8A 3QP9A 3Q6IA 5J23A 1CQIA 3PIIA 1PGOA 2X22A 3GAZA 4OM8A 3IP3A 2W4QA 2RH4A 1E3JA 2WYVA 4E2ZA 4RDIA 1VL8A 4LVCA 1SZJG 4NG5A 4XQCA 1GR0A 2O3TA 3QV1A 1C0IA 3UOGA 1EEHA 4CMIA 1LXCA 1FDSA 1WZEA 2P9CA 1VM6A 3UW3A 2WYWA 1U5CA 1U3VA 4BNUA 1PU2A 4CPDA 1Z6ZA 5JAIA 5IAAA 2NM0A 5CDYA 2ZB8A 5T57A 3ZNQA 5A5EA 4ZRNA 4DIFA 1JW9B 2WD8A 3A14A 4WCFA 1GCOA 2TMGA 1HE2A 2DBRA 2QRLA 3BHMA 4L76A 3TSCA 3PHIA 4JBIA 2O23A 3F47A 4BKOA 4BO4A 3PJEA 3IOYA 2W2LD 5GY7A 3Q2IA 4BKPA 3BMQA 3KTDA 1LDGA 3TZ6A 4P4LA 1I3NA 4YDRA 4FQ8A 2H6EA 4D3FA 4OXNA 3IJRA 4Z9YA 4I9NA 4BS9A 1N5DA 1DFHA 3NEPX 3RBVA 4BNZA 2VTDA 2YUTA 1E3WA 4CMBA 4JP3A 4J7CA 1KVUA 4IMPA 3ROMA 5ITWA 1E3LA 3LF1A 1U2DA 4GGPA 4XJSA 5H83A 1R6DA 2X0JA 3D4NA 2QW8A 2D1YA 3AOEC 4XKJA 1DC4A 2ZIZA 3ETDA 3GNTA 4YJGB 4NJOA 4I5EA 2B83A 3BZUA 2DTXA 2GN6A 3DBLB 3PWZA 1JU9A 1XCBA 5IN5A 2YY7A 3L6OO 5CDSA 2ZJ1A 1ADBA 1U2GA 3CZRA 4NH4A 1ZEMA 3AY6A 3SJ7A 1HLDA 3WMWA 1XLTA 4CLXA 1EK6A 1VL6A 1LQTA 4TVOA 2VYNA 3JYQA 1DB3A 3WICA 1L7EA 1LDNA 2CD9A 2DTEA 3JYOA 2BLLA 2RIRA 3UFXA 3ON5A 5DT9A 1VKOA 2R00A 3BTVA 5A02A 5DDIP 3F9IA 3GF4A 3WSWA 2Y05A 1IB6A 4D3DA 4GWGA 2NVUA 3ANNA 2O2YA 4XJTA 3WG9A 2BELA 1OMOA 2O2SA 2AQIA 1MFPA 4Z0PA 5T64A 4MKZA 1B2LA 4DQUA 1QRRA 1U8XX 1EVYA 4HFRA 1DC3A 1O5IA 4CMGA 1N1GA 2VT2A 2Q46A 5CHEA 5G0TA 1MA0A 4BGIA 2X5OA 1OC4A 1VPDA 2Q3EA 2W2KB 4R9RA 1B26A 5KNLA 3I23A 1Y7TA 4HFMA 3JQ8A 5L95A 3GG2A 3RFTA 3QHAA 1XGKA 3WDSA 3KYDB 2FRDA 3GRKA 1B8UA 1B8VA 1ISIA 4OSPA 2Y0EA 4U6SA 4AJIA 2J8ZA 3R0IA 4WCFC 4CM6A 4IDGA 4WASA 5L4NA 2O7QA 3I9JA 1ISGA 4HFNA 2GN4A 5JCJA 1QR6A 1EFLA 4Q3CA 4RF2A 4AJ2A 2VZ0A 3AW9A 4Z0HO 2GZ3A 4NBUA 6ADHA 1CYDA 4GX2A 4R01A 1LLUA 3FWZA 3WX0A 5JCJD 4IPTA 4O63O 3KLPX 1ISJA 4IZIA 2NU8A 4B3HA 3TPCA 3DTYA 2LDBA 4IIUA 5H81A 4EZBA 3VZPA 3PLNA 5IG2A 5U1PA 1IY8A 2AEJA 2EEZA 2CVQA 2P5UA 3AWDA 3NDIA 3PYMA 4PVDA 3PHLA 4PLVA 3GY0A 1NM5A 1HDZA 2VOEA 1LU9A 1ZW1A 2QZ9A 4ND3A 5KOIA 1DLJA 2JFFA 5JDIA 2FMUA 3JQEA 4QO7A 3RSHA 3PJGA 4BNTA 4D45A 3GVCA 4XX0A 1RM0A 1C14A 1HZJA 4ZA2A 2D5AA 4G2NA 2R00C 3KM0A 3TDKA 4B3IA 4UUMA 2VYND 3QIVA 1E1MA 1NWCA 2RH8A 1H9BA 1XELA 1EUZA 3PYLA 5THKA 4DYVA 2AEFA 4XB1A 4MIOA 3PQFA 4L8VA 2B36A 4WJZA 4LGVA 4E21A 1MG0A 3MJVA 5JO0A 1XWFA 4O0LA 4YJFB 2NUAA 2JCVA 4EUFA 3ITDA 2PY6A 5L4LA 4NK4A 4K9DA 5G0SA 3SEFA 2NU7A 1R4NA 4YWJA 1Z75A 3T7EA 4ALKA 2D59A 4WCFB 3EC7A 3JQ6A 4B4VA 1CDOA 5ES3A 5AXDA 1P44A 3GFGA 3ZHZA 3DR3A 3D3EA 2ZTUA 4A5OA 4D41A 3ITKA 1GD1O 3OM9A 1YO6A 4J4HA 4Z6KA 2BFMA 3HJAA 4CMIB 1P3DA 4FJ2A 3ZWOA 4B7UA 4IDDA 2TMDA 5JS6A 2RHCA 3JQFC 4YRAA 1NP3A 3ZU3A 1DLIA 2PR2A 1SBYA 5CAEA 2I6TA 2IYPA 5F3RA 3DC2A 3W1VA 1BXKA 3RAJA 2DPGA 2VNSA 1HYHA 4LW8A 2NVUB 3I9MA 1YBAA 4CJXA 4XRRA 4YJGA 5EPOA 2ZTLA 5TRTA 3ZNNA 2VHVA 1TI7A 2IXAA 1QG6A 1WXDA 3RASA 5FI5A 2J5KA 5IXSA 2FZEA 3JYNA 2DQ4A 2XPCA 2VQ3A 2EV9A 1CQJA 3U4CA 5L7TA 2B4QA 3P5SA 3AFMA 3TRIA 4J1SA 1UXKA 5JO9A 3KHUA 3GUYA 3T4XA 1HYGA 3G3EA 4Z0TA 5BR7A 3FR7A 5L3ZA 3HDJA 4WEQA 1E7SA 5AQ1A 3GA0A 2W2LA 4QX6A 3K2EA 1VJTA 3PWKA 5C7IO 1C0KA 2WWRA 5A04A 3H4VA 4Q39A 4MVJP 3EGOA 1M75A 3BMCB 3ONFA 4KQXA 1QORA 3VOSA 5DP1A 2HJRA 2GR9A 3GC6A 1TT5B 3NV9A 4U5QA 4RORA 3WJAA 3IMFA 2EGGA 1I01A 2I65A 3VAZA 1NTOA 1V8BA 3IUPA 2QG4A 1BGVA 1OOEA 2H9IA 3CZMA 4NHEA 3KYCA 3I83A 3WLEA 4DC0A 3DEYX 1O0SA 2JHGA 3WYEA 1BVRA 3TF5A 4OGWA 1CWUA 3ABIA 2ZYDA 4YXFA 3LC7O 2EXXA 4NI5A 1ADGA 4Z3DA 4P8RA 5T8KC 5FI3A 5L4SA 1B14A 1CF2O 1W73A 4DLLA 1LI4A 2IDZA 1YL6A 3TL2A 3TZQA 1A71A 4MVJM 4BNMA 3I4CA 4DL9A 1I33A 4B7CA 4PN3A 1VSUA 4II2A 2NTNA 1LSOA 3MJ4A 2IEDA 1IUKA 3K9QO 1NNUA 3LT1A 3MJEA 1YVEI 3CMMA 2AMFA 3LQFA 4GWKA 1FJHA 3E03A 2X58A 2WYUA 5JDCA 5BSHA 3N7UA 4FN4A 4IJWA 4R3WA 4J43A 3PYXA 4ZRMA 4CM3A 4OXKA 3V1YA 3GMDA 4CM8A 2I99A 1HXHA 3E9MA 5HA5A 3VTZA 4QFDA 1G0OA 5BSEA 5DBFA 1NR7A 1MC5A 1HDCA 4DLAA 3RC9A 4IM7A 3RC7A 4ND4A 3IS3A 4LRSB 5FFFA 4BO2A 4GX0A 4PLFA 3PDJA 2YV2A 1EDZA 3HHPA 1VRWA 1PWXA 5CG2A 5IN4A 3F4BA 3GVIA 4YAGA 3ZN2A 3OICA 3WOHA 1GZ4A 1A9ZA 5AXCA 3L77A 5I7FA 1NHGA 3MOIA 5B4TA 2Z1MA 1AHIA 3O03A 1PJTA 2IYOA 2PGDA 2OMEA 3NX4A 4DLBA 3CUKA 4EEZA 2ZQZA 3LC1O 2E82A 4DPLA 4JLWA 4RCVA 2G1UA 4RVFA 1RYEA 4OXYA 5A9RA 2A4KA 3A06A 4L9RA 2Y67A 3INTA 4N5LA 1E6EA 4M1QA 1FXSA 1R66A 1X13A 4GVXA 9LDBA 2ZJ0A 1P77A 2JFHA 3FR8A 4WLFA 3CH6A 3H5AA 1KY5A 3FI9A 4P22A 3S55A 5JMWA 1QMGA 1YKFA 3R1IA 3UN1A 2NNLD 4GSLA 3A1NA 3W4KA 3H5RA 3KUXA 5JYDA 3RBXA 3LK7A 4TZKA 1DOHA 1EVIA 1FDUA 3NDRA 1D4FA 4KOAA 4LMPA 4YTEA 4W6ZA 2Q99A 4ALJA 4B8WA 3GZNA 4MP8A 3BMNA 5CPBA 3AY3A 