4D3YA

The structure of inactive prolegumain from chinese hamster.
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
404
structure length
384
Chain Sequence
GKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMSPISLPPVTRLDLTPSPEVPLTILKRKVGQIQRLLDARHVIEKSVHKIVSLLAGFGETAERLLSERAVLMAHDCYQEAVTHFRTHCFNWHSPTYEYALRHLYVLANLCEKPYPIDRIKMAMDKVCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUMAIN
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
total genus 139
structure length 384
sequence length 404
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4d3yA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3yA01
3EDRA 2QLFA 1RWNA 1SC1A 2CJXA 1QTNA 3V4OA 1CP3A 4NOMA 3SIPA 1PAUA 2C1EA 4HQ0A 3H11B 4N7JA 4QULA 3NKFA 1SHLA 2H51A 3R5JA 3UO8B 5IAEA 3GJRA 5I9TA 4QU0A 2WDPA 4QUAA 4QTYA 1F1JA 4JJ8A 4ZVQA 2HBQA 4EJFA 3SIRA 2DKOA 2CNKA 2K7ZA 2QL9A 4DCOA 2HBYA 4QU8A 3D6MA 3V55A 2J32A 4I1RA 1I4OA 4DCPA 3R7NA 3PD1A 3KJQA 4QUBA 1I4EB 2XZDA 1I51A 3H1PA 4D3ZA 1RWOA 4HQRA 3R7SA 4AWAA 2XYGA 3P45A 5IC6A 5K20A 1I3OA 1RE1A 3DEJA 3NR2A 4ZVTA 4PS0A 3DEHA 1IBCA 1QDUA 2CNNA 5I9BA 3IBCA 1RHKA 2C2KA 5IAGA 3S70A 5LUBA 2J31A 5IAKA 1RHRA 4JJ7A 4QU5A 4NBLA 4QUGA 1F9EA 4IYRA 1QX3A 2QLJA 4ZVRA 1M72A 4QUJA 3ITNA 4FGUA 4D3YA 3PCXA 4QUDA 2FP3A 1SC3A 4EHAA 4ZVUA 4N6GA 3V4LA 1NMQA 2QL7A 3H11A 2H54A 4JJEA 4PS1A 1NMEA 4M9RA 4QU9A 3R7BA 4JR0A 4QTXA 4JR2A 4ZVPA 5H0IA 3R6LA 2J33A 3DEIA 3R6GA 2H65A 3K7EA 4JQZA 5LUAA 4NOKA 2J30A 2XYPA 3D6HA 4EHLA 1JXQA 1RWVA 4LSZA 4AWBA 1SC4A 1PYOA 4D3XA 3KJNA 1RHUA 3GJQA 1RWKA 3RJMA 4IEFB 4AW9A 4EHNA 4EHHA 1RWXA 5IASA 2HBZA 1NW9B 3H0EA 5JFTA 1CVRA 1NMSA 1RHMA 1RWMA 2CNLA 3DEKA 3V3KA 4QUHA 4NBKA 4PRZA 4EHDA 1RHQA 4N7MA 2H48A 4NOLA 2FQQA 4ZVOA 2XYHA 1BMQA 3D6FA 2C2MA 4FXOA 4NOJA 5IBRA 3S8EA 4JB8A 2H5JA 1GFWA 3OD5A 3GJSA 1ICEA 3GJTA 4NBNA 5IAJA 2FUNB 1GQFA 2QLBA 3V6MA 3V6LA 3IBFA 2Y1LA 5IANA 1K88A 1SHJA 4FEAA 4N5DA 5IABA 2H5IA 2H4WA 3BIJA 4EHFA 1RWPA 4I1PA 5IBPA 4QUEA 4QUIA 3PD0A 5LU9A 3NS7A 4JR1A 4DCJA 2CNOA 2XZTA 2QL5A 2Y0BA 3H13A 3P4UA 2CDRA 1RWWA 4JQYA 4PRYA 3R5KA 4N6OA 4ZVSA 2CJYA 3UOAB 2C2OA 3KJFA 3E4CA 1RHJA 5IBCA 2P2CA 4EHKA 5LU8A 3QNWA 3EDQA 2AR9A 1K86A 5IARA 4N6NA 4FDLA 4HVAA 5IC4A 2C2ZA 2NN3C 2H4YA 1KMCA 2HBRA
chains in the Genus database with same CATH superfamily
3HACA 1RR8C 1ZSYA 3AZOA 4BZWA 4D9IA 5L4NA 1O6FA 4KWEA 2H1WA 2DLCX 1NVDA 3GRYA 2CMFA 4F84A 4HLCA 5AW4A 3QWFA 3QG1A 2JVJA 1H69A 3TWOA 2OPBA 3TECE 4NNPA 2O8FA 1XX6A 1Z7GA 4N0EA 4B9AA 1P1RA 1PL8A 2IBSA 4R6XA 3FKJA 5EJ4A 1II8B 2NTNA 1NBMD 1MC1A 5C35A 3ORHA 2WEKA 1RRFA 2ZRBA 1XTSA 4H4EA 4GYYA 2WKPA 4CF5A 1I0IA 4MW7A 3M2TA 1X7WB 3Q8MA 3O8NA 4HPWA 2ZJ8A 3DNFA 4G26A 4TSRA 3T1VA 2LP4Y 3KXPA 1PFKA 1R50A 4H7DA 5LZ2A 3KV3O 1E6EA 5BWNA 3BICA 1W9MA 4KGDA 3EH1A 5H02A 1NU8A 3TI9A 4DJEC 2GEVA 3IS3A 1E98A 1R5NA 3WLLA 4LZJA 3AL3A 3K6KA 3E03A 2YWBA 4HWPA 3CLTD 4XD2A 5JRJA 4K81B 2X5NA 2O2DA 2YV1A 3GZTB 1YBMA 2ASEA 1U1EA 5AW3A 2WUWE 4M98A 1DDGA 1PG0A 1Y63A 1JN0A 1U4NA 1P61B 1ESZA 2X5KO 3K35A 4H4DA 4TXMA 3VU9A 3WSWA 4DV4B 2NGRA 5DYYA 1RYEA 4TVOA 1UQTA 3OWXA 1VJ1A 2PUVA 5BQOA 1AZSC 2Q3BA 4HPXB 4ZYTA 2J9GA 3IKVA 3TFWA 3GB9A 4MIYA 3RVQA 3ZWYA 1EZZA 1YXMA 3NBUA 3L5OA 1NH3A 3PFHA 1MX5A 3OPNA 4F3EA 3B48A 3EIUA 1O03A 2YZ7A 3GMSA 1JFFB 1JWBB 4P53A 2ZS9A 1PQWA 3S5JA 3FF4A 1AV7A 2NU9A 2TYSB 1OXSC 1Y48E 5ETJA 1EK0A 3X1WA 3M4ZA 2ZIUB 3T7JA 3TTVA 2QTHA 3NAZA 4AL4A 1EMDA 3HXLA 4IL5A 1ZHHA 3BWMA 4CR8A 1J1IA 3NGMA 4JNKA 2CMHA 1RXUA 2WAAA 3SVZA 4HTAA 3PD7A 1OXMA 4R0MA 3CXRA 3FJOA 3NWJA 5J43A 4PYIA 1E3MA 3ADPA 3KWMA 1MT3A 5CNJA 5BNFA 2HU2A 3KFLA 4WASA 4YC7A 1USUA 1AKMA 4WK0B 1Y1WA 3RVLA 4MUMA 4I36A 4X20B 4F6LA 1DTWA 1VPVA 5CDSA 1L8XA 4FXOA 4ID9A 1RQ2A 3LUGA 1YMVA 1SY7A 1YDFA 1QG2A 1ZI8A 4UFNA 4Q37A 4GDFA 2WF9A 4U7FA 3UH0A 3KZOA 2UVPB 4E4RA 1P6XA 1JT9A 3OPMA 4DLUA 4JL5A 3ZGXA 3HYNA 4GOOD 3ANYB 5A3QA 1DAPA 1CR4A 2HB6A 5CX4A 2BM1A 1BE6A 2PWAA 5FD8A 3SLKA 1W44A 3LCJA 4B84A 4BX0A 1F14A 3GJ6A 1QRRA 4WNYA 3O8CA 4REQA 1BU5A 2FWBA 1FDOA 4H7IA 1NR7A 1S7CA 5MN4A 2BGRA 1TWCA 1KEEB 2GAIA 1W35A 2PD4A 2P8SA 2WIFA 1H6DA 2JCXA 3G8AA 3IQHX 3L6EA 4ZCQA 2ZPUA 2WFLB 3HMQA 4M9UA 2WHYA 1TQ8A 4BTLA 3FY4A 4GC5A 3CNNA 2YY7A 1RRPA 2QRVA 5F21A 2FN7A 1VG9B 3TR5A 3BFPA 3OIFA 2F9MA 4IOLA 1VG8A 1X7DA 2PFSA 5GONA 4CL2A 4IW3B 3T3MB 2I2DA 3ANNA 3GOHA 1J90A 2C9OA 1PP4A 5FH9A 2H07A 1XALA 2QNRA 2OT3B 4PAMA 3R3SA 4AN0A 3GNLA 3DYBA 2X77A 3E7WA 1Y6QA 2PKQP 3IDAA 3ROMA 2F17A 3UAWA 1T2EA 3C16C 4W1RA 4FMCF 1RMTA 4WESA 2C7BA 3M9LA 4ZZ1A 4P2GA 1QJ4A 3M7IA 5A4MS 2ODQA 3DOJA 2WU0A 3E58A 2QRHA 1ESNA 4GHWA 1J70A 5D6OA 4I1IA 3WK8A 5I45A 3WYCA 3OCZA 4S2EA 1C7QA 1NJFA 4M8LA 2ZVQX 1CC1S 4GI3A 1NLMA 1KDOA 3A6EA 4P4LA 3K31A 5EZSA 1O2DA 2IEAA 2LDBA 4NCXA 1CF2O 5H4HA 3W5SA 2O2SA 3ZTYA 4C43A 1BWRA 4ZPXA 2YY6A 5LYJA 1K8QA 1TQDA 2V5UA 2XMSA 3BXEA 5HJ2A 3WQQA 4JYZA 3V8NA 2NZXA 1JDUA 4DL9A 4IQ8A 2R8ZA 4MWGA 3C4JA 2Y2VA 1Q7TA 1A9XB 4OOEA 2C78A 1V8DA 1ZN2A 5DEOA 4RESA 5TGDA 4ES6A 2AG0A 1AM4D 1EZ4A 3PIRA 4G85A 1JRLA 4NSNA 1VL6A 2WLTA 4XQCA 5EI5A 2FF5A 2I8AA 1DI0A 1PHPA 1SQ6A 4NBLA 