4D3YA

The structure of inactive prolegumain from chinese hamster.
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
404
structure length
384
Chain Sequence
GKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMSPISLPPVTRLDLTPSPEVPLTILKRKVGQIQRLLDARHVIEKSVHKIVSLLAGFGETAERLLSERAVLMAHDCYQEAVTHFRTHCFNWHSPTYEYALRHLYVLANLCEKPYPIDRIKMAMDKVCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
molecule keywords LEGUMAIN
total genus 139
structure length 384
sequence length 404
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4d3yA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3yA01
3R6LA 2QLFA 4NBNA 4FEAA 4AWAA 4EHAA 2QL9A 2XYPA 2Y0BA 2XYHA 4N6OA 2QL5A 5IARA 4DCJA 5IANA 4PS0A 3NKFA 4JR0A 3GJTA 3R7NA 4QTYA 5IC4A 3GJRA 4D3ZA 3DEHA 5LUBA 4NOJA 4FXOA 5IBPA 1BMQA 4ZVTA 2CJXA 1I4OA 2QL7A 1K86A 4FGUA 4N5DA 3H13A 4D3XA 1CP3A 1NMSA 3H11B 3PD0A 4DCPA 1F9EA 4JR2A 4EHHA 4EHFA 3V6MA 2H4WA 2H54A 2H5IA 1ICEA 2H48A 3ITNA 1RWPA 5IASA 4LSZA 3QNWA 1GFWA 1KMCA 1RHJA 4IYRA 1RWMA 3R6GA 4NBKA 3S70A 3KJQA 2Y1LA 4D3YA 2HBRA 2WDPA 3H1PA 4HQ0A 1RE1A 3PD1A 4AWBA 4EHDA 4QUDA 2FP3A 3S8EA 2J30A 4DCOA 2K7ZA 3KJNA 3D6MA 3NS7A 4QUJA 4ZVSA 4NOKA 3H11A 4JJ8A 4QUBA 5IAKA 1SC1A 4N7MA 5IBCA 4QU8A 4EHLA 2C2OA 1CVRA 2HBZA 3R5KA 1NMQA 3R5JA 3V3KA 3SIPA 4PRZA 2NN3C 1RHKA 4I1RA 4JJ7A 4EHNA 1QX3A 5IABA 1GQFA 4PS1A 4QULA 4QUIA 3V55A 4FDLA 3V4LA 1RWVA 4NOLA 3IBCA 1SC4A 3KJFA 2C2MA 1SC3A 2FQQA 4QU9A 4QTXA 5IC6A 1RHMA 3EDQA 1I4EB 5JFTA 2FUNB 3UOAB 1RWOA 2CNNA 2CDRA 3DEKA 4ZVUA 1K88A 1PYOA 2XZDA 3R7SA 4JJEA 1RWKA 1PAUA 3R7BA 1RWNA 2J32A 2J33A 2H51A 4N6NA 3V6LA 4ZVOA 4N6GA 1RHUA 4HQRA 3OD5A 4QU5A 2XZTA 5LU8A 3K7EA 4NOMA 2HBYA 3E4CA 3PCXA 4HVAA 4EHKA 3RJMA 2P2CA 2H65A 3BIJA 5I9TA 1SHLA 3GJQA 5IAGA 3D6FA 4IEFB 2C2ZA 4AW9A 3DEIA 3D6HA 1RWXA 2H4YA 2QLJA 1RHRA 1I51A 5IAJA 1RWWA 4EJFA 1JXQA 4JB8A 4QU0A 3SIRA 3H0EA 4ZVPA 5LUAA 2J31A 1QDUA 1SHJA 1IBCA 5IAEA 4JR1A 5I9BA 2CJYA 4ZVRA 2CNOA 2AR9A 1M72A 3NR2A 2C2KA 3P4UA 3P45A 1QTNA 4N7JA 4ZVQA 5H0IA 4NBLA 4I1PA 3IBFA 4JQZA 4QUEA 1F1JA 3UO8B 2CNKA 4QUAA 3EDRA 1NMEA 4M9RA 5IBRA 2H5JA 1I3OA 2CNLA 3GJSA 2QLBA 4PRYA 3DEJA 5LU9A 2DKOA 1NW9B 2XYGA 3V4OA 4JQYA 4QUHA 1RHQA 4QUGA 2HBQA 5K20A 2C1EA
chains in the Genus database with same CATH superfamily
3U0VA 3BB3A 1G8KA 4H59A 5IARA 1KO8A 1AKQA 1WV1A 2PSSA 4P2BA 5KPDA 1RPAA 3CBQA 4KN5A 1XRPA 3MCWA 1TWCA 1DQNA 1U7ZA 1UBEA 2FHPA 4WQMA 3QVVA 4D9HA 2SKDA 4ZVTA 2R1ZA 1JZTA 2Z6VA 3JVIA 1Q84A 2P30A 1UDCA 1U2DC 1M2VB 4JR2A 4BWYA 4CV0A 1YDEA 2H54A 2H5IA 4JEIA 3EIEA 4OKSA 2ZSEA 4ZAWA 3I01M 4S3MA 4E4YA 1WZCA 3OY2A 4MA5A 4TVKA 2BP7A 4A7PA 5C4MA 5JXWA 2DFNA 2M1XA 5KX5F 1AGYA 1LLQA 1MO2A 2AEMA 3OE7A 3R09A 1AN9A 2IZ5A 1YAHA 2MT9A 5TJ9A 2OO3A 3RARA 2D5BA 2Y77A 3CIFA 2XLCA 2PHZA 2I65A 5BV1A 3ESRA 1V16A 2GBLA 4FILA 1SC6A 4UU1A 1NBME 4S1VA 1OAOA 5J40A 3RBXA 4AZVA 4EI2A 4NBRA 4AY5A 4F3YA 3PLRA 1PGQA 1KIFA 4MKGA 3EHEA 1KZHA 2X6RA 1Z5OA 2QE7A 2EARA 2A7QA 1Y6RA 4TN5A 4AG5A 3KEGA 2PLNA 1Y98A 1WXHA 3FYHA 4XCXA 5HFAA 3H9QA 3WK4A 3BD6A 3L8CA 2WD8A 4I6JA 3WMWA 5K05A 3L4KA 3QE4A 1KI6A 2PMCA 1MIOB 1TX4B 2Z9DA 4HYQA 1C1DB 4DUGA 2C5LA 2IV3A 1IUNA 2XRYA 4J1QA 3C2QA 1E9EA 1FMJA 3RVOA 3WV5A 2JGNA 3RJTA 1A9OA 2WQ7A 3NFRA 5CX1B 4NK4A 1ZR2A 5L8VA 3WKCA 2XW6A 2YKGA 5CFLA 2FCAA 4U7DA 2IYYA 4H17A 5IS2A 3BA6A 4KR7A 3I30X 3ORFA 3HWX1 1FFHA 1NBMD 1B8PA 1G41A 1QRTA 4J49A 3TNYA 1HE3A 4E12A 2WTBA 1I9CA 1PR1A 1WUTA 3BH6A 4X44A 2Y6UA 1RI4A 2C07A 3GIDA 3FMIA 4ND3A 3EXG2 3SJ7A 1TM3E 3T5BA 1MQAA 4DLXA 1WMEA 5C3MA 4QDUA 4CEHB 1MC5A 1ZIXA 2YYAA 2FZGA 3CUWA 3IUEA 4IIJB 4J0JA 4OBBA 4X45A 4ZEXA 5FI1B 3VU0A 3WIDA 1E6EA 2PWYA 5D5HA 2AFIB 4C14A 3L7NA 3AH8A 2WNHA 3E22B 4HLUC 1G4UR 4CCWA 1APBA 1TI7A 1RYEA 4Y18A 1QQAA 5KVSA 3L9XA 1J6UA 4EB0A 2FG6C 2FCRA 1EM8A 3LPNA 2BVNA 3SBDA 2FY8A 2W6PA 1EJ2A 2P1DA 2RHOA 4OHZA 5DXFA 3JQ6A 1I6MA 4RUKA 4X1YB 1VG0B 1YQ9A 5IBRA 5KQGA 4YJFB 3VZBA 2WV9A 1J5PA 1X13A 1CUGA 3CNHA 3IB3A 4QVKA 1ZIPA 4KVZA 2P6PA 4H77A 4DIEA 2GZMA 1FYEA 4PLFA 1NVFA 5KX5A 2A67A 3QQ5A 4U2BA 1ZJ4A 1K8RA 5AJXA 2QUBA 4ENVA 3L06A 3I32A 3QWIA 5LXTA 5CG2A 1NAHA 3C8MA 1J24A 3PJFA 4GBMA 2BV3A 3N75A 3QU9A 1LDMA 3L82B 4CM6A 1VA4A 1FXSA 1Z4OA 3LUGA 4Y2PA 3EUWA 1SBNE 2VH1A 2AZ4A 2X5OA 3MJVA 5DIZA 1T0HB 5DT2A 4YAEA 1DD5A 4TXJA 5KO2A 3PVCA 5CJ2A 4CMAA 5B1YA 3CF0A 5J4YA 4AS2A 4ZAYA 4BX8A 3I9OA 3G2OA 1XJ5A 1ETUA 2HFJA 4MMZB 5JE8A 3HXLA 3NYWA 3R7AA 3RF6A 5CT6A 2Z8ZA 3ONFA 3P2MA 2JLYA 2VP2A 1BQEA 5I3ZA 1IK4A 5JAIA 2QY9A 2JC3A 2PRYA 1UJNA 3BFVA 4I3FA 4P86A 3WHKA 3J81A 3D6AA 1U0TA 1UXIA 4WNAB 4R0MA 5KNCH 4MDEA 1HT1E 3EHDA 4LZOA 2OGUA 3P9SA 1C3JA 3OZXA 5THKA 2G4LA 4KRGA 4GX5A 4Q21A 1RBYA 3GLHE 4YONB 5ALNA 1RE0A 3U7IA 3UMGA 3ICOA 1MENA 2J7KA 2ZIUB 4Z4HA 3RJ5A 4N41A 4G0QA 1VQ1A 2HAEA 1Y6FA 2IS4A 2HU2A 1VG9B 2XMGA 3HKEA 1DJMA 2O57A 1GTZA 4MB6A 2J5BA 3L0CA 5K45A 3A0RB 3D9QX 2ZSDA 2WWVD 5HIAA 5JADA 1YJXA 2YWCA 5TJHA 3W5HA 2XOEA 1CD5A 3V42A 3CVOA 4GMFA 4ND8B 1IUKA 2OESA 1O95D 4TGLA 3TAXA 4BNDB 5B55A 5LQCA 2IBSA 1YL6A 1GPLA 5EKUA 2IH5A 3H1FA 3N0RA 4Y2GA 3UXEA 1V35A 2BGTA 3N05A 4K9LA 