4D3FA

Bcsired from bacillus cereus in complex with nadph
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
284
Chain Sequence
b'KSVTVIGLGPMGQAMADVFLEYGYSVTVWNRTSSKADQLVAKGAIRVSTVNEALAANELVILSLTDYNVMYSILEPVSENLFGKVLVNLSSDTPEKARKAAKWLEDRGARHITGGVQVPPSGIGKSESYTYYSGDRVVFEAHRETLEVLTSSDYRGEDPGLAMLYYQIQMDIFWTAMLSYLHALAIANANGITAEQFLPYASAMMSSLPKFVEFYTPRLDEGEHPGDVDRLAMGLASVEHVVHTTQEAGIDIALPATVLEVFRRGMKTGHASDSFTSLIEIFKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMINE REDUCTASE
publication title Structure, Activity and Stereoselectivity of Nadph-Dependent Oxidoreductases Catalysing the S-Selective Reduction of the Imine Substrate 2-Methylpyrroline.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
total genus 114
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2014-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4d3fA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d3fA01
4N5NA 4FC6A 5G4KA 3ORFA 1CF2O 2IYOA 4MVJA 1B14A 1YB1A 3HDQA 1PL8A 4KTTE 5B4UA 1MB4A 1DDOA 3RKRA 4UVHA 5AXBA 2V6MA 1WMAA 1LUAA 1XA0A 2CY0A 5L95A 4UUNA 1MGOA 4UUMA 5ES3A 3RUDA 4QTZA 4R1NA 1P1IA 4GLLA 3WICA 2ZTUA 3F5QA 2HAEA 4F46A 4OSPA 1U7HA 1U3WA 4WJZA 5AOVA 2GR9A 1R12A 1LC3A 1FJHA 1ORRA 4B7CA 1ISMA 2CF6A 2VYVD 1R66A 4BNWA 5TIIA 1MG5A 2Q4EA 3ZU3A 1E7QA 1LSJA 3JYOA 1Z45A 4NK4A 3WBBA 3B6ZA 2VN8A 4O63O 4TMFA 3BMNA 4BQPA 2Y1GA 2ZATA 5DBFA 4A73A 5TSDA 2UDPA 3IDSA 1PSDA 2X86A 2C82A 3NKLA 3OM9A 3OJOA 4YT5A 3RWBA 3QIVA 2PKQO 3KYDB 1JN0A 3SLKA 1XR3A 4EZBA 4PZEA 2WTBA 3D5TA 4QQRA 4ALJA 1RWBA 1ZFNA 3K2EA 1DIHA 3P5SA 5F21A 3UOGA 1W73A 3HG7A 3RBXA 3D3WB 1SBYA 2VWGA 3LT1A 4GAEA 2B83A 3BHJA 1I24A 2EKPA 3BMOB 3F6YA 1UP6A 3FRJA 1T24A 3ZWXA 4LK3A 3EDMA 3A28A 4DVJA 2IEDA 1BXKA 1GV1A 3P7MA 1ZSNA 3DOCA 4J1QA 1YBAA 4XJTA 1OAAA 4ITUA 4YTEA 4Z0TA 4RDHA 3L4BA 1Y5RA 1DIRA 2PD6A 3PJDA 3R6DA 2VWQA 2VOJA 4MINA 3T7CA 3W1VA 4RJTA 3M1LA 4B8WA 3U62A 4BB6A 2J5RA 3TZHA 3E9QA 4IINA 2WD8A 3WGOA 3K2BA 1IZ0A 4WEOA 2VNSA 3RBZA 1D4FA 1JKIA 4XIYA 3WJAA 1JU9A 4BS9A 3WJ7A 3FBGA 1RM5A 3C7CB 5I8ZA 2IXBA 1GZ4A 3EVTA 2PH5A 3NGXA 4ND1A 4RCVA 3RUFA 4A27A 2VRBA 3VVCA 3DZFA 4J1TA 1E3EA 9LDBA 2P9GA 2IXAA 3K6JA 3ONEA 1C14A 3IMFA 3RUAA 3I9MA 3ZNNA 5LDHA 4WUVA 4BVAA 3GC6A 2YZ7A 2Z1NA 5JAQA 3SXPA 2I65A 3BMQA 3WYCA 2C20A 1E7WA 4WLFA 3AOEC 1IZ9A 3WB9A 4NIMA 1JQBA 2DVMA 3QVWA 3CTVA 4RQUA 3U3XA 3FR7A 1YVEI 2ZYDA 1U7TA 4YAEA 5L4NA 1FDUA 4GH5A 1LDEA 1ZK2A 3D64A 3K8ZA 1ADGA 4JP3A 3UAGA 4PLGA 3JQCA 4JK3A 3QWIA 1OC4A 4DLLA 1WLYA 3GA0A 3VPHA 4NU5A 5I7EA 1DJNA 2PR2A 2W2KA 2NACA 5BT9A 4BNKA 1ISHA 1PQWA 1EEHA 2YFQA 4N7RA 4OIMA 4TSKA 3UVEA 2CF5A 1UXHA 1WNTA 2BFMA 5KVSA 1Y7TA 4IJVA 2Y1FA 2DBQA 3H65A 1T2CA 5FI5A 4CQMD 5IFLA 1PR9A 1N8KA 2Y0EA 4OQYA 4ID9A 1PWZA 1R6DA 3RD5A 3OIGA 4HXYA 1HWYA 5TJ9A 3JQFC 2GSDA 3FPLA 3FNEA 2Y0CA 2VZ8A 2Y67A 4JX8A 2R2GA 5I7SA 3AU8A 4RVFA 2CMDA 2WYVA 4JN6B 1R4NA 4CMIB 4J7CA 5L9AA 4J7UA 4CMJA 4R69A 3W4JA 1J5PA 2O3TA 1ULUA 2YQ5A 4TRJA 4W7HA 5BNFA 1NAHA 2B0JA 3H9JA 4E6PA 3IAHA 4ZQGA 2YUTA 2WSBA 1F14A 1TT5A 3OA0A 2P5UA 5B37A 1EQUA 5A04A 1GPJA 1JDJA 1QKIA 4Y98A 3Q2IA 4FB5A 1ISJA 1N9GB 4IY1A 4EYEA 5H81A 1BVUA 1PQPA 1AXEA 3S55A 5L40A 4BNGA 1I3NA 3VH1A 3VTFA 4ZN6A 3FNFA 5EINA 4LRTB 4OXKA 4IJKA 5KJ1A 2Q1SA 1UDBA 4S3MA 3GF4A 4J6FA 4CM8A 1FDVA 4MVJF 4XCVA 2HMTA 2Y1DA 5JSFA 2IEBA 5A9RA 1WDLA 4CQLB 4IGFA 2PZMA 1KEVA 1VL6A 4Y9DA 1XGKA 3INRA 3WGIA 4DIOA 3NX4A 4PLZA 1EDZA 2ZB8A 2VUSA 4BL5A 1PJSA 3H9QA 4EJMA 4MVJD 4F3YA 1X7GA 3TN7A 3KEOA 4NMHA 3JQAD 4TRRA 1BXZA 2TMGA 2FZEA 2DKNA 3QWHA 5G2OA 1B8UA 1XEAA 4ZRMA 2BH9A 3CXRA 3GDFA 1LQTA 2ZB3A 4XGKA 2AQHA 5T64A 4AJLA 5KNLA 4ZHSA 3U49A 2JFHA 5U9CA 2A9FA 3VKVA 3R3SA 5EN4A 3VPSA 1V9LA 4N5MA 5C37A 3CMMA 1LNQA 4L75A 1IPEA 1ZH8A 3X2FA 3MWDB 1G0OA 4P38A 3VH3A 1T4DA 1E1LA 2DTDA 3WWZA 4PG8A 4J90A 5LDGA 1E3WA 4MP8A 3LVFO 4JNKA 5B1YA 4HFNA 1T2DA 4QECA 5U1PA 4CLHA 3BXXA 5C7LO 5A5EA 1LI4A 1HZJA 1Q0QA 2VT2A 2WWRA 1R16A 3CINA 3PIIA 3BZUA 1NVGA 3T7EA 3MEQA 4KOAA 4NJMA 3VKUA 1PIWA 1SCUA 3ETEA 3GEMA 3GGGA 2Z1MA 3IJPA 4ZU3A 5JO9A 4RPLA 3LT4A 3MJVA 3TSCA 1V6AA 2P9CA 3M2TA 2B4QA 2OBNA 1DC5A 1H9AA 3MJ4A 3PLNA 2A35A 1PGQA 2VYNA 3UKOA 1LLUA 1GPDG 3UICA 2X23A 2BD0A 3KRTA 3OP4A 4ZQFA 3W6ZA 1PJLA 3RC7A 2AMFA 1U8FO 5JBIA 1E5LA 3TOZA 3I3OA 1TA4A 2X6TA 3VH2A 4OL9A 1QR6A 2RBEA 1VRWA 3DC2A 3V2UA 3H3JA 1HDRA 4E5MA 4YAKA 2A92A 4BKOA 1VSVA 4BGVA 4CLRA 1Y8QA 2GF2A 1QYCA 3KSZO 1FF9A 4XR9A 2YHIB 2PWZA 1NWCA 1E5QA 3HDJA 5IG2A 3GHHA 3EVNA 3R0IA 3OJFA 2C2YA 4RF4A 2VUTA 3QE3A 4MKRA 5G0UA 2Z5LA 2D2IA 4B8ZA 1QXSA 3CPSA 4UVGA 2B69A 1DFHA 4ALKA 4E4YA 2O3JA 2IDZA 5IF3A 3TL3A 1BW9A 3KXDA 4MKZA 1E7YA 4TKMA 1C1DB 3GOHA 4I5GA 2I76A 3BTOA 2FWMX 1DIBA 5CAEA 4L76A 1X15A 3KZVA 1E7RA 1B15A 1P0FA 2DC1A 5FI3A 3H5AA 1UXIA 1Y81A 3PVZA 4IQ0A 1DLIA 2IYPA 4FCCA 2NV6A 1HLDA 4FR5A 1QSGA 1BVRA 4NFSA 1ZJYA 2D8AA 4R5MA 5G0VA 1ZK0A 2NVBA 1VL0A 3QW2A 3I1JA 3TZKA 2VRCA 4NZ9A 3FBTA 1T2AA 5ITWA 4XQEA 2DBZA 4RVSA 3KLMX 3DONA 2DBVO 3E9MA 3ZNQA 4IDBA 5CEFA 3PFFA 1BDBA 4EJ0A 2HLPA 2Q45A 4XDZA 3UN1A 3RROA 5U4QA 4WK6A 3D1LA 1A4UA 3O8QA 4WNIA 1PGJA 2FHSA 3NJ4A 2ZTLA 1I2CA 1RYDA 1YB4A 