1K2VN 1J8FA 2XB9A 2RJNA 4U2BA 1TF2A 3DNPA 3ZCVA 1RTTA 3W7VA 2WVAA 4S1NA 1Y81A 3FI0A 1C1HA 4YJ3F 4EVRA 3HKZA 1UEIA 1WX1A 1RJFA 3L7MA 4M83A 4DV0B 5LWQA 3JQ8B 3BGVA 1CUSA 3F78A 2HNKA 2K5UA 4M8NE 4MEJA 3UAOA 3ZHRA 4ZZ2A 2OBFA 5CP8A 2Z57A 1N1EA 1M2VB 5F5LA 2VBFA 3TQCA 3I6ZA 1NW8A 1KL7A 1G8JA 1W25A 1F51E 1XRJA 1KAGA 3QF4A 2IYTA 1DE0A 3M4YA 2BH9A 3ND8A 1ZLYA 1OBFO 1L6RA 3FBWA 4QJ4A 3TSZA 2Q5LA 3HKDB 2FV8A 2IYXA 4KODA 1T9GR 2UUCB 3ZK7A 1KYWA 2Q21A 1PDWA 1X8LA 2VHVA 3C8DA 3I2KA 4EZBA 5JAQA 4RWEA 4ND5A 1NZDA 2DY0A 3JR3A 4BASA 4G4GA 4KP7A 1X8KA 3TZLA 4DA8A 1JECA 4ECEA 2C3OA 2X0FA 2QP4A 1L8AA 1EBBA 2OGUA 3CR8A 3M5DA 1JNXX 3O3MB 1HFKA 1X7YA 2M6LA 4AZWA 3F5MA 4IHJF 4BMOB 2FN9A 2OLKA 4AJ4A 1DL5A 4WK2B 2O8VA 1QWSA 521PA 1DLJA 1P29A 1R66A 1ZITA 3K0FA 3DO5A 1PEAA 3IDOA 3B1VA 4FD2A 1C0EA 2HWXA 1YDMA 3C74A 1E7SA 3HB1A 1QIMA 1DWPA 4WGGA 3TZEA 4BUZA 2RH8A 1X7ZB 4B87A 4D9CA 1OH6A 1RJ9B 4ND6A 4CTOA 1TAHA 3WFZA 2XGGA 3P4UA 1L5LA 3GTPA 1SD2A 2GARA 4OQMA 2YINC 2WHQA 4ZCPA 1A36A 1DO2A 4HRAA 4F2HA 1KI7A 1KS9A 1FFXA 3LZDA 3QHQA 4EBFA 4UQLA 3M70A 1LI5A 4Z7JA 1GLVA 1MA3A 3CLTC 1OIXA 3NW9A 4LNAA 1U8ZA 2QLFA 3QFFA 2J5XA 3MT8A 4FFVA 1THMA 4FQ8A 3ZLBA 1U0BB 4UBOA 1LWOA 4YMSA 5F33A 4R3WA 1JQDA 1GL9B 3VHXA 3BA1A 3ZIAD 3LUJA 5AVZA 2HXSA 5KVSA 4Q1BA 2QSZA 1PFUA 4JBXA 2VSYA 5HHTA 2F8MA 4JEHA 3EFHA 1R5ZA 3LY5A 3FFBA 1KA9H 4YP0A 1X0XA 3PHGA 3ZHUA 4TMFA 1A77A 1UPCA 4WLNA 2FDXA 2XDYA 3CRMA 4N7BA 4E70A 3O3CA 1W1IA 4KN6A 1QFMA 4DWJA 2GPNA 4RGVA 1H8ED 4O4HB 2B1GA 2ACEA 2G88A 1WUIS 1NG9A 4JQOA 4OKIA 2G09A 1WQ4A 4CKBB 4EG1A 1Z07A 3E1KA 3VR4A 4P3OA 5DI9A 5EZYA 4TVKA 1C3XA 4DCPA 1JVBA 3O90A 3E9QA 3P26A 4HD8A 5KWEA 5EKSA 4OGLA 1HBJA 4FYMA 4JVSB 4HMPA 1SAYA 2BTQA 4MV7A 2J6CA 2FPGA 4RPKA 2GF9A 3CEMA 3ZC3A 4UMDA 2FGJA 4GXNA 5F1PA 1XCLA 4F85A 1TQ2A 2D7DA 1G17A 1M1UA 5C4MA 1MZPA 5DBGA 4XSHA 1W52X 4ASUA 3BBPA 1HM5A 3C6MA 4G25A 3LY7A 1IZZA 2HSDA 3TLXA 1GSIA 5B6PA 3OT5A 1N0UA 3CZAA 1OGIA 2XA9A 1QRDA 2FSVC 3AW8A 3BDAA 1G1AA 1RFLA 3ITNA 4MGZR 3N9IA 4HX5A 4L16A 1IXSB 1IK6A 2Q6KA 1IOZA 3I1IA 3PZRA 1H2AS 4GDMA 4JCCA 4OQEA 3DONA 1KIFA 3NC4A 1LBTA 3DZBA 4AJ9A 5BXYA 3GZNB 5JJ5A 2RHWA 3F7OA 3UUGA 2IXTA 3DZHA 5JROA 1C1DB 4FGKA 2D6FA 5CNKA 4KZKA 5I9MA 1IBSA 4HNTA 3DJYA 2OTCA 3COYA 2ZE5A 2LUOA 1YO6A 2YVAA 3OF5A 1TIKA 1FBNA 1KFEB 3SYKA 1Q50A 2FA9A 3AR5A 3V1TC 4E5NA 1YAJA 4LJ7A 3FAKA 1S8NA 3KZCA 3SX4A 1AK2A 1DOAA 2QE7A 2NPIA 1DC8A 3ANSA 3KPYA 4FZVA 4E6PA 3KSMA 3LT2A 1PZEA 5JXGA 1C0PA 3O93A 4YGXB 3TBFA 4YCNA 3H7AA 1VGVA 2NZWA 1D0SA 3D6TB 4MYUA 3JVIA 5DSTA 1M2NA 3QPVA 1SZPA 1BVRA 2AXQA 2XEXA 4W7SA 1CFJA 4DQ0A 2PGOA 2ZCUA 3CNEA 4X1OA 1Y7LA 4HS9A 2JFHA 1D8AA 1Q1EA 2BGJA 4HYQA 3G68A 3ZWQA 2D1FA 2HCBA 2XB8A 3NGLA 3HA7A 1XMIA 2BI8A 1NF3A 1YB6A 1GGVA 1WBJB 1CJVC 2Q1SA 3FUTA 1PFWA 1AZTA 2G70A 3A4LA 3IUJA 1JIQA 1XSEA 2P30A 2QU7A 3GJ8A 4KYTA 5I9LA 4G0XA 3DBRB 1JU4A 5I4CA 4C2UA 1Z4IA 3NZEA 3GUVA 2VIIA 2CDCA 2AW5A 2ROQA 2IU0A 4BV2A 1Z0JA 1WB9A 3A4MA 1A82A 2H1HA 4K8RB 1JJ7A 2IUEA 1UXIA 4MVYA 4JJZA 2JJYA 5FFFA 2VYCA 2ZUBA 1EKXA 3OOHA 4PLGA 3WNCA 5AJTA 2C7QA 2RBGA 4GMGA 5JEDA 3JARA 3GYBA 3GD5A 3CN9A 3GA7A 2JA7A 2ATCA 1FJ2A 1ADBA 2ZKIA 3I30X 3LLCA 1HDRA 5LBIA 4XYGA 1O7JA 3N0WA 4V2UA 5HM6A 3N39C 1HT1E 4GNRA 3RU9A 5ECGC 4UU8A 3BK1A 2HO5A 2YYAA 3IHWA 3LLSA 4LBYA 4ZT7A 3ZV5A 2WDPA 2J9ZB 4IMIB 4MS4B 5G4KA 1CDOA 3EWNA 1A2OA 4IGEA 1WXHA 4RPIA 4H7PA 2J3MA 5I7OA 1W5EA 3M6WA 4Z2YA 2GPSA 2HCTA 4UAJA 3QOYA 3STWA 3U44A 2GK4A 3VX4A 3FDZB 1M6VB 1G7SA 3RGGA 4E2WA 1CJCA 3NWPA 2A3RA 4GPIB 2GYVA 4MI6A 5EUCA 4EKNB 4P82A 3N7AA 5C4IA 2YWJA 3BWVA 3MTDA 1CB7A 1CUEA 1IATA 1XDSA 2M1XA 3HLTA 1W6RA 4RZUA 2GKGA 4RIFA 4L15A 1LX7A 4FOTA 4UCWA 1I4DD 3LX5A 3U4GA 2E0IA 1ETUA 1ULUA 3DL2A 4CVNA 1P2FA 3IPLA 4QSHA 4ZO8A 4AY5A 4ZYYA 3ONNA 1KO4A 5B58T 4Z1OA 1M1YE 3WIBA 5HNKA 3CRZA 5IFKA 5JTUA 2BDTA 3V42A 3AI1A 3TRJA 4KK3A 3OTGA 1CEXA 3FVTA 3H2HA 4XB2A 4KN5A 1CHDA 3HA5A 5EXDA 2IH5A 1WLYA 1J24A 1WUKS 4LOIA 1JJFA 3ZW7A 5KC8A 1OWLA 5AVKA 4A2WA 4TKLA 5TDHA 4LBVA 3PR2B 4RHEA 3B3QA 1SCNE 4KXNA 1EFKA 3KZVA 4NENA 1DINA 3IOYA 3MAGA 3T5MA 1ABBA 4YRFA 1H4QA 2FPSA 2JHPA 5AK5A 2ZUCA 3AEZA 4ER7A 1SD5A 3EOZA 8MHTA 4KX3A 5ALYA 1IY8A 2G4VA 1TT7A 2Q2VA 5B57C 3MWLA 4WLUA 3BZUA 4ARVA 4HY3A 1LSSA 4IX9A 2I2XB 4MKXA 2WUVA 3EVCA 3OJOA 3EBPA 2QRZA 4HFMA 1N1MA 3EPHA 4D9NA 4AB1A 1NTOA 2WR8A 4DCTA 3G79A 2WMNB 3HPRA 4NFYA 3CIOA 2UVQA 4XCXA 5CURA 3DOCA 3SIWA 1HQKA 3LUBA 5D8DA 4WXRA 3X1MA 1FSZA 4A26A 4H3SA 4LDRA 4B09A 1ISIA 4RTQA 3WGNA 5I7VA 3L8YA 1SPXA 3ZY5A 1MV5A 3LT1A 3QIAA 4BB9A 3IT2A 1N2IA 1B76A 3O9VA 1KAQA 4KR0A 3CKMA 2HQBA 3SJCA 4V38A 5EE5B 5CEJA 2VP6A 3RV3A 1S9HA 3B89A 2R47A 2Y9PB 2PUAA 1FU4A 1V8PA 2VTVA 1WCWA 2FUCA 1AB6A 3CURA 3R7WB 3ZDDA 1T3TA 1PZHA 4LDAA 1I94B 1EESA 1YJCA 5FBKA 5AOVA 1P77A 1YQXA 3DEZA 2PNFA 3HVKA 3GRFA 1N6NA 4I2NA 2YHBA 3EIEA 1DJQA 4PYQA 1K8XB 1S1CA 3TJRA 4FDTA 3AIKA 4S2UA 1NOIA 4EJ2A 3ECSA 3KTOA 3WYNA 3B6JA 1EVJA 1K6JA 2PMFA 2PRJA 3B5EA 3H9EO 3KQOA 4MS1B 5EJ6A 1KARA 4IDOA 5FI1B 2NT3A 1RJWA 2EJVA 3IAXA 1FPQA 3DOHA 5ARBA 4R1SA 2GLTA 4TTQA 3CYFA 1NLFA 4HDMA 4HAOA 4JX9A 2NXWA 