3B52X 2EL7A 4W1SA 1LZKA 3WQSB 4F2GA 3SQXA 3KSAC 1RWOA 1ZUNB 2VRBA 3MD0A 3V9AA 2NU9B 3R7SA 1E6KA 2QVYX 3RSOA 2BUBA 2VHYA 2QM7A 4GZLA 1GT6A 1HKHA 4ZQCB 3HXTA 1VLQA 3RIEA 2JGKA 1AUPA 1G6KA 2A9RA 4RJTA 1D4FA 3RAJA 4U7PB 4N6GA 1RHUA 3CN7A 4BLOA 4UE3S 1F7UA 1RTKA 6Q21A 2O3JA 1RJDA 3ESQA 2Y1WA 2A9JA 4MEJA 3PTLA 4DLWA 3KOMA 1UBHS 4AIRA 1SOMA 2WVGA 4WTOA 2L42A 3IQEA 4Q4AB 4TROA 3NHJA 3QWHA 3S99A 1IQ0A 3OOWA 2UUBB 5LDHA 2Y4NA 4YJKA 3WS7A 1TA0A 1FS4A 2PSEA 3JSXA 2WM2A 4UCXA 5KC9A 1YKGA 4LQLA 3RTGA 3HP1A 1I7PA 3ZQJA 4BN4A 3Q85A 1EDOA 4QNNA 4DQVA 5LUAA 2HW8A 1JPJA 2GK3A 2J3QA 3DM5A 4B8YA 1E98A 1TQDA 1W76A 2JIBA 4W99A 5IAEA 1JSXA 3T0FA 2GHTA 4ZYLA 2Y76A 4NZYA 3NR2A 4JLNA 1QP0A 5KTKA 4N7JA 4XPZA 2CWWA 3AKZA 4MQ5A 4NEQA 4OM8A 4Y1RB 3AOEC 2NNLD 1GR0A 3WWZA 4D41A 1EDEA 1KY2A 2Z1MA 5B6PA 2QW8A 3CQZA 2JJ1D 3DOCA 1L7AA 1OIVA 4P3YA 1V11B 4J2OA 5H3LA 5JCJA 3D5TA 3ZYZA 2QTNA 4R1QA 1KS2A 4B17A 2OFXA 5AR1A 5HGJA 4LKOA 1SBQA 2BI8A 2FP4A 4GE3A 2EFYA 3KPUA 4FDTA 4N12A 2OBXA 5IUNC 2J0UB 1E1QD 3VFDA 1DJLA 1D6MA 1ECBA 1ZIOA 3HCWA 4F5YA 5JNTA 1BOFA 1XEAA 1UAYA 2NP7A 4C04A 1ABBA 4CIYA 3O31A 1R50A 5AKJA 4DXDA 1SXJD 4BN0A 1XJQA 1QCZA 4GW3A 1N3IA 3C24A 1U9CA 4L73A 4YCAA 5DM1A 3FJ1A 5EXPA 5BNTA 1WG8A 4LRUA 1GP2A 4IZIA 1F51E 4D43A 2P4UA 5FIUA 4X92A 1AKRA 1JB9A 3P0RA 4J0IA 2X4GA 3ZOKA 1BKYA 4D8TA 3H0KA 4IDOA 4UJ3A 3VU3A 4BB9A 2CBGA 4XD7A 5EMJA 2IELA 1B93A 1IQRA 4FQ7A 4MVJE 4XGKA 3D4IA 4IHJA 4H9GA 2ZCJA 221PA 1WXEA 1I4TD 2IY9A 3T0GA 4R7GA 3RYCA 3U6KA 4HB2A 4YA6A 3TLKA 4EA8A 4H31A 5I4CA 4KX5A 1OH8A 1DAHA 1CZNA 5AM4A 2DBRA 2QP9X 1J0XO 1EK2A 1ZOLA 2HHAA 4OYYA 3K20A 1C0IA 1VJTA 2OFWA 1RRPA 4MKZA 4DMRA 2W6QA 2CVOA 3KQQA 3AESA 3AZQA 4NARA 3UJBA 4ED9A 4WCFA 3SXUA 3WMGA 4CM4A 1DE0A 1WSDA 1AGPA 1Z12A 2ZJ2A 2DERA 4JX8A 5AW5A 3WGIA 4TYMA 4FI3F 4BX2A 1MNAA 4YLEA 1F7VA 1U3UA 3QPCA 4U39A 2JFQA 3RCBA 2O2GA 1HLPA 1R0ZA 4I5IA 1KARA 3UMJA 4C6TB 1TECE 4OQNA 5LZ9A 4B6FA 4QO7A 1JDVA 2HPZA 5B37A 4YRBA 2AKYA 4L6CA 3O21A 5BY2A 1M2WA 4C01A 2Y1EA 5EE3A 1IWBB 1KDRA 3M1IA 3NDJA 4DWOA 3I8OA 5DSZA 4FBGA 1E2GA 1M0WA 4DLYA 5GZ3A 1L8XA 4IDPA 1Y0BA 4LF7B 3D7LA 1RWNA 4RMHA 1OFGA 3FXAA 3IAXA 1IXYA 4ZCPA 3V1LA 4YB8A 3E0XA 3OO0A 1VL5A 3KM0A 3LOUA 4QRDA 4AMGA 2FU5C 2Z56A 4L76A 2YFKA 4FI3C 1JHZA 1XQ9A 1NMYA 1J1ZA 2TECE 2WHPA 3KHSA 1UDBA 4WD3A 1SEPA 1N1GA 3TQSA 5AI8A 1BS2A 4GFDA 2AX4A 4N0PA 2OG1A 1OB2A 3GEGA 1MHPA 5FR2A 1SXGA 4R16A 4MHSA 1Y89A 3LD9A 3U7GA 5H81A 4JBHA 3OAAD 4HOYA 2H9AA 5FOXA 1C50A 3TLGA 5F7XA 1T4BA 4EF5A 1H4QA 1U8AA 1HX7A 1MRNA 2Q8NA 3P45A 1K8XB 4WFQA 4DNFA 4NNOA 1Y81A 2WJAA 1P39A 3PL1A 2CJWB 1ZM2A 3IP5A 4I50A 1J22A 3FPGA 4NG5A 5KKAA 3QUSA 5C1IA 5TIIA 1Z2PX 1L5KA 2Q1YA 4KPFC 4ML3A 4JDUA 2FEKA 4MVWA 3KU4A 5KIAA 3B6ZA 4ZGWA 5DN9A 4L2IB 3CRMA 1QZTA 4EMUA 1IRXA 2XGGA 1RHQA 3BERA 1QBKC 1T9BA 1XTQA 3ZWNA 3EOAI 3NHMA 2XVMA 3R6LA 1R0RE 4N9WA 1QQ5A 2QS9A 2Y0BA 4B35A 2D7DA 4BPBA 5GVRA 4EFMA 4I4LA 1NJ1A 2AVDA 3DFUA 5IC4A 4MAMA 3LX6A 4D96A 2XHEA 1E6WA 1F3OA 2EQBA 2J67A 2P4EA 4NBVA 4PF1A 3LXMA 1Y8CA 3GY0A 3T5DA 3WGLA 2FWBA 1HEYA 3OPYA 2CJXA 2CB0A 3C45A 3ROZA 1IVSA 4BEVA 2AN5A 2IIPA 1OX4A 4RJKA 3B9PA 1FRZA 1GTMA 3UH1A 2CDNA 2ZRQA 1X14A 1HH4A 4RHXA 4MRMA 1P8AA 2EP7A 4QYIA 1KMQA 1ZJ5A 2XR1A 4MW1A 2LDBA 2AK3A 1PDVA 2Q4BA 3GAAA 3MOSA 4BVJA 4YJ2B 1XEWY 1S7CA 4P3OA 4CR6A 2XQJA 3HN6A 3PXGA 2VTKA 4CNBA 1KJYA 1TK2A 1WBJB 2Y1DA 2PH1A 1L7OA 4FBMA 1E4OA 1NW8A 2HXGA 1QLHA 4MX8A 5B57C 4OGFA 3PUYA 1CEEA 4PSCA 2HLNA 3D4NA 3CPHA 5FBHA 4MVJD 3U4HA 1Q0RA 4HGNA 3A6KA 3H1GA 4GOKA 3FGPA 2PPVA 3IR6A 2HM7A 1GVNB 1OC4A 3NONA 4JNCA 1BEEA 1O4VA 1UL1X 3DMTC 3IAS1 4HXYA 1GA1A 1XR3A 3R3ZA 5AOVA 3UXYA 1BYIA 5JFOA 4WKNA 1DIGA 1XTIA 3DFMA 1G3RA 1HO3A 3B5EA 4BNDA 3WFZA 3SU8A 3U7JA 2CXQA 1NT2A 1EFAA 2I7CA 4WNYA 3RHSA 1W581 4CL0A 1UMDA 4KO1S 1NH3A 1OGYA 2BHSA 2IOFK 2YBDA 2H6EA 5JDCC 3V8PA 3HU1A 3QUBA 4Y2TA 3NHSA 2D54A 4GOND 2GCNA 4IKOA 1DMRA 3VR6D 4CF4A 1SURA 5A1JA 3E1GA 2BEKA 1S6YA 2VN8A 4ND8A 1KH1A 1EX9A 3P9NA 3BL6A 2B4RO 4INAA 4JJ4A 1ZNXA 3LQYA 4B32A 5CCDA 1OI2A 2H1CA 3A6DA 3PK0A 3ZU6A 5I9NA 4HG2A 3JAMA 4HB3A 2PRJA 1F5NA 2PGOA 2J59A 3UJCA 3Q11A 2H65A 4IWNA 1FRFS 4ZOLF 3W8FA 1CZRA 5E0KB 1YACA 2WAOA 4MV1A 5BSMA 1EDZA 1FE8A 3JQDA 2QD3A 3TR5A 3KD2A 4KB5A 2EBUA 2C1ZA 4C87A 4QQFA 8MHTA 2G8LA 5FNVB 1ZYUA 1BXGB 5KWSA 4EUEA 1E94E 1JMKC 4L74A 4U0KA 4BBPA 4BX0A 3B36A 1DI0A 2QSJA 1U0OC 3DT6A 4GC9A 3SMQA 1L7XA 1NU6A 3K1AA 2ECOA 3N8NA 5LYJA 1PZEA 3W9UA 4DCMA 2YWJA 4FIDA 3CR3C 3CVUA 5TEWA 2HJHA 4TTSA 5A03A 4U2DA 4I1YA 1ECLA 1PX2A 2IP2A 3CZ9A 1BYUA 1TRHA 3K5WA 4KQXA 3TM4A 4ZDKA 1UQUA 1UJMA 2VHXA 2ZSJA 4P7JA 1E2PA 1E9AA 1UBRS 4IVRA 1SUPA 2EQ5A 4OH7A 4TMYA 4UCFA 4X1OA 5EMNA 4QUHA 4AMBA 4ECEA 1Y698 2VT7A 4ALKA 1PL8A 1WUYA 2ZETA 3QELA 1W0KA 5G4KB 3RH0A 4LBWA 4H16A 1NURA 2PBFA 1M5TA 5A0FA 4ARAA 4CKCA 1SR8A 3S1LA 4JUFA 3SC2A 5AVQA 1OXMA 1M2HA 3IVAA 4FUQA 1DXYA 1Z4JA 2PCJA 1J23A 3EZNA 3PQDA 4PTLA 5ALDA 2HQ1A 2ZS8A 3AW8A 1O2DA 3EGCA 3ICEA 4V38A 3S6JA 3FWYA 3SYKA 3BMOA 4HDQB 3F6YA 4RWEA 5SZIA 3EA4A 1S3GA 3E9RA 1WQGA 1ZRHA 1S9DA 2X8JA 2BHTA 2W2XA 2W7TA 1Y1PA 3L8HA 2PG3A 3HJRA 