2PGLA 3BHIA 3CTMA 3FHLA 2CVQA 3RUHA 1T1RA 2WDZA 1MG0A 2Q46A 1BTOA 1ZKMA 8ADHA 3UCXA 2GZ1A 1NYTA 9LDTA 4YJDA 1NASA 3UGKA 1KY4A 1PTJA 3DL2A 4FFRA 2CNBA 4J49A 1KS9A 1Z7EA 4CM7A 4E5KA 1RYEA 4YACA 3L6EA 3PWSA 1A4IA 4XZ3A 3OQBA 4U6SA 2VUUA 3GMSA 1W8DA 1TT7A 3LT2A 1QV7A 3GAFA 4RLHA 3LF2A 1I01A 4XB1A 4YEDA 2PGDA 3NT2A 4FC7A 4FGSA 3GVCA 4Q3AA 1LRKA 4MO2A 4CMKA 4K28A 4TVOA 1QORA 3QRWA 5COQA 2XXBA 1I0ZA 1P1HA 2NU9A 1YB5A 2GN9A 2WYUA 3EAGA 4TRMA 2H6EA 4OGWA 3BYZA 4W7IA 4CLEA 4TRNA 4E12A 4J2HA 3A4VA 5JDIA 5CDTA 4LVUA 4KUGA 4P4GA 4FBGA 4GI2A 3ZWVA 4EUHA 1B8PA 3E18A 3WQQA 2A94A 2OUIA 5JY1A 3MOGA 5F1KA 4FJ1A 2C7GA 3UUWA 1Q1NA 4BO1A 4CM1A 1LA2A 4DUPA 3RSHA 2WJPA 1XG5A 3ULKA 3RVDA 1ZK3A 3Q0EA 3D4PA 7MDHA 1P9LA 5JYDA 1X0VA 3DTTA 3GH3A 4C4OA 1YOVB 4BNMA 5L4LA 2G0TA 2AQKA 3ANNA 1DAOA 4M54A 3MJCA 3QJ5A 2HQ1A 4QFCA 1E3LA 2Z95A 2JFGA 1N7GA 2JD1A 1EUCA 1ZSVA 2OGUA 2I66A 3DAFA 1YQGA 4QXMA 4UAGA 2JKVA 1I32A 3DOJA 1VI2A 3DQPA 1DO8A 1V0JA 1M76A 3KYDA 5A3VA 3E5MA 4NBVA 3QVXA 5I8WA 1EBUA 3IS3A 2BGLA 3U4CA 3GHYA 3AM5A 3ZU4A 3D3WA 4A7PA 4KP7A 1BHSA 4NBWA 5DNAA 4EW6A 1QMGA 1ONOA 2AQIA 3BMOA 1XWFA 4YA6A 4BNLA 3F3SA 4CM9A 4DMLA 1Q7CA 2DPGA 5H82A 2H63A 4A5OA 3WR5A 2DM6A 3OBBA 3WFJA 1R15A 2YW9A 2GDZA 4GQAA 3K30A 5LCXA 1GV0A 3E8XA 4WLUA 4M49A 1NFQA 4NBTA 3I83A 2YYYA 4K6CA 4BO7A 2WE8A 2X5JO 5DF1A 2XF8A 2EW8A 5L3ZA 4ALIA 1MLDA 3IOYA 4TWRA 5A5FA 1OBFO 2CVOA 3N74A 5EQDA 4I9UA 1DFGA 3DMYA 3K9QO 3ZWWA 4WPGA 4CLDA 1O9BA 1Z75A 3AI1A 1GCUA 2X9GA 4BNVA 3ZWCA 4IGEA 4WOKA 4R5HA 4R1UA 5AYVA 5I9LA 4J7XA 2CD9A 4QO8A 2VQ3A 5L51A 4LW8A 1O6ZA 5I7FA 5B4VA 1YRLA 3CSDA 4EUFA 1V3VA 3JQDA 2P2SA 4QFDA 3GDGA 2AW5A 1OFGA 2VHWA 2J5QA 1E3IA 3DZBA 1TEHA 1ENPA 3AY3A 4NNJA 2CFCA 4ZGWA 2VCYA 2X0JA 1TLTA 1M6HA 1A27A 4WLVA 3S2FA 4CMEA 3PDUA 4R54A 5DCWA 5K9ZA 1S6YA 2QHXA 2X0IA 4GPD1 3FTPA 3ZWMA 1YL5A 3MZ0A 4E31A 3SX2A 4MJLA 4L4SA 4BMNA 3WYBA 1YS4A 3TZCA 2YV1A 4OO3A 3L6OO 4O6VA 1JVBA 2QG4A 1GTMA 2NNLD 2H1SA 3PHIA 4I5EA 5BR7A 4FW8A 1EBFA 4Y67A 2BFAA 1SZJG 5HRUA 5T8KC 1ARZA 2GO1A 2GZ3A 1DXYA 4WCFC 2JCYA 1LTHR 1DHTA 1F8FA 3AM4A 4J4HA 1B8VA 1PZFA 2E6UX 4DBVO 3GFGA 3QVSA 3S2IA 4I5FA 4R51A 4MVJH 3OEYA 2PA3A 3O26A 1LBEA 1A7KA 4OKNA 3GEDA 1J49A 3AM3A 4X54A 2NLOA 2VRCD 5JAZA 4FOSA 1QYWA 2VOEA 1I5RA 2DLDA 4GX2A 2PH3A 3VZRA 5JC8A 1A9ZA 4MVJM 2E82A 4NI5A 3ZNOA 3AI3A 4CMIA 4PLCA 2C0CA 3LC1O 4OMUA 3ZU5A 2FSSA 1G6KA 1K0UA 5DBIA 1H6DA 2QYTA 2ZQZA 1AHIA 2QRKA 3Q9NA 3RUEA 3A14A 3Q2KA 1C0PA 2SCUA 3KM0A 3GPIA 1NQOA 4A0SA 4ONEA 4ZQBA 1H9BA 3KLPX 3PJFA 4A03A 5A3JA 1AUPA 1N9GA 1HDYA 3JYPA 4H15A 3ROPA 3FI9A 4CLXA 3TQHA 7ADHA 5KJFA 2PGJA 1EVIA 4NHEA 1C3VA 2VT3A 3WFIA 4AVYA 3U9LA 1G1AA 2FPGA 3WGHA 2NM0A 3PTZA 5DDIP 4E0BA 3DHYA 3HN7A 3O38A 3DZJA 1ZCJA 3V1UA 3RBVA 2VHYA 3C1TA 3OJLA 4RVGA 5JS6A 4CQLA 4B4UA 4CM5A 2I99A 5T5QA 1YONA 4C7JA 3QVOA 2CDCA 4OOEA 2Y93A 4G81A 2ZCVA 1HXHA 5F1PA 1LJ8A 4J16A 2X8LA 4OHUA 1GUFA 4MVJP 3UCFA 2X22A 4CV3A 2BRUA 4L74A 3KO8A 1Y6JA 4CLOB 4XRGA 4BKPA 4H16A 3WLFA 2W98A 4WLEA 1WDKA 4FJ0A 1ISIA 5JCJA 2WMDA 4GBJA 2EP5A 4M86A 1I10A 1X13A 5EIOA 2HSDA 4DL9A 1VJ1A 3T4EA 1H0KA 3WMXA 3RUIA 2EJWA 1U9JA 1IB6A 4KMSA 4BNUA 2HO5A 3I4CA 1EZ4A 1YQDA 3PYLA 2AG5A 2V6GA 5AVOA 1NHWA 4D3DA 5A9SB 2GD1O 1KVTA 1WWKA 4XYGA 5TNXA 1GEEA 1C0LA 4NU6A 2YY7A 5I7VA 1P44A 1YL6A 2ZIZA 3VOSA 4CMAA 3RC1A 4E5PA 2HDHA 3ZHZA 4NG5A 4NR0A 4DYDA 1ZK1A 4FN4A 1F8GA 3JQBA 3PWZA 1NM5A 4K6FA 1GQQA 1E6UA 3AY7A 1K6IA 1XU7A 2OL4A 1I3KA 5AQ1A 2D0IA 1DRUA 4FGWA 1E6EA 3S2GA 4YT8A 3QSGA 3ADOA 3ZWYA 3I4FA 1QYXA 1UR5A 2RHCA 3OFSA 1XDWA 1GQYA 3JQ7B 4LSWA 4BNYA 4AICA 2HUNA 3DO5A 3JD3A 4L9RA 2FP4A 3A9WA 4LSMA 4N5LA 6LDHA 1PS8A 3PZBA 4QT0A 5KVCA 4J4BA 3NGLA 3UW3A 4UUPA 4DLBA 3DAGA 4PLFA 3PYXA 2F00A 3PWKA 1NFRA 3GAZA 3HB5X 1HZZA 4KWIA 4YBZA 3VPXA 3ITKA 3HB4X 4AJHA 3PGJA 4NFHA 4PLPA 3WGZA 4R9SA 3QA9A 2RH8A 3PGXA 1JTVA 2GN4A 2EXXA 2YHIA 1HYEA 2J3KA 3H9UA 4IS2A 4AJ1A 1KIFA 4YT4A 3ANMA 2NU6A 4E5NA 5B12A 1K89A 4WOJA 3JYQA 4AJEA 3OA2A 3C1OA 3IKVA 4AJJA 5CDUA 3DB2A 1K6XA 3DAPA 4PRKA 2D3TA 4HY3A 1UXGA 3L0DA 2J8ZA 3I9JA 4KZPA 4MPDA 4D46A 2GGSA 2E48A 5A05A 4E2ZA 4IQ8A 1VE9A 2YDXA 5MDHA 2HK8A 4WLNA 5COBA 5L53A 3SVTA 1C1DA 3ZU2A 1HE2A 3QLJA 2EEZA 3BTVA 4RL6A 4E32A 1A7AA 2JHGA 3JQ9A 1X7HA 4GWGA 3I5MA 3UF0A 2OO5A 2W2LD 3AUTA 1BRMA 3ZWBA 3DBVO 1NTOA 3F1KA 4MIEA 4XKJA 4MIOA 3K31A 3HN2A 1UAGA 3GVXA 4FFPA 3CMCO 4I8XA 4AJOA 3LDHA 4FSHA 3K5PA 5CHEA 3AOGA 1LDYA 2VNAA 3OHSX 4J1NA 3QQPA 4QO7A 1FMCA 4BO6A 2JCVA 1AGNA 3EK2A 1GUZA 3VHRA 1N1EA 4IIVA 2OHXA 4DQVA 5DN9A 5JDCA 5TT0A 4A26A 4D45A 5GZ1A 5ILGA 1E3SA 4I5DA 3STHA 5KTKA 4EBFA 3WMWA 2VTEA 3OECA 1LSOA 4AJNA 4FFOA 1NPYA 4AFNA 1E7SA 3DMTC 1IHYA 1R4MB 4WKGA 4B7XA 2GRAA 2W8ZA 3C1AA 1T25A 3KUXA 3BIOA 1VSUA 4GVLA 1QLJA 2C5EA 2PZLA 2V7PA 5ICMA 4EJ6A 1HYHA 2BKAA 3JV7A 5EERA 1RKXA 3EUWA 3NEPX 4CL3A 3GNSA 3KB6A 1EE9A 4GVXA 1JKFA 4CQMB 3NDRA 4EEZA 1P31A 2W90A 2BLLA 4IDCA 1ZVMA 2Y66A 1Q2XA 3ETDA 4H7PA 3HHPA 3WOHA 1MFZA 4UEJA 2I5PO 4EITA 4DC1A 2HJSA 1MC4A 2H9IA 1X7DA 5CPBA 5FFFA 1VKOA 3V8BA 4OH1A 4WGGA 4NPCA 1J0XO 4YDRA 4FFNA 4OXNA 4ZVVA 3H3FA 3AW9A 1VL8A 4BNXA 1E3JA 3GEGA 2NQ8A 3ROMA 3MCVA 