4DIOA 1GNSA 2NQTA 4ABTA 1N6HA 3HDVA 3A05A 3K72B 5KHOC 4ISBA 3T7AA 4MAFA 5DI3B 5E6RB 2ZTVA 3BXHA 2I1WA 3BD6A 3SU8A 4UOEA 1YULA 1PVOA 2JGNA 1VCMA 3F8WA 4G0VA 1NVAA 2FSHA 3DLIA 3K4HA 4KFTA 1YQQA 3KHKA 2XHZA 1E92A 5EJIA 3Q5EA 3E81A 4FN4A 4JIMA 3I9NA 4AY6A 3SJAA 1GGNA 4LISA 2ZJ6A 3RANA 5JS7A 4OLFA 2VBGA 2ZTSA 5G0VA 3H4TA 1OX4B 1CR2A 1DKLA 4MJLA 1S8FA 1M7BA 2J31A 3MLAA 1OI3A 4HZUB 3LPAA 4B6SA 2OR3A 2RB5A 3GY0A 2Z3VA 3E5NA 3LU1A 4DW8A 1SU7A 2CSXA 4IOJA 1TA4A 3CJQA 1WWKA 1NXTA 2P9FA 4RK1A 3RSGA 2QN3A 3WB2A 4XVUA 5JBNA 1HMYA 4DLRA 2JZNA 4IILA 1E2NA 2LZ0A 5IF3A 1BE1A 4XM0A 4MPPA 3K6JA 2PG3A 1AF4A 1Y5MA 3L3BA 1AZWA 1TT5B 4PPGA 1T6NA 4RSMA 4GECA 3TW8B 1IJKA 2W2KA 3GFTA 4IJUA 4BWVA 2WJPA 4AJ1A 3TLCA 4XE5A 4D4HA 4ZYZA 3ELWA 2WHEA 4ZCRA 2GBLC 3AEKA 3KRTA 1NUSA 2F1JA 5H3CA 3A2NA 1TF5A 1BX1A 4Y67A 4JA2A 5CFRA 5I7WA 3BILA 2DMRA 2FZKA 2HJWA 2QV7A 3H1AA 5C8VA 3OC0A 3HCPA 4KIUA 3WKCA 3CEJA 1W4CA 4BNDB 4KQ6A 3K0CC 2J0UB 3DDHA 3P9YA 4XJVA 4RK7A 3E82A 3D3WA 1I7PA 4MWBA 5B37A 3QEBZ 3PQEA 4X7BA 2C9MA 3SMVA 1P7WA 1W5AA 3NAMA 4AIIA 4YCJA 2FWJA 5IAOA 1TCUA 4KVFA 1I30A 2P67A 3ISJA 4OP1A 3W5UA 1D9ZA 2X6QA 2Q6IA 1DZ3A 1Y89A 3KBOA 3LYUA 4H27A 4M53A 4URZR 1DEOA 3DP9A 4GLBA 3WLAA 4C6HA 1U0EA 2VQEB 5HKAA 3THXB 1Y3DE 2A92A 4XIGS 3CKLA 4XYEA 5FHRA 1I7LA 1NN5A 2JFXA 3IP5A 4JFRA 5DWQA 4K8OA 5C53B 1XRQA 2V3VA 3FMFA 3AVQA 4RV4A 3LHKA 4P5EA 4MWSA 2O5EA 3IUPA 1NNEA 1J5EB 4MPTA 1QRAA 4CT4B 4CEJA 2GBCA 1OX5A 1XA0A 2OHVA 5CPFA 4EUHA 3X1DA 3UT0A 5B7PA 2CXSA 1DMSA 2NTVA 4KFRA 1QF9A 5FUWA 1TWAA 1G8MA 3E9YA 4R41A 3VTKA 5L6LB 1NP7A 4KMMA 1QR6A 1WXQA 5CCXA 2Z6UA 4ZDJA 2WWIA 1OBCA 1Z8DA 1QH0A 3B2NA 3ONFA 4IIBA 4OKNA 1QGUA 5LXTF 3U9LA 3W4KA 4AMYA 1DRWA 4M1SA 2EAUA 3K0AA 1G20A 1QLJA 2ILVA 3AL0C 3UFBA 4QNRA 3A06A 2OG2A 2HT6A 4QPJC 2MYTA 5IP5A 1CRLA 3C7DB 4ZHQA 4M9SA 5IF9A 2P2DA 2PA0A 1O6BA 4PIPA 3F5DA 5A6VA 3U19A 3LBAA 3SEFA 1ZXXA 3G7UA 4CI0B 2BOVA 1KKLA 3SD7A 3T7KA 4QU8A 3ZY4A 1C5KA 1B3RA 2YN2A 2ZANA 3DZIA 4L08A 5CFZA 3K5OA 2PWYA 1GL3A 3A14A 4CU2A 2PAAA 3ED5A 2GYUA 4DPLA 2O1EA 4HYEA 1XCJA 1VE3A 1W1UA 5FAXA 1N0WA 3E7PA 1KZ4A 1JKJB 3VAYA 2GZMA 5K20A 4M7RA 2VFAA 1RE1A 2Y4OA 1URPA 1SEUA 2PQ2A 3GUZA 5SY9A 4XFJA 1IHPA 2DKFA 4G41A 1GR1A 1KS2A 5K6AC 3HXTA 1GA4A 1JZTA 2BISA 1LD3A 3EULA 3KBBA 4QASA 3EPKA 1GEEA 3WQHA 4FW8A 3QUQA 1JDNA 3EC7A 2CBXA 4WD3A 4DR4B 1Z0UA 4KQWA 4BMNA 2GPTA 5EPEA 3SC4A 4KPEC 1DG3A 1XJ0A 2BELA 5KYYB 2WSMA 3V7FA 3ETHA 1N2CA 4UZEA 4PS1A 5JAZA 1FUUA 4J7CA 1MABB 3ZBPA 4ENRA 1AA6A 1VBKA 2SKDA 2W5UA 3CLSD 4D9FA 1Q3KA 4NYIQ 2WD8A 5ISMA 3EY9A 3F71A 3AIOA 3RJTA 2FX2A 1BU8A 3IAEA 4IX1A 2BAGA 1XDUA 2WJVA 5KJEA 2MSDB 3PHLA 2VTBB 1NJSA 3CW2A 3L7NA 1KOGA 1K4MA 3OPVA 5AVRA 3FJ1A 1IW7D 2NAFA 2XT0A 3ZBTA 1MVOA 3A6GA 4K87A 1NMSA 4AS3A 1P2TA 2PU7A 4C2MA 4MVXA 1MJHA 5A04A 1VJ0A 4MULA 2VTBA 3AM5A 4BRWA 6REQA 4K1LA 5LR6A 1WHTA 2VYVA 5ALIA 4A5SA 4RSGA 2HHLA 3G02A 4WECA 3JRXA 3HGQA 3VJRA 2MSWA 1Q84A 5CA0F 4JLDA 4TL8A 1KI3A 4PZDA 2BP7A 3Q4GA 4LW8A 5D00A 2BEKA 2BM8A 4UMFA 5AT1A 3JCZA 4IZIA 4BV8A 1E99A 1NY5A 2ID4A 4CF6A 1ZKDA 1Z6YA 2WIKA 3IBFA 3VOTA 5K3EA 2HW8A 1E32A 4X44A 5L6MB 3PFNA 1M2JA 1F5SA 3OP4A 4MROA 2ZJYA 1V3QE 2FMHA 2MJLA 3ER6A 3WIEA 4NU0A 3GPDG 2PL5A 4AY3A 4BVHA 3A0UA 2WQ6A 3LP5A 1QTRA 1LTHR 1I2DA 4Q01A 5M7EA 2WLSA 4U39A 5MF6A 3PX3A 3TYXA 2DQSA 2RONA 1IAQA 3UOAB 5HIAA 5F1OA 2N75A 1O4WA 3N75A 4M2LA 4C7OA 2JBWA 1HT3A 1QHFA 4R1NA 4ZT2A 3KXKA 5BN4B 4F92B 3OFND 5EJ8A 5LQRA 3IO5A 4DXHA 1Y5RA 3WYGA 4NYMR 3G2QA 3V5NA 3ZHXA 2PFKA 1E62A 2GYYA 2G9QA 3A6FA 3B1KA 3PDUA 4RK5A 2PUGA 1VMEA 3GGDA 3GIDA 3I37X 2Q3HA 3CB2A 1TMKA 4PFJA 1IUPA 4CL3A 1RMQA 1EM6A 4KO3S 4XR9A 621PA 2QJFA 5AI6A 3H2BA 1KY5A 1QKJA 4C1BA 5JAPA 2V1UA 1PEDA 4PZ0A 3CHYA 4HMQA 1XO1A 5NLLA 2AH5A 5C34B 2RHOA 4ERXA 4JKYA 4J7AA 2CXTA 4KXUA 4WLFA 4UPVA 5JS1A 1X1CA 3B1XA 3PI7A 1E3WB 4JJ8A 4U5QA 4Y6SA 3N8IA 4WBSA 3IKJA 8OHMA 2PKEA 3VR3A 3H4MA 1PQYA 3O3NB 1OLSB 2F6RA 4HX2A 4P7FA 1SQGA 2HBYA 2ZIXA 3HQ4O 2ZWIA 4LDZA 5DHSA 1V43A 2VKTA 3TF5A 3SWWA 3P2KA 4NDAA 5EE1A 2G3YA 1XQWA 2H2FA 4JQCA 3F6CA 2Z2IA 7MDHA 3HJNA 4XSGA 1J0AA 4WOPA 2XLCA 4BIIA 2RCYA 1M5RA 5CA1F 4UNIA 4WN9A 2P9CA 4TV9F 1HTTA 2YJ5A 2O8EA 4OU5A 3M9XA 5CW2A 4I4CA 1QVZA 2ZUEA 1RYYA 1WUYA 1M6NA 3WDMA 3NASA 1LPNA 3OQIB 4BC0A 3OJCA 2FXVA 1YH3A 5KX5A 5GZ1A 2BGGA 3DPSA 4EKGA 2P9GA 1JJAA 2F43A 3LY9A 2QRKA 3IP3A 3B85A 4MJ7A 3WG9A 4KOAA 1NBHA 3SZLA 1H2XA 2ZI5A 3A1WA 4JWTA 1EWTA 3TLGB 5C52B 1JJVA 3AUKA 4POOA 1ZRMA 3P9ZA 5IHPA 4EQ6B 3DXXA 5EIWA 3FCEA 4KMSA 4FHCA 3F96A 5JVDB 4AF6A 4DA6A 4DV7B 3NC0C 1T10A 1Y8CA 2OYCA 2HKIA 5JJCA 2H1IA 2ZQZA 2DTDA 1T2VA 3ZHBA 2JHCA 3V7YA 3TW0A 1UK8A 1WMBA 3R0ZA 3KDPA 4FZ3A 1UZUA 4Q0MA 3KHSA 1C3OB 4OO3A 4IOMA 3RJMA 3RYIB 2A69D 3ZU4A 5C9HA 3LQFA 2WABA 2Z6AA 3IRVA 3ZVMA 4KR6A 1YQWA 1CVRA 2B8EA 3K9HA 5IUNC 3A1SA 4QUHA 3KJXA 4K9LA 4QD3A 4TS4A 5CLLA 3IV6A 4IJ6A 5T8KA 1KBZA 3H8WA 2V7EA 3L93A 4M7PA 1MF7A 1YR7A 3KJEA 4IIJF 3BWEA 4A8HA 5KSOA 4CEHB 5HTKA 3IL2A 1VJ5A 2D62A 2W6QA 3N2GA 4I9NA 1BXKA 5AICA 3L2OB 2DXIA 4A4DA 2Y77A 4JUFA 4BN5A 1MRSA 5JAHA 1P0CA 3HJBA 1RP7A 2C5SA 3L06A 1L7AA 1GTMA 