3AM5A 1XQ6A 4YEDA 4IGFA 3SJUA 3WJ7A 3SX2A 4XYLA 4BO1A 3TOXA 3RJ5A 1P0FA 1W4ZA 3K8ZA 2C82A 4J49A 1ISHA 4O5OA 4Q3DA 2VYVA 4PLPA 2G5CA 4Y98A 2HMSA 4M89A 2UAGA 1GEEA 1HRDA 2I76A 3K30A 4YQYA 4KTVE 2YHIB 3UXYA 1LRJA 2Q4EA 4CM4B 1BVUA 4XZ3A 4GGOA 1MLDA 3H9EO 4UEOA 1T2AA 2O3QA 1BXGB 1VSVA 1IPEA 3GEDA 4B4WA 2FZWA 3DOCA 1B16A 4IS3A 1ZK4A 5ICMA 3AUSA 5KWEA 3BMOB 4RQTA 2O7SA 4XGNA 1CETA 1EK5A 2E49A 1P1JA 4R4JA 2BHLA 4MIYA 3ZWPA 4DPMA 5I7VA 3H5NA 5KKAA 1F06A 4BHTA 4ND1A 2POQX 4ZVVA 1ML3A 4NK5A 5BT9A 1AHHA 2CFCA 4CQMA 2VHYA 4BMSA 3AM3A 2WJPA 4GX5A 3KOUA 3TFQA 1TT5A 3GVHA 5G0WA 2Q1TA 1Q1NA 5EINA 2Q1SA 1EDOA 1UUFA 2HK8A 2O4CA 3ANLA 3OJOA 2HK7A 3ROKA 4CR6A 2WDZA 2F1KA 4R1TA 4HKTA 4PVCA 1V9LA 3A4VA 3DHEA 3KYBA 4C4OA 1ZSYA 4GQAA 1I10A 4WPGA 4KWHA 1C1XA 1H93A 4IQ8A 3GAFA 1DHRA 3C1OA 3NT2A 2RAFA 2GRAA 4NFYA 2EW8A 1PJ3A 1JAXA 2YFHA 1XDWA 3BAZA 2J5QA 1H6CA 3K96A 6LDHA 4YAJA 2OP0A 1P1HA 1Y5MA 1WVGA 4RQUA 4MJLA 4W9NA 2C7GA 3DZBA 2CDCA 2HMVA 1PGJA 2BKAA 5EQDA 3UUWA 1SEVA 3IKVA 3LLVA 5KTKA 1ZVMA 4NU6A 4P38A 3FBGA 3GQVA 4GVLA 1ZSVA 3GDOA 1QLJA 3LYLA 1E7MA 1IYZA 3DB2A 4HX5A 3QWAA 4BGEA 4FW8A 4E4YA 4J7XA 1W8DA 2NTVA 1VL0A 4NPCA 2GF2A 2Y0DA 1DIHA 4DMLA 1E1NA 3OQ6A 4CV0A 4R51A 4YRBA 1XIVA 2YHUA 2YV1A 3DAPA 2DBQA 1ZK1A 4EUEA 1UXGA 3VVBA 3QW2A 1X7DA 2VRBA 3U4DA 3OJFA 2XAAA 3U49A 3U9LA 4FFNA 4FB5A 2PKQO 4AJKA 4PG7A 1MC4A 3AJRA 3SLGA 3F5QA 3WIDA 4CV3A 1F14A 4BNLA 4O6VA 1KC1A 2D5CA 4B7XA 5IJZA 4JGBA 1ZNQO 4IGEA 5G4KA 4MVJH 4Q3NA 3FD8A 1PGNA 3D4OA 1NFQA 2PZJA 1J6UA 2CVZA 2FSSA 4MVJD 3RUFA 3UHAA 2AQHA 2IEBA 1T4DA 3WB9A 1H94A 2HRZA 4JIGA 2AQKA 3DFZA 3UH1A 4HV4A 4L4SA 3BMQB 2HK9A 1BHSA 5KVVA 4WUVA 4XYEA 3PQEA 3HDYA 5CDTA 2VHWA 3X2FA 1LTHR 1PL6A 2H63A 1YRLA 4GL4A 3DONA 5DF1A 1M6HA 5IF3A 3RBZA 1HEUA 4ZGWA 3IAHA 1ONPA 3BIOA 4PG8A 3L6DA 2Y1OA 3Q11A 4YACA 3MTJA 5JMPA 2W90A 4OOEA 4CV1A 3NRCA 4PLYA 3O8QB 4M55A 4LCEA 1ZBQA 3Q3CA 5HS6A 4NMHA 4L0QA 4A0SA 1Q7BA 1SAYA 1P1RA 4BQRA 2FY8A 4DMMA 1UDBA 4R1SA 3E1KA 3P7MA 4XYGA 2A9FA 3FPCA 4PRLA 3GH3A 4IIVA 2I5PO 2YW9A 3NT4A 3EYWA 4MVJG 4XCVA 3WSVA 3JD0A 2BH9A 1IHXA 1ZK2A 2GZ2A 2OGUA 3PZBA 1CRWG 1PZEA 5C3MA 3ZHBA 3NTQA 5AYVA 2ZB4A 3NTRA 4PGFA 5CEJA 3TWOA 1BW9A 1ZJYA 4WOJA 1LDEA 3I4FA 4Y8VA 3CINA 1HTBA 3OFSA 3PFWO 3RI3A 3JQ7B 1LEHA 3ROPA 1EUDA 4FOOA 3ST7A 1Z45A 4AJ4A 3KEOA 1VKNA 2EJWA 4XRGA 1G0NA 2UVDA 5DP2A 2DFVA 1P1KA 3CSDA 1ZSNA 4RVUA 2DC1A 3D5TA 5DNAA 2OUIA 5G4LA 3RWBA 3TFOA 1AGNA 5JE8A 1D1TA 1ZKMA 5LCXA 4JJFA 2EG9A 4FFRA 5JW6A 1RJWA 1QV6A 3ZWAA 5JXWA 4FSHA 4LRTB 1NVMB 4KWIA 2JJYA 4UREA 3DQPA 4QTZA 4JX8A 2B35A 4DQVA 1KS9A 1JWBB 2Q50A 1EUCA 4MVJA 4KQWA 4DC1A 4YQZA 4CQMB 4BV8A 1ENPA 5EESA 4UEKA 3JQGA 2GASA 1NBOA 3GZ4A 4C7JA 1D1SA 3Q9UA 4TRNA 3W8FA 2Y93A 3BMOA 1ZUD1 5BNIA 2CDBA 1YS4A 1BXZA 3ENKA 5TS3A 2PH5A 2PGLA 4M8SA 1X0XA 1E5QA 3PP8A 3KYDA 4GH5A 3OA0A 1XKQA 1P45A 5AXAA 2VT3A 3DBHB 4I1IA 4CM7A 3P19A 4BO3A 2VOJA 3OH8A 1UP4A 2PNFA 1DIAA 1EVZA 2AG8A 3DAGA 2PK3A 3E9NA 1N7GA 4G5HA 4E2WA 2VRCD 1ZFNA 1MFZA 2P9EA 5TSDA 1NFRA 1SB9A 1ZMTA 2BFAA 5IXYA 4Y6SA 1JDJA 3ZW9A 3QVXA 4CM8B 3KSUA 3DFUA 3VDQA 4GLLA 1ORRA 3RC1A 4NFHA 3WTCA 1HF3A 1A5ZA 2WSBA 2E6UX 2VUTA 4I5GA 1K0UA 3OMLA 4WGGA 2FPGA 2J3IA 3EHEA 2A92A 2X23A 4PG6A 1LDMA 5B12A 2NV6A 2BI8A 3EZYA 5K6AA 1T4BA 1HSZA 3D0OA 4OQZA 1OI7A 1ONOA 1SO8A 1PL8A 1U5AA 3PWSA 4I5DA 3PEFA 5F1OA 4BNWA 1W6UA 2GYYA 4UUPA 1V3TA 5IDYA 1F0YA 1Y5RA 3EY4A 4OAQA 1LA2A 3EVNA 3WNVA 1RYDA 3EVTA 1T2FA 2B4TO 3AOEA 3DL2A 2EKPA 4R1UA 4YT5A 4YT2A 1NAHA 4RVGA 3VDRA 4MKXA 5DOZA 4CR7A 4RVSA 3MWEB 3FNHA 4FJ0A 4R54A 1WPQA 2X1HA 3ZNPA 3W4IA 1DRUA 3ZNOA 2NU9A 5CPFA 4PZEA 1GPDG 4XA8A 2Q2VA 2OP1A 3RJ9A 3WNQA 1F12A 2IODA 2QX7A 1I30A 3MJCA 2FPPA 1RWBA 4YJDA 3U5TA 1E0DA 1KVQA 1P31A 3WFIA 3GPDG 4BGUA 4FPXA 1IE3A 1N7HA 2XOXA 3EMKA 1P74A 5ER9A 1GADO 4WK6A 1O6ZA 4JJIA 1X7GA 3LT0A 2FP4A 2HUNA 2I67A 3ETGA 4Z3KA 4LMRA 1B8PA 3CPSA 4WNIA 2P4HX 4BNGA 1E3IA 5T67A 4L4XA 2Y99A 5CEEA 1V3VA 1IOLA 2EJVA 3GNSA 4TKLA 1PL7A 5FWNA 2ZTMA 2BFPA 3OQ1A 4H3VA 4CQMD 2CNBA 3U09A 1LC3A 1PS9A 1PS0A 3JD1A 4KUHA 1PJQA 3RKRA 2X0IA 2WEKA 2P68A 3R3JA 4PLHA 4G81A 1NQOA 4TQGA 1KEPA 1XR3A 2HLPA 2YHIA 3W8EA 4YPOA 1R4NB 2PD4A 2WD7A 3K73O 3NKLA 2OL4A 1DHTA 1WMAA 3ONEA 4D42A 1Z7BA 4R68A 1L7DA 1ID1A 2VN8A 1WNTA 2QRJA 4URFA 2Y1DA 3ASUA 1EMDA 3OEWA 3LDHA 2IZ0A 3BTSA 4CL8A 4AG3A 4ZICA 1I3KA 4ND2A 2VYVD 5A03A 1JVBA 3S1LA 5BNTA 4RGBA 4DPKA 2O3RA 3KETA 3GDGA 4MINA 4YAIA 2QYSA 3ZDFA 4YRDA 1LX6A 2V6FA 1HZZA 3D3WB 1HLPA 3WS7A 3UCFA 3DBRA 1V35A 