1Q7GA 1PS0A 1BDMA 4M55A 5CDSA 1KVRA 4E2YA 1NP3A 2NTNA 3TDKA 2EHDA 3GDOA 2NWQA 3E03A 4IIUA 5IXSA 4AJIA 2NQTA 2D5CA 2P68A 4JLWA 3DTYA 3LLSA 5LC1A 1N7HA 3GR6A 4TZKA 4XJSA 2D5AA 4MVJE 5F5NA 3L9XA 3KSUA 4BKQA 4YPOA 1OMOA 3G49A 4YT2A 3GNQA 5AXDA 3MJEA 1G0NA 2OXIA 1YOVA 2G17A 4ALNA 2X1HA 3DR3A 4PIVA 1GR0A 2EWMA 5THKA 1IY8A 4BNFA 3UHAA 3CKYA 1I36A 1VJTA 2AG8A 2QRJA 3MWEB 4BV8A 2VWPA 4Z3KA 3RI3A 1ZNQO 4PG5A 1RM3A 4DC0A 3C24A 2FPIA 4F45A 5B4TA 2XXJA 1NQ5A 1ONPA 3LSYA 1HTBA 3ZZNA 3JQAB 4OM8A 1NVMB 3QVTA 5JCJD 3FWZA 3FNGA 1QLHA 1WPQA 1CYDA 1YKFA 1FDSA 2RHRA 1EMDA 1RPNA 2EW2A 3GQVA 1HSZA 1PJ3A 2QQ5A 2BFOA 3RJ9A 4JGBA 2O48X 3I52A 3M6IA 1H94A 3S2EA 1KVQA 4JBGA 3ZWNA 2BFPA 4GWKA 1ONNA 2ET6A 3PK0A 4ROSA 1U4OA 3ZNPA 2AE2A 1B3RA 2GLXA 3ZI0A 4RVHA 3H8VA 1GYPA 2R6JA 2O3QA 3TZ6A 1EQ2A 3GGPA 4Y6PA 4XIJA 3WGYA 1SOWA 2JCXA 5BSFA 3UXYA 2YV3A 3ON5A 4IS3A 4PCVA 3GRPA 4E2XA 1HE4A 5A9TA 3SJUA 3CH6A 2O2YA 3TRIA 3WSWA 2PD3A 4IXTA 4NFYA 1HT0A 1O5IA 2FRDA 3L4BC 3LLVA 1U3UA 5H83A 4CMBA 5TRTA 2J3JA 3PXXA 5CEEA 4CMHA 4IDFA 1Y9EA 2HK9A 1Z7BA 2FR1A 2X0RA 3CZRA 3JCZA 4JIGA 4DQUA 4PLWA 4JJIA 5FF9A 2QZ9A 3I9NA 1WMBA 3SC4A 4QSMA 1NNUA 2R00A 3ST7A 3EZLA 4XB2A 2HMUA 2OFPA 5CG1A 1SPXA 3VDRA 4WLOA 1XLTA 5AXAA 4OQZA 1DPGA 3LU1A 1RJWA 2FR0A 3I9LA 5A03A 3O03A 5IJZA 5JE8A 1LDMA 4Y6RA 3VZQA 2BHLA 4KWHA 3PFWO 1MP0A 2Q4BA 4PG6A 4FQ8A 2IRWA 4AJ4A 3CIFA 2DBRA 4D0SA 4RF2A 1IUKA 4L8VA 4GX5A 3ICCA 3G3EA 4KDEA 1P33A 2WD7B 4W82A 1HDXA 3EC7A 3F1LA 5JAIA 2ZTVA 4XEHA 3WNVA 1YL7A 1DRVA 3JQ6A 1GADO 3JQGB 2HMVA 2P4HX 2G5CA 5TF4A 2AE1A 3OQ1A 3GLQA 1GZ3A 3NV9A 4KTVE 3ETGA 4LISA 2D1YA 4UVIA 4CMCA 1MXFA 1QYVA 3ENNA 1U3TA 5K0ZA 4G65A 2CSUA 3GPDG 2C54A 4BHTA 2POQX 3W8FA 4IPTA 3FNHA 2EV9A 3KHUA 2I9PA 1NHGA 2WM3A 2Y1EA 4U0KA 1Q0HA 2P9EA 1IPFA 4ZRNA 4QUKA 3WGTA 5EESA 4TZTA 1LLDA 3H2SA 4CR7A 2PK3A 2P4QA 1ZBQA 1CEQA 1E7MA 5CEJA 2BGMA 3EY4A 4NH4A 2PZJA 4BO2A 1K3TA 5ER9A 3BTSA 3GT0A 2FR8A 3LF1A 1UXJA 1UXKA 4CJXA 2GCGA 3WSVA 4UVEA 4PFJA 2NSDA 4N54A 4WEQA 1HSOA 3WG9A 1IHXA 5KVQA 5FEUA 3U0BA 1JLLA 2O50A 4Z9FA 5CFZA 1I3MA 4YXFA 1J4AA 1KOLA 2O4UX 1PGOA 1PZGA 3H6KA 4BNHA 3DBHB 3U5TA 3DZHA 1ZEMA 1A71A 3L07A 3ZCXA 4W9NA 5IDQA 3OJ0A 4P4LA 1Z74A 5I9MA 4BGIA 3EMKA 5ADHA 4PLTA 4BOYA 1IE3A 1W6UA 1OZAA 1UP4A 1NQAO 4B4VA 4CODB 3U4DA 4CLOA 4YJFB 1HLPA 1PZEA 1NPDA 3O4RA 3RUCA 2BGKA 3AY6A 1L1FA 3RAJA 3R1IA 3KETA 3RQSA 1C1XB 3Q1LA 5GMOA 3D7LA 4UULA 4HFRA 1NWHA 4Z9XA 4W6ZA 1GQ2A 1JWAB 1OI7A 2B5VA 4PG7A 4R3WA 3PHLA 4QEDA 3RKUA 1LLCA 2VHVA 1UDCA 1V3TA 3F4BA 1CRWG 4KDFA 2B4RO 2EF1A 2ZK7A 3M1AA 1UZMA 5ER6A 3E6AA 3Q3CA 1KYQA 3WIEA 4UUOA 5HM8A 5A9SA 4TKLA 1CIVA 3DBRB 4R01A 5F1OA 1SNYA 3TZQA 3NUGA 1HE3A 4ZICA 2ILTA 3NTQA 1HRDA 4JROA 1RM0A 2RCYA 5CP8A 5K6AA 4GMGA 1VKNA 4B3HA 2PFGA 3GK3A 1GCOA 1PZHA 3GN2A 2BI7A 4NK5A 3KYBA 3PQDA 4K9DA 4TVBA 2FOIA 5JW6A 4R16A 3N58A 5KJEA 2WE7A 2HCTA 5L7YA 1T2EA 5F5LA 4DIFA 3TWOA 3ZV4A 1BMDA 3VTZA 3JQ7A 2C5AA 4BO4A 3CEAA 5MGBA 3K92A 1UAYA 3LC2O 4YJHB 4PZCA 4HKTA 3DFUA 3RU7A 3MJTA 2BF7A 5DBGA 4D41A 4D43A 4E13A 3INGA 2DPHA 1GD1O 4RF3A 2OZPA 2XPCA 3FR8A 4EUEA 5I9NA 3Q9UA 2Y99A 1H93A 4FS3A 1ZO8A 3OJEA 3JQEA 3AJRA 3FD8A 4BUCA 1E1MA 1FDTA 4DBZA 3AUAA 3G1TA 3HDYA 4CR6A 1SEVA 1YDEA 2O4CA 3H2ZA 1DIAA 2CVZA 4LN1A 1M6WA 2X5KO 1O95A 3VPFA 2EIHA 2VYND 4BNZA 3V1TC 5HS6A 1PU2A 2I3AA 3D4OA 3F47A 3GNTA 1P1KA 1LXCA 1ZZEA 1XQ6A 1F12A 1AE1A 3MOIA 5HTOA 3WYEA 1H2HA 2E49A 3WXBA 3GUCA 3GY0A 4J4TA 4WE3A 5IZ4A 4FOOA 4JXKA 5JMWA 5KKCA 3F9IA 2O3SA 5L7TA 4JJFA 1P1JA 2PNFA 4RV9A 3GG2A 3LYLA 4II2A 4RORA 2UVDA 2IZ0A 1GFSA 1V35A 3DHNA 4I1IA 1MXHA 4RF5A 1ZXLA 4RO0A 5GY7A 4OYRA 1ADBA 2VZ0A 4B4OA 2DQ4A 3GVPA 3HDHA 2OOSA 5AXCA 3NT4A 2IODA 2CDAA 4BNTA 3BHMA 3PI7A 1CQIA 2YQ4A 1YO6A 1GU7A 1PEDA 4Y6SA 1PS9A 2I6TA 3JD2A 1U3VA 3GMDA 4HV4A 3U09A 4IDDA 2GPTA 3KEQA 1IYZA 4J1SA 4RPKA 3B1FA 1DEHA 3GVIA 5C7OO 1O8CA 1PL6A 1ZUD1 4BQRA 3DHEA 1EDOA 1D8AA 2DTXA 1B2LA 4W99A 3AOEA 4RZIA 3IP3A 4P4NA 2QRLA 1R4MA 4BO8A 2VTDA 4LGVA 5ENDA 4IUYA 2V6FA 3IUSA 3WBFA 4QX6A 2XOXA 4IXWA 4MVJI 6ADHA 2GYYA 1I30A 3OF2A 5DULA 4ZD6A 4YAJA 5JC1A 3H9GA 2WYWA 3HE3A 5DP1A 4CQMA 3B1JA 4WCFB 3W4KA 1M2WA 3ZWAA 3ZDFA 5DCUA 4CUJA 4E5YA 3KOUA 1ENOA 3HSKA 3R3JA 4XDYA 3VC7A 3IP1A 4IDAA 4B3JA 2J6IA 3IQDB 2E37A 3A06A 5J23A 2JD0A 1EUZA 4NQZA 4Q3DA 5HBRA 3JQFA 2OBYA 4K26A 3D3EA 4Y8VA 2NADA 1DC3A 4URFA 3DEYX 3WGQA 1E77A 4WECA 1DIGA 1HDZA 1XQ1A 2D4AA 4FD3A 3GGOA 5BSHA 2YDYA 1Q7BA 1ZW1A 4GX1A 2UYYA 3HWRA 1PR3A 3DFZA 3BA1A 2JFFA 4UEKA 4O5OA 3TNLA 3WLEA 4A10A 3OIFA 5CDGA 4ZQHA 1JAXA 2QYSA 1Y9AA 3E82A 4FJ2A 4JBHA 4MIYA 4R9RA 3F46A 4BO9A 3F5SA 3QWBA 4FIZA 3D4NA 3RFTA 2AXQA 3BMCB 1N5DA 5KCZA 1ZEJA 2CDBA 1X14A 3I23A 5C7IO 5JDIC 1YWGO 1VM6A 3NRCA 1SEPA 3HJAA 2C7VA 4AJ2A 5HA5A 1YXMA 1U28A 3L4SO 3HUDA 4JP2A 1PJ4A 2QIOA 3DBLB 4E33A 1KVUA 2CZCA 2NTVA 5EQFA 4DPMA 2WEKA 4DPLA 1KC3A 4FFLA 1DC6A 5BQFA 1LDBA 2Q1UA 3JQAA 3PJGA 3AI2A 3WQRA 4U8GA 2ZYAA 3GRKA 4M1QA 3NTRA 5JPIA 3DDNA 1MFPA 3A1NA 3DZIA 2O7QA 4RGBA 5G4LA 5JNLA 3ANLA 1P3DA 2Y1CA 4TQGA 2A4KA 3ENKA 4EDFA 4HFJA 4YYZA 4PLVA 4Z0PA 1LEHA 5K6AC 3ONDA 3D0OA 1E0DA 4YJGB 4I9NA 3FTNA 1L7DA 3WTCA 2X4GA 