3G0DA 4CLRB 4P4NA 3VHRA 1PX0A 3WLTA 2O20A 3DDNA 4YREA 4LE1A 4C88A 1N77A 2NQ2C 3AB7A 2C0PA 1R6DA 3CX8A 1DKRA 2R6R1 4GF5A 4WOCA 3R75A 2FW0A 1CZUA 3L8GA 3SEQA 4EQ6A 4YMIA 2YZMA 4DIMA 1YONA 3FR7A 2FZLA 4JX9A 1LPAB 2W2OA 3NEYA 2J3KA 2K2QB 3P5BA 1A2KC 1AUQA 2FZWA 2Z4TA 2H92A 3DBVO 3HVIA 3OM9A 4KE6A 4A8TA 4PYJA 4M9UA 4C08A 4EO4A 2AJDA 3IDQA 4AJKA 1WUKS 1WW8A 5BQOA 3FMVA 5G0UA 2IXEA 1YR1A 2Y1OA 3OMXA 5EGSA 1Z8NA 3VSBA 4EGCB 3IPAA 1E63A 1XCJA 1FUIA 4GLJA 4DBZA 5FTNA 3VR4D 4WUVA 1EJ9A 5AXCA 3JR3A 1A3CA 4NMMA 1H0KA 1ZHOA 1PV4A 2LCIA 3FPLA 4MR8B 5AWFC 1XNRB 2F43A 2WSIA 3BGWA 1Q1EA 3H5IA 3GW8A 1GZDA 4X61A 2D0OB 4G1CA 3HXQA 1WSBA 1AKWA 3B9QA 3PA6A 1RXEA 2CFRA 2HQSA 5AP9A 3BGOS 4GRIA 1U3FA 2YV2A 4YCBA 5EIOA 1FVOA 1NW5A 3OJLA 1VYUA 2R7MA 1VSVA 1XL0A 5AW2A 3ZWOA 1IOZA 3KKEA 4TUYA 3IOEA 3KLMX 1Z25A 1EP1B 3K72B 1X7ZB 3V7FA 2QBYB 5JAMA 3UBMA 1O97C 4BAZA 2FF7A 1WMDA 2JAPA 4JLOA 1W93A 4NATA 2NO5A 3M4NA 3T9DA 3TQOA 1P5JA 1YBVA 1N7HA 2YIJA 3DFFA 3GBVA 2VBGA 6AT1A 2HUPA 2Q29A 5B4TA 2P2CA 3BIJA 1WW2A 1QO0A 2P1ZA 1I7SB 1ORTA 5KCZA 4LW8A 5DGDA 3TRKA 4YJ3A 4GIBA 5J59A 3BMNB 1UBTS 1OLUA 3ANYB 3VKUA 4E7OA 3QEKA 4QU0A 1VIDA 4ZXFA 5DSTA 3AG6A 2VNJA 3T9EA 4M1YA 1R6AA 4DV7B 2IW1A 3OCXA 2WKQA 1GCGA 3CKLA 3ZVKA 3IMEA 4D0RA 1N5DA 1PS8A 2I8LA 1H0HA 4M2LA 2CLKB 1UK6A 2CBZA 5LMNB 1Z34A 3FH0A 1J2TA 5K0TA 1DKMA 2R8OA 3V8RA 1NYTA 2DSTA 1MX1A 1YH3A 1IW7D 2PYDA 2YYZA 3FZNA 5HJ2A 3TLCA 4C4XA 3IQDB 1DDOA 1MQ8B 4D3DA 2JJMA 1YC2A 3HJUA 4JIMA 2NSYA 4RLSA 5E6UA 1OH5A 1FNNA 2QN2A 4LYFA 1IQPA 1CVLA 4UTNA 1H5QA 2ZBQA 3IXQA 2AXNA 1HDCA 2Y05A 5CYOA 1NW9B 2WYWA 4I0WB 3PR1A 2PUAA 1XLUA 4KO2S 4F56A 4HDMB 4M87A 2XGMA 3GC6A 4D9EA 2OY0A 2AXPA 4UHBA 5LP6A 2XVAA 2Q2WA 3LXXA 3AIMA 2C92A 1XLVA 4FHFA 3VAYA 4BEWA 2QL5A 5LOVB 1GAEO 1KEVA 4XM2A 2NM0A 5F3DA 5JNSA 4Y0NA 1XCPA 2AD5A 1K4MA 1TGYA 3GR6A 4UBIA 5AI5A 5KMGA 1VMAA 4ILEA 4J7UA 4UUBA 1ULHA 3LZCA 3K5OA 3RVKA 1EG7A 4L72A 3S29A 5BVGA 2ICAA 1H6CA 1Z6TA 2D4HA 2RK4A 3TM5A 3CGGA 3OQPA 3RHZA 4ER7A 3FWHA 3O91A 2LNDA 3T3OA 2Q9AA 3KNZA 1JKJA 4KREA 3H2BA 4RZQA 4ZV9A 1JTFA 4LCBA 4YV7A 1ADYA 5WRFA 5JWRA 4R8MA 3ZC3A 1R9TA 1J8QA 2GDJA 4LFCB 1QTIA 1PTJC 4MW4A 1ORDA 5DLPA 4S24A 1J9ZA 3TTTA 1CUZA 3PD1A 3DXXA 4U8GA 3VTKA 4IDHA 3A1DA 4U7FA 1N4AA 4GVLA 2MSCB 2YTZA 3D4OA 3OE5A 5AJYA 1JVSA 1GNLA 2HIHA 4TUYF 1DAGA 2F9FA 4H7FA 4NE2A 4B3IA 3DWEX 3ZE2B 2DCMA 1VECA 1QIEA 4YJGB 5ELLA 5G0SA 1SC1A 4M88A 2IXDA 2ODWA 1GN8A 4EMBA 5ILOA 3NIFB 2CMKA 5DYGA 1ZD4A 2JI9A 4FOLA 4BMCA 2IY7A 4E5NA 1S9HA 2AI3A 3HXMA 5C1PA 1MFZA 4K9SA 1JDUA 3PVZA 5AI4A 2L18A 1WRBA 2AYYA 2HQRA 4X5OA 4L1KA 4IRMA 3ONNA 2GM3A 4YJ3F 3ROMA 1RBMA 1V7ZA 1OAOC 1K5PA 2C78A 3MBIA 3W9BA 1RRMA 3D8HA 3EYWA 5IZ4A 2R5NA 2PR7A 5EIWA 2EVWX 4NONA 2LV8A 1II8B 5HDQA 5CB4F 3BMOB 4LXTA 1QCDA 1TKAA 1L4FA 2VJQA 3JQ7A 5CIWA 1AZLA 3ENWA 4FE3A 4KE7A 1IEVA 3K5IA 1DEHA 4L4ZA 5EVJA 4F9TA 1A9TA 3ANSA 3O0DA 5H7XA 2BSXA 2NSLA 2VAPA 4OU4A 2GYUA 3SHTA 4FFWA 2DHQA 3EVGA 1TIBA 1U9IC 1FFSA 4V3CA 3EF0A 2WJYA 3GTMA 3AERA 4Y2QA 4EAQA 2Q2OA 1UT5A 2ZIEA 3BTUA 4N5LA 3HZOA 3FAZA 4PY2A 4JMLA 3R7LA 1NFQA 2J41A 4GT1A 2F43B 1CY2A 1OU4A 1PFUA 3OLZA 4Z4GA 4CMGA 1N5KA 4JLWA 2PS3A 4X00A 4QG7A 1PR3A 3W7VA 4TQUS 3K8OE 2PFSA 5KQLA 1FTGA 2IJGX 3EF1A 2O8FB 1LI7A 1R1DA 2YFHA 4XGNA 5K0SA 1HDGO 1VE6A 3BWYA 1TIPA 2W0SA 3BG5A 5J2UB 1E8NA 3UIEA 1B8OA 2UUAB 2DECA 3IBTA 1E5LA 5D51S 4L5JA 1TADA 3INRA 4CT4B 3ESAA 2OORC 4FFOA 4X8HA 2AHRA 2QK4A 4O4JA 1IBSA 3MM4A 4GLOA 2YH2A 2CNLA 3NEAA 3OJWA 2GR9A 3C3AA 4MP6A 4ZQGA 1UDAA 1G9SA 2VPYA 2KS6A 1IAVA 1Y1RA 1Y1KE 1Q0HA 1TKRA 2X2PA 1PLKA 3BHIA 4TRNA 2OYRA 4QASA 2QV7A 3CIOA 4NPCA 4U6SA 5DI3B 4AMYA 5HS6A 1T9CA 2GAOA 3NWEA 1GU7A 2GD6A 2ENUA 4CKWB 3PTAA 2HSEA 2OGSA 4WT7A 5F51A 3ZZNA 1P9RA 2IHNA 2D62A 4HFJA 4R8RA 4B5LA 3SKVA 3GVCA 1E7MA 1HDIA 2CXTA 1YWGO 4IMPA 2O14A 3WSTA 3JATA 5J43A 1W59A 1X7WB 2HY7A 3GEMA 4JLDA 1L4YA 3AUJB 3Q12A 2HADA 1CERA 2E2HA 4P7GA 3H2ZA 1E2BA 2X8LA 4HDRB 4JQSA 4DMMA 4UU0A 1UMKA 1Z0FA 4FGWA 1SBTA 2CY0A 4YLYA 4LC1A 4RYDA 4LPKA 3HBFA 1A04A 4NV0A 4X90A 4BP8A 1V43A 4EVIA 1KKLA 3UJNA 3OQOA 1PFWA 4N54A 2NPOA 3NBFA 4M9CA 3QLEA 3N7UA 3T4EA 1O6ZA 2QTZA 3HO8A 4OREX 3U9LA 4B8WA 3ZYCA 5HQ3A 1DWOA 3WDMA 1TMGE 5KKNB 1CJMA 3JU3A 3UT5B 2CXHA 1AUOA 3PGLA 3UPTA 1YA4A 3HP7A 3HDJA 3ITKA 3NAQA 4BYMA 4M55A 2BDUA 3JD0A 4HEA1 4OHWA 4JGIA 3L1HA 2WWRA 5DE3A 1YNJD 1K8QA 2X5NA 5CBKA 3B8EA 3SR4A 3VNSA 1R6UA 4F7WA 1SHZA 2NU8A 3JZAA 1X1AA 3AR8A 1FNSA 3LLSA 5EQJB 4I7EA 1RI2A 4PX5A 5K8CA 4NTZA 1CB0A 1GSIA 4O4IA 1IWPB 2CNDA 2JGEA 2YJZA 3SWWA 2ZSFA 3RVJA 1GPAA 1JDNA 1A9XB 3EA5A 3M81A 2FPOA 1X1EA 1F2VA 2HMYB 4MRRA 4LYYA 2JGAA 3EQZA 3ORSA 4OJNA 2AMJA 5AW7A 2Q5HA 4Q3CA 5TQVA 2ZSIA 3DZFA 2M6KA 1W94A 2FV8A 4K6CA 1YB6A 2XV1A 4F6CA 1PV2A 4UASA 4BP3A 2D5AA 1MA3A 3VOSA 2UZ1B 1N6KA 3ILSA 4OXRA 2NNWB 2WJGA 3EBPA 3I12A 3NBAA 3L40A 4JLJA 2WG2A 2DLDA 3WIEA 3QLVA 4RD4A 9ATCA 2IYEA 3JSAA 4Y8VA 5F4BA 4YQFA 2YWHA 1XRSB 3ER9A 3CCFA 4LN1A 4XIGS 3RLFA 2F4QA 1XTPA 1YCGA 4A5OA 3P7MA 2JAWA 3PT9A 4HGZA 3TXAA 3IE1A 4IDFA 4WPGA 3HZZA 2I4LA 4XLZA 2X76A 1JHPA 2YHIA 4ND6A 4YUXA 1KPIA 