1T1SA 4UVHA 4AFNA 1F8GA 2DVMA 4JROA 1KBZA 1T26A 3FF4A 3BYZA 4B4OA 2X9GA 5MGBA 3G49A 5JLAA 4PLWA 4RF3A 2ILTA 3MZ0A 1Z7EA 1GQ2A 2V6MA 5JYEA 1PJLA 4ITUA 3QJ5A 4CLOA 1R0SA 5TIIA 1N1EA 4GSKA 1MGOA 3W8DA 2AQ8A 4MOWA 4QT0A 2V65A 5CDUA 3TZCA 5KIAA 2Q1WA 1OC2A 3KVOA 9LDTA 5FEUA 1V0JA 3P2YA 4BO9A 3ICCA 4EI2A 1HDYA 2C59A 4FS3A 1EFKA 1PQPA 4PZCA 5A9SA 2VCYA 1XQ1A 2NLOA 4AJJA 2GZ1A 3PJFA 4E2YA 3I6IA 1J49A 4L74A 3DBHA 4LISA 5GZ1A 1H6AA 4Y6PA 4I08A 2NQ8A 2UV8A 4D7AA 3LLSA 3ZZNA 3WGHA 5HBRA 3RUHA 3T4EA 5A4DA 1S7CA 1O8CA 2HCTA 1NPTO 4GMFA 4RF5A 2PA3A 4ZJUA 4KDFA 3QWIA 2DUWA 3B1FA 4AJNA 1DEHA 4BNVA 4QSMA 2DT5A 3HUDA 3OQBA 3WQQA 3MWDB 2BGKA 5F1PA 1WP4A 3IQDB 1P0CA 2DPHA 1WDMA 3OA2A 2GPTA 4RL6A 2SCUA 4CUKA 4CM5A 4CM1A 3UVEA 1ZH8A 1ISFA 4AICA 3F3SA 2OBNA 3AOGA 1EBUA 1U7HA 3E5MA 3B6ZA 4LSWA 4TVBA 1LJ8A 3H9GA 3JQ9A 3WLFA 1Y8QA 1YH3A 3BTUA 4CLDA 4JP2A 2C7VA 1ADCA 2EW2A 1WZIA 4RVHA 1I8TA 4NBVA 3GFBA 4N5MA 5ILOA 3OJEA 2NQTA 1YL5A 1PR9A 1JKJA 2D4AA 5T6BA 1UR5A 2HMTA 3RKUA 3AUTA 5L7YA 2ZATA 2X0RA 2HDHA 2FN7A 3DXFA 3DZKA 3PHJA 4FCCA 4YT4A 4DREA 5IZCA 4J0EA 3H7AA 4RO0A 1DAPA 1YQDA 5I9MA 3QVSA 1EZ4A 3E9QA 2ZQYA 3EZLA 5A1TA 1A27A 3DMTA 4OYRA 4EJ0A 4F6CA 2X6TA 4J16A 2J3JA 4UVIA 3PJDA 3JD3A 1I36A 5KKCA 1NX6A 3ZWBA 3JYLA 4HWKA 4PIVA 1MUUA 3HQ4O 3S8MA 1CIVA 1UP6A 4NBWA 1MP0A 1T2EA 3SC6A 1BDBA 4R3NA 4A26A 4WLVA 5L51A 2VWHA 3DZIA 3SLKA 4HNHA 5CFZA 2Q45A 3DHYA 5TQVA 5COQA 1AUPA 3V1TC 2PD6A 4AVYA 1NHWA 4A7PA 2EERA 3ZGYA 3FSRA 3QVTA 1PGPA 3S2FA 3W6UA 2BFOA 2D3TA 3PHGA 4JJGA 3X2EA 2W8ZA 3IIEA 3E5RA 3PPIA 4LSMA 1R37A 3OECA 3U4IA 1UXHA 4W4TA 3VVCA 1BSVA 2X9NA 3HFSA 3VPFA 3BMNB 3FTPA 1SC6A 2HMWA 3PK0A 3TJRA 1Y8RA 1S6YA 3QWHA 4K6FA 4RV9A 5TX7A 4CLRB 1PJ2A 1C1DA 3CE6A 1DC6A 3SXPA 1E1LA 2A35A 4N54A 4FFMA 1K5HA 4DTIA 5HRUA 2O3JA 3ANMA 5TT1A 4FGWA 1E3WB 1Z74A 3JD4A 4J1NA 1U8FO 4M49A 1SNYA 4BGVA 5HS4A 1LSUA 5EERA 4LK3A 3RFXA 3VH4A 3VH1A 1VI2A 3BHIA 3W4JA 2YQ5A 3AY7A 2X0NA 1E92A 2GERA 3MOGA 4Z9XA 1C1XB 4KUGA 3GHHA 5G2OA 1XHLA 2G0TA 3OSUA 2IRWA 3M6IA 1SCUA 4E31A 5A05A 2DM6A 4ZQGA 1ENOA 1I3LA 1AE1A 3D64A 3O4RA 2C2YA 4KP7A 2RBEA 1V6AA 4YAKA 4NDNE 1BMDA 1MXFA 3CXRA 1G6KA 1UP7A 2NTJA 3QE3A 4KTTE 3WR5A 4K26A 3L9WA 3CTMA 3K6JA 1R15A 4ILKA 4EDFA 3KSDO 3V2GA 1WDKA 4IJVA 2PLAA 4EW6A 4CLOB 1TA4A 5HWSA 4XD2A 3I52A 2PZLA 3A28A 3N74A 5KVQA 3F6YA 2NSDA 4E32A 3L6EA 4FIZA 2EGHA 4F3YA 3F1LA 1QYDA 3HDQA 5ADHA 3VPHA 3RUDA 1PS8A 3ADPA 1CJCA 1VC2A 4JNKA 1MG5A 4GAEA 4Q3BA 1YQXA 2ZCUA 4L75A 4OQYA 2YQ4A 1MB4A 4YA6A 5L7WA 1A7AA 3V5NA 1NWHA 1GL3A 1YWGO 2C5AA 2CDAA 4ALIA 1E77A 1Q0LA 3HSKA 2DUUA 1YGYA 1H2BA 1IULA 1DJNA 1T2CA 2IE0A 2AE2A 4U8GA 4WKGA 1B7GO 4K1LA 7ADHA 2BRUA 3INRA 1YB1A 1XU9A 2XXBA 4G65A 4IDAA 1G1AA 2FSVA 5A5FA 3HFGA 4IUYA 4O59O 5JDCC 3K31A 3NUGA 2P2SA 4JBHA 2BGLA 4CMHA 1DIBA 2P5YA 3GGOA 2BD0A 4HADA 2QRKA 4CR8A 3HN2A 1QYWA 1X14A 4GX1A 4XWYA 5COAA 4DA9A 4PLGA 5I8WA 5JC1A 1AXEA 4KZPA 3GRPA 4RF4A 4HXYA 3DZGA 1YB5A 3M2PA 3RIHA 1N9GB 1U3WA 2PGJA 3B1JA 3RU7A 5IDWA 3I9KA 3QSGA 4D46A 1TVEA 3M2TA 1YBVA 1IL0A 1PZHA 1UDCA 5KVCA 4BNJA 3KYCB 5ENDA 3IKTA 3IL2A 5C37A 3INGA 4AL4A 5KJ1A 1GEGA 4FDAA 1T2DA 3MTGA 3SBOA 1E5LA 3S2EA 5TJ9A 3ZCXA 5K6AC 4J0FA 2V6GA 1DAOA 3AI3A 3JQ8B 3MJTA 4N5NA 4CMCA 1PTJA 3BHJA 1Q0HA 1I3MA 4L4RA 8LDHA 4J6FA 3E6AA 3V1UA 1VJ1A 2CF6A 3DWFA 1IHYA 3LT2A 4D43A 3QVWA 2CZCA 1LUAA 1PQUA 3GEMA 3NGLA 4BKRA 3ZU2A 3ZV3A 1YL7A 3KB6A 1ZEJA 1JKFA 2CSUA 3N58A 4QO8A 1U4SA 3WWYA 1PGQA 4E5PA 1YXMA 1ZMOA 4W82A 3VPGA 4CMKA 2RCYA 1UDAA 1EBFA 5U9CA 5A9TA 2P91A 2Y1GA 2VNAA 3KXDA 1X7HA 2VTEA 1U4OA 1I24A 5G4KB 1JAYA 3FRJA 1LQUA 2FOIA 2PH3A 1A7KA 1KYQA 2DFDA 4D0RA 4B4UA 2YZ7A 4CL3A 3FN4A 4QEDA 3ZU4A 5GMOA 1U3TA 3S2GA 1PEDA 2O3UA 4EYEA 4WLNA 2ZKLA 1ZO8A 2R2GA 2P4QA 3L0DA 3RD5A 1HL3A 1PSDA 1ZXLA 3D4PA 2D2IA 5JDIC 3ROQA 1M76A 1D7OA 4R16A 3O8QA 3P2OA 2HJSA 2Q2QA 3L9XA 2X86A 3G79A 4H7PA 1H9AA 1OFGA 2J6IA 1GU7A 3LZ6A 4FR5A 4R5MA 3PQDA 5B37A 4CUJA 1YE3A 1PZGA 1E7QA 1HETA 2CMDA 4NJMB 2HQ1A 3TOZA 5K0ZA 1QSGA 1WWKA 2HO5A 3VPSA 4E33A 2FR8A 3ENNA 3DZJA 1QP8A 3QY9A 1LLQA 4FGSA 1X1EA 1QKIA 3LSYA 2EKLA 1EQ2A 5TJHA 1ARZA 4UAGA 1KVTA 1WAMA 2JD0A 3S2IA 1AXGA 2CUKA 4KUEA 3FNEA 1C3VA 2OORA 3HG7A 3LF2A 5FF9A 5BNFA 3U3XA 1ZZEA 1QLHA 2J5RA 3LC2O 5EJ2A 3CIFA 3ZHXA 3TZHA 3ZI0A 4F6LA 4FD3A 3DMTC 3OIDA 4FOSA 4UVDA 4RJTA 4ZQBA 4BB6A 4ZQEA 1BW9B 3C24A 3FPLA 4YJFA 1YQGA 3IC5A 2ZCVA 5TT0A 1SOVA 3B1KA 3H65A 3EDMA 4BO0A 4BO7A 1J4AA 4D0SA 3RUEA 3JSAA 3ZV4A 1DXYA 4BMVA 3HN7A 3UAGA 1E7WA 5DCYA 4HY3A 3B20A 