1C9NA 2GUWA 3P2OA 4XA8A 4ZU3A 5LDDC 3W5DA 3N5CA 3R0XA 1DU4A 1T24A 2FEWB 2OBNA 3KO8A 1PQUA 2IXFA 1N2GA 2XODA 3MT9A 4FTWA 5EIFA 3D9QX 3LYHA 5G0TA 2BC9A 3IP1A 1J09A 2JJQA 1OT3A 3LKZA 1O3YA 4YCDA 4YALA 5DEIA 5HQJA 1WPRA 2FN4A 1Z5ZA 4OGWA 2C5GA 4GKVA 3D81A 4GBJA 1GUDA 2B8NA 3WKDA 2Q49A 3TOZA 4L8IA 1DKNA 5ALVA 1Z8HA 2PAFA 2PLFA 5BUQA 1L3CA 1L2TA 3STVA 3N3BC 5H59A 3TEFA 3JQ7B 4GQAA 2A1UA 2P41A 3AY7A 4D02A 4DVGA 1EAYA 1SXHA 4H9GA 5T6MA 3RHFA 3LUCA 3HY3A 2P78A 2PS0A 2PZGA 1HYHA 5KZMB 1EJ0A 1O8CA 4KDEA 4EHIA 4NARA 5H68A 4OQYA 4TS1A 3VC7A 1ZICA 4IMPA 4ZOLA 4YREA 5HJ5A 4IVQA 5GV8A 2Z56A 2XGMA 5JBIA 2RKWA 2ZJFA 3JU3A 3Q87B 4HLNA 3UXMA 3S6JA 4ZDKA 4LF6B 2FPXA 1MKYA 1ADJA 3PNPA 2B0CA 1F60A 2P4HX 3CLSC 4D9BA 1I4TD 1X0VA 2SCUA 2ZPTX 3CW9A 2IPNA 4MUJA 3WZMA 4DCOA 3TQSA 2IE8A 3DVQX 3EARA 5B30A 3AINA 4CM5A 3ZS8A 2PT5A 2IKQA 2A9FA 3BXGA 1ZLXA 3FUCA 3E05A 5LC1A 3PGXA 2G07A 4H7HA 3UB2A 4KYIB 5ALWA 1VKNA 3AOGA 2Y93A 1HC7A 4IUYA 1OAOC 2OO5C 2Q99A 4WCFB 3TQHA 1RSZA 3FTDA 3BIXA 3P9IA 5JXWA 4F5ZA 1BHQ1 2G17A 1P74A 5D84A 5B12A 2HNBA 1ESEA 4K40A 4JEUA 3I4CA 3SS7X 2B9VA 1DTSA 1PX2A 4N5MA 1I3KA 4PWYA 4LXHA 3IMCA 4XM2A 2IEBA 1UT5A 4WZBE 2YXEA 3ZYZA 4N9QA 5J5VA 3AFOA 1E89A 5JC1A 2R6JA 2JGJA 4YMHA 2CLKB 2C8VA 3GVIA 4PCVA 1FK8A 4K3VA 1KJNA 2GILA 3QKRA 821PA 4C76A 1J9EA 4DQUA 2H54A 5NULA 3QVGA 4UUNA 1FW8A 3VH3A 3VH4A 4X7PA 4OI2A 1CBUA 2Y1OA 4UNSA 3KIPA 4EPYA 4F04A 4WXYB 3ICEA 3A58B 2Y0DA 4FONA 3TS1A 5KQPA 3C87A 2BKXA 1HE8B 3EA5A 4QECA 4HNAB 4RMIA 4X45A 5CNMA 2O5JD 3C3YA 3QBJA 4Q02A 3KX2A 1R4MA 3DFKA 3RGWS 3WGJA 1TVMA 4DLSA 5FWYA 1PYGA 2QD3A 4EY5A 5JZSA 1AKEA 4JXKA 4EY7A 3THYA 3IAHA 3AYZB 4Y2UA 4BTVA 1O58A 2HA4A 3E22B 5JFGA 2CVOA 1IE3A 4M37A 1OA0A 1QGZA 4NBKA 1DBWA 4YI3A 1PJ2A 4FOSA 5CDFE 4C4XA 1H4SA 4JEMA 5AUOB 1YR2A 3EF0A 1S8OA 1R0XA 3PJFA 4AJJA 3QEAZ 1TO1E 2VXOA 2ZP1A 1VSVA 3BGDA 3T41A 1UKBA 2ZT6A 5ESRA 1JPNA 2YKGA 1OLXA 5JLJA 2R6FA 1SXJE 4V3CA 1GN8A 4D97A 5F2KA 5BYAA 1A9TA 4WDQA 5JQGF 4K6MA 2WJIA 3PZBA 1T0PA 3LRPA 2C7OA 1R6AA 1RXSA 2PK3A 3LWDA 1EP2B 1Z6PA 2O20A 3U7FB 3NS7A 4ZQBA 1AT1A 3U7EB 3DWEX 1ADGA 4JQSA 2CYBA 5ES3A 4B3IA 1E94E 1X92A 2UUOA 3CG4A 3GNTA 4JBNA 4UNNA 5BQ5A 3VSAA 5SY4A 4LZNA 2C2OA 2YX1A 1QCYA 3PBKA 1UPTA 3MQ4A 4MV9A 4EYEA 3OCVA 2C2ZA 3U3OA 3HDYA 1PGNA 2AJCA 3T3PB 1E1DA 3JASA 4IHJA 1W87A 1Q83A 1KP3A 1OI7A 1V37A 5H16A 4CV1A 2R751 4RVFA 2WHXA 5H4GA 1D6NA 4MI9A 4G5SA 1YDEA 4X7MA 1N6PA 4Y6GB 5DGTA 2D5AA 3ILYA 3MWGA 4TXLA 3UIEA 3HG7A 4I8IA 1M76A 2CB9A 3AHJA 3D6AA 3NEPX 4YBRA 2PX2A 3P4YA 2GEKA 5GOTA 4LY6A 4DIBA 2HIGA 4GG1A 4CFSA 2QW1A 2FPIB 1QGAA 1QX4A 2X5OA 3RSLA 1V11A 1HK7A 3ZE1B 4DG5A 1OBOA 1RKXA 4WVLA 4QQNA 1UBNA 5CM8B 4ZMRA 1UWCA 4O3MA 3GJZA 4W8OA 1Q0UA 3O47A 2O8NA 5FLXA 1PJTA 3AQ4A 3RUDA 1YS7A 2Q3EA 4TQGA 4ZT6A 2AKYA 3ZE6A 4F3RA 1C8VB 1BQEA 1EG7A 1Z45A 3F98A 1TW3A 3VGPA 2QTGA 1LPAB 5DHTA 4EHBA 5CIQA 1C7RA 3E3OA 1NXSA 3T3IA 2I3DA 3EZ7A 4HVTA 3VR6H 4FVTA 4B2IA 2OZVA 5EN4A 3H75A 4EB8A 1UDBA 5CQGA 3CH4B 2I9KA 3A6LA 3N2EA 2E21A 2WJGA 4LNUB 3UT5B 3KQHA 1DXHA 4G65A 3RIMA 3A1NA 5C3UA 4DCVA 4BPBA 2XHEA 1I5OA 2IH4A 2VHTA 1X13A 2NV0A 5KNCH 1Y6RA 1E6UA 2P79A 4TRMA 4ILKA 3ZZNA 3NOVA 4IIXA 4LAFA 3SVLA 1DNPA 2GR9A 3LDAA 3PVZA 4C7KA 4ENVA 4ESEA 4DDTA 1N2XA 2HIHA 2UDPA 3A37A 1L8QA 2NW6A 5HRCA 4D9HA 3T1NA 2QSYA 2VWGA 3IQZA 2IPAB 1I7QB 3MTAA 4I2VA 1FP7A 4KTVE 1GTRA 3IPAA 1Z4QA 4C20A 4BEBA 3QLVA 1DAHA 3MTBA 4Z49A 5P21A 3G49A 4QEZA 2O2XA 3FVRA 2WQZA 1IZ8A 3PV0A 1U0SY 3R5FA 3GPBA 3AIMA 4NMWA 2I76A 1ZXBA 3LW8A 4U63A 5ALOA 1SMKA 2HTFA 4HOYA 1C9YA 2ECOA 1C4OA 1PT7A 2H8GA 1CT9A 1ESCA 2WOJA 1E6WA 2FWIA 1EUDA 3BWDD 3FLEA 2AMLA 4XUGB 2VJMA 5AI9A 3WGZA 1T9HA 1VYTA 2HXGA 3T12A 2PS3A 1Z39A 3IXMA 1W4RA 5B2EA 3SEAA 2PXXA 3O21A 1R8YA 2G5CA 2J3JA 2XMGA 3P7MA 3LFTA 4FJ2A 4GM4A 4KKXB 4ZO9A 3ZS9A 2JKZA 1ZJJA 4KPYA 1QFJA 1U7UA 1PJCA 1UJ6A 3NFRA 1WPGA 1E1QA 2QG6A 1CUVA 2RBEA 4PGHA 3AKYA 4PYJA 5SZHB 3OHSX 3ZK8A 4YO7A 2CLMB 4GLOA 4C7VA 2O0KA 4MV6A 4UHFA 4DADA 2E82A 1KMHA 2VNSA 3MD0A 1C30A 1NQXA 3C1UA 2EKPA 1E2EA 2D2FA 4JSYA 4R7GA 5DTMA 2WWFA 3TXYA 4PRYA 1WUJS 4O5AA 3RROA 1CNFA 3SQNA 4ZREA 3ZXSA 4ZKDA 4KRXA 4BZPA 5BNIA 2EARA 1AUPA 1MTZA 4Q6BA 4YRNA 2IYSA 1CEQA 1IEQA 3BX1A 4CLRB 5AW1A 1T5TA 2E5FA 3TR6A 3ZD7A 1TFRA 1EXWA 1UBGA 4RK6A 3ANXA 4WCFC 1GPLA 4QTUB 5EIBD 2R92A 4FFDA 4G81A 1AHPA 3MJFA 2MSKA 1IM5A 4YRQA 1SCUB 2POQX 3BD7A 1B8OA 2AA3A 4QLBA 2NO0A 4IIHA 2ZI6A 4K9PA 1O97D 4AG5A 5KTYA 1QHNA 3N0VA 5IT0A 1NXVA 2OQIA 2RHRA 1WKCA 3QLTA 4U3JB 4UDNA 4HWKA 1CRPA 1W4AA 2FQ1A 1GVHA 4PQFA 4CDGA 3O26A 4QDZA 1ZGHA 1XZGA 4QA9A 1BXGA 2B2CA 2H7VA 3L5KA 3V8PA 4DR2B 2BHLA 2BFCB 1JEQA 3K6RA 4QODA 3S5UA 4A2PA 1YVEI 3L01A 1DHRA 1BKYA 1Z35A 2CLIB 4JUCA 4P54A 4S0XA 2VRNA 4B32A 3AONB 1OXBB 1ZD2P 5HWSA 1FS4A 3LUHA 4XEHA 1EK8A 3M6LA 1IUKA 3EF1A 5AW6A 1MDFA 3KJGA 2QKYA 4E6EA 1CRWG 3F73A 1JAYA 2YZ2A 4CLOB 1SU6A 4M99A 4GS5A 4ZVTA 3LUPA 1DEKA 5TEVA 3QSGA 3WADA 4DKJA 1NI4B 2CNNA 1KXJA 4ZTZB 1FMCA 2O2YA 3T0IA 3S81A 3SJUA 3R4VA 3RC9A 3LNTA 1U0OC 5HJ7A 3G0BA 1C4WA 2R00A 3W5HA 3K9FC 2X8AA 5JPIA 4HQ6A 4TMYA 1FSSA 1P3DA 1XZDA 2QL7A 1EFTA 