2E5FA 4L8FA 3GK3A 4NDAA 1GU0A 1OZGA 3OU6A 2OV4A 3SC2B 2BT4A 4IBOA 2CDAA 2CEKA 3N8HA 2J07A 3W9YA 1BVRA 2QD2A 3ESZA 1EFPB 1TZBA 3G2JA 3RBVA 2ZI9A 4K9OA 3SE0A 1HE5A 1P61B 1YD7A 4GECA 3IBYA 4JFAA 4AWXA 1OLXB 2HIMA 5IJ0B 3PX7A 4BVHA 1TYDE 4NI5A 4D46A 2GPSA 2D1RA 4XYEA 3QTBA 2QN7A 3FKIA 1OGIA 1SZJG 3SEFA 5G3YA 4B4UA 4PYLA 2HF8A 1LK0A 4LMBA 2VDJA 3L8DA 2YJ5A 4XFJA 4GOMD 5EQFA 1AHNA 2ZQZA 2ENWA 5HDBB 2NUTA 3T35A 3WP0A 2OCKA 1M2OB 3GEIA 3L43A 5DCWA 1P5RA 1G5RA 5CG1A 1M54A 2DQ4A 5C9HA 1M2KA 3WL4A 1RZVA 4ZDIA 1NNSA 3MS7A 3WO1A 1IHUA 3VVCA 2EKDA 2FF5A 1Y8RA 2BBTA 2QAJA 1Q3KA 1PNQA 5A3QA 2HWKA 2XTZA 4DQLA 3NRBA 1V1RB 3AHHA 3SDZA 3TAUA 2H2DA 3ZWPA 2J9FA 4I2NA 1TGVA 3OCUA 3Q3EA 1ZRSA 4FOSA 2QRNA 5HILA 1T25A 1ND5A 2VBIA 4Q7EA 1JDSA 1OVGA 1SHTX 2GNAA 3HACA 3DDWA 1DADA 4S0XA 5CXXA 3VAAA 1QAOA 3LV8A 3JWGA 1TNDA 4LHEA 2OZLB 3LS2A 3V5NA 4J16A 5C9ZA 2H00A 3SJRA 2H2WA 3K0BA 4XX0B 3CY6A 2WINI 3IBGA 1N6LA 1PU2A 3P4YA 1ENPA 4HX5A 4LDRA 1DC5A 4JI5B 3L0BA 3ETDA 1NBIA 1QH0A 3M49A 3USZA 2VYVA 1FDVA 3CRZA 3JWIA 10MHA 1UM8A 2K7ZA 3KG2A 4B79A 1BTOA 3E9CA 2EJBA 4BQPA 1ZGHA 3QIAA 2P9BA 5ALLA 3VMMA 4W5RA 2ZBRA 4QWWA 4IWYA 4XUCA 2FFQA 3LKBA 1KAEA 1SCUB 2A2ZA 4YFVA 5A05A 5BSVA 3W5UA 2NVXA 5JZOA 4O4JB 1ST3A 2PJZA 4GWKA 4FSXA 1MCZA 3QW4B 3R6DA 1B23P 5K99A 1AS3A 2XA2A 2QN8A 3W6ZA 1MZPA 3HKDB 1QZZA 3X1YA 1VMIA 5EESA 4EUSA 1SUSA 1U7WA 3CV3A 3JTMA 1LTKA 1RLTA 3FLMA 1S8AA 1OI3A 4ZODA 3IURA 2YRFA 4QTXA 3GMIA 3AETB 4IGIA 2ZK7A 5CM8B 1S8FA 5IKEA 3T3MB 1S01A 5ARDA 2K4MA 2OCPA 3BEDA 4B80A 1N7JA 1KPGA 4KXQA 1GKLA 2B82A 1QHNA 4QVIA 4ZTUB 3I1FA 3NBKA 4IXTA 5TT1A 2CDCA 3ONVA 3EVCA 5G53C 1JG2A 3TF5A 3WKAA 4TWBA 5L7TA 5TGDA 3GFOA 2N75A 2Q7DA 3AC0A 1KBZA 2C1XA 1WHTA 4Y1FA 5AUOB 1TVCA 1YCFA 2JLQA 3ICWA 5LOVF 5E1BA 4B4DA 1GZVA 4HNTA 4TV9B 3JD1A 3DAOA 3NANA 4BNFA 3T3IA 3JQ7B 1FFEA 3RUAA 5HXAA 1E1MA 2BEWB 4ZVMA 4GXQA 1UMBA 4J8PA 2ZZNA 2CUKA 5TS2A 3UMCA 3A10A 1W44A 2QUAA 3AFIA 2CYBA 3CZ4A 4R81A 4FIZA 1PNVA 1HZZA 1YUBA 5I9BA 3PC7A 1RQ7A 1YIOA 5DB4A 1C3OB 5BNFA 3X43A 4AMVA 5K6AC 1XQWA 2C95A 4AKIA 3N2ZB 3T4PA 3PEYA 3IELA 3EZXA 2DXIA 2IW3A 4R2LA 2G1AA 1D7OA 2GSDA 2GVZC 4NJMB 3DCJA 4PLPA 1OBCA 2IWHA 3EUEA 1E6MA 3ZCQA 4F93B 4DV0B 5JALA 4NVRA 5CYGA 1QORA 4QRIA 3T1YB 2DOKA 2P5SA 3K9BA 1S89A 3M4JA 4L50A 4Q7KA 4G97A 1UJCA 4AUKA 4FFRA 1Q20A 2R00A 3CEHA 5K3EA 1C0KA 3AIIA 5ALIA 1WCXA 4AP6A 1AHPA 3QLTA 3TG2A 3K59A 3LT5A 4DUYB 3WWEA 1DAEA 2AV6A 3R7NA 3MC1A 4QTYA 5JEDA 2VSQA 2NYAA 1KVQA 4KO3S 3ZD7A 4C89A 4PLHA 2PS9A 4OHYA 1N7IA 1JLLB 2RI1A 3JTEA 1Q16A 3UV6A 2W6ZA 3F8WA 3U4MA 4Q1CA 2C82A 3I6IA 1U7HA 4MUKA 4LXGA 3ZE6A 2UZIR 1S02A 2DKNA 1CQXA 1QWOA 1VKJA 1Z37A 2F62A 4PR0A 4G0VA 4F6RA 2JH3A 5ICFA 2GAJA 5COQA 1ZW6A 3VPFA 4OA8A 1G98A 3L6OO 2CF5A 4KO8A 2ZXFA 2X7HA 5CHYA 1I3QA 1U80A 3DC7A 1RWMA 3E70C 3GIWA 2F90A 1RQNA 3LQQA 4NEHB 1REQA 2I4MA 5T8KC 2DG2A 3PE4A 3ZQUA 3GP8A 1CQIB 3CPEA 3ZW8A 3FNQA 2Q3HA 5F78A 2O52A 1QZUA 2EGGA 1GYRA 5K0LA 4TV9F 1HFKA 2KBEA 2AFHA 1WUJS 1ODCA 1UK9A 1ZD2P 1QOQB 2GUWA 2XIQA 3CB4A 4FN4A 4NAHA 2MSDB 4RFLA 4HNRA 4BLWA 2O6LA 2B78A 1EHYA 4JQOA 4NFYA 3JAWB 2VDMB 5LVAA 3RR2A 1XMQB 3ZWAA 4RQBA 3TQHA 1XX6A 3QU4A 2BYTA 3LSYA 4ZO6A 1NW4A 1Q7TA 3EAQA 1XNQB 2PRZA 1GJRA 4YYZA 3VAZA 3WP1B 1Q1AA 4RJLA 2AOXA 4JL5A 3FOFC 2A7XA 4LDQA 5DFAA 2QG4A 5ITSA 1S2MA 1YI8A 3WTCA 1A5BB 2Q4EA 3AESB 4WA8A 3DYIA 2BONA 3E35A 1OHHD 2IPXA 5B3AA 4BDTA 2CDRA 4MIOA 3A1WA 4O1IA 3DMTA 4L95C 4P5PA 1NM5C 5I8ZA 4XWOA 2AG0A 1DFIA 1Y4AE 5FUVA 3BBLA 1X1RA 3LK6A 2G5TA 3PUZA 2ZTSA 3FDFA 3GRFA 4U2EA 4BFTA 4UXJA 3O73A 3EVZA 3D6TB 3HCEA 4MQEA 4W8GA 3CVVA 4EJMA 4CYMA 5MN4A 3MHPA 4IM7A 4M46A 3AP2A 4DLRA 4M9QA 1JLRA 3QSGA 4K9KA 4O63O 1JU9A 1JGTA 2PVPA 1D9XA 3CO0S 1HKUA 1JA1A 3AXTA 4FW8A 4RQAA 5AKGA 3WRYC 3ZN2A 1PLJA 3BWCA 1GZ4A 5FFFA 3T06B 1IN5A 4Z9XA 3A1VA 2C2ZA 4ZQBA 5I7AA 4PPGA 3I72A 5D3MB 3KZKA 3TZHA 2O8NA 5EHNA 3TIVA 1RWWA 5CLGA 4JB8A 2REXB 1DOZA 1MC8A 1YMQA 3I6MA 3LWNA 4GPTA 2XSZD 2F48A 3BAFA 1OYWA 2C9CA 5BN4A 5IM4A 4OJMX 3I2KA 3PHJA 3WFJA 4JODA 4KITB 5AW4A 3IP7A 1WVIA 2QX9A 2R86A 4QOEA 5CIQA 5I5EA 1BW9B 4N8SA 4C4TA 1BKSB 2HA5A 3F5MA 4JLPA 4TLLB 1PBTA 2GSWA 2QTHA 4K1XA 5DBGA 3UO8B 3VR1A 3LUBA 5J4LA 1U99A 1KYTA 4B09A 2VXOA 2RGCA 5H70A 2BEUA 4CEHA 5AW0A 3RK0A 4U63A 4RK6A 2O19A 2DPXA 2JIZA 1SKQA 4TYNA 2VJCA 3OTOB 1KRHA 1JG7A 4B47A 4CM8B 3L6DA 2XDQA 1A9XA 3NDRA 1JYEA 2BF4A 2QLFA 3OMLA 3HLKA 4MUNA 1N2CE 4RF5A 5LIRA 1CHDA 4QG3A 4NK5A 4KV7A 4E7PA 4P36A 3KEOA 1GR1A 4M0UA 3WI7A 4DHEA 3IT2A 4D4KA 3ND8A 3A6EA 3H2HA 2IDMA 5F5NA 1W4AA 3GRYA 5BV2P 5M2QA 5I4BA 2VUHB 5KDOA 1SQFA 5EEGA 1E3TA 4AKEA 1VPLA 1YSCA 1IJBA 1YZVA 4UU7A 4DIBA 2C9OA 1NVBA 3QWAA 3PIDA 5E7MA 3ILHA 1E1CA 4IDCA 1X0VA 5TDHA 2F67A 1KMCA 3G2QA 1E66A 5BSHA 1DEXA 1WD5A 3VNBA 2N3ZA 3IQFA 4HGQA 1A9YA 5ILGA 3LVFO 3K0KA 2ZWAA 3KZOA 3NETA 3P0IA 4ZCTA 1R6XA 1BNCA 1N5RA 1XEXB 1QDEA 1M66A 4NMLA 2XYQA 3THSA 3HQ4O 5DTEA 1NV8A 2Y0CA 4IOMA 1LUAA 1NUHA 1Q44A 3EQ6A 4E07A 3QPWA 5YASA 1QE0A 1EHIA 2FE1A 3C5HA 4HPJB 4WKPA 4FZVA 2VK1A 4L22A 1DBVO 3THOA 5F35A 2GAAA 2UZAA 3Q4GA 3QJYA 1P1KA 3Q8XB 1PG0A 3GTGA 1KSGA 