3JQFA 1KVSA 1F8FA 1DFGA 1UZNA 5G0VA 3WGYA 5A3JA 1BTOA 2Y1EA 5JFOA 1TLTA 3VKUA 3GVXA 3COSA 2ZYAA 1DPGA 3H3FA 1ZJZA 3L4BA 4BNXA 2PD3A 3C85A 3WBBA 1GV1A 1I2CA 2GLXA 4NQZA 3GR6A 1UXJA 1ZIDA 2Y66A 4XB2A 4ZHSA 1GQQA 3AM4A 1J5PA 3HE3A 4A2CA 5T8KA 3ZV6A 4J4TA 4ROSA 2XF8A 4UVGA 4I5FA 3AFNA 3HNPA 4WOKA 3K5PA 3JQGB 2NVBA 1KVRA 4MPDA 4WEOA 2JL1A 2E4AA 1RKXA 1PJ4A 1R16A 4IBOA 4NZ9A 4I8XA 3ICPA 1I5RA 2H5LA 1L1FA 1YOVB 3HWRA 4R9SA 1P1FA 3CKYA 4IDEA 2O3SA 5TC4A 3ULKA 1NPDA 2G76A 4PLTA 3V2HA 1QYXA 3K92A 2Q4BA 4P4NA 1IZ9A 4D3SA 4YCAA 5MDHA 2JD1A 4E30A 4CQLA 1PR3A 4YVFA 5JNLA 1Y9EA 5ICSA 1Z82A 2DTDA 1I0ZA 3VZQA 1UAYA 2BMAA 1XU7A 4IDCA 3JQ9C 5B4VA 4UEJA 5THQA 3U0BA 3AI2A 2ET6A 1KIFA 4XGKA 3KBOA 3RUCA 4BO6A 2ZB3A 2HKIA 2GUGA 3ZWXA 2X7HA 3DO5A 4MP3A 1Y6JA 2VHZA 3D7LA 1ULSA 1BWSA 1JN0A 2WMDA 4LCJA 3CMCO 5L53A 3GN2A 3HB5X 4J2OA 3WQSB 3WWZA 3JQDA 1GV0A 4E5YA 3GLQA 1ENYA 3R3SA 4CQLB 1LDYA 3VH3A 2PZMA 2X8LA 1U9JA 4I9HA 4WNCA 4XYBA 1C1DB 1O94A 5EQFA 3WGTA 3IUSA 4J9UE 2EWMA 4JQCA 1Y81A 4D44A 2UYYA 3OHSX 4BL5A 3F5SA 3PRJA 1N2SA 1ZK3A 2FPIA 2VUUA 4MVJE 4TRJA 4XQ9A 4MIEA 4DQXA 4MO2A 1XEAA 3GEGA 4GLOA 2YV3A 3EUWA 3QQPA 1HDOA 3AI1A 1FDVA 2I3AA 1EE2A 5F21A 4AJLA 4U0KA 1LSJA 5G0UA 2B37A 3H2SA 1ULUA 4OL9A 1DJQA 1RM4A 4INAA 4U7WA 5ITVA 2PWZA 5JSFA 1GUYA 1PWZA 4AJPA 4EITA 4GI2A 2B4RO 2FHSA 3GPIA 4XQEA 4NJMA 5KJEA 3PI7A 1B15A 2Y1CA 3JCZA 4GPD1 1Q7CA 1X15A 5KJFA 4E0BA 4A10A 1GDHA 4CM4A 3DMYA 1ADFA 4YB8A 5BQFA 5C7OO 3VTFA 4CMEC 2UUPA 3WGQA 5L40A 1JWAB 3UICA 4IZHA 5ILGA 1LSSA 4Y6RA 5CP8A 4DWVA 4XDYA 4QQRA 2O4UX 5HTOA 2VZ8A 3L07A 2X4GA 2AXQA 5KJCA 4K6CA 4H16A 5GZ6A 4TSKA 4BNHA 1IZ0A 5K9ZA 2OO5A 4BNIA 5EMHA 4IDFA 3RCBA 4M87A 1V3UA 4BB5A 2Y1FA 3U62A 3O26A 4ZD6A 3GMSA 1T25A 3E48A 2GD1O 2J3KA 3C7AA 4MDHA 1B0AA 3K2BA 1ZK0A 3ZWVA 5AVOA 1KEVA 1FDTA 2WD7B 3MCVA 5JY6A 1BXGA 2AHRA 1X1TA 1X0VA 3GZNB 4AJHA 2HRBA 2JFGA 4CV2A 3PGXA 3ZWMA 8ADHA 1GZ6A 4A73A 2EHDA 4EUHA 3NGXA 3QLJA 3DTTA 4GKBA 1I32A 3QVOA 3D3WA 3I9NA 4BNKA 3F46A 4AJ1A 3GDFA 1QV7A 5F1KA 3JQAB 4BNFA 1OZAA 5JCXA 2DBVO 2GNAA 4ID9A 4JXKA 4WLOA 4DGSA 4RPLA 1NVGA 2YJZA 4IJUA 3Q0EA 2WM3A 4Y67A 1CEQA 2O48X 4L73A 4OIMA 4ALLA 4BVAA 5TF4A 7MDHA 3R6DA 3OJ0A 4IS2A 1QXSA 3FCOA 1YJQA 1XYGA 4HFJA 5HM8A 5I9NA 1JTVA 4FFOA 4DBZA 2UDPA 1K3TA 3ZW8A 3OETA 4IXWA 4OMUA 3LT4A 3DZHA 1YB4A 4CMAA 1VLLA 3PFFA 3F1KA 2JCXA 1GY8A 5JAQA 4J3FA 1K89A 5IFLA 1UH5A 4RLHA 4RPHA 3DBRB 2X9VA 1VJ0A 2FWMX 1RM5A 4LN1A 5EL0A 1Q7GA 3JQAA 1KEUA 3H9QA 3H9UA 3HZZA 4MVJF 2HMUA 4RPKA 3D1LA 4HBGA 3JQBC 1LC0A 3FWNA 1DBVO 3WGOA 4N18A 4PLZA 5COBA 4Q3AA 4GMGA 2Z1NA 4QFCA 3ZV5A 4XEHA 1E3EA 1DRWA 5F5LA 3CTVA 1NYTA 3ZWCA 5JC8A 2IZ1A 3IJPA 1PIWA 1H6BA 1R0KA 5IDQA 3GVPA 4M86A 4FFLA 4W99A 5ENVA 1E3SA 1GTMA 3QA9A 3G17A 4YAEA 3TQHA 3OBBA 4ALMA 3RC2A 1GAEO 3RUAA 2H1SA 3B70A 3DDNA 4MKRA 4J90A 1WLYA 3MEQA 2GN9A 2ZK7A 1PJBA 1DIRA 3KEQA 2Z95A 1P33A 4K28A 1LLDA 5DBIA 4C7KA 4CMEA 5KVSA 2AW5A 3OP4A 1NR1A 1N9GA 1HWYA 4YJHA 5GZ3A 2NADA 2IZZA 5TLSA 3G0OA 2I3GA 4BV9A 3E18A 1GYPA 2YFQA 2C2XA 1H2HA 3TL3A 3WFJA 3QWBA 3BTOA 4O1MA 1Y1PA 3EK2A 3DZFA 3CEAA 1UJMA 3Q9NA 1A4UA 1EE9A 4B79A 1UZMA 4PG5A 1N92A 5FYDA 5U4QA 2BF7A 1JA9A 4XGIA 3WIEA 4CM9D 4EJ6A 1I2ZA
chains in the Genus database with same CATH superfamily
4J2HA 4DVJA 5SZJA 1EFPB 1IVSA 4X61A 1N5IA 1YI0A 1C8BA 5KU7A 4RD0A 4YJHB 4LF7B 1FQOA 2MR6A 4JUCA 4UAVA 4OQQA 3GWZA 2PTGA 2OTCA 4GNKA 1CY0A 1QYRA 4Y1FA 1F17A 1V1RA 1FB5A 3GXOA 4A92A 2QTMA 4ALNA 1VB3A 2O57A 3BBLA 3GNQA 1DKNA 3TZKA 2BTQA 3QYJA 1Z38A 1MX3A 4PQFA 3H9JA 4EGFA 5K8JB 4W9NC 4HO1X 3RROA 3EH2A 5BSWA 4CFYA 4RE6A 1GCUA 4UXHA 2C5BA 4NYMQ 4RGVA 4RZHA 1JNYA 3EPKA 1OI2A 1KH2A 4OHMA 1L9KA 2RHWA 4YQFA 2O0JA 2X6QA 1S9DA 1VL1A 3B3AA 2V7PA 4UUAA 4CHGA 5BWBA 5KZMB 2B78A 5B58T 1AKTA 4Q3KA 5B3LA 4HVAA 2YVQA 2V5AA 2EP7A 5DYTA 3UHFA 1JSLA 3UQYS 2J3HA 1HQCA 2IYLD 3GJZA 2I33A 2PEZA 1YBMA 3TOVA 2PSFA 2PRKA 1IXKA 3WTBA 1I1QB 3EIWA 4BQPA 10MHA 1X7ZB 3S2SA 5EXPA 1OBFO 1VG8A 3FYUB 3PDHA 5LYJA 1OHHD 5FTWA 1ZCJA 4PHCA 3RUIA 3W6ZA 3N7AA 2G25A 4MV1A 3OTIA 3U4HA 4CE6A 3DDHA 4UMDA 4BKUA 4H15A 4B33A 5D3MA 1NBEA 2CGEA 4GZMA 1M1YB 4CEIA 2UZ4A 1Z6AA 2ZSBA 2FXVA 1XHEA 4UJ3A 2H51A 3HKCB 5HOQA 3PGA1 3PLRA 1WF3A 3DOOA 3RR2A 2NZ8A 3C3XA 4C4AA 4LYEA 3CH5A 1NQTA 2I1VB 1PBTA 3BIXA 3R3XA 2FW9A 3W5BA 3B7WA 1HM5A 1DXOA 5J2UA 2R6ZA 4IIGA 4GE0A 4UUQA 4OKIA 5DSTA 2D74A 4KB5A 5DBOA 2GSDA 4M7RA 5IT4A 4O1HA 2W71A 2RHTA 1MJ5A 4ML3A 1Q3KA 3DBVO 3HY4A 2EW1A 4Y1EA 4DB2A 3PIDA 3EASA 1CHDA 2CHQA 1K6XA 