3B9BA 3Q7QA 5CVVA 5AM0A 5CFMA 2QAIA 2ONCA 2V1XA 3EXFB 3QU7A 4GBMA 3G89A 2IEGA 4HCJA 5J5AA 4EGSA 4R2MA 3D02A 4P32A 2ZYHA 3BBLA 1G21B 4JQZA 3WKEA 4ZA2A 3SSNA 3ZIDA 1WU7A 4XCVA 3TDNA 1QGDA 2PCLA 3KAPA 1K08A 3LUAA 3NEYA 3ZGYA 1RFGE 1RIIA 2Q4BA 3NYRA 1T9ZA 5DKFA 3LSTA 4RWZA 4D44A 4GPBA 3L8DA 3ZV4A 3S27A 4E3WA 1FDSA 1R0KA 1TTQB 1PUXA 3LH5A 3LXUX 5FB3A 4ZYLA 2VH1A 4X3CA 4PGGA 1CR1A 4AMUA 1N7JA 2VCEA 2CE2X 3BRWD 3JX9A 4N1AA 5CD9A 2W9XA 3DDZX 1NKTA 3HKBB 3DF7A 2Z4TA 4RTNA 1XP8A 4MMXB 4P83A 2Z8XA 5BURA 2V59A 4PG8A 3I64A 4WKBA 5CT8A 3O4VA 5K3CA 2WSSA 1JHRA 3UWKA 3GZ4A 4CUJA 1R16A 1G5IA 2HFJA 3RIGA 2AJLI 1GPUA 3FE2A 1W48A 1Q15A 3KQSA 1CJUC 4CNQA 4UAGA 2QRUA 5G41A 2AF3C 4RD1A 1VL8A 2D8MA 2PZFA 3T9DA 1NBME 4BNLA 2G08A 3NIWA 2V9ZA 3M6AA 3K96A 3O8BA 4YFVA 2QGZA 4AXBA 4ZO4A 4BE7B 1C2TA 5EEHA 2VK8A 3ETEA 1LI4A 1XQVA 2DUJA 1T8WA 4NX2A 2HBRA 1Q44A 1N6OA 3EMVA 3EFEA 3ADCA 4LMPA 1RZRD 2O8DA 3TE7A 2B3DA 1AVTA 3SFVA 2PH5A 2WSIA 5BV2P 1JAIA 1UJBA 3QQPA 1KGDA 2F90A 4KUHA 1Y8RA 1RBMA 1T5BA 3FRIA 3EJ6A 3QWBA 1JIVA 3OC6A 3OEEA 1JT2A 1G55A 4IXTA 4OHXA 5AW5A 2ZSDA 4D8XA 3TFOA 2VQFB 4LY0A 1BN7A 2AOXA 3O8DA 5CK5A 1GILA 2D2XA 2D8AA 3AUAA 2D1SA 3OM0A 3W2EA 1U0RA 1B0PA 4IGIA 4E3ZA 2GRUA 4JLKA 4NCHA 4RF3A 3Q3IA 4TUYF 4ZCMA 2OESA 2EP7A 3FYCA 4HDSA 1R49A 2Y1WA 2B63A 1RLTA 3EQ8A 1AXGA 4X6UA 4ZO6A 3ZWBA 2GD6A 3I2IA 3OP1A 2X0NA 3KEFA 4G4JA 3OU2A 4UEQA 4E51A 1LK5A 3D64A 2VRWA 3L4BA 3GJ7A 3QVJA 4M0UA 4RETA 5C32A 2ODNA 4Y2TA 4AMVA 4XKJA 1CE8A 1IDOA 1TO6A 2FJUA 1FFWA 2R1UA 1L4LA 4MEAA 2FZWA 1W8DA 3CQZA 3GEGA 5FL7A 5FX2A 1NFFA 3O5AA 3SOPA 4MW5A 1HL7A 3UXHA 1IN1A 1P7YA 1K89A 1JLHA 1OE0A 4CN8A 3SC2B 4EW1A 1VECA 3HP7A 1XVVA 3N8DA 3LX4A 3NYQA 3DBOB 1RACA 4NULA 4X5OA 2COEA 1WDMA 5ALSA 5K0GA 3ZWOA 4TZ0A 2Q1WA 1BHSA 2FEOA 2JJ1A 3RWMB 3UJBA 4UUOA 2W6MA 3NHRA 4K05A 4QBGB 4P38A 4Y2GA 3NT2A 4EJ3A 4YRBA 4TWIA 3VISA 1P75A 1JG3A 2MTBA 2ZI9A 2H29A 2NTYC 2VLBA 2FZ5A 3D3NA 3ESAA 4L2IB 4M76B 1AF7A 4UDYX 3DV9A 5ILGA 1GR0A 4JLWA 3WYEA 2OC4A 1IDN1 2BKEA 3AUJB 3R6GA 2O06A 1ZL0A 2WF8A 1JLKA 2XWQA 3SZ3A 2QZSA 1VKHA 1Y7IA 1NNUA 4MCIA 3WO1A 1CKEA 4MITA 3GWGA 1NX6A 2EHDA 4HZGA 1PE0A 4MW4A 2HYDA 2ZS7A 3AZPA 2OWDA 1C9MA 2A9RA 1U2QA 5KNDH 5EKXA 3WQRA 1EUYA 4AYBA 3AT1A 4HRXA 3LQ2A 1DKOA 1GNQA 1MCZA 2YJGA 3I6YA 5EIBC 1P1JA 2WM8A 4JOQA 1SVMA 5A4FS 1VGQA 4HLUA 2V6FA 3TQFA 3FMOB 3OKPA 2UYYA 2OHFA 4RPCA 2ZIVB 5SY6A 5IBRA 3DDOA 3FPFA 2AFHA 3EYAA 2C77A 4FOLA 4H17A 2GETA 2IZOA 1Y42X 4QBFA 1IQRA 5JHGB 3T3NA 2FX5A 3LXMA 1A95A 1A9ZA 1G3QA 1TQ4A 4PFSA 1EFVB 4QJBA 5TARA 1L5KA 2A86A 3IOEA 4GP6A 2WICA 3U3MA 1W2WB 1PF7E 1YA6A 5IDVA 1XPUA 4AZ3B 1NXXA 3O6VA 4G9BA 3KQKA 1T91A 3A04A 3EIOA 3ITEA 1V6CA 5FOWA 4MUNA 3CWCA 3K9GA 4L4UA 4KHZA 1KKUA 3FKIA 1B23P 1OFUX 2KQUA 2QMUA 1M7HA 1B73A 3O38A 2XUOA 3OQ6A 5DYWA 3VI3B 3FTFA 3D2LA 1FFBA 1S01A 1YVDA 2PJDA 5A4IS 1M2WA 1TCAA 4UAUA 1J2RA 3ZW8A 1F9AA 1N34B 1ZRNA 2N1MA 2G80A 2O3TA 1GHTA 2IEIA 5KYWA 3KD3A 2QTZA 4NPHA 2BF4A 3EDRA 1PR4A 1AKQA 3IEUA 5HCIA 3L18A 4AS1A 3P0RA 3TEJA 3WHLA 2ZIGA 1L1QA 3FB4A 2P2GA 2IV7A 2XD9A 4HB3A 2OXIA 1W6UA 1JR3A 2R7MA 4GQIA 2WYVA 3LECA 3S2GA 5CEFA 1F06A 3D4PA 4LGVA 2Z95A 4CMHA 4MA5A 5L9AA 4EYOA 4MQUA 1LQTA 3M82A 5BQPA 2OCDA 2O7QA 4IKEA 4RABA 3LBNA 3L40A 1ZUNA 4RVDA 3W7BA 1ZWLA 3JY6A 3ZCQA 1GG8A 1BX3A 3RC2A 3VX3A 4EJFA 3N70A 2FLWA 1KPGA 5EXSA 2PGNA 5HFJA 1QP8A 3NTRA 5T41A 2ZE8A 4PFQA 4PN7A 1U3GA 2V7XA 3IDQA 4AICA 3CKYA 4UC0A 1HSOA 1JPVA 2PWBA 4CM4A 2OZLB 1VB3A 1Z6GA 2BGIA 1WHSB 3TAXA 2ZIWB 2PZ8A 3IHKA 4HT3B 2X19A 3K59A 3NTQA 4CQLB 1NVFA 4GMFA 4BP3A 1E9CA 1C3LA 1MB2A 5TT0A 3KHUA 1T2DA 3IMGA 2DQ4A 5I9IA 1JBQA 3EDYA 1JL3A 4GE3A 3OI7A 1V2HE 3R4CA 4BO0A 3FSRA 3AILA 2GHIA 2BBTA 5BWBA 5CITA 4LFAB 5A0VA 5C4GB 2DUUA 1IN5A 1UC9A 1PK7A 1TRHA 2IEDA 4P84A 4MQEB 4CIAA 4GUAA 1VOTA 4CQMA 2B98A 5KYGA 3H5IA 4K46A 3WLQA 1TK9A 1QHXA 2GERA 2QMQA 3Q98A 3A9CA 2Q41A 3E2MA 1A35A 3GHHA 4FIZA 4G2NA 3FNHA 1P1BA 3WRYC 4KO4S 1V4NA 4IBOA 4NEGA 2Z2JA 5CLIA 3TTYA 4EM6A 3RUFA 2BE9A 4F9FA 1K68A 2II6A 2UV8A 3GQVA 1MIUA 1U1GA 2DZDA 2P0AA 3D5TA 2GA9A 3JD1A 3PFWO 4KDCA 4MYTA 4BQFA 4BFWA 4DMUB 3EDOA 1E2IA 1ZSNA 4B6EA 3CVJA 4DRYA 3HY6A 4KRYA 1YA8A 2OY0A 2PZEA 1VE1A 2CNLA 4UE6A 5EHQA 4AMZA 3DHYA 3LO5A 1YNOA 1FB5A 2HH9A 2K2WA 2V7UA 1GZ3A 1TM1E 3SIXA 4B45A 1E5VA 2AYYA 1M0TA 1CCWA 1CIJA 4IGKA 2OGTA 5B4VA 2C4VA 5DHFA 1GPAA 1GLGA 1NUAA 5FP0A 4NBNA 1Z2EA 4BNXA 5LA6B 4DDHA 2QLBA 1YL7A 3AI2A 3B78A 3UW1A 2M6SA 3PX7A 2ZZMA 1J9ZA 5DGHA 4JAVC 3RIEA 3USES 1YKSA 4AJPA 5IXSA 3KYLA 2QXTA 3QVTA 3G2PA 4HWTA 1E2LA 2PH1A 4EKDA 5CT9A 3SF8A 1FMJA 4GUDA 5HA5A 4LHZA 3T5DA 1UBHS 2R2AA 2F62A 2EG9A 5DBFA 3RRJA 5AFSA 2QTTA 3NM4A 2AT1A 4L5JA 5TMDA 2GM3A 2NZVG 4MZXA 5FLKA 1ZYUA 1IBKB 3KOYA 3VHLB 5A2QA 3QA3E 4CETA 3EGEA 1BXRB 1RDFA 2BFAA 2HO4A 4RM3A 3WOHA 2X8BA 3PNOA 5A4DA 2QJWA 1DIRA 1SQFA 3E4CA 1KJYA 3SXPA 3M1IA 5JBQA 1VXRA 4U5XA 2PGLA 4UUMA 1D1SA 5ANRB 4AKTA 4BLQA 4K9MA 4Y18A 4YRDA 5B2FA 4BMZA 4JJAA 4ZPJA 2NMVA 3T3OA 3MN1A 2FPOA 4JP2A 1V9SA 1LJUA 3A8TA 2QP9X 3CRVA 3PWZA 5TQ0A 4AO6A 2DE0X 2GBGA 3PCRB 5ALRA 3B5IA 4Z0PA 4F3TA 3JALB 3NNSA 3QVMA 