2XNDA 1ZD5A 1J90A 5ECYA 1FJXA 4IGAA 4YRMA 2XCRB 1TPZA 5A2QA 2OCGA 3QEMA 1SC3A 1E4YA 2B2XA 3IYLW 1LRLA 1HFWA 1SKYE 1Y3AA 4YRSA 5L3QB 1K83A 2FW7A 1DP4A 3QOFA 1EUCA 2G1UA 5ED4A 5KTYA 1SKUA 4IEEA 5K0ZA 1L5HB 1FNMA 1ILEA 2D1QA 3EBLA 5BR8B 1Z28A 2V0GA 2QT0A 4AU1A 4HZUA 3B6KA 3SXPA 3REOA 2PSDA 3TBFA 4F3CA 3ZWMA 5A7GA 1NR1A 1OTHA 3FZYA 4Y2RA 4F71A 1G42A 3V7WA 4MIKA 1HLDA 5DP1A 1U0FA 4O0MA 1SC9A 3DD5A 1B6GA 1XTZA 1HPLA 5IBQA 3ZWVA 1SIBE 1E3EA 4LRXA 2PZFA 3HJHA 4KH0A 5BVGB 5LCXA 1GZHB 1K5GA 3T3GA 1CRLA 5A5EA 4QDTA 3OQIB 4YPFA 4LNUB 4E22A 4XQCA 1G8MA 2J9XB 1SUDA 4PZ0A 1K0UA 1KFCB 1X2EA 2HF9A 4FCVA 5KC8A 1K2WA 2JDIA 5DRYA 4OFBA 5DXAA 2XCQA 3PKJA 1CUAA 4WGFA 3HB9A 5LJLA 4JFRA 4IIGA 2JAOA 3DNFA 1CP2A 2F3PA 3FCYA 4QT4A 3PQCA 1E7SA 2KLBA 1YC5A 5D3KA 5B3JC 2OBFA 2R6CA 2N1MA 3GARA 4B81A 5H8WA 1W1UA 1SQ6A 1NBOA 2AX3A 2XT6A 3L6UA 5A71A 2CE7A 1TU3A 3D8SA 3PX3A 3ES9A 4X93A 2X0IA 5L45A 2VSXA 1NMEA 1EUQA 2Q6LA 2ODNA 3U26A 1R3DA 3K6JA 3K4PA 2QM8A 4ZHQB 1FP2A 1MBZA 4IXNA 2B4AA 4O2AF 2X1MA 3HVRA 1VL8A 2MOKA 3GFRA 3BILA 1WLYA 4F72A 4JUIA 3GEHA 4C5AA 1R0BA 4A73A 3BMCB 1QZXA 2IZ6A 1QUFA 2R66A 3L9WA 4TQGA 3VPAA 4PWYA 2J9YB 1KZGB 2JJQA 3OM8A 3KJGA 3M0EA 5DSXA 3F5SA 2QRLA 1G7SA 1MB4A 3VPDA 3X2FA 3ZUPA 4FEYA 4HNGA 5A5VA 4B71A 1DAPA 1Z9BA 2Z98A 1RKVA 4JLUA 1U0SY 1WO8A 4MRMB 1MGPA 1E5TA 3BTVA 4G3XA 2PRKA 2KX7A 1HZJA 2QN3A 1P2GA 1TLLA 1UBNA 1G8PA 1S2DA 2HSJA 3I76A 4RIHA 3MWDB 1FDOA 4ZCRA 2FSFA 4WUTA 1X8LA 1LX6A 2QTCA 3ITNA 1V4VA 1MJGA 2HIGA 3MRSA 1KI2A 2W4IA 2WWTA 1Z5GA 1ZKDA 2IHBA 3RGWS 2C83A 2OD7A 4Q1DA 2A6HD 1WCV1 4MINA 3SVTA 5J63A 3T5CA 4V3BA 4P3KA 5ESXA 3L5KA 2OILA 2ZBDA 2FP3A 3MGCA 4PM4A 5EP2A 5HIMA 1K4TA 3QLUC 5E2AA 4KTVE 4CTKA 1NVUQ 2R92A 3CRNA 3QXCA 4BFLA 4ZU1X 3JQAB 3CF2A 1KJWA 2DULA 2M98A 4LWOA 3PL5A 3BJRA 5FBWB 1O87A 1DUSA 1KP2A 1OC2A 1YVUA 2YCBA 1Z7BA 2A1IA 1JR3E 4H4DA 4R9UC 4UBJA 5DGTA 3SM9A 1E7WA 4MCHA 2YC4C 1KYIA 4ETNA 2VUMA 1F2UB 3MTDA 2AK2A 4I1RA 3DEFA 1SNYA 1HNXB 4I66A 4CM1A 1CY4A 2HPVA 5EA2A 1V2GA 1E92A 2DZDA 1K4SA 2PUJA 4MRPA 3G82C 5EJ4A 2ZIXA 4BVGA 3RKSA 1RHMA 2MSLA 1BJRE 3H9EO 3HJBA 4LJ4A 4MW9A 4POAA 5K0CA 3TD9A 1IHYA 2X8WA 4ND1A 3UK0A 4D8WA 3P2YA 4GX0A 4RX1A 3QE0A 4HEJA 3UQYS 3QVGA 5LYJF 1YBAA 2R48A 1PD1A 3AHDA 2O8BA 2ZB8A 4ZIRA 1TK3A 2NXWA 1MR3F 2ONKA 3PX2A 2WFMA 2H59A 3IDAA 2O3SA 2JD2A 3WLKX 2OC9A 3BJIC 3CQ9A 5CVVA 5LU8A 4H7PA 2A5FA 4NZZA 3BL5A 3N8IA 1MTOA 1QPBA 1O0BA 5JCZA 4JXKA 2RCYA 3LA6A 3ZDCA 4IEFB 4Y6OA 4U9UA 4OPMA 4CU2A 1RR6A 3E7XA 4KFCA 3AM1A 4ZOAA 1K08A 2FWNA 2R6GA 3I34X 5AW9A 3U80A 3VDQA 4XDHA 2I7TA 4AT1A 3PXCX 4OY3A 3CLTC 5AK0A 2FUEA 1KZ7B 3SSMA 4HQKA 4CFSA 2AQKA 3FROA 1T2UA 3EISA 3IHLA 1JILA 1L7QA 3QXHA 4MNTA 1KVSA 1MB3A 3H17A 1EI9A 4I4TA 5CJPA 2R8YA 3M9XA 1J70A 3G89A 1I3LA 4I1PA 4C2TA 3GRCA 4EYOA 3K4HA 4BP1A 2KLHA 3PZBA 2G1PA 2VHZA 3H4IA 4AY4A 1SBIA 3FTCA 4OEHA 4B6EA 2GPAA 2HHCA 3SIXA 1M2OA 1JPVA 4XWAA 5EGNA 1QG4A 3BD7A 4U00A 3MCVA 4JVOA 1UK7A 4BMYA 3ZNQA 1YO6A 1L7DA 3FSJX 1KBQA 4HQFA 2ZVQX 3BRCA 3HS3A 1KH3A 1KH2A 2GA9A 1P0QA 2XYHA 2OB1A 2YVKA 3BRSA 4XM1A 1GUYA 3DDOA 1D6SA 3A37A 1V3VA 1G6Q1 1XTVA 2RDMA 1ILWA 2NT3A 2YRWA 1FDRA 5EINA 3DUWA 4BNIA 4ZCQA 2CL7X 3CH6A 4JWKA 1KO5A 3DLPX 4CLHA 2WHXA 4BJ5A 4G8DA 5DXJA 1DKNA 1K86A 2PH7A 1IUPA 4OAOA 3LPAA 3OUTA 3C3YA 2B1IA 2RFLA 4KWEA 3ONEA 4XB1A 4X66B 4ZPJA 1HDZA 3HPQA 2FE4A 1A97A 3LUAA 4MARA 5HE9A 1PEYA 3ASZA 4KAFA 2R47A 2O8DB 1THGA 1UODA 2X5KO 4MS1A 4L9SA 1F6WA 1TU4A 3DZDA 3D1VA 4I1VA 4W63A 3I4LA 5FCDA 3BSSA 3OJOA 5FULA 4DIUA 2V6IA 4JA0A 4BJ1A 1O95C 1E20A 3LX8A 1EFHA 1XCGB 2O5VA 4WZBE 5F64A 1M6WA 1K7CA 2ASVA 2BGIA 2IHUA 4XPIB 5C5DA 1II9A 1ZCJA 5M34A 2P69A 4MLPA 3W6NA 1X7XB 3WQHA 5E7QA 2QPLA 3C41J 5B6JA 4IO1A 3BXXA 4KPEC 2BHRA 3LIIA 2DRIA 2KB0A 2O8DA 1NQ5A 1TE2A 1LSSA 3AL3A 5AOCA 3PZRA 1P2FA 1EA5A 1LV8A 4E31A 2IGTA 2GFQA 2Q3CA 3A9SA 4FHDA 4Q18A 1PQ4A 4EG7A 2G9QA 5K3FA 1O6BA 1KJNA 3OFKA 2ATVA 2F3TA 3DVAA 1JIKA 5BVHB 4BRWA 3JPYA 3AEQA 3WMRA 1DIHA 4BY9E 5F2NA 1B1CA 1A7AA 3HNRA 3L0SA 1Q3TA 6ABPA 2UU9B 3HVUA 4FDLA 4H7DA 3W5DA 3DPSA 3EEYA 3DT9A 3EGVA 3K9NA 5THXA 2Y66A 1G5TA 4GOJA 1YQUA 2IFTA 4BFCA 2CLIB 3GFQA 1NR5A 3DVRX 5JPIA 2PJUA 2GD2A 1Z0ZA 2E85A 5C8YB 1CW2B 1OJLA 4JJIA 3EZ7A 3ESCA 3NTVA 1I80A 2NAPA 4YC7A 4K6OA 2AEEA 4MITA 5IF9A 5L3VA 4MUEA 1N2JA 4C3VA 1Y5RA 1ZVQA 1TJ3A 4G86A 4DZZA 4EHKA 1AKYA 3VZSA 2BE5D 3QZUA 3ZLUA 1RXCA 4DV3B 2IF0A 2QLTA 4DCCA 3PWZA 1LQ2A 1AF7A 1SHUX 2XTAA 3NUGA 4MH0R 3E5MA 3PUVA 3OE1A 1XV5A 4YQYA 2R7ZA 5C8YF 1N9GB 2H5LA 4KVFA 2YHBA 3GLTA 2E37A 4A6PA 3TR6A 3FOAA 3OETA 3X1ZA 4UNPA 3AT1A 5EVCA 4NDNE 1ZH6A 2Z8XA 4IPTA 1QYCA 3BGDA 3RGGA 1L4KA 1TVKB 3VH1A 3MJDA 3QSYA 1YU6A 3UCFA 5GONB 2NVYA 3TUJC 1I7DA 2GILA 1L1FA 1KMHB 3F7MA 4KIUA 1KDYA 1TYCA 3CINA 4OATA 3UCXA 2H63A 5IXYA 4N48A 5F2OA 1ECGA 4BNXA 4BU1A 1UANA 3H16A 3HKBB 4UD6A 4BLVA 4UUOA 2OAP1 3EY9A 4PAGA 2ZJ5A 1QHSA 1U0EA 1E77A 1TUEA 2RONA 2QA5A 4ZRDA 4J0KA 3BHMA 2ZI6A 5D7NA 2WOOA 1C7ZA 3D3JA 3RO7A 4RD0A 3SZMA 5LMCA 4NU5A 4EEKA 4KYUA 1YHYA 3AZOA 3IVGA 4HPWA 5A9RA 3QVSA 1ATZA 2HLDA 3CNOA 1JLHA 3IPXA 4NYIQ 4QL3A 4R2WA 2PBZA 2PY6A 3A6FA 