3OJLA 1R4ZA 2XUAA 1NQ5A 1ORVA 2Q0SA 2LVBA 1SCIA 3FSEA 5TQ0B 4GP6A 2SKDA 4B3JA 1WKCA 2DBZA 1P7VA 1YZNA 2NP7A 1E1KA 1RI2A 5KWJA 1J2TA 4MMYB 2O8NA 2HRCA 4PC1A 4TSFA 3L7BA 3N3BC 5K03A 1XNQB 4GDMA 1XDGA 4PYMA 2WT9A 2IXBA 1H5QA 3EARA 3V1LA 8GPBA 3G1TA 4QHSA 2OM2A 1CSEE 3WLAA 3A3NA 3LGSA 5IKMA 3WWEA 4DYDA 4PM4A 5C81A 4HNTA 4F7WA 4JDPA 3I9V1 3FHLA 2P6RA 3ZD7A 2OPBA 1E6WA 3ANYB 4NLLA 4K9NA 4BZXA 3FTNA 5CYOA 5LKRA 1T6BY 3S4YA 3TE7A 4YAUA 3FLEA 4MVWA 4J29A 2EKQA 2HNAA 3EIHA 4R81A 1PG0A 3ADOA 2IP4A 4FYHA 4W7IA 4F3RA 1YOBA 2FTKE 1CJUC 4WVLA 4F46A 2QJRA 4LOHA 3OIUA 4EHFA 5IXJA 3IOCA 2E5LB 1DO8A 1N8KA 2IQIA 1IPHA 2R87A 1B1CA 1DELA 1EINA 1T9GS 2FFAA 3M34A 4LRYA 2JAPA 2QT1A 1B0PA 4N3AA 4XTCS 2EVWX 4E5NA 2VHTA 4KQ2A 1LBIA 2EBHX 2KI5A 3SSNA 3T9DA 4U6QA 3VJKA 3ET5A 1TKAA 2XUDA 1ZMBA 3M6VA 4H35A 4PFQA 3T61A 4ZZ0A 2CLFB 4EKYA 2CL5A 2MYTA 4GMKA 3OOJA 5ITSA 1I13A 3RRYA 4DWJA 5GP1A 2JFUA 5ALOA 2EAUA 3K0FB 2V58A 4OSOA 1JDNA 3SSMA 5CDGA 2HXSA 3OMXA 3CYFA 1KE2A 5CFMA 1IVNA 3GW8A 4FC6A 1A4IA 5IBQA 1I2AA 2NTYC 4X65B 1MX9A 3G88A 1ACLA 4EYKA 4FBMA 5MFPA 1OSNA 4IHJA 4EIWA 1HNZB 4Q02A 2A94A 5F98A 1CUBA 4PYOA 2CXQA 3U4QA 5DTQA 4Q3EA 1GUFA 2BMEA 2HXYA 1ODTC 3FZGA 5BXQC 1N2IA 1MOZA 5CYPA 2EP8A 4L0DA 3KQLA 4WY2A 2JJ2D 1QYCA 4MS3B 5B4UA 4LNAA 3QOYA 1C0PA 1ESDA 3GQBB 3NLLA 4LOIA 4QD3A 1WQ1R 1CNMA 5E4FA 5KCZA 1Q15A 4Q00A 5KU1A 3PF9A 3ZTTA 1UZLA 4RVDA 2B6HA 1U2PA 2ZJ6A 3BGSA 1IU9A 2Z3WA 2E0IA 3UCXA 5GJVC 3SKYA 1GRRA 3V4OA 2ZIVB 5IPFA 2A0WA 3QI2A 4QPPA 4RZUA 2BVNA 5A6SA 3FW1A 5LL6P 3UCEA 4YUWA 4UZSA 5HHTA 2L42A 3RVJA 1C7JA 3NJ8A 2W83A 1SR8A 2PLWA 1V9CA 2ZYTX 3E5NA 3GGPA 1XSEA 1SEPA 4LYYA 4XIJA 2DFTA 2Q27A 3HL0A 3LU1A 4P0QB 3IVMA 1IEVA 1USWA 3LUDA 4FFPA 1U0TA 3RS7A 4NNJA 1LBEA 2CL7X 3EF3A 1DNPA 2QLJA 3OFKA 4W5OA 3PX3A 3KLMX 4QL3A 5JVDF 1JLLB 2PSJA 2Z6VA 1UT5A 3K09C 4XGRA 3OFVA 2BBOA 2I62A 3UWSA 1H4QA 2XIJA 4JVOA 1K06A 4OKNA 4CF4A 2YNMC 3KPYA 1T13A 2XV1A 4D79A 2B7CA 3BXXA 4NZZA 1YJXA 1VG0B 1FF9A 1LPBB 4IRMA 1R0XA 1THTA 5DNYB 1X2BA 1ZESA 3CIOA 2FFBA 2LCIA 1C0LA 2ZJ4A 3ILYA 3MJSA 3O0TA 4OQLA 2FPLA 4UEWA 4F5EA 1IOVA 2QYOA 4IF4A 1R6BX 3OX4A 4Z3OA 2P9GA 4RY9A 1T9GR 2ZUSA 2DR0A 1BFKA 1M8PA 2JH3A 3NO4A 1NXPA 1M6VB 4MNTA 4C0BA 4II3A 1GTSA 5LFAA 1Y3CE 3V9AA 1NRJB 1CF9A 4F1KA 4EOGA 1UFOA 4PZ0A 4C88A 2WZCA 3LZDA 4IZ6A 4DA6A 3RU9A 3IR5A 4CETA 4UZFA 3TSAA 1DIGA 3PI6A 2PKQP 1NXVA 4QGGA 4W7HA 4Z4QA 1IK6A 2Q1UA 3K6KA 3EAGA 3T1OA 3EDYA 1CB0A 2Q3FA 5EXDA 2RGNA 1IZ7A 1H65A 4AK9A 3RQSA 4DDMA 3FPFA 2PZEA 3HLYA 4FBGA 4XFKA 1XTQA 1Z2DA 3KQUA 1QHGA 2N46A 3MRXA 1MABA 1ZL0A 1HE8B 4CCAA 5A06A 2REQB 1I6WA 2VJQA 4TMWA 3FHTA 1ZG3A 3E82A 3NBZC 5I48A 3O1JC 3HMQA 2JLZA 1L8AA 2RGUA 1YONA 4Q93A 4UU7A 2W2VA 2FWBA 5AKJA 2HA3A 4JT9A 3PNKA 4E6PA 4YUAA 5JZ9A 4ZP1A 2XMCA 2VDQB 4D9NA 3FYSA 2CBXA 4O25A 1XB2A 3BD8A 3F73A 1JI0A 4BECA 1OYVA 1ES9A 1I9CA 3CLTC 4UTPA 4P58A 1T1IA 4EGJA 4WZAE 1Z33A 2DFPA 2FWRA 1KYXA 1SBTA 2C29D 2I0FA 3DE0X 3DKRA 2FEAA 3DF9A 3RVSA 4EY6A 5JNSA 2WF7A 2JJ2A 2RMKA 2VWQA 1IMJA 1F4VA 4DJDC 3EXAA 4KR3A 1XZMA 3B3GA 5ICFA 3K2QA 2XRMA 3W9YA 1GN9A 2FN8A 1GG2A 4DV6B 1KH3A 2O7NA 3SAJA 3WLQA 1WJGA 2UXBB 2HOQA 2C4UA 1YQWA 2PMWB 5EKTA 3S28A 5KC8A 2JI9A 4R69A 4DAEA 2P0YA 3JX9A 1K27A 1LRLA 2GTIA 3O74A 5FPPA 1EQUA 1DAEA 3OG9A 4PXSA 1CDDA 1K1EA 3MBIA 4CL0A 4QICA 1C4KA 4OYHA 3LUBA 2XWPA 4WLEA 5AVXA 2QX4A 4NBTA 5LD2B 4U7TB 1SXHA 1NMQA 3RG8A 2GCNA 1MB9A 1VE3A 4EEXA 4EK9A 4O8ZA 1T1RA 2C07A 1KK0A 1PR6A 2YS7A 1YKGA 3C14C 2GZRA 3I92A 1P9LA 1QV9A 3EDOA 5EN4A 3DV2A 4FOPA 4EQZA 3REOA 3UMSA 2Q5OA 3VO1A 4WE3A 1T2NA 1T1GA 4NR0A 3UKOA 3NH9A 5I8ZA 4TKUA 4CODB 1P4GA 1JDPA 1AKMA 1IZ8A 4R2JA 5LP6C 1UKZA 5KTNA 1T9CA 2I2XB 5DLDA 1EFTA 2P6NA 4G4GA 4KQGA 8MHTA 1XZ8A 4JA0A 1IUNA 4PONA 1PFGA 2ZBVA 2BFDB 3R6LA 5JAOA 3U0VA 3VSCA 1H2EA 3IDSA 3MCUA 4XYMA 3TINA 3G82C 1MEOA 3C3JA 2GD6A 2IYUA 4NDZA 3VZRA 2DLDA 3PUYA 3WDKA 4M0UA 3PDUA 4CBVA 1B3BA 2F3PA 2OB1A 1FW6A 5HFAA 4EJ2A 1GYRA 5EPUA 2QAIA 3L49A 3IP1A 1CFJA 3KXPA 1R4MA 2WIDA 4EFMA 4CF5A 3G85A 2O52A 5LQJA 2E87A 4WBNF 1AA9A 5H7XA 4LKRA 1C8KA 1M7HA 1DAHA 2Q3MA 3PPXA 3GPBA 2R3SA 3GD7A 3GWGA 3Q1LA 4NIMA 1TM3E 1O95A 2Q62A 4FDTA 1CZHA 2IHBA 3RWOA 2A57A 3RIMA 3T7SA 3GV0A 4MW9A 4XR4A 3FCUB 3DEJA 3VBEA 1U0JA 1CR2A 4DSNA 4ZQHA 5GINE 4AKSA 2IXFA 2QP3A 4PS0A 4F8JA 1MPTA 1C3EA 3GFFA 1HEIA 3TIXB 4AJOA 4DM3A 2WUDA 4NECA 4A3SA 3JS5A 3EXHC 3H8VA 4HGNA 4IQ0A 4RFVA 2Y68A 1M5TA 3RVPA 1BRMA 1MXHA 2FX3A 2BCJQ 2VNIA 3ONWA 4IIFA 4MLCA 4H7EA 2GGSA 1APBA 1P7CA 3JAKB 