2FN7A 4IQGA 4JBIA 5F3RA 3AWDA 4EEXA 3JSAA 3AFNA 2B5WA 4YR9A 1MUUA 3WWYA 2ZB4A 1JVSA 4EI2A 4CPDA 1HDGO 5G0WA 1ZSYA 3RJ5A 3ROKA 3AUSA 3N7UA 2J5KA 3ZHYA 1XSEA 3KVOA 3AUUA 1R0LA 4RVDA 3U4IA 5IZCA 2DTEA 3PIDA 2OORA 4OXYA 3H5RA 1LDNA 2HK7A 2OP0A 3KYCB 4FFMA 5TX7A 3UFXA 5BSEA 1KVSA 1DJQA 5A02A 2EERA 4XR4A 4YCAA 4CM9D 4U5QA 4D0RA 1LLQA 1Y8RB 1ML3A 1PQUA 3EW7A 1FDWA 1LSSA 4L4XA 2F1KA 4OAQA 1P74A 2BELA 5TLSA 4D3FA 4PVDA 5FYDA 3WQSB 2AA3A 1D7OA 4BGUA 3NDJA 3OEWA 4W4TA 4B4WA 4B7UA 1WZIA 5BNTA 1PJ2A 1DRWA 3I6IA 2NU8A 1RM4A 2CUKA 5TS3A 1KETA 4KUEA 4U7WA 5A1TA 4YQYA 1SOVA 3ZN2A 1QG6A 3PJEA 1DFIA 4OOFA 3VZPA 5DT9A 1VPDA 1ADCA 3P2YA 1IOLA 4UEOA 5JFOA 4YRDA 3JTMA 3D5QA 2VWHA 4NBRA 3T4XA 1CERA 1M66A 4HADA 4B3IA 4CMEC 3K73O 4BO5A 2EG9A 5DCYA 2GN6A 3I9KA 3V1YA 1U2GA 3PDJA 4DGSA 3QWAA 1HEUA 2WD7A 1B0AA 3NT5A 4FPXA 4CV0A 1ADFA 1E6WA 4CM4B 2FMUA 1N2SA 4LCJA 4XYMA 2O3UA 1EE2A 4ZJUA 3TFOA 1IL0A 3JQGA 1H6BA 1NQTA 1UDAA 1X1TA 2PTGA 1Z73A 4HWKA 1E92A 2NVWA 3IKTA 1PJTA 5DOZA 4HNGA 1I33A 1R37A 1GDHA 1XCBA 1GL3A 2C2XA 4CV1A 2RAFA 1LQUA 4J43A 4I9HA 5CG2A 3OIDA 3SC6A 1WP4A 3H9EO 1N1GA 3LT0A 4RDIA 2RH4A 3IUPA 1ZXBA 1T26A 2Q3EA 2Q2VA 4DRYA 1WW8A 3BAZA 1K6JA 1P0CA 3QP9A 3QWFA 1NBOA 2O3RA 1WZEA 2QW8A 2X9NA 4PLYA 4LRSB 4OJNA 1KEWA 1DAPA 3E9NA 4HX5A 3V2GA 2HJRA 4G5HA 1WVGA 2AQ8A 2Q49A 1HE5A 3W4IA 1ENYA 3GVHA 3AK4A 3HFSA 4F6CA 2DFDA 2NVUB 3INTA 2Y05A 4JQCA 2BI8A 1ULSA 3NJ8A 3ONFA 1B26A 1GY8A 2AHRA 3JQ8B 3MTJA 5IDWA 3PQFA 1V8BA 1JW9B 1HYGA 5EJ2A 4CUZA 3DBHA 5C3MA 4BNNA 1ISFA 1TB4A 4J9VA 1TXGA 1D1SA 3V2HA 1GEGA 3TFQA 4IDGA 3GZNB 2IZ1A 3COSA 2JAHA 3DZGA 1WAMA 3RC2A 1CWUA 1NR7A 4XQGA 1MC5A 2IZZA 1X1EA 3QV1A 2Q99A 1DC4A 1LU9A 1U1IA 3RFXA 5EMHA 1R0SA 4YJFA 5IDXA 4F6LA 4K1LA 1OC2A 1EUDA 3GFBA 3OICA 4DPKA 3CUKA 4O0LA 4ND4A 4OKIA 1C1XA 1U5AA 1YBMA 3K96A 2GNAA 3HADA 4Q3BA 5C5IA 4CUKA 4XYBA 4DA9A 4LVCA 1BXGB 4GX0A 4PRLA 2HU2A 3HNPA 3DWFA 3DOOA 1PGNA 1CDOA 2ZB7A 3FSRA 3SJ7A 1YGYA 3ZW8A 4GMFA 4J0FA 3DBRA 5TC4A 5GZ6A 4Z3DA 3C7AA 2AEJA 2Q1WA 1ZMTA 3H7AA 4D42A 1GZ6A 5ITVA 5G4KB 2ZCUA 4IJWA 2Y0DA 4PGFA 5IN4A 4BO3A 4CM6A 1BGVA 1CJCA 3NDIA 3SBOA 3PPIA 3FF4A 1SMKA 4XWYA 2X5OA 2NUAA 2VZ9A 2GASA 1UZNA 2XAAA 2JL1A 3OQ6A 3ADPA 1QP8A 3TJRA 1DSSG 4DIBA 4BMSA 4IBOA 1MA0A 2Q1TA 3VPGA 4XD2A 3C3XA 4ZQEA 1EVZA 1M75A 3ZGYA 4XYEA 3EHEA 3JQBC 4YJHA 1WXDA 5JCXA 1P77A 5CPFA 4YAGA 4CL8A 3NAQA 3PQEA 4UREA 4DYVA 2RIRA 2HMSA 4II3A 3LZ6A 2DUUA 1I2ZA 4YRBA 4D3SA 4R68A 1H5QA 5TJHA 4RPGA 1P1RA 4J3FA 3WX0A 4BNIA 1NPTO 3BMNB 5IZCC 1ISGA 5A4DA 5ENVA 4E2WA 5FWNA 3PZRA 3PLRA 2UV8A 5T67A 1YJ8A 4R3NA 4Q3CA 4ALMA 4M87A 1T4BA 2JJYA 1C0IA 1PJQA 5ICSA 4BKUA 3OETA 1O89A 1L7EA 3FPCA 2X0NA 5DZSA 1MV8A 4J9UE 2HKIA 4R41A 2YHUA 3NYWA 1SC6A 3L9WA 3ICPA 4XGIA 3CZMA 1Q0LA 4L4RA 3AFMA 1A9YA 3RU9A 1QRRA 3LQFA 1AXGA 2HRZA 1FXSA 3ASVA 4WCDA 1VJ0A 5KOIA 4AL4A 2P91A 2EGGA 3JD4A 4GGPA 4MP3A 5DP2A 1YBVA 4DTIA 3G17A 1GAEO 3X2EA 1A5ZA 1U5CA 4D44A 2C29D 3W6UA 4YVFA 2YFHA 2OP1A 1HDOA 1NVTA 4AG3A 4GGOA 1EFKA 3JQ9C 1O94A 1H2BA 2B36A 2FZWA 3G0OA 3EZYA 1QV6A 1U2DA 5JXWA 4PN3A 2ZJ0A 4ALLA 3B70A 1Y5MA 1Z6ZA 4D7AA 4Z6KA 3EGOA 4XRRA 4J2OA 2I3GA 3E48A 4PG4A 4BMVA 1HDCA 4Q3NA 4RVUA 4GSLA 4HUJA 5EL0A 4YAIA 3ZV6A 1PX0A 1TVEA 5JDCC 5L45A 1PJCA 1PWXA 1UJMA 3TL2A 1B7GO 3RIHA 5TQVA 4IMPA 3BMQB 3HQ4O 4XYLA 2ZJ1A 3M2PA 4DREA 2O7SA 2JD2A 2UUPA 5T6BA 4PLHA 5T8KA 4OSOA 1JWBB 4WCFA 4CV2A 4YB8A 4INAA 1T2FA 1PJBA 4BIIA 3SEFA 3I6QA 4LMRA 2PLAA 1EFLA 3KBOA 1HKUA 1YQXA 4P8RA 3PEFA 4ND3A 4PVCA 3OMLA 2YJZA 1U8XX 4E3ZA 4E30A 2DAPA 4MKXA 1XYGA 1NXQA 2LDBA 2TMDA 2GERA 4ZA2A 2DT5A 3OH8A 2W2KB 3V5NA 4R4JA 4M8SA 5IAAA 1B3BA 1UUFA 1ENZA 4YWJA 1AN9A 2GUGA 4IMRA 2DUWA 1X0XA 1ZMOA 2ZQYA 3GZ4A 2ZTMA 4NDNE 1F17A 1EVYA 4AJPA 1HF3A 4Z0HO 4U0JA 2DU8A 3BTUA 1VLLA 1R0KA 1H6AA 1UZLA 2B4TO 4S1VA 4DLAA 4RZHA 5JLAA 3H5NA 2AEMA 4IZIA 4GSKA 1F06A 5BSGA 5L7WA 3DXFA 3PHJA 3BMCA 1W0CA 4N18A 3SLGA 1KBZA 1I3LA 4GLOA 3GG9A 1R4NB 3RC9A 3FN4A 1N92A 2PKRA 1LX6A 3RASA 3ZH2A 4AJKA 1GUYA 1T1SA 5KKAA 2Q2WA 2H5LA 5THQA 5A06A 1QYDA 3DBLA 1TT5B 4TROA 2G82A 1XIVA 3W8EA 3O9ZA 4YRAA 1J6UA 2J3HA 2Q50A 3QY9A 4Q39A 3TF5A 4ND2A 1ID1A 4O1MA 3Q11A 1I2BA 3VVBA 8LDHA 2G1UA 3HZZA 3QHAA 1CETA 3W8DA 2PD4A 3FCOA 5JY6A 1A72A 4HFMA 4GKBA 4I08A 4M89A 5G0SA 3RCBA 4CM8B 5JMPA 4O59O 3VH4A 4ILKA 2O23A 2X7HA 4MP6A 5DOVA 2VHZA 1XELA 1BG6A 2LDXA 2VYVA 4J91A 1V3UA 3LK7A 1LDGA 3ZHBA 4YJGA 1I8TA 2Y68A 1OOEA 2PY6A 1IULA 1C0KA 1GYRA 3ASUA 1JAYA 3JD0A 4RQTA 1JKJA 1P1FA 1LRJA 2QZZA 4GKVA 4XX0A 1XU9A 3ZW9A 1D3AA 2HRBA 1K5HA 2C59A 2DFVA 1JA9A 3E1KA 5TGDA 2FY8A 2G76A 3OSUA 5IDYA 1LC0A 3KYCA 2PV7A 5BNIA 1EK5A 3B1KA 1M67A 5L4SA 4HBGA 3WS7A 2BMAA 1HL3A 3I9OA 1DBVO 1YE3A 1Y8RA 4P22A 2HMWA 2NU7A 2V65A 4UVDA 4MVJG 1NFFA 5KIAA 2IE0A 5COAA 1Z82A 2EJVA 3U4HA 3AU9A 1KC1A 4J0EA 3ZHXA 3JYNA 1E3WB 1BSVA 3F4LA 4ND5A 4XA8A 3MJSA 5KJCA 1VC2A 3GUYA 1W4ZA 3VDQA 1GYQA 5KJ6A 4KQXA 1K2WA 1PGPA 4BNJA 5IN5A 5KWEA 2GZ2A 3ZWPA 4ESOA 3WTBA 4IM7A 1BWSA 4NJMB 3WGGA 4LMPA 4BO0A 2W4QA 2C07A 4MDHA 1TI7A 2V6BA 2J3IA 1EK6A 4FDAA 2R00C 5IXYA 2I67A 4CMGA 1SB8A 4WNCA 2X58A 3C8MA 1U4SA 3LC7O 3IL2A 1PL7A 1WDMA 5ILOA 3WDSA 