4IIVA 2R7LA 5KSPA 3UVEA 4QZVA 1N1EA 4WXEA 2EFJA 4DB2A 3IODA 5J23A 4GX1A 1T6NA 4URZR 5E9QA 4DDMA 3LAWA 2IU3A 3EXIB 1NNLA 1XF9A 2VDLB 2HJSA 1O89A 2JLCA 4Y98A 1E3DA 3OF3A 3P26A 1KEPA 1ZESA 1CJSA 2YWRA 3CX7A 3SK0A 4D6XA 5FUXA 4KNVA 2PWPA 2YV4A 1X7GA 1JQ5A 3TLZA 1TT5A 3VR5A 4ZZ0A 5D2CA 4MS4B 1TT7A 4N3AA 4AVYA 3ACDA 1PK8A 4IMIB 4K3UA 1L0BA 3S2EA 3SHVA 1AO0A 1HV8A 3E9QA 2ZUEA 3IC5A 5L4LA 2BUAA 4QUDA 5ECDA 4RTKA 4F06A 2H31A 3G2PA 3I6YA 4QAQA 1UFOA 1Y7IA 1RYHA 4NS4A 1DFHA 4QNRA 2WK1A 2CZQA 4Q3BA 4V2UA 2GN1A 2Z6QA 2IVZA 3KPYA 1VCOA 3I4FA 1S3FA 2FPPA 1ZN7A 2OHJA 1KEEB 1JHAA 2DU8A 2ZRFA 5GMOA 1GNQA 4K7JA 4DA6A 2B1JA 4RL6A 1F0NA 2ODBA 2DQYA 1EUDA 1GCOA 2GEKA 4JL6A 4OI1A 3OIVA 3EB9A 4OHFA 8LDHA 2WIFA 3GBSA 3LYLA 1KVTA 2Q9CA 4MA4A 3DZCA 3EPHA 2HRRA 4NOLA 1IZYA 4UHDA 4HTFA 5C8YA 4B6JA 3KELA 1W36C 1E1RD 3OVMA 3RROA 3TVDA 4R9SA 1O7JA 3O0TA 5BRJA 1INLA 2R1UA 3O9MA 4MV6A 3ETJA 4LXUA 5JECA 5AMXA 1AN0A 4N40A 4PANA 3O8LA 3OSUA 5E38A 3K0SA 2NU6A 2GK4A 1AK9A 2C29D 3KFVA 4HKTA 4ZQEA 5DNWA 4MYSA 1Z7GA 1V96A 1AS0A 1ZXBA 3SJCA 4CIXA 3CG0A 4PCAA 1MTZA 2UUCB 3IV9A 3QA3E 2BEVA 3QVJA 5ALXA 1XT6A 2QW0X 5FA8A 3VTAA 4Z4CA 2DR2A 2JGDB 5HUHA 4RPJA 3KL4A 1U7OA 1DINA 3GBPA 4PG5A 3LNTA 4ARCA 1GARA 4TSFD 5HKLA 4CF6A 3QE3A 5D8DA 3T3NA 4XVQA 4HWTA 1K92A 2YJ3A 4WEOA 1K8ZB 4E5UA 2PX5A 3B53X 3HKBA 4FPXA 3WLNA 1FSGA 5FPSA 3C1AA 4AKTA 2V5AA 1EBFA 4PLTA 5H80A 4RQUA 4LTNA 4RW0A 4O1HA 4IGFA 1XRJA 4OQFA 2P2DA 3NRJA 2DYKA 3PQFA 3HZHA 5K8LA 4TS4A 2V54A 2AOTA 2IS6A 1CR1A 5T41A 2JHCA 4CT0A 2GZ3A 2WTAA 3Q8MA 1GPJA 1IPHA 2H8KA 3VHXA 3KK0A 4MJLA 2CMFA 3U7FB 2ZUBA 3R24A 4WNAA 1AXGA 1H1LA 4KQFA 1N25A 3VO8A 2O8EA 1BMTA 3ZXIA 4DMHA 1QOZA 3EXHB 1O03A 1PJ3A 4M36A 2AS0A 3OCJA 4TSFA 3WZLA 1JQ3A 5FAXA 5DHAA 2CZCA 1VMKA 4I19A 4JQYA 1OF1A 2G9NA 4L9AA 4F46A 1G7TA 2I54A 4HH4A 1OASA 5KYTA 3OWOA 2CUZA 2UYYA 1ZMBA 4NCHA 4MUJA 2O2IA 3EVTA 3TLBA 3GOQA 3OLCX 2QTRA 3VSEA 3ZK7A 4DLNA 3I23A 3IE0A 4BAUA 3K1ZA 1R3UA 4KUHA 1N2HA 1LBEA 3NFYA 4G4SO 2X3YA 2BR5A 2XWBF 3HFRA 4XQGA 4OK5A 4DW8A 4LHXA 2J5RA 2C03A 4M1TA 4D9MA 5JO0A 1NBWB 2IVFA 1JBKA 4L8IA 4C6SA 5HBGA 3KKNA 4JQCA 4YCLA 1ES9A 5AJZA 4YMTA 4FC6A 5E3IA 2J6HA 4KWTA 3WLRA 3TD6A 4QEZA 2G3YA 2F1HA 1L5RA 3A70A 3DF7A 5E4FA 3T1VA 4F5ZA 3TAHA 4PN3A 4TVSA 4C7OA 4JV5B 4I5EA 2CD7A 3TOSA 1QKKA 5D3ZA 2V7TA 4MXDA 3CLTD 1H2AS 3DMFA 3O4IA 1KIMA 2ZYGA 1XE3A 2OWEA 3OZVA 4RVFA 2NQTA 1YBFA 3AI3A 4XFDA 3UYLA 4F1KA 3QEAZ 2I78A 3ZQ6A 3OOEA 4JYAB 4JJ8A 3U31A 3RVSA 1JF8A 3BL8A 2MR5A 4Y6RA 4BO1A 4BASA 4IKPA 4LQDA 2JLUA 4GZ3A 5E0OA 4X1KA 1M5RA 4IS3A 4O5OA 4P7BA 3ZDEA 4GKJB 5G1NA 4NXNB 3K70D 1IAQA 2W4QA 4W4TA 5JNUA 1OMOA 2WC1A 3O2QB 4WLNA 4HH0A 4ZREA 2EGUA 3EF3A 3B82A 1L7EA 3LHSA 5DRTA 4OQMA 4RV4A 3CZRA 1IZ0A 3GEBA 5CT4A 2HGSA 4L0QA 1WKBA 3UXHA 3IBCA 2WA2A 3TQCA 1QGZA 5EFZA 1BVHA 2XT9A 4S05A 1C7RA 1DC7A 2CEAA 2IZ0A 1THMA 1U9ZA 3AYXB 3B70A 4YMUA 2YOHA 1DRWA 1MIHA 3K9QO 1A95A 1XK7A 4DV2B 5DNAA 1JA0A 2BJWA 3KOXA 4ZCIA 2AYZA 4B4WA 2ZR9A 4NC9A 1Y4UA 1PAUA 3CC8A 4Z5XA 2RB5A 3IR7A 2R3SA 3ZCTA 2OD2A 2DVMA 1ISPA 3HBLA 3FYSA 4UEOA 3GGJA 3SF8B 2YDXA 4TWAA 4ZI7A 3CH7A 3GJ7A 1U5BB 1DKOA 2HSWA 4YP1A 1EEHA 2RJNA 4X7RA 2BSAA 4ON9A 3DJFA 3SNKA 1XPJA 4S1OA 1NM5A 2H1RA 2IC5A 4R05A 3SZOA 2BGWA 2VHWA 2F00A 2VRCA 2BBSA 2RGUA 4IH1A 5ALHA 1R0CA 5FXMA 5K3DA 5C31A 1KI3A 5JJBA 4K05A 3X1JA 1YAJA 4ILKA 1V7PC 2GRJA 1BMDA 2HOQA 2QIOA 4MV4A 3EH1A 3VR3D 5IDQA 4X6UA 3HCOA 4DSZA 4R1NA 4NULA 4WK6A 3OJ0A 1RAHA 3D59A 4RKRA 4A2QA 3TNJA 1SU8A 1UPBA 3KZMA 5GWXA 3KVVA 2J9RA 3SQLA 1CNFA 1DL5A 3E18A 2NU9A 1RPNA 4LGMA 3GVXA 2PUTA 4KLAA 1ENOA 3A26A 4MV5A 5EWJB 4LZJA 3PUKA 3F5DA 4WIAA 1LQTA 2WF6A 2Q41A 4U9IS 1GGJA 3EEIA 2QVLA 5GGYA 1ZDMA 4QM6A 2PUBA 3GLIE 1NZFA 2QSUA 3AJEA 4MAFA 4E51A 2AG5A 3L7AA 3GDWA 4UMFA 4HMPA 2BRUC 4D57A 3W05A 4C7JA 1F9AA 2XF8A 4MQLA 4EB6A 4RULA 3GLUA 5SICE 5EY5B 3EFOB 3DBHA 5EIEA 4JCCA 1R12A 1RRVA 1Z88A 1ZK4A 2Q3LA 2WRZA 3GLQA 4OU5A 5JRDS 1T13A 2DP4E 2ZIZA 1IDOA 4LY9A 3FVTA 3PUJA 4EY4A 4LC9A 4GM0A 4C06A 1HI9A 3CLRC 2HREA 3BIWA 1GDHA 4ITUA 3V6MA 1EAYA 2YWBA 3RTCA 5JD4A 3GLVA 4QARA 1WM1A 4ND5A 4I1UA 3RIXA 5JSBB 2OA0A 2BF7A 3VPXA 5HRCA 5TXGA 4BNLA 1I4LD 1KSJA 3I42A 5DBEX 1DG9A 1JQBA 3VR0A 2EKLA 1TZMA 1B6SA 3T5TA 2G7ZA 5AVUA 3KTFA 4FE4A 4F8JA 3R7FA 1KQNA 4YK7A 2WVAA 3OI7A 1IZ7A 2PDAA 1WPRA 3W9SA 3SYLA 3R9WA 4AXBA 5GONA 1W8DA 1OROA 4JU8A 3VZQA 4MPRA 1VBFA 2DMRA 2Q3FA 4Q15A 3OIDA 4O26A 1H23A 3B1JA 4JN6B 4W5TA 3G2KA 3PNLA 3H9BA 4A0QA 1UC8A 1IEWA 1ZNZA 5LOVA 2F3QA 1NQAO 5JI3E 2SHKA 3K16A 4X6LA 2BL4A 4GICA 3ZD9A 2ZRCA 4HDMA 1T8PA 4BFXA 1XIVA 2ECKA 5AW3A 3L6BA 3WLSA 2JGLA 2QROA 1QHHA 1YE3A 4UNQA 5A6VA 1WOMA 3IDZA 3EWNA 2LZ0A 4JBIA 1OLOA 3WQQA 4BZXA 2ZI4A 3LCUA 4ZKDA 1V71A 3PV0A 2F64A 2RH4A 4ACBA 3E05A 1WP9A 4D8VA 1JSLA 3IEXA 3FHOA 1H85A 3VJLA 3UHAA 3WL7A 3AVWA 3LKZA 5FQOA 3PQ7A 1YZLA 2H4ZA 3C6YA 1Z2DA 2UYGA 2WM8A 3IUNA 3A7EA 1PG5A 3GRZA 1T5LA 2H9IA 1QIIA 1LNZA 1AHIA 1V48A 2O2SA 4GPZA 1ZEJA 3M2TA 4M99A 5HRAA 5DGXA 3VA7A 4N01A 1ISIA 4DKJA 4YCDA 4B75A 2P4HX 1ZGAA 2QTWB 5DDIP 5TNXA 4LHZA 1A9SA 4PYQA 4Z2YA 4RQTA 1D3AA 3DKPA 1XMIA 