2QN1A 4LY3A 4QNRA 1UBFA 4JV5B 4Z7OB 3L4SO 3CTPA 4J1TA 3W3AD 1I1HA 1XAHA 1P6UA 3RFVA 3ZGNA 2X5JO 4J9VA 3H1PA 1KZ6A 3BWDD 2A5LA 3NALA 4E7OA 5EJFA 3KK0A 2CLIB 4YRGA 3EIEA 4Q7MB 3VR6H 3AHDA 4RNCA 2QR5A 1II0A 3KELA 4DQKA 2F3SA 3KRTA 2HBZA 4J91A 3ZUPA 3MILA 3ZWNA 4FJ1A 2PCJA 1WXIA 5LLTA 1ULHA 5FWDA 3D5QA 1RYFA 3ND8A 3BXEA 4IEFB 1NONA 1Z28A 4N0EA 4ZT3A 3HSYA 2WPNA 1ZNXA 3GAZA 3MPUA 2W4QA 1SXQA 1E3JA 3KQOA 3SM3A 4E2ZA 5HKAA 1VL8A 1D6MA 2Y9YA 3DV0A 4NG5A 4EW2A 1ISPA 1GR0A 3G23A 3IVXA 1Q6ZA 1C0IA 2UVPA 1EA7A 1LXCA 1RRFA 1Y1QA 2XMPA 4JJ7A 1FTQA 5DLQC 4JL8A 5T4EA 1VDMA 2R1UA 3C87A 1Z6GA 2WYWA 4Z54A 1U5CA 1NN3A 3Q3GE 1PU2A 5C4GB 4CPDA 3P0EA 5IAAA 4ZMRA 1RWXA 3ZNQA 2AI1A 4AJ9A 3WWCA 3ZE0B 5A5EA 1Y6GA 4ZRNA 3H0KA 1JW9B 2WD8A 3A14A 4PHFA 2GESA 2TMGA 4US1R 2DBRA 4KOEC 4X45A 5AW6A 4Q82A 1P18A 3BHMA 1AKYA 4RXUA 3VR3A 2QU7A 4NNOA 1QPZA 1ZBDA 2O23A 2PBZA 3F47A 4U6NA 1TZMA 2GK7A 1JPUA 2JBWA 2QMUA 2WG2A 3QENA 4JC5A 2FSPA 3G8YA 4TS3A 5F9HA 5AI9A 4ZIRA 3Q2IA 2W11A 3SEAA 3BMQA 3WKDA 4F5WA 5EJMA 4P4LA 4F12A 1YRYE 3D2LA 3WMRA 2AT1A 1LK7A 3U4GA 5I3ZA 4D3FA 2J9XB 3RS9A 3IJRA 3PCRB 1DO0A 4Z9YA 2E1RA 2BR3A 1A8PA 3RBVA 2VP6A 5JSUA 3D2CA 4X6UA 4F8YA 4OQDA 4BZZA 4E11A 2WV7A 5CM8B 3ROMA 5KHLB 2AVNA 2VJBA 1W52X 1REQA 2AR9A 4OQNA 2LCFA 1R6DA 3FFBA 421PA 4BFWA 1P9NA 1HQYE 3JQQA 2BBWA 3QUBA 3CLVA 1TEZA 3HVJA 2PL1A 3T15A 3GNTA 3IP8A 4L8GA 4DCJA 4G8BA 2QLTA 4GPTA 5IJ0B 4ZJZA 4DNOA 2PU5A 2Z58A 2VDOB 1KDPA 1MJNA 1T5OA 1DXHA 3B82A 3EGCA 3M4NA 3VU9A 1U2GA 2K2WA 3E05A 4NH4A 3W7VA 4AG5A 3U3DA 2F1HA 3SJ7A 1NSFA 4J0DA 2H9AA 1M83A 1XLTA 3D6HA 1ZN9A 3FYDA 5IM4A 3IXQA 3BIJA 3BZWA 3RSCA 1BN7A 4EJSB 2Q6TA 2VYNA 1KAGA 1NI3A 1ZA2A 4REMA 1G8KA 1CHNA 3MFQA 2KQUA 3O2NA 2DTEA 1VHJA 3L8GA 3NWPA 1E4OA 3JYOA 3OZEA 4KBFA 2RIRA 2YHAA 5CLQA 2JASA 5AKGA 4HX2A 4TZ6A 4YJ2A 3DVQX 1H3NA 3ON5A 5DT9A 4BPBA 2PWAA 2H06A 2P2GA 4NMLA 3NKVA 2DEUA 1RCTE 2QQEA 3MWYW 4G0YA 4JH0A 1VHLA 3T95A 3ESYA 1T9HA 2JFVA 1I7PA 1NW8A 3AF2A 1RYHA 4MKZA 4U9IS 4YRFA 3T5TA 4R1LA 2LXNA 3LCUA 2XJ9A 3HGQA 1BDJA 3NANA 4HFRA 4UTOA 4ZT7A 3QPCA 1L7QA 1I9GA 3UFBA 5IM4F 5G0TA 3VC2A 1MA0A 2ZU0C 4JVNA 2VDNB 1GVHA 1V25A 1P9OA 2ZJ8A 3LM8A 2OCKA 1U0FA 3L6CA 3QXHA 5KNLA 1ADJA 1W0KA 3I23A 3EXEB 3LY9A 3DPSA 1ZICA 4JVSB 2A9OA 3DCIA 1XGKA 2XHEA 4TM7A 3WDSA 2A2ZA 2FRDA 4F11A 1B6GA 2P8SA 2Y0EA 3NATA 4HDAA 4A0QA 4AJIA 5EAIA 4FQ7A 5LP6A 2DERA 2AI2A 2C78A 1Q1QA 4HFNA 1VIAA 1II8B 3IBCA 2GN4A 5ADUS 1P9WA 4H4DA 4YPOA 3LFHA 4AJ2A 1RE1A 1AGYA 1AO0A 1HZZC 3MCZA 4NBUA 4Q6BA 1S9HA 3WX0A 2JA1A 4JLDA 1EX9A 1G5IA 3V80A 3X0DA 4KJXA 4MHSA 1PWYE 2PZGA 4IZIA 3AEUB 2C9ZA 3RS2A 2XTJA 4WXYB 3TPCA 3ZC3A 4HB3A 5H81A 2X40A 4DJAA 3OZXA 2P9TA 1I2DA 1KKMA 4CRWB 5IG2A 4XDGA 3PFHA 4F0JA 5ANRB 3AWDA 2CVQA 4LRUA 1JJFA 4FYYA 4GG1A 4P7BA 5FD8A 3PQ8A 4PLVA 3GY0A 3QNMA 1MT0A 2VOEA 4MYHA 2X8WA 3K9NA 1EJ2A 1G55A 3OTGA 1ECBA 2G88A 4LYJA 4ARCA 4MS1A 3R8XA 5LVAA 1NYLA 2QZ9A 5GADl 1H2WA 5KOIA 5AK5A 3D02A 4ANFA 4HLNA 4HHEA 4FGZA 1UIRA 3ZDAA 1L5VA 1G3RA 4AYWA 4S1OA 4EKEA 1RM0A 1C14A 4KQFA 3MJDA 4X5OA 2NOGA 5C8ZA 2GTPA 4XLTA 1AJEA 1A1SA 2XB9A 4KXUA 4G2NA 1AS2A 5BQPA 1F6DA 2J33A 1Q11A 4OY3A 2C5GA 2ZRCA 2OZKA 1JEOA 1U3CA 4PYLA 4B3IA 5DW0A 3T5DA 3SBXA 1M2OB 3VHXB 1GGKA 4K87A 5GJWC 4ZRDA 3VO9A 1E1MA 1K8QA 1DEOA 1NWCA 1W9HA 2BAGA 2NW6A 3NIBA 3VI4B 2BTEA 4GWLA 4QQ8A 1BU5A 2YWBA 5THKA 4EG6A 1IY0A 1FSFA 2GVNA 2W00A 3LS2A 4KWEA 4XB1A 5DX8A 5KOHB 5LZ2A 2JATA 6REQB 2VAMA 1X38A 1NW9B 5BPHA 3AVWA 1W44A 1PQYA 1QIMA 2CLKB 3AQ4A 5D01A 4F85A 5LQDA 2F4VB 5CR9A 4E21A 2V5VA 4BKMA 1ZD9A 2CVPA 4RHXA 4CIDA 5BNWA 2XXAB 2JCVA 3VC3A 1QQ7A 4NBSA 3FA2A 5IT5A 2YMMA 3ITDA 3ER8A 4L51A 3F3YA 4JAVC 1U98A 1O8BA 3G2KA 1Z75A 2A86A 2B8EA 1NF2A 2FMIA 2N75A 3BXOA 4WCFB 1PW7A 4D6YA 1RI5A 4G5XA 3LE8A 3KQMA 4B4VA 5LP1A 5FUBA 1UJCA 2ZAMA 3GFGA 5BSRA 5HZKA 1PZMA 1XCPA 1X1DA 4HAVA 2BFBA 1DWQA 6YASA 4PO3X 3SQMA 3K7EA 1BDHA 3HZRA 3OM9A 4L7VA 4F3NA 4K5QA 4Z6KA 3HJAA 3DHWC 4M98A 4Y6OA 4Y9RA 2EZ4A 2WUEA 1VPEA 4FJ2A 1KYIA 2NZYA 4B7UA 1L7XA 4KVZA 4IDDA 2OHJA 3O4GA 2DFNA 1TU0A 2H1WA 2G9UA 4CW7A 4YRAA 1H2ZA 3TVTA 4N76A 3ZU3A 1DLIA 2P77A 2ZB2A 3KQVA 4WXRA 5CAEA 5MN4A 3CRRA 3VKFA 2JJ1A 2ZU6A 1D8TA 1Q5PA 3TG2A 4Q1DA 4RTPA 2LKDA 3I32A 2O7RA 2OMKA 2OZVA 3GUUA 1VCOA 4RS4A 2JFBA 4RY0A 1Q91A 2XE6A 1KL7A 2HI0A 5B6PA 1G16A 3ZNNA 5DLPA 1TI7A 5D1NA 4OGLA 5FI5A 5ESWA 2J5KA 5IXSA 2I4MA 1NBAA 1FUKA 4JSRA 1DMRA 1I1NA 2XPCA 3BKXA 4QLBA 1TZCA 4FSXA 3X1YA 3TRIA 1FXWA 1NVBA 2WWYA 4MGYR 3KHUA 3T4XA 5JXHA 1XOIA 5CT8A 3G3EA 