3RFVA 3PHHA 1DHRA 1S7CA 2JHFA 2Q2QA 3JYLA 2X9VA 3EYWA 3KTDA 3FWNA 4A2CA 4D79A 3G79A 4DWVA 2FSVA 2Y1OA 4CM4A 5GZ3A 1B16A 4XQCA 4BV9A 4LCEA 1E1NA 4DQXA 3WIDA 4XQ9A 1UP7A 4CLRB 1Y8QB 3TPCA 2EGHA 3VAZA 3GN1A 4JCOA 2W2LA 4HNHA 4R1SA 3WNQA 1E1KA 3P2OA 4DMMA 2VHXA 3PHGA 4PZDA 3JD1A 5G0TA 4Q3EA 2YV2A 3TOXA 1LRLA 2EP7A 2PZKA 4L73A 3ITDA 1SB9A 4KQWA 5HS4A 4IDEA 3ROQA 3HFGA 2B37A 3KV3O 3C85A 5TT1A 1YJQA 1BW9B 1KEPA 4IJUA 4BB5A 2NTJA 1NX6A 3NTOA 1XHLA 3P19A 2EKQA 4CM3A 1KERA 2B35A 3ZWOA 1O0SA 1H6CA 3E5RA 2GN8A 1UH5A 1XKQA 2UAGA 1CQJA 3KSDO 3B20A 2D59A 4E21A 2OMEA 4Z9YA 3L6DA 4MOWA 3G1UA 1ZIDA 3Q6IA 5JYEA 3CE6A 4H3VA 2NVUA 1SAYA 3ZV3A 3IC5A 2E4AA 3DMTA 3S1LA 4IZHA 2FPPA 3UH1A 4BGEA 1D1TA 4RLSA 1NAIA 4NBUA 3JQ8A 4HP8A 2UUOA 1YDWA 2O2SA 3PYMA 1LSUA 5HWSA 1NR1A 4R1TA 4Q9NA 5T57A 3GZNA 3H4VA 3O8QB 4CR8A 1ZJZA 2ZKLA 1DLJA 2EKLA 2JAPA 1KY5A 1MX3A 1KEUA 1ZK4A 1FK8A 3C7DB 3PRJA 1DB3A 4U6QA 1EVJA 4NJOA 1AHHA 2P5YA 4GL4A 4RPHA 1DOHA 4XGNA 4YQZA 5EPOA 3S8MA 3VZSA 4C7KA 5JAMA 2ZYGA 1YH3A 4W9NC 5CDYA 2PKQP 4DXHA 4WASA 3IJRA 4JJGA 4L0QA 1F0YA 3DZKA 5JO0A 2AEFA 1P45A 4RPJA 4B79A 1BXGA 4G2NA 4EGFA 5KVVA 4KUHA 3PP8A 3MTGA 1SO8A 1Y1PA 1HETA 3ABIA 3L77A 4BKRA 3ZV5A 3IIEA 3UCEA 2QX7A
chains in the Genus database with same CATH superfamily
3PQ8A 4HGQA 4N5NA 1YIOA 5E4TA 1ZOPA 2JGFA 3ORFA 4Q9KA 1B14A 2GKGA 4YLYA 1MB4A 1W34A 3GCZA 1I14A 4LWQA 2IUFA 1RI5A 2AJCA 5CU7A 5J63A 3W5SA 1L9XA 2FJPA 2V6MA 2I03A 1SUPA 4UNSA 1WMAA 3RVLA 1FFXB 1ZH4A 4CNQA 3MPOA 1LUAA 4HJXA 1XA0A 4OHZA 5L95A 5EHNA 3OLQA 3OVMA 1DNPA 3RUDA 4UUMA 5ES3A 1GRRA 2GVZC 2X3FA 3KALA 3OT1B 4GLLA 4R2JA 5F33A 2FXVA 4F46A 2BKXA 1U7HA 3WNBA 4HNAA 4HX9A 4YMUA 5SZIA 4MUNA 4WJZA 5AOVA 2QTVA 1JFSA 1A8HA 1R12A 2GR9A 2J4DA 1I4WA 1LC3A 2Q3JA 2QTZA 1J24A 4H7IA 1UEIA 2CF6A 4DQDA 3MCZA 2BF4A 3ND8A 1R66A 1S8NA 4ZYTA 1QE3A 4S1NA 5TIIA 2Q4EA 2VPXA 1PV2A 1E7QA 2QX9A 2RAVA 2ZUDA 3K1TA 3ZU3A 5K0BA 3ZLJA 2JGAA 2H51A 3LGSA 3B6ZA 3QELA 2IHYA 4A1OA 4UBKA 4B76A 5CXUA 4E94A 1Q92A 1O87A 4S2EA 3WGJA 1V7QA 3HM2A 1DQSA 2IU0A 1HA3A 2VK8A 5LA6B 1VMKA 2ZATA 2VPIA 3VISA 1HTWA 1MKYA 1ODFA 3EOZA 3MTQA 4F4JA 2X86A 2C82A 3NKLA 5J59A 3OM9A 3OJOA 3R9KA 4YT5A 1M6EX 2PKQO 5DM0A 4DIBA 4JKYA 5DX0A 3HCWA 4YUVA 1XR3A 1TYBE 2XA2A 3KAPA 3E9CA 1EWRA 2FK8A 1OY1A 4QQRA 4TXMA 3SU8A 4ALJA 4TZ6A 2QX4A 1R8QA 5F21A 1W73A 1ORTA 1CULC 2I55A 3HG7A 1APBA 1XRMA 2PYDA 4GAEA 2FUEA 4GZ5A 3ZJ4A 3MGCA 4WRRA 2B1QA 3V6LA 3A4YA 1I24A 3BMOB 3EVGA 3WO1A 3T95A 1FNDA 2A57A 4F2HA 3EH1A 1W5SA 1NJ6A 4V0OA 5HPYB 1T24A 2RI6A 3AL2A 4LK3A 5DM60 2BTEA 3EDMA 4H17A 2G5PA 2JFQA 1YR3A 2XRFA 2Y1XA 2Y1WA 4FCWA 3GJ3A 1BXKA 5ES4B 2XMZA 3CNOA 2KHZA 3DOCA 3AHGA 3N9IA 4O25A 3CZ5A 1XZCA 1Y82A 2ALJA 4ITUA 5B57C 4Z0TA 1Y5RA 2FU5C 3HHEA 1DIRA 4Q05A 3RYFA 4RJTA 3R6DA 3ZCVA 3Q7QA 3AF1A 1BOFA 1GXSB 4RABA 5TPZA 2J5RA 3OFJA 3JASB 1AQ6A 4REOA 4LF4B 4PSUA 1L7MA 3ISTA 1IZ0A 1DAIA 3PG5A 5I3CA 1EIWA 3CWZA 4ZVKA 4RD6A 3PXCX 3K05A 1SGWA 5BURA 1T4MA 2ZBEA 1EJ2A 1JKIA 2P1ZA 3D6JA 4IIEA 3PUIA 3TK1A 1M8FA 3Q8XB 3DL4A 1UBRS 3EXIB 1GZ4A 1WHTB 3VYSB 3ZHRA 4RCVA 4B6OA 2R3SA 4M98A 4YGYA 3KSAC 3NW9A 2X9LA 3K6JA 2BFEB 2BMJA 2IOQA 1J9GA 1JYEA 2IXAA 3IMFA 1T8WA 2LBPA 1SBTA 1FVFA 2ZBFA 5LDHA 3SZ3A 4Q47A 3V1MA 2MSNA 4BUZA 1HNZB 4KQMA 4BVAA 2Z1NA 4HZGA 3KOYA 3SXPA 4UOZA 4DUGA 4K81B 5E2AA 3ZHOA 1XRQA 1UC9A 3BFPA 1TX4B 3TE6A 2H54A 4NIMA 2DVMA 4JX9A 4A0QA 1DDGA 3VFDA 2WW8A 4RQUA 4EG0A 5ESXA 1OTXA 3UB2A 4C0AC 2ZDQA 1G5HA 2O8DA 1TM7E 2ZYDA 4JP5A 1U7TA 4FMDB 4I6EA 4YAEA 1J0CA 5G02A 4D8VA 2FEOA 3PEUA 1FMTA 4OYLA 2QVGA 1ZK2A 3KZOA 2FFJA 4ZO7A 3TD6A 5LQAA 2OD7A 4QREA 4QNMA 3A37A 1VCHA 1AKTA 3I01A 3D6AA 4G3XA 3PF8A 4NU5A 3GCGA 3RG2A 1RZUA 2W2KA 3HS3A 1AQNA 3MCUA 4O2LA 2CXPA 3EG9B 4MWOA 2I7DA 3PSHA 5D7NA 2OPBA 3HY3A 1EX1A 2ZJ3A 4LY3A 2CF5A 4GPAA 4KAFA 1Y7TA 4IJVA 5KVSA 5DXAA 3N0VA 4NLLA 1T2CA 4BVBA 2HIGA 4UBOA 1N8KA 3Q10A 4OQYA 3E5NA 1R6DA 3V97A 2P35A 2V55B 2I1QA 3NNSA 5IPFA 1HWYA 3Q12A 5TJ9A 4J3NA 3JQFC 2GT1A 3JX9A 5T7BA 1HMPA 4LIPD 1Y1SA 1T5HX 2R2GA 4MUKA 4RVFA 4BVHA 2PO7A 4I0WB 3DBIA 1M2JA 1R4NA 3U7QB 2CYCA 4CGZA 2V5UA 1CJVC 1XWIA 3I2FA 3MUOA 4CMJA 5KPDA 4L5IA 1XLWA 1PV1A 2VA8A 4GU5A 1J5PA 2REQA 1FJGB 1YR7A 3CR7A 2M98A 2QTRA 4RHFA 2PZFA 3CV3A 1G19A 2FW8A 4KNYA 1TT5A 2I29A 4FEAA 1KDRA 2RBKA 2I3DA 4YCBA 1WSBA 4BXOA 1ISJA 1N9GB 4QUIA 3R0ZA 5SICE 1CK4A 1WU8A 4EYEA 1BVUA 4BN5A 4PN7A 4LF7B 5DEOA 1QHYA 3NIBA 3HL0A 2E1RA 4Q66C 4Z0NA 4FLMA 4ZN6A 2ZT7A 2OO7A 4PIPA 4RA9B 5BNWA 2WWXA 4TSFD 1ZL0A 5DISB 3ZS9A 2AN9A 4OXKA 4B8YA 4DCTA 4J6FA 4S3MA 4CM8A 2I22A 1C7FA 4MVJF 1J5XA 2PXHA 2HMTA 4XASA 3EHDA 5AM1A 2IEBA 2C99A 3O7MA 2GM4A 4EA9A 3GB9A 3HJRA 1FW8A 2XIQA 3DKIA 3UWDA 4DV7B 1KDYA 4OXXA 4G6ZA 1X38A 1YZYA 4B4DA 2DHEA 1E99A 2A1TR 5K8TA 3QX3A 4HB3A 5AHWA 2Y3IA 4C03A 1TK9A 5B6PA 4Y9SA 2ZB8A 4KXLA 3SYTA 2C57A 3FUVA 4RD2A 5E7JA 1X7GA 4BE9A 1ZH0A 3RHTA 4TRRA 1BXZA 2V9ZA 3MIIA 4KN8A 1V1RA 2BIFA 3QWHA 1RADA 1XEAA 2OT3B 1DWQA 2PSHA 4LMAA 4ZRMA 1LQTA 1LWOA 2ZB3A 3QMMA 1XDUA 5T64A 1J23A 1ILEA 3BD6A 3KD3A 3PNLA 5KNLA 3D43A 2PE5A 5BWOA 3ENVA 4URUR 4P82A 4Q1DA 3VKVA 1NQUA 2SHKA 3R3SA 2Q07A 1N0IA 2ZR0A 5LLSA 