2W6PA 1GYPA 1VPWA 1Q2UA 4KR9A 5E4YA 3AVTA 1LNQA 4BVGA 3RFCA 1C3EA 2DLNA 1QH1A 3BE8A 1ACJA 4X1YB 3RVDA 4EDFA 4F6RB 3TO5A 3OM8A 4MB6A 4CMBA 2EQBA 2W2PA 4I6EA 1QC5A 4B2LA 1GYQA 1JE1A 1QAOA 2CZGA 3OCUA 1D4AA 3OF3A 1AH2A 5A1JA 2FPPA 4EH1A 3HXMA 2WAOA 4HMOA 2E1RA 4D9MA 4DSNA 4S1OA 4GKAA 3C2QA 5KYUB 4XH9B 3E5RA 1Z28A 1KNXA 4KB4A 1K8RA 2WB2A 2C0CA 4LIPD 1QUFA 1BWSA 4NHEA 1XMOB 4FGSA 3AVUA 1U6KA 4ACBA 1QYIA 4UNPA 3SOZA 2MSCB 3F3YA 3T99A 1RRVA 1E3QA 4YAUA 2ST1A 1HE5A 1PWEA 2I6TA 3H17A 4H6XA 1HFJA 2H63A 4A10A 3OX2A 1UK9A 4MARA 4P31A 3ID6C 5ELXA 2ZYIA 4XZ3A 3RVSA 1FW6A 4EFDA 3VKVA 3PPVA 1IHOA 1Q7BA 1PG5A 2QGNA 3MGBA 4YAEA 4Q4LA 3L0ZA 5JCJD 5ICEA 1K6EA 3B9PA 2GAOA 3M4JA 3OQPA 2GAJA 1OV4A 3Q7SA 4IJ5A 4JUDX 2P75A 4CDNA 5BSEA 4Q6WA 1NBMA 1J5PA 4PZLA 2FW6A 3QX3A 4OUDA 2EW1A 3LUKA 1MW8X 2BEUB 1RLIA 3BKWA 4C14A 1IVNA 3U7RA 3N53A 2PVSA 4D42A 2X3FA 5CA1A 1G8AA 1Y82A 4TTPA 4TV9A 3ZH2A 4AWBA 4B6JA 2P6OA 5AHRA 2WZCA 5B2ZA 3DE3X 1M6YA 2AZDA 2BN4A 2WB1A 1DIAA 1T9KA 1SHTX 4BAUA 5CB8A 5JMOA 3MCTA 3PI6A 4XPIB 5JAIA 4ENWA 4Y3UA 5JSZB 3H9BA 3GLGB 1J2TA 4G5XA 3GLFB 3VZRA 3HEMA 3JQBC 3R40A 1E3IA 1SQ0A 2AL7A 2GN2A 2ORWA 4AXXA 5C18A 1TQHA 1WQGA 1X80A 2W7TA 4BUCA 1AMNA 3GTQA 3W1VA 5G1NA 1G2QA 2GSWA 1EINA 1YZUA 4U6QA 5F4ZA 4ZOAA 4LZPA 4Q1DA 4DF3A 4XWWA 3ZHYA 2BY4A 2HK8A 2GDJA 2WFAA 1XNQB 1GQFA 2G63A 3T8YA 4HUQA 2AXPA 2C4KA 2YXNA 4YWJA 2NO6A 4GGPA 4B4UA 3WLOA 3UN1A 1RIFA 4X54A 2WUEA 2BKUA 1A8QA 3TD9A 3TRDA 5LQMA 1C8LA 5GINE 2WVGA 4MGIR 4IJWA 1PX0A 1YJAA 3KYJB 2XW6A 1UJ5A 1A5SB 3B38A 4D3SA 3AW9A 3EXIA 1M34B 4L73A 2PT9A 4BBAA 2KW5A 1AG9A 2PUHA 3RSCA 1I6LA 2CB0A 4JLBA 1U8FO 4U7GA 5KQMA 1C9KA 1JFFA 4RNCA 4N6OA 2DBQA 3CUVA 3HKCA 4ZXPA 1ZW1A 2YHSA 4UZFA 1IHYA 4WXEA 4CRWB 4F4DA 2A6HD 3NUGA 1Y34E 2ORVA 3LQRA 1IWBB 2XKAA 3IVXA 3KT6A 2R97A 3T3GA 1UMDB 2NP6A 5FFNA 3UM9A 5TGTA 3EZGA 1K66A 3LP8A 4W8HA 1XEXA 2W6JD 1PW5A 1KYZA 3RVBA 1ZU4A 5JI2E 4XDHA 1DAOA 3VPAA 4DCSA 4NS4A 5BW6B 2QJRA 2UZ1A 3PXAA 3EEFA 1TVEA 3VAAA 1L8OA 2R1TB 5G0WA 4NFLA 3COWA 1U8CB 2W48A 4NJEB 3DP7A 1HFEL 2JJ2A 2O2GA 3I2FA 4MRNA 2P4QA 3MJHA 4NECA 4YUWA 4J0CA 4DRZA 1QHGA 2JGDB 1CTQA 1IEXA 3LT5A 4G36A 1XNJA 3IPCA 3TW6A 5KNBH 4RYLA 4DREA 2VNJA 2UVPA 3B7WA 3AVYA 3G0GA 5IC5A 4NZPA 5JAUA 1SRQA 3HTXA 4KFSA 2DULA 4HXGA 5F2OA 3ZWXA 1QQAA 4QWWA 5FDFA 5FA5A 1IPFA 2BEVA 2MWMA 2BWJA 3KLOA 4FPXA 3UF0A 2VUIB 3MB5A 3UXEA 1P62B 2HA5A 5A5FA 4BP9A 2IP2A 2ZJBA 4Z1MD 3P45A 3P2EA 1HE2A 3QBTA 4UVEA 4EG3A 2Z08A 1KEEA 4BEJA 4LXXA 3OT4A 1QAMA 1UPAA 1NDHA 3EVDA 4FN5A 1ZNWA 4DTIA 3I2HA 1I0LA 5HF8A 1KOFA 1F12A 1Y1TA 1QO0D 3FM9A 2A57A 2C5HA 2UUAB 4QU5A 4Z54A 5EWLB 5JALA 3KFVA 4L9WA 3QE4A 3NVAA 4TVSA 2X7XA 1HE1C 1RQPA 1SBHA 3FNFA 3AERA 3CE6A 1D8TA 3LHIA 4LE2A 1H8HD 4YQZA 3RYFB 1LBHA 1QGOA 3F4LA 3HBAA 4NNJA 1T26A 3ONVA 1OKKD 2AFIE 1WM1A 2VDQB 1H93A 2QT1A 2VPQA 3IQFA 4O2LA 3NJ8A 1G18A 5ALKA 4EABA 1V7CA 1ZMBA 2Q9UA 1UBTS 3I05A 1I8TA 3SZMA 3IT3A 1TX4B 5HTOA 3CPSA 2PGJA 4K6KA 4QGFA 5HIJA 2G06A 2GZHA 1ZH6A 4JIGA 4PCLA 3R8FA 4LGCA 5SV2A 2DOKA 1PYDA 4M6WA 1CZUA 4D6PA 5AVUA 3A1VA 1SA0B 1YQUA 3JQAA 3A9TA 4KI7A 2OCGA 4CKYA 2WBLC 1CY6A 2VJKA 1VL1A 2AYXA 3QVOA 3LT4A 3VDRA 1RD4A 1Y8AA 5HGXA 2GPBA 1G19A 2A0XA 2BONA 3C3JA 4XGRA 4A92A 2IDZA 1N8NA 2N47A 1DJOA 4PLCA 5I7SA 3DUFB 2EVWX 3KVNA 1V48A 1L7BA 1W49A 3F67A 3NXKA 2FP4A 2QVZX 2ZUWA 4NKRA 3DKRA 4QDOA 4RVCA 4QEKA 5I4BA 4JGBA 2AB0A 4BO1A 4A6PA 5AQEA 1RKQA 3UG7A 1ZN9A 2XOKD 3WC4A 4EDHA 3OIUA 5BRAA 3B9QA 5DHUA 2ARKA 3MWEA 4XTRA 3DCNA 4EPXA 5IKOA 3RAFC 2OFOA 1J4AA 3L0SA 1XMVA 3DB1A 3R2JA 4B7ZA 1I9GA 1XLTC 1RABA 1LLQA 2BUBA 1U7HA 3AR8A 3QOWA 4KOEC 2ZTHA 1KJIA 3OAAD 2C5BA 2LV8A 4RNDB 4CR7A 2JW5A 4EGJA 5E4TA 1M2VA 4Q5GA 4YP7A 3G13A 4HADA 2H1OA 2HREA 1CY8A 1FYVA 3V2GA 3C6YA 2EWMA 3EGIA 1H1LB 3BRQA 4U02A 3KTFA 4ND4A 4EL5A 2GN0A 1XRSB 4FS8A 2JLBA 2FCRA 4N39A 4AFNA 4L4XA 4I6GA 1ID1A 2GCOA 1JLLB 3T94A 3WGKA 4DR1B 4M1EA 5JQGA 5AI4A 1W59A 2NUBA 3QWIA 4TLLB 3OY7A 2P1RA 3NIGB 1RLOA 1YUNA 2IDJA 3DAYA 1GZ4A 2H4ZA 4MQFA 5HE9A 5LZ8A 4F1JA 3NMUF 1N2BA 3ORQA 4A36A 3AUSA 3NJRA 5K3BA 1SRRA 4PR0A 1W29A 2ASVA 3N2KB 1Q0ZA 2BCGY 2HLNA 3JQ6A 4WTOA 1HDEA 1OHHD 2C57A 3H9QA 1PJ8A 4H60A 2AFVA 4BQEA 1CUGA 3T3EA 1FE8A 1JB9A 1ZCAA 1ZWKA 3FUWA 4DYVA 3AY3A 1KQOA 1N7GA 3BFKA 3KJIA 1X7ZA 3SEZA 2NUTB 3IT1A 1U7XA 1RJ9A 1RWOA 3E5MA 3KOUA 3L1HA 4C3UA 2LCFA 1I3OA 1SK9A 4N5LA 5EPUA 2R62A 5CIWA 3RAJA 1XT6A 2NSDA 1FVXA 1M6EX 2Y0CA 1X1AA 1NVTA 1R0YA 3EH2A 1XNGA 1G8HA 3FFWA 3G0OA 1P6UA 3KAQA 4KSCA 3HN7A 3ZIAA 3MJTA 4URWR 4XASA 5F51A 4N9WA 1F9EA 2IHBA 1O5IA 1O95D 1Z18A 2PR7A 3MNFA 4N65A 5FULA 5B4TA 4J0DA 2XBMA 1O54A 2ZDGA 1JKMA 1QZUA 4FW9A 4FYYA 3UJAA 2EP8A 3JYQA 1NUPA 1PCXA 2C4WA 2VT6A 1SNYA 3IJ5A 3WGLA 2F1HA 4MQ6A 1Q0LA 3L4EA 1PR5A 3P9KA 3VMMA 1Q57A 1BDBA 2EL9A 2PBRA 1A97A 3RODA 4GBED 1YB4A 4O4HA 1BD3A 3Q7EA 3KKZA 5L4SA 1SZJG 3B6EA 2OZKA 3U26A 1ODLA 2Q2NA 3OZXA 1DRVA 1QF6A 5F9HA 4HEHA 4WGFA 1JQJC 4D6XA 3RYHB 1E2JA 1KAEA 3H3FA 4MR7B 1U3CA 3DH0A 4G2TA 4CV0A 5KWVA 5FCDA 1E3DA 1HT0A 4MJ3A 4ECAA 4YYZA 1C9DB 4LRUA 4MWTA 3OIYA 4Z7QB 1KQ3A 3CNLA 1KI4A 5L53A 5HILA 4M0PA 2NTEA 