3RSFA 4C89A 4ABYA 3Q9LA 5CXUA 4WEQA 1E7SA 5FTMA 4BCDA 2CV1A 5I4KA 2W2LA 2XGOA 3C6QA 2WSMA 3OZSA 2OK8A 4HPXB 4Y1RB 5F51A 5FA8A 2JIZD 1C0KA 4X41A 4KLAA 4BQFA 4F97A 1QONA 1Q44A 1C4OA 4Q39A 1VYVA 1FC0A 3OT1A 1QORA 3CB4A 4V0NA 1NI4B 5KOJB 5DP1A 1JMVA 1XEWX 2GR9A 3F71A 4B3GA 1TT5B 3L7IA 3SR4A 2J5XA 4U5QA 5FUXA 1YVRA 1G9SA 2A9PA 5AJZA 2X0KA 4CIBA 3UHPA 2WV9A 1NTOA 2HCBA 3DXYA 3LLMA 3VAZA 1V8BA 1XMVA 5L6MB 1Z4OA 4JWKA 1NG9A 2PANA 1JALA 4NHEA 5EXEA 4CI0B 1Z0DA 2J4DA 3KYCA 2LD4A 3I83A 1JI3A 4NOLA 4DLWA 2JHGA 5D7BA 2PUTA 1C4XA 2R65A 2BGGA 2YJ5A 3OSZA 4OGWA 2OC4A 3WIVA 5K8IA 1X19A 3H5IA 1WUJS 2IPLA 2OBLA 2QD1A 5T8KC 5SZHB 3V4LA 2PUDA 4QDJA 3G2JA 1VFNA 2IDZA 3TZQA 2VK1A 4BC0A 1NE7A 4EATA 4BNMA 1EH5A 2QVXX 2NTNA 4Q4CA 4ZYXA 1UADA 3AEXA 4JI5B 4ACBA 1E94E 1GDDA 1CVRA 2HGZA 4FYJA 2J7KA 3L4KA 4X1KA 3Q88A 3RSOA 4X1KB 1DEKA 4GWKA 1FJHA 2NO1A 1EJ6A 3E8SA 5KNCD 2ZUEA 2A14A 4ZVNA 1ITZA 1N9KA 4Z8YA 4IIDA 4OG2A 2C9YA 1U2SA 4ZRMA 4KPEC 1EXMA 3V1YA 5KSWB 2R5FA 1JR3A 1WNFA 2PBFA 2H2FA 2I99A 3F6EX 3O4IA 5EMLA 3QLUA 2QZ4A 3ADBA 1T0HB 4HBZA 1I94B 1GZ7A 1G0OA 3NHSA 5DBFA 3N05A 1ABFA 1F2DA 1MC5A 2Y1LA 4KW7A 5CLGA 1HDCA 3BE6A 2RDMA 1E2JA 4ND4A 3IEMA 3D31A 2PVPA 1PR1A 1W48A 3PDJA 3PITA 2YV2A 4OQ4A 1QBKC 5BYBA 3TLJA 1N3YA 4PHTA 3FJYA 4X93A 4ZAWA 3VSDA 4L4YA 1VSBA 3FMPB 3LX5A 2QPOA 1XCLA 5JR3A 3MPOA 2FPWA 5CG2A 4WN9A 1Y48E 4W8HA 2C2OA 4NG4A 4MR8A 4P3PA 1FA9A 5CVUA 3F5MA 4DCPA 3WRVA 1JU3A 2W2QA 5JD5A 3HJFA 2PX6A 1OLSB 4MUNA 1HRKA 4ASUD 1N6NA 2IS2A 5C2JB 4RS3A 2Z1MA 3R77A 1AHIA 3O03A 2ZUCA 3IUQA 4NH0A 3LPAA 3I58A 4HAWA 4CG1A 2OV3A 3EA0A 4DLBA 3THYA 3CUKA 4PFSA 2C9BA 3AUXA 4MX8A 1Z8NA 3GLRA 4WUTA 1L0BA 2Q7XA 2Q3CA 3AYXB 4U4AA 5CJJA 4LECA 4RVFA 2WM9B 4UHBA 2QTLA 2ADOA 3P96A 3L06A 4IGKA 1ZHFA 3F8WA 3E7DA 3C4VA 5KC9A 3ZE1B 4M1QA 3RYFA 1R66A 5FIUA 5KOYA 1AV7A 3KWFA 5DWDA 1K7SN 2QT9A 4BVBA 3ZE2B 9LDBA 2CL0X 3D7RA 4Q9IA 2WWIA 4MR7B 3Q72A 4PHGA 3BK7A 1F2UA 4WVFA 5KYWA 5CT5A 1WZNA 4EX7A 1KY5A 5GAJA 4HNQA 2IF0A 5JMWA 1YKFA 2X9QA 3N8KA 2UUCB 4GSLA 4MUAA 2WFAA 3FFWA 3A1NA 3FMOB 1ZXXA 1IN7A 1ZRSA 5AK0A 4D3ZA 3C3WA 4NULA 3DCYA 1YGPA 3LX4A 3RBXA 1GUBA 1TCBA 1IJEA 1RYBA 1W5AA 1DOHA 2QUKA 2VAXA 3NDRA 3AINA 1V7CA 2X5NA 1C9DB 3I2GA 3IHWA 5E9QA 2EZ9A 4B8WA 1U2EA 3IXMA 3N0WA 1UF9A 2HPHA 5HBGA 2DZDA 3W2FA 3VA7A 4IOJA 4GYJA 3AM5A 5FOQA 1SUFA 1EXDA 4B3MB 1VHTA 4KLRA 1YRQA 1PHPA 4KR0A 4Q9AA 1GPYA 2PR7A 5LIPA 4QLOA 5HUQA 2XDYA 4UAJA 3CUSA 2JBHA 3SX2A 1RT9A 5T4HA 1U2GC 1A88A 5I45A 2VYVA 2JKYA 1O87A 4KRFA 1E2KA 3FGOA 2HMSA 4M89A 3RGGA 3SBEA 4NE2A 3VTAA 1TAUA 3DMHA 2BKLA 1QFXA 4YQYA 2YIMA 1HUQA 3UXYA 4FLFA 5LNK1 3F7NA 1NU6A 2IIVA 1VI6A 1NF3A 1YS7A 3THSA 1MLDA 2CKMA 1DGQA 1DKOA 5IUKC 1EFCA 1T2AA 4FFBB 1BXGB 1VSVA 4S0ZA 3RO7A 3ZY4A 1CRLA 4IS3A 5ICMA 3TEFA 2QRUA 1GSIA 4RDXA 1AKWA 1FY2A 4R05A 5DB4A 4EWLA 3DLTA 4MIKA 3BMOB 2Z09A 1DARA 5IH7A 4F91B 1P75A 4Y2UA 5ECDA 2GVZC 2G7ZA 3UMMA 1WA5A 1TPYA 2E49A 1P1JA 4CEHA 2IHYA 4R4JA 3RS0A 3ZWPA 5DM1A 2W0SA 5HKLA 1NYQA 1UPBA 4QJBA 4P7FA 1V4BA 4BHTA 3R8CA 5LXTA 1EUCB 2POQX 4G1MB 4GRDA 5ELXA 4BUJA 5BT9A 3PTLA 3LHKA 1QVWA 1PFVA 4BNDA 2VHYA 1PF7E 1VE1A 2WJPA 3U3ZA 2IKQA 2OXTA 5A2QA 4H0NA 2Q1TA 2OVFA 1LTQA 2XSZD 1EDOA 1WIWA 3A3KA 2LIPA 2O4CA 3ANLA 2HK7A 3MWGA 3BG5A 3OJOA 3ROKA 1ZRMA 3FNIA 3K53A 4R1TA 2ZKIA 3V4ZA 4C4OA 2QZPA 4JI4B 3A6FA 2EGUA 1CY7A 2UUAB 1C1XA 4IQ8A 2E6KA 3SFVA 1DHRA 2JZNA 2GRAA 2EG5A 1ZH6A 4WJKB 1Y1RA 5F76A 1XDWA 3R5SA 3OAAA 1NVXQ 2DWOA 1OWLA 2B34A 2B4YA 4F4CA 3LQQA 2BHTA 2OPHA 2VDVE 1Q77A 1OZ0A 2DBYA 2VJMA 4TXLA 1QIGA 4MJLA 2PQMA 4RKYA 3R8FA 2HYIC 5KQGA 2C7GA 1CR0A 3DZBA 2CDCA 2HMVA 2I8CA 1PGJA 2ISSD 3EUEA 2ZSIA 3ZBQA 1NV8A 5ESRA 2R85A 4QOSA 2K7ZA 3VOTA 3AJEA 4GVLA 3W9BA 5D6NA 1ZSVA 3GDOA 1L1QA 3GEHA 3GT4A 2Z4RA 2GAAA 3LYAA 4KQMA 4MHOA 4PIMA 2VBIA 1L5MA 1MA3A 2Y71A 4D82A 3T52A 2W6IA 3DB2A 4E51A 2V4UA 4F4FA 3A3YA 3WYFA 2OD7A 1KMIY 2DJ5A 5FLYA 1W8DA 5EOVA 3GAAA 1BC5A 1AF7A 4OQPA 4I4TA 1DIHA 2FF7A 4LGCA 1XIVA 1GLVA 1TMKA 2W6JD 1GTRA 3OLVA 5EIEA 2JJ1D 3RLIA 2BDTA 5EJ9A 2FWPA 1AVTA 1UXGA 3TVDA 5CM2Z 4LWZA 4XARA 4XASA 1RE0A 3K0BA 4R1QA 3T94A 5LMZA 2HWKA 1VGVA 3NONA 3H1TA 3AJRA 5GPBA 1TYAE 3KV1A 4JYBA 2QTAA 3V7YA 2CXTA 4A1OA 4F4DA 4P4SA 1JRLA 4G0WA 3F97A 1GPMA 4M1TA 5SY9A 1TJ4A 5IJZA 2MSDB 1T3ZA 2BZ0A 3K05A 1N78A 2QTGA 1RXYA 2DR3A 4DIMA 2FSSA 2CVZA 1X1BA 4MVJD 4UM7A 2IEBA 3ZCTA 2FP4B 1PJRA 1H94A 1T4DA 2Q4DA 4OJYA 4JIGA 5DWQA 5F2OA 2AQKA 3EQ6A 3BWMA 1OXMA 2BEWB 3DOEA 4IV0A 1S3FA 4HV4A 5HFNA 4L4SA 3WHIA 2HK9A 