3OPYA 4Q0MA 4N5MA 3CMMA 1LNQA 4QU0A 1ZH8A 3X2FA 3R6LA 4OJTA 3MWDB 1KDOA 3VNAA 2WWIA 3L7NA 3VJLA 2OG1A 2QK4A 4RV4A 2P4UA 4L5CA 5IAJA 1EP2B 4A8PA 4OD0A 4RS3A 4ID3A 1SN7A 1B42A 1T6YA 2ZLBA 5JPDA 4LYAA 3KSRA 1BMQA 1E3WA 3IAXA 4MP8A 4ZYYA 1XCPA 5B1YA 2J0SA 2P4EA 1L4KA 3HXKA 1BXRA 4BFXA 4BGDA 4ZCSA 4KPUB 1JPVA 1ODCA 1W1UA 3BOSA 1LI5A 3R76A 4CDNA 3NTLA 4I4LA 4KHPB 1E2PA 4ZAFA 4KR9A 2WKWA 2JJ1A 5B3JC 3CT4A 4LBZA 3B2EA 2M6SA 3MEQA 3T7EA 1CF9A 2HA2A 3G9TA 3H9BA 1PIWA 3P26A 3VKUA 2WVAA 4P0PB 2JLQA 4RPLA 3W9BA 1V6AA 3PLNA 2GN1A 3VSDA 1JF8A 2A35A 2QG9A 2RHOA 4KYIB 3VPCA 2VYNA 1Y9ZA 3N2IA 1KJJA 4JL8A 2X23A 1JEDA 4WBNA 4FX2A 4DNQA 3OP4A 5A5DA 3HUFA 1RXSA 4MJ3A 3A3PA 1V1JA 4R7TA 1RXWA 1JG6A 1PJLA 4U8HA 3ERCA 1E9RA 1W48A 1J8MF 4UCXA 4MEBA 1IN1A 1KO8A 2CK3A 3ILHA 1PSWA 5JS8A 3VH2A 1QR6A 3FKQA 1ZN2A 2I4LA 1VRWA 3A9SA 3DC2A 3H3JA 1IZZA 3NQ41 1CSEE 3AINA 1YMQA 1OR8A 4JUDX 4BGVA 4R6XA 1B1AA 1Y8QA 4XR9A 1FF9A 4YUWA 2PWZA 3OIUA 1E5QA 4L1KA 4BVLA 4TS4A 5BQOA 5FPYA 3COVA 1YR9A 4N3GA 5K0FA 1YJBA 2GFIA 3BWDD 3QE3A 1UM9B 4E0BA 4I9FA 2Z5LA 4B8ZA 1IOVA 3QZUA 4UPVA 5I45A 1K06A 2B69A 1DFHA 4K0RA 1E8MA 2YN0A 4YJ3F 4E4YA 2IDZA 2QV7A 4WD3A 4GLBA 4JL6A 4ES6A 5A4KA 1YB6A 3FCSB 4NMWA 3TL3A 2IPXA 1A1SA 1L7QA 4YP5A 1O7JA 1UQRA 1YRYE 1E7YA 2Q5JA 3R0VA 4TKMA 4BFCA 3EIQA 5LZ9A 1WUYA 5JH7B 3MS2A 4WZAA 1UBTS 3SNKA 5CAEA 3I0NA 3VHQA 3KZVA 3WP1B 2XMGA 3G0BA 1E7RA 1B15A 3IT3A 2IH2A 1P0FA 2DC1A 2RKWA 3H6GA 2R8XA 3BFXA 5FKJA 3H5AA 1DLIA 2C4KA 1KHHA 2EJUA 3BDIA 2G7MC 2IYPA 1ABEA 3F71A 1ISPA 4DUGD 2VP4A 4LOKA 5E1MA 4R5MA 1SQ0A 5B58C 1OH6A 1VL0A 2D5BA 3IXQA 4ISBA 3P94A 4V0LA 2RGCA 1XXHB 2JI6A 2RKOA 2VSNA 3PV0A 2VRCA 3SZGA 1XU4A 3FBTA 3N87A 1LZLA 1UEXC 3H13A 5ITWA 4OUKX 3DGFC 2DBZA 4M53A 4RVSA 4ZAZA 4Q01A 3DONA 2DBVO 1Z4NA 3UPDA 1QGOA 1LVHA 1TVCA 2WA2A 2B9VA 4WQMA 3ISJA 5ELLA 5CEFA 3OQOA 1XTZA 3Q6MA 2RB5A 1VLQA 2HLPA 4TWJA 2Q45A 4XDZA 5F9MA 3K20A 3UEOA 3RVMA 1P7VA 2HD4A 1HPLA 2VP6A 1PGJA 2FHSA 1AF7A 1L5FA 3NJ4A 4QPJC 4H7KA 4QUHA 3BHIA 3CTMA 3FHLA 2XBMA 3QKUA 5AKKA 1T1RA 3C3DA 1I9CA 3JALB 2WDZA 5TDHA 4QM7A 2HRRA 3AWIA 1MB9A 4ZCLA 2GZ1A 3FWKA 5TVKA 2WB2A 2C1XA 9LDTA 1KY4A 3LK6A 3O4GA 2EJCA 3WIUA 1PTJA 3B6IA 4V0MA 4RD4A 3IB6A 5KTTA 2ZR9A 3BWBA 3QBTA 1ECJA 1UM8A 4J49A 2MCFA 4X94A 1TADA 1RYEA 3CM0A 2E5LB 1BS2A 2XQKA 1CUDA 3P2EA 5J1SB 4MLZA 1FSPA 2C58A 4XZ3A 1FA9A 3GMSA 1KAHA 3LT2A 3CRNA 3Q5EA 2OGTA 3LF2A 3R0QA 2Z6QA 1FYWA 3NT2A 3BXOA 3BGSA 4B46A 4FGSA 2VJYA 5JECA 4EECA 1LRKA 5P21A 1Z5ZA 4PX5A 2GBLC 3TIIA 4TVOA 3HVKA 1SCJA 3QRWA 5COQA 2OMKA 4L8GA 3U4QA 4B45A 4I4TB 2XXBA 4OHXA 1E96A 3S8YA 2JH9A 2YINC 2NU9A 3EAGA 5JSZB 4AN1A 4AKIA 1T29A 4ZZ3A 5FUBA 1OILA 4QHSA 1IN6A 4X7PA 2C4HA 5FTWA 3O73A 5JDIA 3OTGA 4M83A 4DG5A 4P4GA 2DPLA 4FBGA 2C3OA 2IYZA 4GI2A 1GUAA 4KFSA 4KXVA 2XT9A 3K6SA 2COKA 2O0MA 1ES9A 1G4HA 2CWDA 2J9GA 3E18A 4IX1A 1KJIA 3TQCA 3WQQA 1E0KA 5JY1A 4NJEA 4OG2A 4X66B 1UJ5A 3ZDAA 4UC0A 3QPWA 2WJPA 2QLBA 1XG5A 5AW9A 3ULKA 1ZK3A 5HDQA 1XZAA 1J8FA 2OUKA 1M2VB 3AV0B 1SUDA 1X0VA 3FKSA 4QQ8A 5JYDA 2C7RA 5K6TA 4MRAA 1TKCA 2FEMA 2FA9A 4YIHA 3ANNA 1DAOA 2WNSA 3I04A 1W35A 4COOA 5JV5A 3QJ5A 4ZZ1A 4QFCA 1GA4A 3FPBA 3AIKA 5GV7A 1EUCA 1DKMA 1ZIOA 1ZSVA 4KGXA 1VL1A 5B64A 2HCFA 2I66A 1ZUNA 3OT4A 4HYQA 5CVUA 1PWEA 5IF9A 1XEWX 3T6KA 2GK3A 4QXMA 3ZV7A 2JKVA 2AX3A 1C41A 1V0JA 2IZOA 2OILA 4RTSA 1NVDA 3B3AA 4HVLA 3I28A 3O1JC 1GVNB 5ESDA 1EBUA 2X7JA 5LIPA 4YI3A 5KU1A 4EMBA 3H0KA 1IWBB 2XX3A 3HBAA 3JYHA 5G1NA 3ZU4A 1JIIA 5DNAA 4A7PA 4EW6A 3EDQA 3G2IA 5CVCA 2O2ZA 3ZHTA 3JAKA 1AKUA 1IJKA 4YA6A 4BNLA 4KAAA 3FPGA 1KJNA 3H8SA 1Q7CA 5H82A 4DMLA 1BKSB 4EG4A 3TCNA 1Y4DE 3OX3A 4TV8F 3UJ8A 2OYCA 3WFJA 1P9RA 1R15A 3QEKA 3KG2A 3LVQE 1L5VA 4WLUA 4BFYA 3H2KA 5JARA 4NBTA 5KMGA 4BO7A 1H05A 1WZNA 3G59A 3EULA 2X5JO 2YOGA 4CCYA 3WL4A 5L3ZA 1N2ZA 3HA5A 2XJ9A 4M9ZA 4OSEA 3BC1A 4MV6A 1G98A 4CF4A 3IOYA 2HQBA 4D3YA 2CVOA 1P6QA 4RACA 4BZPA 1DFGA 3DMYA 3JARA 2W70A 1O9BA 4NKRA 3MGGA 3WJ1A 1HDIA 1T34A 3P9XA 3WIOA 1XZHA 2PUEA 1OWNA 5JUWA 4LA4A 3SC2B 2G7ZA 3BIWA 4R1UA 1RYHA 4UDNA 5AK0A 3CC8A 4F1WA 4DM4A 4AC9A 2CD9A 4QO8A 2FMKA 2VQ3A 4G56A 4LW8A 2C9DA 5FJIA 3RRZA 2C5FA 5I8PA 3CUWA 3QPUA 3SR0A 2CK3D 2RJ3A 3CSDA 1AZSC 1LBHA 4EUFA 4QFDA 3GW8A 2VHEA 4BU0A 1RLUA 4WFQA 1TEHA 1ENPA 4TV9A 5DSTA 3KUKA 4YJ2A 2A0WA 2CFCA 2R9VA 3A6KA 2IBTA 3WK4A 4CEIA 4TS1A 1G291 1FW6A 3R5SA 5K9ZA 3U13A 1S6YA 4KFUA 5DHSA 1II8B 3DDCA 4GPD1 3SBDA 4E2FA 3QMVA 5MHTA 3EEFA 3ZWMA 1UWLA 3OO1A 4GOND 4Y2PA 3MZ0A 2R5WA 3DLHA 4MJLA 3V9PA 4OXQA 4BMNA 1GSAA 3OE7A 4LJKA 5JCOC 2FFBA 1XJ0A 2C92A 4HDSB 4PXSA 2VDMB 2ZG6A 4O6VA 2O8VA 1TQ4A 2CV2A 3BSSA 5LQSA 1NDHA 2OBLA 5BR7A 3WLMA 3WRXC 1Z6XA 3OZFA 1YS9A 1LTHR 5BOSB 3V4LA 1T5DX 2P11A 1FNMA 5JQGB 4J4HA 2A4MA 1F0KA 2E6UX 4GP9A 1F6DA 4E7OA 3LPCA 1YVDA 5CUQA 5JXHA 4HRVA 1XE3A 4KFTA 1OI2A 3TR0A 3TX2A 2EAUA 3VU9B 2PA3A 4KE6A 1LBEA 5JRJA 2MTBA 1FQOA 4G4GA 3GEDA 1J0AA 1J49A 1Z2NX 2EZ4A 3T12A 4X54A 4JSYA 4N0QA 4D5EA 2BR3A 2H07A 2VRCD 4FSXA 4RSRA 2XXAA 3LHKA 2QQEA 5JZMA 4LDNA 1B1CA 1EGQA 1Y1QA 3ZCSA 5H4HA 4EHLA 1C9MA 4FU0A 2ZANA 1LQ2A 3RTAA 3Q0TA 1M0WA 4UPDA 4CMIA 2X2OA 4M88A 1JIXA 2EWVA 