4XLZA 5IG2A 3M6UA 3ABQB 1T1JA 3A26A 5DXAA 2NU8A 2TRSB 4LJYA 3D8NA 3DHWC 3FVQA 3ODPA 4R3UC 2I2WA 3V6MA 4B3CA 4CIVA 3TIIA 3CVXA 2IHKA 3PXCX 4MVJH 1V41E 3A70A 3URKA 2LRHA 1H0HA 2FETA 4BNYA 3D0OA 4GWLA 1J20A 4EHFA 4EF5A 3HUTA 3CG0A 5K99A 1KORA 4HLQB 1J8DA 5F9FA 3ZDYB 1NRJB 3EWAA 4RA6B 1A5TA 1S2MA 1RZVA 3GZNA 1E2KA 3WGTA 4B7AA 8LDHA 3HM9A 5LBUA 4YV2A 1C1DA 3OWHA 3G5MA 2BFEB 2JFOA 4OIMA 4Q4DA 3UV7A 5JZ9A 1ORDA 2ZTUA 5KUTA 1BVUA 4WPGA 1AKYA 1VRVA 2Q5FA 4Q9IA 4ZAGA 3ER8A 1SUWA 2DC1A 3T5BA 1Z5WA 2PZKA 3U4HA 5EJ9A 3TGPA 3I2GA 3GEMA 1T3SA 5IAKA 3THRA 1XN4A 2C1XA 2OD2A 3BWBA 4CL8A 2HWYA 4QFBA 1EXMA 3PJDA 3PX2A 4P3KA 1JSRA 3B3GA 2QLTA 1CZOA 5ADVA 3OT1B 5DW0A 2PZBA 1KSJA 4ER5A 2V7PA 4FE3A 1ZOSA 5CH3A 4E46A 3IIJA 1SZDA 1HLFA 2Q27A 3GYGA 1R64A 4IDQA 5F78A 4UFPA 2XWPA 4F4CA 4B71A 3WLHA 5LL6P 1IZ7A 1NQAO 1PQPA 1CK4A 1DBVO 2AOUB 3DQQA 1CLEA 2COUA 2W2XA 1EGVB 1U8UA 4QYIB 1GVNB 2VQ6A 3KS9A 1SOWA 2DPGA 1CJBA 2JF0A 1O94D 2WINI 3JSXA 3L4SO 4N3AA 3DTTA 4J3NA 3S2EA 3VNQA 5JMPA 5DMHA 4YMGA 1YCHA 4YAJA 1P2GA 3Q2KA 3PPXA 3MD9A 5BORA 4TLDA 5DTQA 4P33A 3L43A 4W9MC 2M32A 3C8ZA 4EX7A 1YV9A 3LHPS 3LXXA 2YUTA 5JJLA 1MX1A 1MJ5A 2C8LA 1AGNA 1ZGAA 1H65A 2FQWA 3DEJA 3MEQA 3EWIA 3RRBA 3AX6A 3SBDA 4GNKA 3OE1A 1L5YA 4RW0A 2ZAGA 3K0CA 1IJFA 4JODA 4TQ9A 5T5QA 2EZ8A 3O4RA 5HSGA 3ODGA 1TUBA 2QDXA 4EVSA 1O6ZA 1KSGA 5JXJA 2YWDA 4HSGA 4ZVMA 1MX9A 1VHLA 2R9VA 3VR6D 2GB4A 3TXXA 1RTKA 2AMVA 5FO1A 3W7AA 4BNUA 1E20A 4GMDA 1NYTA 1XVTA 2E37A 3HFRA 1U0NA 3D8TA 5JSBB 3STUA 1UXKA 1CQJB 1KSFX 4N3GA 1TCBA 4UVIA 1JHVA 1XZCA 2XAUA 4MS4A 2B78A 5ALPA 4EW2A 2BJWA 3WBKA 2G9RA 3IHTA 3NHZA 1HDOA 5EWJB 2JCVA 5KNCD 3Q40A 3KQQA 1AQIA 5BR8B 1RHUA 5I8WA 4R9UC 3PJEA 3E70C 4OP2A 4NMLA 4B3XA 4PV7A 3CO5A 3WQSB 2WY2D 3FDZA 5SZJA 5A5EA 1OZAA 2X9GA 2INGX 5A7FA 4JI2B 4OB7A 4NCAA 5F3RA 4B3RB 1IL0A 1JXOA 4EX6A 2MR5A 2O7RA 1QE0A 2LBPA 3EXHB 3SMQA 1ISJA 2YOGA 3AWDA 4HHEA 4O4IF 4CUZA 4EJSB 4JJFA 1NIPA 4P0PB 5T4HA 3T9CA 2B9SB 1R4NB 4TMXA 2QTWB 3ROTA 5IJZA 1TW2A 3LOQA 2JBAB 4HDCA 4R2LA 4D45A 2HDWA 1JHZA 5HZHA 1UINA 1ML4A 2PX3A 3HSKA 1XZMA 1FQWA 3KJHA 4UXHA 1KVSA 3RU2A 2MMGA 2ZEJA 1I4WA 1KQNA 4DLAA 2IY8A 4F56A 1VHDA 3PUWA 3V34A 4OB8A 4BMXA 1W2GA 2P9YA 4DRXB 5LU9A 4FYDA 3EPPA 1XI2A 4DNXA 5BVGB 2YFYA 2XZTA 4HAYA 5AYVA 5DV9A 1ARZA 4O2RA 1U1FA 2M6RA 1DDOA 2VLIA 1L7NA 3TRHA 1N57A 3DE7X 5HF5A 2ZYAA 2ZWPA 4PG5A 1F4PA 2X3YA 3L6OO 3M0EA 2J3HA 3BK7A 4BAGA 3C6KA 1CJMA 3GK3A 1C7EA 4KAJA 4N6NA 4L0CA 1HRDA 3DTVB 3DBLB 1M2OA 3GCWA 1G5HA 4Q19A 3VH2A 5A5GA 5CX1A 2WHPA 1Z0KA 3DTVD 5EIHA 5IWCA 1HORA 3EGDB 2EEZA 4RIHA 3AOEC 3FFAA 5AW9A 1O95C 4BVAA 4OQQA 2GFQA 2IPMA 2J3IA 5I7RA 4YRMA 3H5NA 3WMEA 5JS6A 4EW3A 4L8WB 3M6XA 3CRW1 2MHCA 3JWPA 3KUCA 3AVXA 2EW8A 1H5QA 4ARZB 4C88A 4QTYA 2L18A 4Y1FA 4NE9A 5JJIA 5K7SA 2DHCA 4A0FA 1V6SA 3IRUA 3GLUA 3NYWA 3FKSD 1E2MA 3TKYA 2OKCA 2EFJA 4J1SA 1TU3A 2EZ9A 3L7LA 3I83A 1UANA 4J3JA 2J87A 4IM7A 4G1FA 4GE0A 2JD1A 1ELOA 3QPAA 3QLJA 5LQAA 1AD2A 3QUAA 3T9FA 2IUTA 1OA1A 1V5EA 1Q74A 1MOQA 3Q8XB 2XCQA 4R1TA 3WIDA 3ZGNA 3JQGA 5FUYA 4RTMA 1WUTA 4OXIA 3D6UA 1FY2A 4FUQA 2B92A 1T9BA 1RYNA 2YHIB 5HKOA 3HXPA 2E89A 2O0MA 3OTIA 5FL3A 3HWSA 4TUYA 4QUGA 2ENWA 5DO9A 1I1NA 3SQOA 3TLBA 4HWGA 4ZVRA 3UNXA 2I5PO 3L0OA 2QN7A 1NHWA 2NO4A 1ZOPA 4TV8F 4F97A 3FOEC 1L5VA 2TMGA 5TX7A 1Z4LA 1AO3A 4MS1A 5EVCA 3M3PA 4NAHA 4DGSA 3MBKA 2JAHA 1GRNA 2XRZA 3OOJA 1E1CA 2FKNA 4YRGA 3OLQA 4G0MA 3RQSA 2NG1A 4BRZA 3MWFA 4D3XA 3GLQA 1F2TB 3EW7A 1MOPA 1UBSB 3ETJA 1T0UA 3MMPA 5IASA 1JR2A 5A71A 4PRLA 4UVDA 3U4AA 1XPRA 2JLYA 1SVIA 3DMNA 4XDZA 5AI5A 5HOEA 4EO9A 4KR2A 2QPTA 3OQBA 2DETA 5IJAA 2H48A 4J03A 4Q7EA 3U39A 4DT1B 1Q21A 4NYMQ 3E4DA 1A96A 1NX9A 3NJ4A 3Q0EA 4TRJA 1DAFA 5ELLA 2AZXA 4LSGA 4NCIA 2QRLA 1JZQA 2QYSA 1MC4A 4WCDA 2QF7A 3ZWAA 3FSJX 1TE2A 3FRHA 3KNZA 3U0BA 3PGLA 1OFUA 5E95A 3BDVA 5K8VA 3RS0A 3G8YA 4KLNA 3OCXA 4DLWA 2PSEA 3U61B 2NO1A 3LM8A 4JVOA 4L4SA 1BOOA 5BT8A 4JC4A 5KPDA 2RSLA 2HGZA 3AESA 1QUEA 3MCZA 3CVVA 1GE9A 3CF4A 4N48A 2JFNA 1TT5A 3TW8A 5CH5A 4YT8A 1D2NA 2Q3MA 1GTSA 3AVVA 5DTJA 4RY0A 5E6SB 5CFOA 4WERA 1KEWA 4JI6B 4P9NA 3OZTA 1RVV1 8GPBA 4XFKA 5KOHB 4YJGA 2JRLA 4BFXA 2EQ5A 1WRBA 2GEJA 4UKDA 1CWUA 1F0KA 1GV0A 3O4GA 5GIOE 3IGFA 5HF9A 4WFKA 2NXJA 3GEHA 2W8ZA 3UKDA 1WCXA 2GRAA 4ZDIA 5HBRA 1LU9A 4PSAA 3PTLA 4P3PA 1E7YA 1TEXA 2OCAA 2B1QA 3SBXA 3WYBA 5FEUA 2QN2A 2ZRLA 3BVPA 3WNQA 1CQWA 2R5WA 3TTXA 3T1TA 4X6LA 2AG5A 3RFFA 1WKVA 1P7VA 1ULZA 5CK4A 1GZ5A 4ARUA 1G41A 5KB3A 3AF5A 1D2EA 1U9ZA 4DSZA 1A5ZA 2FGKA 3GGJA 1DG1G 4FMDB 4U4AA 1U31A 3ZG6A 4G6ZA 3G9XA 4PHGA 2CXNA 2G25A 5DNVA 5KYKA 3BZBA 5K8UA 3SEQA 4D81A 1I7NA 1KEUA 2JCBA 3DFIA 5G3YA 1Z82A 2JGMA 3T95A 3ZXXA 2DP4E 1QBGA 2YJNA 3DCJA 4PANA 1KZ6A 4O2AB 5D2CA 3SS8A 5BRNA 5ERXA 4DLKA 5EJGA 3W3ZB 1KPHA 2R96A 2C9DA 5DYTA 4TTTS 1A76A 2JC3A 3TOSA 3QU5A 2P2LA 4XQ9A 3EXHC 1HWYA 2H7XA 4C0LA 3IMEA 3WAJA 4TS3A 4EJSC 4DQVA 2G9NA 4ESOA 1G8PA 2OK7A 1YMQA 1ISMA 1OVGA 4R9VA 5KOJA 4F86A 3OETA 1A9OA 1CERA 3KU4A 4GYWA 3TDKA 1DQRA 3H6HA 1NTRA 5AUPB 1I2MA 2FVYA 2RE8A 3NHLA 3DMTC 3QLUA 2A0KA 5AJZA 2WM3A 4A16A 2O7VA 3EIFA 4QQ8A 3O1HB 