4FR2A 5KVVA 3PQEA 3MINB 3T0FA 1LTHR 2RJ3A 1YRLA 2JFYA 3O91A 1Z2AA 1FP4B 2ZRGA 3FYUC 4GL4A 4DQ0A 2O5EA 4M22A 3RBZA 1SXJE 2O06A 5ALTA 4QTTB 1R0YA 2QN6A 1ONPA 2NT4A 3BIFA 3L6DA 1H8HA 1HLGA 3CZCA 3IQGX 4RULA 1LTKA 4MQEB 5H16A 3AG5A 3NRCA 3HKBB 3IPAA 3O8QB 4KBGA 3USCS 3KKMA 4ZOBA 2PSSA 1G8MA 1ZBQA 1SHZA 2DLNA 2HEIA 4R1PA 4L0QA 4U63A 3T9EA 4EB0A 4M9CA 3AJ9A 1P1RA 2NT3A 2E55A 4B3XA 1XQYA 1T91A 4XIFA 5E7MA 2K4MA 3O84A 2FY8A 4HMOA 5CK5A 3TTVA 4C6TA 4KHPB 1CUFA 4DCSA 1PNVA 3MJHA 2HWYA 1B76A 1RPJA 3ZE8A 2OV4A 4XYGA 2A9FA 1KEEB 1VL5A 4JI0B 3GH3A 3HCDA 3QLEA 2I5PO 4IIVA 4UMEA 4D4JA 3NUZA 4LYDA 5AW2A 4FNGA 1O4WA 5HSGA 2AUMA 5KMGB 3PUKA 2XB2A 4NEHB 1N36B 3WSVA 5AVZA 5KNBD 1T8WA 2YH2A 1N0IA 4N9QA 1CRWG 2IH2A 3ZHBA 1M1XB 1RU3A 1QHFA 5AYVA 1XRJA 2WB4A 1SZCA 3U7EB 2W2PA 5L3QB 3A58B 5CEJA 4BATA 1IWPB 2OG1A 4IKEA 2H1RA 2F1OA 5SZKB 2ZJZA 1N5JA 1MEJA 2RGRA 2JF0A 3OFSA 1HTBA 4AWAA 5KWSA 5B1IA 3ZXIA 1KZGB 1XJ5A 2Z1DA 1HE1C 3P27A 5FNVF 3T5CA 3PHCA 5B2FA 3WGNA 5J2TB 1EUDA 4WN3A 4TLEA 3O9MA 3RARA 4AJ4A 4S04A 3OBIA 4GRIA 4ZXPA 3TW8A 1GTJ1 1PEKE 2BEKA 3CSDA 1F8XA 1RFGE 1BH2A 3MSCA 1ZSNA 1JLMA 4RVUA 4YCMA 2GRUA 3RJMA 1ZU5A 1GKIA 4DCMA 5BWOA 2QVBA 4EMBA 1Q95A 5JE8A 2K2QB 2OGZA 3ZYCA 4FFRA 3SBDA 1RJWA 5EY5B 1QV6A 1E1RA 2G9RA 1YUMA 2QLFA 1ZM7A 4QTZA 4HN2A 4JQOA 4EFLA 4JI7B 2DSTA 2EBFX 2P3LA 2PX0A 3BGWA 3EPPA 4JX8A 3K5WA 4A2WA 4F72A 1JLRA 4K40A 2B61A 2A9JA 3TW0A 1CRPA 2VDRB 4MVJA 2AF3C 4RY8A 3GZJA 4DC1A 4GE3A 4CQMB 3FCXA 4QGHA 3SXUA 3VR6D 3IUYA 4RKWA 4CF6A 3JQGA 1U3GA 2BJVA 2GASA 1NBOA 1WD5A 4TWZA 3X43A 4BLQA 4C7JA 3Q9UA 4EAAA 4KNWA 2REXB 5BNIA 3BSFA 4RV4A 1ZUD1 1U1DA 4KAXA 2CDBA 4NCJA 3H1FA 4B3BA 1NXSA 4LXUA 3ABSB 3ED5A 2PGLA 4ESVA 1SZDA 1E5QA 5KYKA 2QLLA 5H9VA 2LWIA 2O2IA 3AY0A 3IV6A 4EY4A 3KYDA 3HBFA 2V54A 4CN9A 3X1WA 3SR0A 5JANA 4GH5A 2YV4A 3AZQA 1RKUA 4C01A 2PUWA 2PX2A 1Y5IA 5H3HA 5AVSA 3BL5A 4H17A 2VT3A 2AS0A 3DBHB 1QAOA 3GGJA 4OFZA 4W5WA 4QYTA 2AN5A 5IVIA 3U9SA 3QXSA 1MO5A 4M1SA 4EG7A 4KREA 3HPQA 1BA2A 1JQDA 4L5CA 4BVLA 2UYHA 3MD0A 1DIAA 1EVZA 4QOGA 3TQQA 1DCFA 3MAGA 4E2WA 4OH7A 3V7WA 4ZZ3A 4GU5A 1WHSA 4BTVA 1W2HA 7GPBA 1YBHA 2P9EA 3AVUA 1P6XA 4MQ6A 4ESEA 5TSDA 1ZIOA 4H1VA 4Y6SA 3EIOA 3GUHA 3O2QB 1PJZA 4YUZA 1AGXA 1XZDA 3G2MA 1O95C 3QVXA 5NULA 3TSZA 4E2FA 3KSUA 2QL5A 3SN6A 4HS9A 1T4MA 2OCPA 2H5EA 3GJXC 2QW1A 4P34A 1BCRB 3RPEA 4D6PA 3ZHOA 2GDJA 2PAAA 3A2LA 3N53A 4IMIB 5ED4A 1A5ZA 2WSBA 2E6UX 2ZPAA 1K68A 5CGZA 1K0UA 5KREA 4WGGA 2UXCB 3EHEA 2J3IA 3FPKA 3K0EA 5FQOA 3ZXUB 2X23A 5EP1A 5HVNA 5BT8A 1BWPA 4IGIA 3D6VA 4GEKA 5DH9A 4OLJA 3DS8A 1YQUA 1U11A 1VSTA 1L5OA 1H9CA 4MJXA 2MSNA 5FHRA 2CYCA 1U5AA 1C4WA 1OI7A 1ONOA 2OHOA 2DQZA 2WFZA 4GMXA 4P3OA 1LPMA 4Y2PA 1L1EA 3AB3A 2QENA 3LUCA 3I2HA 3WZ2A 2QPLA 4LJRA 1F0YA 3KD3A 1J2UA 2VDWA 1U80A 3QF4A 3EVNA 2I34A 3JVDA 4YMUA 3VNVA 1RYDA 3VX4A 4ZCMA 3EVTA 1T2FA 3AOEA 3DE7X 3DL2A 2EKPA 2FW8A 4V03A 4YT5A 4I99A 4IAOA 3R40A 5IBRA 4A8JA 3C4QA 3R5FA 4YT2A 1VPLA 4RTJA 4YHHB 2IX3A 4RVSA 1Q0ZA 2H0RA 2YX1A 2WF9A 3MWEB 2X0EA 4DM7A 3DNFA 5AW0A 1WPQA 1N2OA 3GUVA 3MGBA 3EF0A 3NNNA 1ESNA 3LUPA 2KYRA 1EWTA 2Q6OA 4JQZA 1I4EB 3NHZA 5CPFA 4HXFB 3QVVA 2IGBA 4ER7A 2RE8A 2GBLC 3EEYA 1C80A 1FPQA 1I30A 1Y5NA 2FPPA 1QIIA 4YJDA 1N9ZA 3IJ5A 3A04A 3WLOA 1KVQA 1ZMRA 5FWAA 4BB0A 4DLXA 1N34B 5F64A 1A8QA 4QPNA 1Y1SA 1QHHA 4UHFA 4ARBA 5AJWA 1G4UR 1FS6A 5ER9A 5J3JA 4OJMX 2XUZA 3G9QA 1GN8A 4XDHA 3VR0A 4BWVA 4F93B 1WXFA 3DM9B 1BFUA 4KSYA 2VPZA 5AW3A 4JJIA 4NHOA 1X7GA 2JGRA 2YXEA 2FZGA 2ZVDA 3NHUA 3PSAA 3A7DA 4YMIA 1KDVA 3ETGA 1ESMA 5SYNA 1T9DA 1NVVR 1QQTA 3A6EA 1B8PA 3ZLVA 1SKAA 5KI6A 4FU0A 4NXMB 4AQ7A 3GCDA 4WK4B 4D4HA 5E2AA 4DJTA 1IOLA 2WJ6A 3GNSA 1HT1E 4MS4B 4W5RA 5FWNA 1PKXA 3CX4A 1JFFA 3NHKA 4MICA 4CQMD 2CNBA 3A6DA 3JD1A 1XJ0A 1SCUB 3RRBA 3U80A 2F64A 2X0IA 3B7PA 3OTWA 3ENWA 3DKPA 4PLHA 4G81A 2YWHA 1CUJA 1GITA 3L8CA 1KEPA 4TQGA 2HLPA 1K8YB 4X1YB 3ZD9A 4R2MA 4B6GA 1R4NB 2I3BA 1ZN7A 2CUTA 3L0SA 4BPRA 4ZI3A 1TF5A 1WMAA 1G8FA 1W5FA 4EG8A 2I2WA 4MPJA 4MV0A 2Y3IA 1FTGA 1ID1A 1RAHA 4A6XA 4BX9A 4YIHA 1JB1A 4URFA 1W581 4V0ME 4MW2A 2ST1A 3WHKA 1VIDA 4N49A 4EG1A 4DKJA 4ZICA 2EEPA 3CA8A 1Z7WA 5A03A 1PSWA 1JVBA 4U7FA 4BP8A 1WY5A 4WTOA 3BH6A 4ZZ2A 3PEWA 3BT7A 2IU3A 2GHQA 4KPFC 1H69A 2I2DA 2QYSA 2WJYA 3E2MA 3ETCA 4IFBA 4KXWA 4YAIA 1LX6A 5JU6A 4FYXA 2W7TA 3Q5EA 4QG3A 4NXNB 4RSGA 7REQB 2HQRA 3QOXA 1Z26A 4EB6A 2YYAA 4JROA 1N6PA 4ZYTA 1UMCB 2AC7A 3GIWA 4NYMR 1Z39A 1NN1A 1W75A 2F59A 2OXEA 3G49A 2Q4RA 5EXXA 5DYGA 4O2AB 4ENUA 1W34A 3W9UA