4TVBA 2W6OA 2QYSA 1I5EA 2VHEA 2H9YA 3QY9A 3B8HA 2VF7A 3ZJ5A 1ZXXA 4R1UA 3LFHA 1AQUA 4HDCA 4LBZA 4OQXA 3BWVA 2HDHA 5DI9A 1DJOA 5D85A 1PIWA 1TFUA 2CJYA 2RKWA 5EIFA 1QG2A 4ZRNA 3T0IA 3P4UA 3TUIC 3CRQA 4U2CA 1XKLA 1LDYA 1RC0A 2WPDD 3EEFA 1Y1WA 1XKQA 1DO0A 3DE5X 3PPXA 4TLBA 3F7TA 2ZANA 3KXDA 3VRHA 5B64A 4LPSA 2XH8A 2X0EA 1WCIA 3IEKA 4FK8A 3OQIA 4DQ0A 1SVSA 3VGPA 4WACA 2IHZA 3TDMA 1Z74A 4KQIA 4KXFB 1W0JD 1B00A 3SG0A 5JRZA 1TEHA 2F8LA 2AR0A 2DH6A 2FRVA 1WZNA 4GSKA 1U2GA 5KWJA 5C52B 5F21A 2Z08A 3KEQA 2J5QA 1CRZA 4UTZA 1XZEA 2BKEA 4X85A 5F5XA 3UW3A 4UULA 2VP6A 1KL7A 3TTSA 4EEZA 3AKDA 4Z54A 5I7UA 5JCOA 1AKMA 1CSEE 1V3UA 2HHHB 3DLCA 2GWRA 4OMCA 5EWMA 2CGEA 2FDRA 1YDMA 4U3JA 3JAWA 4BQNA 4HVLA 3IKTA 2UVPB 5AVKA 4ZYZA 1VE3A 3GPCA 3W2FA 2JI4A 4M6WA 1LLDA 1ULTA 2LW7A 4D82A 3B3FA 4M0DA 3DO5A 3ZR4B 2VNSA 4IX9A 3U81A 4W1QA 2XNDD 3VC7A 4HDNB 2R60A 4YRQA 2HPHA 4M8KA 2WAXA 3W7BA 1XCBA 3BS4A 4PNZA 1WDWB 2HA4A 3WBJA 4HLUA 3ZOZA 4ECAA 4EJ2A 1U2SA 1K8YB 2CBXA 3FMGA 1FSFA 1NI5A 1K7FB 2QZZA 5AJVB 3GZNB 4AO8A 4ZZ1A 4BZZA 2GZ1A 3L6CA 1IRIA 3MIIA 4N7MA 4M76B 2PXAA 2H85A 1FTYA 3H65A 4I4IA 3PHGA 2HJ9A 2ZB2A 4OHMA 3ZDYB 3C1TA 3COPA 5ALSA 5EERA 4FWTA 4YRCA 1L8QA 2DUMA 1XU9A 4GU5A 1C0LA 2HQBA 1V1RA 1MVNA 2XUOA 3THRA 1EGVB 4ZTBA 2I34A 3EIOA 1HNZB 1ADBA 3OJEA 4NMXB 4LXQA 4EVQA 1V4BA 2OP0A 3NIDB 3ODGA 2W2KA 2WA1A 1SD1A 1ZHHA 2DAPA 2JA1A 2OV3A 2ZSKA 3EMDA 3G5MA 4RXMA 1C80A 3RIMA 4BV8A 2QN6A 1BHO1 1Z45A 5KOJB 3QEJA 3I6BA 3ROPA 3ILYA 3IEMA 2CJPA 3CJQA 4DR3B 5FP0A 1YI1A 2A78A 1PR4A 3HADA 4LWPA 3G8YA 3TLXA 3JYOA 3KC2A 1XCLA 1JECA 1SQ0A 4LTMA 3RHFA 2VH5R 1P62B 2IXTA 3G0CA 1PEDA 4E21A 4HF7A 1A8QA 2GTPA 2NZYA 4KKXB 2EX1A 1XJWA 3JYLA 1WXXA 1K5DA 2IUTA 5DO9A 2NMVA 1ORHA 4AXXA 1WPXA 2H2FA 1E1LA 2HBYA 3GJQA 1P7VA 2HO4A 3D6FA 3L8MA 5FT9A 3T99A 3H87A 1R00A 1Z0IA 5EJ5A 2ZPAA 4CI0B 2ZRBA 4EG5A 4P3XA 3P2KA 4QQKA 4NU6A 3VBEA 2G6TA 4WY5A 4TZ6A 1G0NA 5DEIA 5EIAA 4TZ0A 2GEJA 1SK9A 4UU8A 3W1WA 4YUVA 3X44A 4BKQA 5BN3A 3SZGA 4MQFA 2VTBB 4UAJA 2J3JA 1KWKA 1J2UA 4YT2A 1G5IA 2P41A 3F49S 1DS6A 2OHFA 2OHGA 5I9MA 5TQ2A 3ELYA 1ISMA 1OV4A 3FNFA 3N0XA 4AYBA 2CK3A 3NHRA 1J2JA 2QNBA 4ZC1A 4BZWA 1MJGM 1ODLA 5JY6A 3RYIA 2CXNA 2Y1KA 4WOKA 1ISEA 4OP3A 4QVGA 2G9VA 4FYPA 4UMVA 2YHUA 4N0MA 2YHSA 4YWHA 1Z26A 4EB8A 5K6RA 4MI6A 1R0SA 1ZK1A 3M82A 4JSRA 1CF2O 2ZCUA 4GAEA 4PHFA 1NDHA 1NMZA 1PQUA 2PANA 3GAFA 4MUBA 4DARA 8ATCA 3E9NA 1E8DA 5JYCA 4TS3A 4CKCB 2PX0A 3RUFA 1HETA 1SCIA 1KDOA 1GITA 4Y1RA 2WD7B 5E4JA 3DCYA 1AKVA 4XH9B 1P33A 4ITVA 4U6QA 1T8WA 1WMFA 5CM2Z 1T8IA 4PGGA 1A82A 3EVFA 3KB8A 3MYRA 3UJDA 1T4MA 3DD1A 2QZ9A 3M4YA 4E5MA 3CE9A 4I5GA 1DCKA 3OQJA 5CA0B 3WNDA 1D04A 1PJZA 3A9TA 1X8XA 2EJTA 3DAFA 4ZI7B 2WB4A 2Y0EA 3WLIA 3UUEA 3NXSA 2P2NA 1TM1E 1HNWB 3USES 2GOYA 4HNAB 2FSGA 3ENNA 1V8OA 4CKYA 3GRPA 5KOIA 2WYIA 3OUUA 1YQGA 4KPUB 4W7HA 1M2GA 1XNGA 2NQ8A 2Q1SA 1IBKB 1UEXC 3K9CA 1UWKA 2WU0A 3KAJA 2E4YA 3GROA 2FN8A 1CY0A 3SOZA 3WB1A 1I3CA 2PM8A 4PLGA 4BATA 1NRJB 1UPAA 3EARA 3LF2A 4FFPA 1JHYA 1NRIA 3ZDRA 1WWKA 5KNCA 2OV1A 2IYNA 2Q4TA 4NFLA 3NYQA 3RC9A 5D87A 1EESA 4XUEA 5SYAA 3WGQA 1C9DB 3O8QB 3QTTA 2FPMA 2VG8A 1SA0B 4TXHA 1NSYA 3ZPXA 5AHKA 4E14A 4GRDA 1O95A 1ULZA 3K0AA 5EN4A 1KI7A 4F45A 3ZHSA 2Z57A 3AZPA 4X7MA 3CEMA 4YAOA 4GFQA 3G5UA 1SXQA 2PUDA 4C6TA 2H4XA 4MW6A 3T61A 2XQKA 2W6MA 1SMYD 3KUXA 1V0JA 2QNIA 1NSFA 3I9V6 1KGDA 2AA3A 1O77A 5H5JA 5CFOA 1NUAA 3SHOA 5H1YA 1YJ8A 1LQUA 4NCAA 4O8CA 4JYZA 5AHRA 1GYQA 3WNVA 1XVVA 4P35A 4PHCA 3AR9A 2X5JO 3MXTA 3PF8A 2RG7A 5DLYA 2VAVA 3EWAA 1RBZA 1R8XA 3WGKA 4YIHA 3M1LA 1BHQ1 2A84A 4HY3A 4B7XA 5BV7A 3EW9A 2YY5A 2XITA 4H6VA 4A6EA 3NWOA 2HSDA 4C7VA 5IEJA 3ENQA 2XRFA 4C5BA 4MJ7A 4EKDA 4AYTA 1NHGA 5ICGA 1TVMA 4Y1EA 4M0KA 4X84A 1QANA 1SCBA 4XVUA 7ABPA 5GV7A 3C6BA 4OB8A 1VB5A 4JP1A 1C3XA 521PA 4NCXA 1XZJA 1T36A 4E94A 4EJFA 5LWHA 3MUFA 4MYCA 4QWMA 3HDGA 4PYOA 1ZU4A 1EA7A 1NWCA 4UVIA 4AM8A 1GDTA 1V8ZA 2X8AA 4CKZA 1PNRA 4RTLA 1M1NB 3K58A 5LR6A 2EEZA 9ABPA 4DBLC 2HRQA 3JVUA 2Q2QA 3RFTA 1IL0A 1RPTA 2VJMA 2R4UA 4OCZA 1U63A 3BDAA 1GCAA 2QUJA 4TYPA 2TS1A 2C0QA 2LE0A 4ZT3A 1N2ZA 4E5KA 4CPDA 1MT0A 1MX5A 2VATA 3IT1A 5BV0A 2QZJA 1ESZA 4YHHB 4J0DA 3FFWA 3KS9A 4QFBA 3NI2A 4QBGB 3FPFA 4FMCF 1W4BA 1GVHA 2LR0A 2JF0A 3K1JA 1USIA 4JIGA 1PYGA 1Y6ZA 3AUUA 1U1IA 1E1QA 3CRRA 4A0RA 1V3QE 3L0ZA 1M7BA 4XEUA 1AQYA 1SD2A 3PFFA 1XYVA 3CONA 2QD1A 1H42A 3GDHA 4TLEA 1ZRNA 4M53A 4XYGA 2HH9A 1T35A 3N8DA 4FW9A 3NVDA 1FY2A 5A4KA 1U7PA 3FCCA 2AC4A 3FPCA 3W5JA 3OPQA 1NGSA 2D7JA 5ILQA 4EG8A 3MPOA 3IOYA 3GFPA 3F6EX 1P18A 2O2HA 2V58A 4AY3A 1DPGA 1I4OA 4ENSA 2BKVA 2JZOA 4Q4CA 2OHIA 4N5NA 1FJGB 4I9FA 4L5CA 4PLZA 1QYDA 2ZFUA 3AHFA 1QQBA 1CUBA 3C3JA 4D02A 4MUIA 1X3LA 4YJGA 2V6GA 3EIWA 3FUUA 4MS3B 5HM8A 5CFZA 4TMTA 3GRKA 4MVJA 3VOAA 4X64B 1MA0A 4KBFA 4YRPA 2FRXA 4HBGA 2BGJA 4NEGA 1AK2A 2HBRA 2RHJA 2I2BA 2OO5C 3K31A 2GJKA 4TMVA 3OZGA 3BE5A 1BGWA 1V5IA 4PPNA 1H8ED 2M1ZA 3QVUA 4AC9A 1EZZA 1QHGA 3QKTA 5FUQA 5EZYA 3P9XA 4MO2A 1PUJA 2FR0A 2PIAA 5JSZB 2Z83A 1ZBDA 1GEGA 2IUSA 4OGGA 3K2BA 5SZHB 3A6PC 2AJ8A 1T8YA 3EODA 4MUFA 3TLEA 4HJRA 2N42A 1HLFA 