3X1ZA 4PQYA 5BV7A 2BZSA 5HUHA 3JAWB 2X13A 4NAVA 2O2JA 1QAQA 2C5AA 4JS0A 3RQIA 2A0FA 1K0FA 3C8MA 1C1XA 3AFHA 3PVCA 1U02A 5KSZA 3BREA 2WA2A 2IHUA 2CLSA 4L8LA 4Q39A 1NNLA 3L77A 1XHFA 1IVYA 1KQFA 3JQ9C 4MCJA 1HLGA 1XP5A 1YRLA 3UUEA 1TWFA 4DMCA 4Z53A 4EMBA 5DSZA 3TRIA 2GHQA 2UU9B 1GPWB 3JXEA 3N2IA 3ZR4B 5KNDD 4ON9A 2XQJA 5CJ2A 4YJDA 3FHTA 2HADA 4D0GA 1K7FB 2CDNA 1SOUA 2BDUA 3RBAA 1MO2A 1MJFA 3UW3A 5AVVA 3OHMA 3SFTA 3WLIA 2UXBB 1LH0A 4YXWA 1V7ZA 4W6QA 4BB6A 4J1QA 4Y7DA 5BSVA 3Q3EA 3AHEA 4P6VF 1NFQA 2Q9CA 5EJ7A 3JQFA 4U6SA 5FKJA 2IV3A 3DQPA 2PPLA 4XUDA 3GAFA 2ZUVA 3Q41A 1STOA 1XYGA 3KP1A 1P1IA 4CMJA 1NW3A 2G6BA 1YAHA 1E7MA 4G5YA 1IM8A 4MSUA 4OV6B 3W6UA 4EHJA 3CPHA 4M8KA 4O2BA 3VKWA 4B40A 4WXHA 4DLTA 1PT8A 4FI3F 5TPZD 3OMWA 4H1VA 3SDSA 1P9RA 1XHLA 4ENTA 1OAOA 3LK6A 4MW2A 4YMUA 2OO5A 5C2JB 2BGNA 4RBNA 3NUQA 4UUBA 2QK4A 3KOMA 1FFAA 4BNFA 3IAUA 5H82A 4KQIA 2C95A 1S3GA 4KH1A 1SC1A 3S4YA 3WLTA 2ADOA 5DLDA 4D4GA 2X86A 2ERCA 2OV3A 3H87A 2I3ZA 3Q7IA 2WD7B 4L5IA 4LHYA 2Q07A 3BMCA 3DMDA 4Y0NA 1W88B 4RMJA 1VLQA 4RK4A 4C01A 4HEA6 2GXQA 4TX1A 2VS1A 1OUMA 4IS3A 3UJ6A 1R0RE 3T1HB 2PXHA 1EEXB 4IG4A 3GNQA 3AKCA 5IU6A 2QTVB 1QSGA 2QN8A 4JT2A 4E5PA 2R6DA 1CIVA 2FMTA 1BJRE 1GTVA 3C8UA 2BFPA 2GNOA 4ZT5A 1EFPA 4AN8A 1E6MA 1SBYA 2GEFA 2YUIA 1F0PA 3ABZA 3P9SA 1ISEA 2D0PB 3AP3A 1W5TA 1Q0SA 1P5JA 4AUKA 3MT7A 1OXUA 3AEUB 2VA8A 4KPUB 2IOHA 2C20A 4I50F 5INTA 5T4BA 2EV9A 1TJNA 5IVPA 2FWNA 1UBCA 4X65B 3KCNA 1ABFA 5AKEA 2IC5A 2SKEA 5IDWA 1H1DA 1OLUB 4YLYA 1AA9A 1J42A 1L8LA 2CXPA 3QENA 3TTUA 4MW0A 1ADYA 3NXSA 1ZUWA 1H2HA 3BSSA 2G28A 1VSBA 2V4MA 3VJKA 5BN4A 1XGKA 2BBSA 4C89A 3UGQA 3CPEA 1II9A 1QK4A 2A9KA 5FV7A 5J2UB 4QQKA 5AM1A 4C0BA 3N6RA 1ODTC 4HWOA 4LDNA 4P4NA 4PLTA 4W9RA 5C8YA 3RT7A 4F8YA 3K20A 5D5HA 1RC1A 2B9EA 4Q3NA 4R4JA 1C41A 3D7KA 3G5TA 5HQ3B 1J2YA 1IU9A 1KMIY 4X61A 4E2YA 1QCZA 3WMRA 2BZGA 3MCUA 3PGMA 4B4OA 1I6KA 4L7VA 4F4HA 4U8GA 1ZCJA 4QU9A 3RAPR 4QTXA 5DW3A 2H1FA 4YFYA 3KWFA 3MIIA 5A6SB 3P2MA 1P7CA 4PC1A 1R8JA 1TADA 3K0EA 3EPRA 2Q29A 1BEUB 1G8YA 1WKBA 3KJNA 3NOXA 4QG3A 3SJRA 1JSZA 1RI5A 3CFYA 3IQEA 3ADDA 4E11A 3J7TA 4RHXA 1UR5A 2WVJA 4GX1A 1BMFD 1CR0A 1PK8A 1WSAA 2BSAA 2YR0A 3D8HA 1N3IA 3ITDA 4C5AA 4AY2A 2OE2A 1ZGZA 1KHTA 4H1UA 2BFDA 4ETWA 1AKVA 5DM2A 3ZZTA 2QVLA 3HVHA 3K9CA 4YP9A 1ZJ5A 4AT1A 2XYHA 3OTOB 4UBJA 4R6WA 4HZIA 3F4KA 4W7IA 5FIUA 3U7QA 4BCBA 3DV2A 5JH7B 1U0FA 2UXDB 3FZYA 1GSHA 4R8VA 4BU0A 2FW8A 1Y4DE 4R5MA 1XU7A 1OZFA 1Z75A 3I04M 3OQIA 5J5CA 5HE8A 3FNRA 1RPZA 3DMHA 4XIIA 4O4LF 2E1PA 2FG6C 1PTKA 1QH8B 1ZG3A 1HXHA 2CW0D 3N3AC 1QHHB 4FEAA 4FT2A 3K0SA 1ZM3A 4EIWA 2YCLA 3U4QB 4J91A 2D1RA 4O08A 3NDBB 2X4IA 4EG6A 1UKAA 3H97A 3BMNA 4J6EA 1PJQA 3WNVA 4QYTA 4EQ6A 5JVDA 1SC6A 5JSQA 3WGIA 1E58A 3WHIA 3ZE9A 1S3FA 2HZBA 1ZIDA 4XM1A 3G0CA 4IH4A 4FINA 5G53C 2R8PA 2HK9A 3WWYA 1LNSA 1KRWA 2GJSA 1JA0A 2CZQA 3GUCA 3QYFA 3IE1A 3MJSA 2PSDA 3DTYA 2DUWA 3HYTA 5J4VA 1J6UA 2VQ3A 3CCBA 2I67A 4MVCA 2I4IA 3CUKA 1M8PA 4R3NA 2WWYA 1WA5A 1QP4A 4GI1A 3WJ2A 1ZMRA 1QOPB 2V9CA 3U3JA 1FFHA 2A4MA 4IF6A 2ZUFA 3H3XA 3RK0A 2QVGA 1F2VA 3U7HB 4FQ7A 1U9YA 3UK2A 4CEHA 4WUTA 5K3AA 4D82A 1ABEA 1ES9A 1QQ7A 2OCYC 1T0BA 4A8JB 2FRDA 4GZ3A 4KXXA 4TRNA 3TB6A 3BCUA 3KTAB 2GN4A 2PBFA 3S2FA 3GQBA 1ZD3A 1EX6A 2CXHA 1DJNA 2J7KA 5HYVA 2F8SA 3FYSA 4BEVA 1MP0A 1SUIA 2B2XA 1N3YA 2VSFA 5F9MA 2HHHB 1TUEA 3RO7A 3NWBA 1GQQA 3GD7A 4NZOA 4W4TA 1NUUA 4ND8B 3C3DA 4FHZA 2R79A 1FNSA 2W00A 3AUUA 3N74A 3KTDA 1UBOS 4FE7A 4Y2YA 3FVWA 3HFSA 3I28A 1JHPA 3U4DA 1G21E 4TLAA 5H80A 2JIPA 1EIZA 3OU7A 1NW4A 5JIBA 1CUXA 2FKAA 1I4LD 4WZAB 3W6OA 4DLVA 1FQJA 4QL3A 2X7JA 3BTOA 3HWX1 6LDHA 4DSUA 5KREA 3O7WA 2F8TA 4TWRA 2V0CA 4CF4A 3S44A 4FIDA 3LPCA 4ZQIA 4JJEA 3FTQA 5AOAA 3WZLA 2F9LA 4MIKA 5DTEA 4C04A 4H0FA 3P9RA 2ABWA 2WU3A 4JLRC 2QY9A 3BOSA 3LC2O 4LC1A 5FBQB 3ZHVA 2QWXA 2W43A 3OPYA 3IP6A 3AF6A 1S89A 4G5GA 2PL3A 3QXXA 4HWSA 1E9DA 3UA3A 4QT4A 4J9UE 1IB6A 1T2NA 1IOWA 3CWQA 4M1TA 3ZIUA 4BO4A 4DIUA 5K0EA 1RC8A 2NZUG 1FJXA 1YJBA 2HHAA 5THQA 3T35A 2J9RA 3FCUB 3U48A 3G5LA 3UY4A 1T2FA 2G7MC 4DZRA 1G8GA 4Q7KA 2BT4A 4X91A 1BXZA 2ZRPA 4RVUA 2CK3D 1UJNA 4MCAA 1YFLA 1ZBQA 2ONKA 1B8VA 2ZW9A 1GTZA 1ZEJA 3FDXA 2Y0SA 2CKMA 5TS2A 3WB0A 4DUPA 4YR9A 3G8CA 1Z83A 5J2TB 1YC5A 4RJIA 2NZ2A 1Z25A 3JVEA 3F1LA 4H16A 4J94A 1RYZA 5DNAA 3QW2A 3SKYA 2XB2A 4JENA 1OX6A 2OUIA 4HAWA 4D1YA 2QOEA 1G6HA 1X94A 5D3ZA 1WSBA 2I4RA 4KQGA 1YBHA 2ZBRA 5AH0A 5JS2A 4HEJA 4PZCA 1FU7A 2IYUA 1UJMA 2WSLA 4CBVA 1L5NA 3FPCA 1RI1A 1UKYA 2DSNA 5DWDA 2XR1A 4HN2A 4CM8B 5A3RA 2V0GA 2QL5A 4L50A 2CDRA 3FZEA 4L8VA 5JW6A 1YKFA 2Q3FA 3CLHA 3VDQA 5LP6F 3EE6A 4HNAA 3RLIA 2CXXA 5CYFA 4EPTA 3G9QA 3KYDB 4OKSA 2PEYA 1I3LA 1SELA 2P6MA 5THXA 5JXHA 1GM5A 1D9XA 3H1FA 1L7QA 1ZHFA 3PGVA 3QV2A 1JQ3A 4YP5A 3EZ2A 1JDBB 1RM5A 2XB4A 1QYRA 2NSYA 4J6FA 4OG2A 3ZD9A 5KNLA 5CHEA 3SIPA 3QFSA 3DPUA 1R5BA 1UC4B 3IXLA 2IYOA 1JFVA 1GZHB 1Z5VA 5MDHA 4O4IB 3T61A 5KTOA 2XVXA 4OK3A 2ZSKA 1DOHA 5A3SA 4ARIA 3OPYI 4MGKR 2EF0A 4QHYA 4EKIA 3NVMB 4E2XA 4F21A 2QTCA 2DKOA 2NZ8A 3ET5A 3S1AA 4KHPB 2YH2A 5HFAA 4DAOA 1NR1A 2IU3A 3HU2A 2CNWD 2ZBQA 1P1FA