4PPFA 2FW1A 3WB1A 4OMUA 3KJQA 4C21A 3HNOA 3BGWA 2QYTA 2H4WA 2OCKA 2ECFA 2QRKA 1EB8A 3B12A 3EXHC 3Q3IA 5THXA 1CRPA 3A14A 3Q2KA 5HMLA 1C0PA 3LNCA 3AEXA 2SCUA 2V7GA 3NHJA 3C45A 4AMVA 1J1IA 4ZQBA 1H9BA 2QWXA 3BL6A 1Z6PA 3KLPX 3PJFA 4RELA 5J2UB 3W06A 5A3JA 4W6QA 1TO1E 3JYPA 4QDOA 2XYHA 4L0DA 3D2LA 2GEVA 3FWHA 5KJFA 2PGJA 2QLFA 3A6LA 4QTXA 2QB5A 1INLA 1J7KA 2QVCA 3AXTA 1EP1B 1NOKA 3H4MA 4UBIA 1U7ZA 5E8JA 5E6UA 1V43A 3IUEA 2PBLA 3WGHA 3O4FA 3PTZA 3Q9SA 1OFIA 2TSYB 3K9CA 3PNBA 4RV5A 2DUMA 2IX9A 4HQNA 3SSOA 3TVDA 4ZKDA 3ILXA 3W2IA 4RKRA 3V1UA 4P93A 1X7YB 2VHYA 4O4LF 4Q4JB 4BN4A 4YRIA 4CQLA 5JS6A 3UT0A 1G63A 1FUEA 3H5IA 1H0SA 2Y93A 4G81A 1LJ8A 3SHQA 1S4MA 4J16A 1N2JA 3PKJA 4PQEA 3V80A 4AZWA 2WU4A 5JS7A 2ADFA 4CV3A 4C01A 1JEQB 2CKMA 5E1DA 1NXVA 2EWWA 1ZM7A 2VH5R 1JI0A 2X8AA 1U1DA 5K6RA 1P5FA 1FZTA 3Q8WA 4CLOB 1Y6GA 3OFND 4BKPA 2H11A 4ER7A 1NLZA 1W581 3AY0A 2QVLA 4Q9AA 5CX4A 3P0IA 1X1RA 5DBEX 4EPRA 1OLOA 2XMDA 1RAHA 4NS4A 2NSYA 2I6QA 3TEMA 2OZLB 1ZW6A 4DL9A 2G83A 3RPEA 1KOFA 4BWFB 4DY4A 3EPHA 4QRHA 2QI9C 2PT6A 4QOSA 3T4PA 1ZGAA 5LA6F 3NTVA 4EHNA 5MN5A 1FTNA 2R65A 3RUIA 1IB6A 4AZ0B 4YUYA 4BLSA 3GLTA 3PFCA 4FKMA 4PO3X 1EZ4A 1FSGA 3FKSD 2AG5A 5JG7A 4ZOCA 5AVOA 3GMIA 2HU7A 1NW6A 5I7AA 2OYRA 1YDHA 4WT7A 4FYXA 1BDJA 1E58A 3EBPA 1GEEA 3HYLA 2COEA 2YY7A 1QFJA 5C1OA 4KX3A 4HBZA 2JFUA 3VOSA 2V54A 1B73A 4GI3A 3ZHZA 4BYGA 1J21A 5EWJA 4WV3A 3JQBA 1E18A 1NM5A 3NHYA 4U2EA 2W71A 4Q6WA 5DV9A 4ER3A 4OX9Y 4DADA 1XU7A 5CJJA 3CNQS 5AQ1A 1OQAA 1AMOA 4YT8A 3S2GA 1E8DA 3MILA 4G24A 4GIBA 4ZAXA 3TAUA 1NLMA 4YMHA 3CLSC 1OKKD 1M8GA 2LW7A 2XMCA 3CRW1 3Q87B 2JLWA 1CV2A 1OLUA 3FF1A 1QF9A 4L9RA 1NT4A 2ZRQA 1YCGA 6LDHA 5KVCA 2X8JB 3HH8A 2VDPB 4J4BA 4WMLA 4Y2QA 1FXUA 3I62A 1SHLA 4PLFA 3CLSD 2E89A 3PYXA 3C3EA 3A0UA 1XTKA 3IEUA 3KFLA 4V1CI 2I4IA 1HZZA 2LE0A 4KWIA 2PLRA 3NHRA 4YBZA 5FHRA 3ITKA 221PA 2ZT5A 3HB4X 2DE0X 4MQFB 4NFHA 4E88A 5ALNA 3SWWA 4WOBA 3MA0A 1Y1LA 3MS7A 4RY2A 4U6NA 2HGSA 5NLLA 5KYKA 2RH8A 3PGXA 5GJBA 4ZEMA 5JSUA 1HYEA 4HQOA 3N7TA 4QOFA 5HKAA 5JH7A 4GBGA 2F3PA 2V4MA 4FEYA 5EJ4A 4MR8B 2NU6A 4E5NA 1ZCBA 3HCPA 4JV5B 4MW2A 2Z58A 1FNSA 5EXDA 2FSVC 3OA2A 3CN7A 3IKVA 3VVLA 2WFLA 1FBTA 3VO1A 1L7BA 2JASA 4CIVA 2V7QA 3ZDZB 5H59A 1KJQA 4FB4A 4BP3A 1UXGA 3L0DA 2J8ZA 4OP3A 3EE6A 4L6IA 3X1WA 1JSCA 3ZZTA 1WETA 4UATA 4KKVA 4WLNA 2AN3A 3Q3HA 2ZE5A 2ZDHA 5E9JA 3CRMA 3EZ7A 2H1IA 1FRZA 1RC0A 3C3AA 3LM8A 5HUJA 1M0SA 2EEZA 1GFWA 3BTVA 4RL6A 5ALDA 4ETWA 5KBYA 2Q7OE 2VDQB 2PUFA 1G8MA 1T6BY 2OO5A 3AX6A 2C5GA 4P80A 2VZLA 2NYVA 4G5SA 3AUTA 1JEYA 5AW2A 1R6XA 3SF8B 3ZWBA 2J3QA 3R7BA 3CYFA 1JS1X 2FRVA 4XKJA 3UJNA 3L6RA 1Y42X 3WGUA 3RREA 5CB4A 4ENQA 1CUZA 3AW8A 4FFPA 3U16A 3CMCO 1RJEA 2CB0A 2E1PA 5JJLA 4CKCB 4YPVA 1NLYA 1RCFA 2IUSA 5CHEA 3OHSX 3WNCA 3DKRA 3AERA 4QO7A 3UK1A 2ZR7A 3OE7D 4BO6A 3W04A 1A9XA 3ZOKA 3EK2A 1KARA 2IZ6A 3AC0A 3HSYA 4H7FA 5AKIA 3N8HA 1Y89A 4UTOA 1YQUA 2B8TA 4A26A 2BY4A 2O1WA 4I5DA 4BNDA 4FSDA 2QPTA 3W77A 3WMWA 4HH0A 2IZ5A 3PX2A 4JJ6A 3ESCA 4AJNA 1MX5A 2QF7A 3MMNA 3C1AA 2CFRA 3P9NA 2QAGA 2IIVA 3DWIA 3GELA 1C50A 4PFQA 5AVJA 3WB0A 1JXAA 3RW9A 4YRLA 2AZDA 2VKTA 4EG5A 3P4YA 1L9KA 1RSZA 2Q4TA 1DKUA 2SBTA 1EP9A 2ZRGA 4GVLA 4LGCA 3UWSA 5ICMA 1CW2B 4EJ6A 1RAIA 4X92A 3CW9A 1BS9A 4GPZA 2YJ3A 4CL3A 5C18A 3GLGB 3FSJX 4GVXA 1EE9A 3TTUA 3GJ0A 3GUVA 1UBSB 4EEZA 5EMJA 2QTGA 4H7PA 1CP2A 4BC1A 3GPLA 3TQSA 4OGFA 3AIOA 3O4VA 4YFYA 3ZYZA 2GJAA 3BL8A 4UM5A 4DC1A 1K68A 4EQ6A 4HNVA 4KEAA 4ZI7F 2V7EA 2H9IA 2A3NA 1X7DA 1OZHA 3ROZA 2C5HA 3GLFB 1DWUA 4KSBA 3V8BA 16PKA 1L7AA 2AEEA 1J0XO 1TQ8A 2JGKA 2XOEA 2WT9A 3GFSA 4U39A 2V1UA 2XYGA 4II7A 1BFUA 4H6PA 4FFNA 5CT4A 3PUVA 4AUNA 4M7OA 4F06A 2G1PA 2GEUA 1Z6YA 4F93B 1E3JA 5DNYB 4K03A 2NQ8A 4F5ZA 2WZQA 2D5LA 1PE0A 3TTTA 1U1GA 1V16B 3QG5A 4CVNA 4DAEA 1FL9A 1TZCA 3MINA 3B5JA 3R3HA 2JZOA 3LI2A 4M37A 4XOIA 3S5UA 3TLGB 2FW0A 4ZK2A 1EINA 2B7CA 3ICVA 2IYVA 3GDOA 3TDKA 3ESXA 2H1FA 1TAUA 1SD1A 1S8OA 2ODEA 3PUHA 1H5UA 1SWVA 3OT5A 3QX8A 3FOCA 3P0JA 4KX5A 1QAQA 5DLPA 3J81k 1UPUA 5M29A 3B9BA 2MMCA 3CNNA 2MYTA 4JLWA 3LLSA 5LC1A 4XJSA 2W2MA 2PG3A 1NUQA 4DUZB 1V4NA 5F5NA 1V5EA 3FUCA 4X00A 4PR3A 2JHCA 4XSHA 1ZGZA 4I55B 2GD2A 3D8HA 4YPOA 1ZISA 3CPEA 2V7BA 1Z0KA 3MJEA 1G0NA 1Z07A 3ZWDA 3CVVA 2W0MA 1Z5PA 2FPWA 1KMCA 2G8NA 2GJKA 2RGNC 2WM2A 2ZUVA 4PIVA 4WN9B 5FADA 5EUQB 3KQTA 1NZFA 1Q77A 1I36A 1SQGA 2UZ1B 4Z3KA 1R8SA 2AT1A 1ZNQO 2P69A 1BX0A 3IAM1 1M2HA 4YDHB 3RI3A 4IDHA 3UWKA 4RL4A 4ZCTA 1ZGCA 3DMRA 1CR4A 5AI0A 5B4TA 4FXOA 2PU7A 4D8WA 1NVMB 3WHIA 1RLJA 1L1EA 3F7NA 3FNGA 1II0A 4PC2A 1E4EB 3HPQA 1QLHA 4P36A 3SZMA 4UQLA 3WRWA 2BFWA 2HXYA 4ZRDA 3THYB 2G5TA 4UTXA 2IDKA 3GQVA 1PJ3A 3LHIA 1UT8A 3LCCA 2BFOA 3RJ9A 2GBIA 2A58A 3IOBA 3DH0A 1OPXA 3H1GA 4JGBA 3V8QA 4CI9A 4LUCA 2AGVA 3S2EA 3QU7A 3HGMA 1SY7A 5IXJA 4Y6LA 3THXB 4GWKA 3PK0A 4PZUA 1MJ5A 2PSDA 3ZNPA 4GPBA 2Q3HA 3KPYA 2GWHA 4NYJQ 4IO1A 1QAOA 1U0JA 2UYGA 1CG6A 1BWQA 3EY9A 4ZEVA 3AILA 3KKMA 1IOZA 1F4PA 3FJYA 4Q93A 4YQFA 3VC1A 4UAVA 4TUYF 3TZ6A 3ZJ5A 4PHGA 4EHJA 4M0MA 1BFKA 1E9BA 4HNUA 2P4SA 3GRRA 2OCBA 3ON5A 4JBWA 2AF3C 3QGMA 1E2DA 3CTPA 3GRPA 4X1YA 3MTDA 1EDBA 1VCNA 1K9VF 3CB4A 