1I0ZA 4JLRC 4OA5A 1JXMA 4MCIA 4HN2A 5TVGA 2HQOA 2F3RA 3C8DA 3H2IA 4H0FA 1MX3A 1OLSB 4D98A 1I7QB 3DLAA 4B74A 1KEEA 1LRJA 1D8AA 1PL0A 2OE2A 3DUFB 4FKBA 4G81A 3F7OA 4IJMA 4MCJA 4LQ4A 4P1ZA 4EFNA 3K0FB 3VNUA 4INZA 3TDKA 4QU9A 4IV0A 2OM2A 3TJZA 4FMCB 3TQIA 2Y0SA 1X70A 3GTPA 5LQJA 3Q5EA 4LTDA 3F6PA 2EV9A 3DFZA 3JWEA 1OQAA 2IKSA 1Z6XA 3ZHZA 3IESA 1AQJA 3CGWA 3K73O 4H4CA 3PNQA 3CKKA 2DGDA 5EEHA 1P0MA 1Z8FA 3QKIA 4LK2A 2FUCA 3BB1A 1G6HA 1V9CA 3DHWC 2B92A 2BFCB 3K5MA 1VJ0A 4ZVOA 4OBXA 2EZ8A 4EBBA 5IJ9B 3M3HA 5J1TB 4B3XA 4FOOA 4QREA 1JAHA 2FKAA 2ZU6A 3LP8A 3DULA 1K68A 1Z5PA 1ZITA 3IERA 4FKMA 4PPFA 5JS6A 4ZOCA 3THYB 5J4KA 4A8JC 4DM7A 5A2GA 4EYSA 4G5FA 4BJ6A 3D5EA 2XODA 4L8GA 1ZCZA 1WXIA 1YNOA 2H2AA 4GZ6A 2QRQA 1M2NA 2AYXA 3FCSB 1UEIA 3LWZA 5F33A 3VJMA 5FOQA 1G59A 1HR0B 4IEIA 4LHWA 3VYTB 1SHJA 1TAQA 2BMDA 4CMBA 5A5FA 4UDXX 3CWQA 5FPKA 4GH5A 1Q0ZA 3HM9A 3U7RA 4JOSA 1WOYA 1XEXA 2WB1A 1SD5A 1SQSA 2F3UA 4OKNA 5SY4A 4QSHA 5CBPB 1HDYA 3BXZA 2OCIA 4BXOB 4LSWA 3FYTA 2DSNA 2GO1A 2JHGA 3P71T 1H22A 5FUYA 5HE8A 1M6VB 1XTSA 4RTQA 2JFVA 1ACJA 3OZCA 2VJLA 3BKWA 4REQB 2NZJA 3D64A 5BWLA 1X7WA 5AI9A 5LU9A 2RHDA 1FDWA 1U8TA 3GGDA 3ZY2A 2C7VA 2B9SB 2AW5A 5A3RA 1NVVQ 3BE4A 4JT4A 3ADBA 4GQAA 2IUEA 1EMDA 2HWXA 4UXIA 4F2DA 1UP7A 5A9TA 3EVNA 4M7OA 2J4DA 1NIPA 3CJTA 4Q9LA 1EAMA 3GJRA 2R87A 4DFDA 2WFLA 1LJUA 2JAUA 1NQOA 3ADKA 3NHYA 3OC0A 4G9EA 4AL4A 1BO6A 2Z1NA 3HKEB 4DLUA 3KSDO 3A27A 3HYSA 1BMQA 5K09A 4ZZ2A 1YB1A 1AV6A 1TDJA 1CFJA 5HFJA 4NFHA 5CNJA 3MEQA 3PD0A 2WTMA 2KQUA 3BRQA 3BJMA 5FOVA 1XN1A 2JVIA 2R97A 3IMCA 4HAZA 4A6DA 2YXBA 2VHQA 4TXMA 2H57A 2Q0HA 1GYPA 1JYFA 2HV8A 3LUJA 1VMEA 3PQ8A 3QF4B 5ALOA 5HS4A 2YXEA 3KETA 4OLJA 3MGBA 1NX9A 2QG6A 3G7NA 3HCCA 4OBEA 4JVSB 4OHPA 1GLVA 3BZUA 5FL3A 5TE9A 2DLCX 1MO5A 2B1RA 3R2JA 3FNIA 3S8EA 1E9FA 4BNZA 5IRCD 3BRWD 1US8A 3IP6A 4HR7A 2DT5A 3FOZA 1ULSA 2F17A 3EUAA 1UIMA 2OBMA 4KB2A 1KJJA 4QQNA 3MAQA 1RYDA 4GMKA 3KAKA 3E1SA 2JLXA 1OTYA 2VHTA 3NTQA 1CQZA 1X7DA 5IBCA 3Q7TA 1N4DA 4QU8A 3W7AA 2H3HA 3ZHOA 1C9YA 3OT1A 2W2LA 3PEFA 4PLYA 4KGXA 3E9DA 1IWOA 1JIQA 3OOYA 1VCIA 3M8KA 3R3YA 3KP1A 4GP7A 2YXDA 4AJOA 2X1VA 2VPXA 1HWYA 2FZ4A 1YL7A 2CVPA 1MC1A 2EYQA 3LHKA 1CV2A 1JWAB 4Y6SA 4D9IA 2SBTA 3L7BA 2AG8A 3TI7A 3KOOA 2WIGA 4G67A 2NTYC 3FRJA 4Y0AA 4M1QA 3UMSA 4F5WA 1LDBA 4TMFA 4LVUA 3ZS9A 1CNEA 1L1RA 3C43A 3IJ5A 2C2HA 1Q15A 3CUUA 2ZSUA 3A31A 3L0IB 5BUQA 2UXBB 3NH6A 1NRWA 2A57A 1LLFA 3CXUA 4L3WA 2FMXA 3VYRB 1N7GA 3C6XA 1L7MA 4BS9A 2JPDA 2QTVB 8GPBA 4ROTA 4DY6A 1L7PA 2AFIA 2G1JA 1TYAE 4J1TA 1JS1X 2O5RA 4QEDA 3IP8A 4ARVA 3FR8A 4XQ0A 5CFPA 1PUIA 3QKWA 4HVAA 4YV2A 5BMVA 1G8FA 3MTQA 3RS3A 2VWGA 3WNZA 3GRAA 5ERGB 1D2CA 3EGEA 2IUYA 2MYTA 4J9UE 3EGDB 2B98A 3UJAA 4EGJA 2XCTB 2H1OA 4HQNA 3BT7A 2JFOA 4G85A 1RZUA 1GLGA 3BMNA 2NVOA 2VWHA 2HRCA 3NNDA 5CQGA 1QVRA 2J31A 3KWFA 3Q0TA 1HFJA 3VKVA 5J2UF 3D7KA 3I39X 3OESA 4DEVA 1IYZA 1I4WA 5DBOA 2ETXA 4QAJA 2HDWA 4U02A 4E3WA 4MICA 5BOVA 3UB3A 3KUKA 5LNK6 3AF5A 1IHOA 1BJTA 1Y9JA 3HCRA 4RAOA 3UFBA 3O3NB 1IHXA 3B6IA 3GH1A 1I7NA 1OB5A 3GJSA 2G88A 1L5FA 3ENKA 3L1IA 2B9EA 1UZUA 1X94A 4H7JA 2R6DA 3COWA 1NHWA 2DEUA 1DC4A 4UTVA 2VP0A 3WICA 4AF8A 4M8NE 4BGIA 3CA8A 5J5CA 3PQ6A 3WYFA 5MF6A 4WVLA 4C9BA 1EFRA 4HB4A 2ZSAA 3D4PA 3ZXSA 3LPDA 5DHUA 2FMFA 4FX2A 2GLTA 3RTDA 3FMFA 4L8YA 5HPYB 5TR9A 4EIWA 1M1ZA 1GN9A 5KI6A 2BI7A 5DX8A 3T3DA 3LIPA 4OQPA 1YCHA 3KVNA 1F38A 1HMYA 1V5GA 2RGEA 1JHQA 1PLLA 4X91A 4ZAFA 1DCFA 4XZ3A 5F1PA 3NU1A 3FUTA 2WKWA 1KAQA 1KY5A 4K9MA 4HO1X 1RQXA 2W98A 3OPNA 5BNWA 2RK6A 4WN9B 3TGWA 3OTHA 4HDSB 3I5XA 4FYYA 3UMVA 4EY8A 2PS0A 3AEYA 4WZBA 4CN8A 4E70A 4HL6A 3UJ9A 2IS1A 4UCQA 4ETWA 4IMRA 1WHSB 2AZMA 3Q40A 5BUCA 2XWPA 3GJ4A 1BWRA 1L5NA 5T5QA 1QAQA 1VZ3A 4FZ5A 1OY1A 3GDFA 3DONA 2IHJA 4KIGA 3WK7A 5TX7A 3NDPA 1N3BA 5HG0A 2B0JA 3GCWA 1KAMA 1P5ZB 1WNFA 2QF7A 3KHTA 3MAGA 4XASA 2NTNA 3R5JA 1B1AA 3GJ8A 7REQA 1UBFA 1VE9A 2VNKA 1XZPA 1JP7A 3N3BC 4Q16A 5EZQA 3PE6A 2XBLA 4DCVA 1ODKA 3UZUA 2DE0X 1L7RA 3L7IA 2QM0A 5C8ZA 5G1OA 1GQFA 4OQDA 4J2TA 1NSTA 2FSHA 2JIDA 2E7ZA 2ZJYA 2D2XA 3EYAA 1BGVA 3K0CA 4YMWA 1O94D 1SVMA 3VMFA 4Y2UA 2Z2YA 2FPXA 3RRYA 4ZN6A 2IYZA 5LIPA 3OY7A 2NIPA 1KI6B 1FP4A 1QR6A 2KW5A 4N0DA 4UDNA 3UM9A 1NNUA 4UBLA 1IG3A 2FWAA 4G8JA 5ANRB 5EFOA 4RJIA 1CUYA 2O50A 3U3OA 4B9EA 4US2R 4N6NA 1U11A 3B2EA 2A0KA 3D0RA 4WEQA 1PF7E 1KEKA 2W6JD 2OEPA 4PXSA 2ANCA 5C7YA 1H9CA 2ZYUX 4Z4QA 1P2DA 2RH5A 1OWPA 1W25A 4FMBB 4NQZA 4Y6GB 1M67A 1RI3A 5LBIA 4QUKA 4BQIA 2PSFA 5C5CA 2RGRA 2ONZA 2QR2A 2CVQA 1YTUA 3AEUB 4QBFA 1V8DA 1UKCA 3MTJA 4IOJA 1GXSA 3U4CA 2KHZA 4XD2A 1X74A 3E9YA 2XQGA 1FMLA 3VI4B 5GIPE 2OMEA 1NI4A 1QB7A 2H11A 4LCJA 1Y5IA 5B58C 1GUFA 3ZGVA 4A03A 4I9NA 4MPJA 2G9RA 3L2OB 3RUHA 2C8LA 5MFPA 5FOTA 4RLHA 2B20A 2B7CA 3OICA 1KMNA 4YQEA 4R3NA 3IOMA 4NJEB 1NW7A 1CUEA 3FLBA 3R4VA 3CU5A 2LD4A 2V8OA 2SKCA 4EZIA 5FUMA 4M0MA 4EBFA 4ZHQA 3C98A 2WUEA 4XE5A 3D3WA 1BDHA 1R88A 3D54D 2HTEA 4QGFA 4X6XA 5B3LA 3SP1A 5JDIA 2X0KA 4II2A 2W8ZA 1H2XA 1I3MA 3ONWA 3D7SA 1AY0A 1G7RA 3OZWA 1YZ3A 4LJ5A 2DPGA 4QFMA 5IN5A 4KBYA 4EFDA 2XAUA 2DC1A 2ZRIA 3TOZA 1V6AA 2QRJA