5E9AA 3TRIA 2PD3A 2ZITA 2H7CA 2J09A 3L49A 3EIUA 1TF5A 1X70A 3LLVA 5JS1A 4M3NA 2J3JA 3H4TA 4C43A 2B8JA 4IDFA 4R2HA 3ZKWB 5F9HA 3VHXA 4N7BA 1Z7BA 5M04A 2X0RA 3CZRA 3JCZA 2GXQA 2VAVA 4GT1A 1Q0RA 4R05A 5BORA 4D5GA 2JGDA 3C6KA 5LU8A 4U7DA 4D25A 1R5BA 3IHLA 1WXHA 3SC4A 1NIPA 1FYFA 1QC5A 3NNNA 4CG0A 2YKGA 1NI3A 1MABB 4DJ5X 3EBLA 1RFGE 3EZLA 4XB2A 9ATCA 2WV7A 2HJWA 2HMUA 3QEBZ 1YF3A 1F5NA 5CG1A 5ESWA 1FYDA 1WCIB 3AHIA 2YASA 2YMLA 4UBLA 4GMXA 4J1TC 5JH7F 4OQXA 2GEKA 3ZIDA 3B1ZA 2BFNA 5CJPA 3ES9A 2Z0MA 1USGA 4TT8A 4K05A 3JVEA 2CXNA 2BHTA 5AICA 2JAOA 4M1EA 2IRWA 4OTZA 2N46A 4JB3A 3LGAA 4RF2A 5CHYA 4QUJA 3R7AA 1WCXA 5KX5A 4L8VA 5IJWA 2CJFA 4X1IA 2ECPA 2VSYA 3G3EA 2I3BA 3HXTA 3E3LA 1JR4A 2ZJAA 1MQ8B 4Q1BA 4WI1A 4EHAA 2F3UA 1DVRA 4QWWA 4ITVA 1VXRA 1U2TA 3L1HA 3DYBA 5JAIA 2ZTVA 1IK4A 1GTL1 1NRIA 2HSGA 3W7VA 1IBKB 5JPCA 2P4HX 3DKVA 4J0DA 1ABFA 1JEJA 2AE1A 1Z63A 3GLQA 1GZ3A 3K1ZA 2CYAA 3LO8A 3NV9A 4M1SA 4NZMA 5FT9A 1OB5A 1Y9DA 2WMOB 2D1YA 2ADOA 4CMCA 1QTQA 3TO5A 1FBNA 2PX2A 2ZRKA 5BT8A 5K0ZA 2B25A 2AN5A 2R62A 4HYEA 4JDUA 1I51A 2HA6A 4ND6A 2PYZA 4BHTA 3TBKA 2POQX 2PCLA 1OYWA 2UXCB 5LBUA 5A6SA 4Y0VA 5B2ZA 1KSHA 4KE8A 4L72A 1IOWA 1PG0A 2WHPA 2HIHA 3WHKA 4M7WA 3T7RA 2JFOA 2IH4A 1SHKA 2DGDA 1T5SA 4KIFA 4RDXA 3G89A 2QVBA 4F9FA 2WUGA 1LLDA 4B35A 1RCUA 2Z57A 4HLNA 2PK3A 2WUVA 4NENB 4AS1A 1E0AA 2P4QA 1CEQA 1E7MA 5CEJA 2BGMA 3QOYA 1M7GA 1B93A 2PZJA 4D4HA 1C30A 1KPGA 3BK1A 2CLDX 3IIIA 4P98A 3L7JA 2V58A 5CB6A 4CIBA 4NE7A 1NNSA 4FGZA 4MYTA 2KS6A 5L6LB 1MAVA 1OWMA 1VCOA 4QOEA 3WSVA 1NV9A 1A2QA 3PPWA 3BGVA 4L9SA 3I5UA 1WD7A 2OXRA 2ZR8A 2IVFA 1F2VA 2I54A 3U0BA 2VCHA 4YRJA 1RS0A 2GM3A 1VCMA 2CLMB 2O50A 3ESDA 4QGFA 4Z9FA 1TJ3A 4YXFA 5A3QA 2DZDA 1M54A 2ZVQX 2VHCA 3WLAA 1PZGA 3H6KA 5E6SA 4L15A 1KL7A 3UHOA 3IXLA 5DIZA 4GFDA 1RYNA 3IBTA 4KMOA 1VKZA 1WF6A 2PKYX 3RVKA 3ZY3A 1Q6ZA 2I78A 4IOLA 5BSWA 4PNHA 4UNIA 3WA7A 3R5KA 1TTHA 1VDMA 3OJ0A 1QQ7A 1Y5LA 2C9BA 2WF5A 1XQ9A 1IE3A 1Z5WA 2GZDA 1W6UA 5AI6A 4ENPA 1XZMA 1CE8A 1LX7A 1OZAA 3BSFA 4B4VA 1J9EA 1OH7A 4IFIA 2H29A 2QRVB 3OO0A 2OXEA 3AG6A 4RKFA 2HPAA 2WA1A 3L0OA 3J81A 3O4RA 3F9CA 3RUCA 1D09A 1Q50A 2QX8A 3E9ZA 3J7TA 2ZVJA 3R1IA 4O29A 4ZXFA 4DLZA 2XZOA 2QPLA 1LPOA 3KETA 3R8FA 1ECLA 4BC0A 2IHZA 3DM5A 3MAJA 3EAQA 3VKFA 3BREA 4C5BA 2JFVA 1BGXT 2XCQA 4W6ZA 3VZCA 1LPBB 1OZ0A 3K0HA 4MW4A 5ALEA 1Y6FA 2QTLA 4OQMA 2QVXX 2VHVA 4P7FA 1V3TA 1L8OA 1C9EA 3IUYA 3C6MA 2HXSA 1VZ2A 2YBEA 2Z2IA 3KQLA 1UZMA 4Q4LA 3E6AA 3Q3CA 5HM8A 5A5VA 3C8HA 5TR9A 5DTEA 5BVGA 3NTQA 2UUBB 1HRDA 1DBRA 2GZSA 1DQNA 4QYWA 4DC9A 2A0XA 2JGNA 5IH7A 1FRFS 2FX5A 2RCYA 2JBAA 3CCCA 3PVSA 1FS5A 1BFDA 1W88A 2XNKA 4A23A 2PFGA 1H3FA 2Q0HA 3CLHA 2Q5LA 4DR1B 3DF7A 4OQPA 4TVBA 1L4UA 1ZJJA 2GHRA 3GCWA 2NUAB 2BTQA 2WE7A 3RNOA 2O06A 3DTVB 1UBUS 1QHGA 1RJFA 1T2EA 1VSQA 3HCOA 5FNVA 4WBNB 1KEEA 3FGPA 1IM2A 4XM0A 4GOLD 2MR6A 4LY6A 4Q3LA 2OSBA 5E1BA 3UBMA 1BMDA 5JD4A 3JQ7A 2IYQA 4G0XA 2YY6A 2C5AA 4BO4A 4ZHQA 3M49A 3KTFA 4C7MA 1COWD 4DCJA 3H18A 4HKTA 4E13A 1GAJA 3FOBA 4PAWA 4RF3A 3GRUA 4HMPA 2A0FA 3FR8A 4X1KB 2A5JA 3T06B 4C4XA 3USCS 1H93A 1OI3A 3T1OA 3W1EA 3HCEA 3AJRA 4HC4A 4XOUA 2MINB 1M1YA 1VPTA 4R2LA 4TX1A 1BE6A 1IU9A 2QT0A 3Q3GE 2VCEA 4BUCA 1W85B 2ZSFA 1E1MA 4PTYA 1DBIA 1FRNA 4C0JA 1T15A 3AUAA 3HDYA 2OAP1 3AEQB 2O4CA 5DB4A 3SSNA 1E1CB 1WS6A 2ADMA 4AWXA 3PNVA 4DN6A 2PL9A 4L8LA 1IXKA 4REQA 2GS9A 4BE7B 5BUSA 4I9GA 4ZAWA 3F47A 3MC1A 5JCPA 5HVNA 2BFCB 1ICEA 1MV5A 1XQ6A 1XT6A 1KZYC 2BM0A 5HTOA 3MOIA 1SXJA 4N3NA 3OTWA 1T3LA 2QVYX 3WXBA 4DJJA 3SN6A 4FYKA 1BU5A 2H0AA 1OZGA 2FE4A 1D2RA 3FYUA 3GY0A 4IWYA 4H9GA 4JB8A 4J4TA 3PDIB 4HZUB 3JQPA 3ZGZA 3QJYA 4JI4B 3C87A 3IUQA 2O3SA 2WKSA 3PDCA 1P1JA 5GOZA 3W78A 1CQXA 2GF0A 3LYLA 3NYQA 1TAGA 3AEKA 1K63A 2UVDA 1V35A 5JLAA 1MXHA 2G6TA 3E4DA 1FFEA 4DLTA 2R47A 4NSNA 4RM3A 1ADBA 3FYCA 1XROA 1DDIA 1SUFA 2YRFA 3JXEA 1G16A 3HDHA 4RD0A 5HM6A 1O0BA 4MDEA 3JZMA 2E0IA 4D02A 1WZUA 2C8VA 4YCNA 2HJHA 4AMZA 3CLTD 1SR8A 3G23A 3N8IA 1Y5IA 1ATIA 3PI7A 3PX7A 2FK7A 2YQ4A 1VLHA 2BAGA 1P4SA 1T6NA 1P39A 3DYIA 2P2DA 3Q6NA 4OUDA 2V1XA 2VI5A 4URXR 2I6TA 1VJ5A 5JQGF 4HV4A 4C6TB 2DPMA 1POWA 4IDDA 3WMEA 2FDXA 3AESB 4J1SA 4MUAA 4RPKA 5JSYA 3GVIA 5C7OO 1F2UB 1L4FA 1O8CA 1ZUD1 4FKZA 2QZJA 2RH9B 1O2DA 1EDOA 3DHEA 2WJIA 3LLUA 3L18A 3PC8A 3AOEA 1ZL2A 2FKAA 3T41A 4QU8A 1I5OA 3BA6A 3IP3A 1OBHA 3R5FA 4P4NA 1R4MA 4PW0A 1U8CB 3BB4A 1UODA 3N2LA 4U5XA 1OFTA 2B4AA 1HRKA 1W9HA 2CVFA 4NZZA 5EJMA 4D9BA 2YWDA 2OBMA 1J8QA 4JU9A 1KMMA 3HP1A 5BQPA 1NVVQ 1NA5A 2QTNA 3CNEA 5ECWA 1XCJA 2M6KA 4ZD6A 4UU1A 1RWNA 4YAJA 3IBCA 3ZX5A 4EPYA 4F1JA 5JC1A 5AW5A 4CQMA 4LY9A 3B1JA 1JA0A 5CLGA 3AHDA 3H1AA 2FW9A 1AT1A 3HCNA 1BWPA 1VJCA 3SZRA 5J2UF 2R8YA 5MFZA 1M2WA 3IJ5A 5FBZA 4E5YA 1ZY2A 2PMCA 2V45A 4FP9A 4BYMA 3UANA 3VC7A 1KZGB 3ER8A 3AL0C 2HI0A 2XCIA 1X80A 2JVJA 5CM2Z 1PFUA 3AB3A 4AO8A 4XWKA 4MUXA 3A25A 4QRIA 1V3QE 1OXVA 3LUCA 3WHPA 1A2OA 2GAIA 2ZRIA 3IQHX 5HIKA 5BWCA 2O6LA 5CXQA 2DFTA 4L3VA 3WGQA 1ZYUA 1PT7A 1RQ2A 4HD8A 2YS6A 3WGNA 3IODA 1DIGA 4LFAB 1HDZA 1L3CA 3LBNA 4FD3A 4N1AA 5KTOA 4RTLA 1PRYA 2GAAA 1FUYB 4PX2A 1OFCX 4FYYA 3OY2A 5IARA 4GX1A 3IHKA 4AN4A