4D3YA

The structure of inactive prolegumain from chinese hamster.
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
404
structure length
384
Chain Sequence
GKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMSPISLPPVTRLDLTPSPEVPLTILKRKVGQIQRLLDARHVIEKSVHKIVSLLAGFGETAERLLSERAVLMAHDCYQEAVTHFRTHCFNWHSPTYEYALRHLYVLANLCEKPYPIDRIKMAMDKVCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
molecule keywords LEGUMAIN
total genus 139
structure length 384
sequence length 404
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4d3yA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3yA01
4ZVSA 4FDLA 4N6GA 4HQRA 3H13A 4QU8A 3KJNA 4NOKA 4N6OA 4JJ7A 4JQZA 3PD0A 4N7JA 2CNKA 3K7EA 2XZTA 3KJFA 5IARA 2XYPA 3PD1A 4JR1A 2C1EA 5IBCA 5LUAA 3R6LA 4EHAA 2Y1LA 3R5KA 3H0EA 4ZVQA 4D3ZA 3H1PA 3IBFA 4AWBA 1I3OA 4EHLA 4HVAA 2HBZA 2H4WA 1RWNA 5IAKA 5IAGA 1RWVA 2C2MA 5IANA 3IBCA 2FQQA 2P2CA 2QLBA 3V6LA 1GQFA 1RWMA 5LUBA 2QL5A 1CVRA 1SHJA 2XYGA 1RHMA 2CJXA 4QUBA 4ZVTA 5IBRA 5IC6A 3V4LA 4JR2A 4FEAA 2AR9A 1ICEA 3V55A 1RHUA 2J30A 3ITNA 4EHDA 4QUJA 2DKOA 2HBQA 4QUEA 4N5DA 1QX3A 5IBPA 2QL9A 4NBLA 4M9RA 4EHFA 3UO8B 1QTNA 1RWKA 4D3XA 4QUAA 5IAJA 4NBNA 3R5JA 3P4UA 4ZVOA 4DCJA 4EJFA 3BIJA 3D6MA 3EDQA 4QULA 4NOLA 2H4YA 3D6HA 5K20A 2H65A 4DCOA 3EDRA 1SC4A 2CNNA 3PCXA 3V6MA 4I1PA 1IBCA 2Y0BA 4QUGA 3GJTA 1SC1A 2J31A 3OD5A 2NN3C 4LSZA 4EHNA 3DEKA 1GFWA 4FGUA 1NMQA 2CNLA 5LU9A 4ZVPA 3DEIA 3D6FA 1RWXA 4N7MA 2QLJA 4AWAA 4PS1A 1F1JA 1K88A 3H11A 4I1RA 1I4EB 2QL7A 1BMQA 4HQ0A 4QTXA 4QUHA 4JQYA 2HBYA 4QUIA 4ZVUA 5H0IA 3H11B 4PRYA 1K86A 3SIRA 3SIPA 5JFTA 5LU8A 2WDPA 4EHKA 3V4OA 1RHJA 1NMSA 1SHLA 3GJSA 2C2KA 2XZDA 3R7SA 3V3KA 1NW9B 3DEHA 4QUDA 1JXQA 1PYOA 2QLFA 1KMCA 2CNOA 4NBKA 3E4CA 1M72A 3R6GA 4NOJA 5IC4A 3KJQA 3NS7A 5I9TA 3UOAB 3DEJA 4JB8A 4JJEA 4IEFB 4IYRA 4NOMA 3R7NA 4N6NA 4D3YA 1RWOA 1QDUA 2K7ZA 3GJQA 1RHKA 1RHRA 2J33A 4PS0A 3RJMA 3S70A 2XYHA 3GJRA 2H5IA 2CDRA 4AW9A 1RWPA 2FP3A 1RWWA 2C2ZA 4ZVRA 1F9EA 2H48A 4QU5A 1SC3A 4QU9A 5IASA 1PAUA 2H54A 1RE1A 2HBRA 4QU0A 3QNWA 4FXOA 2CJYA 1CP3A 2C2OA 4JR0A 4EHHA 1I4OA 4JJ8A 1RHQA 3S8EA 1I51A 4PRZA 4DCPA 2FUNB 5I9BA 2H51A 2H5JA 5IAEA 5IABA 3NKFA 4QTYA 3P45A 3NR2A 2J32A 3R7BA 1NMEA
chains in the Genus database with same CATH superfamily
1OXKB 3FBGA 3ED5A 1EX6A 2OUIA 1NHGA 2ECOA 3QX7A 4V3BA 3OIYA 1ZUHA 2W6PA 5TNXA 4EITA 5DGTA 2JH9A 2L82A 4IDDA 5JYCA 4LJLA 3E53A 4GUDA 4IKOA 3PR2B 2Z5LA 1YR9A 1N36B 2W2OA 2VDRB 2RGUA 3ZU3A 3W90A 4WXMA 2QPOA 1ORHA 1YV9A 2G72A 2VDQB 3GZTB 5CRIA 2QF7A 2XE8A 4HX2A 2FZKA 5AJXA 1XCBA 1RXSA 3NRBA 1U9ZA 3BIXA 3TB4A 3E22A 4CHGA 4DRXA 3IPAA 4EKIA 2HQ1A 2WR8A 1TJYA 3FHLA 3NUGA 3D1LA 1GCIA 3O6VA 4R2LA 1SB9A 3DWEX 4OQLA 2HF8A 5BW5A 5A62A 1VCOA 4DKJA 1SEVA 3CRW1 2O9JA 3TUIC 4E1BA 2PJDA 2WSMA 3L79A 1LSSA 3PYMA 2AOTA 2AC2A 1U7XA 4HP8A 1SVKA 5JH7A 4B80A 1KXZA 2V6BA 3EFOA 3PPXA 5DTQA 5K3SA 3U6KA 2AG8A 1XCJA 2H5EA 2ZIVB 2WYOA 3EA5A 4AWXA 4TRNA 1VBNA 2XDQB 1N3YA 2HNBA 1GJRA 1TF7A 4ZT2A 2CFTA 1B8OA 3GDHA 3EBOA 4ZA2A 5EE5B 4KCGA 1KO8A 1Z5GA 2NTYC 1AC5A 5CA0A 5HXAA 1O97C 5BYJA 4L5AA 4N82A 1EVYA 2PDAA 1T9CA 3PGXA 5LNK1 1I32A 4B31A 2ZBGA 2RHLA 1WDLA 2Y0BA 5LQAA 3KLNA 4EFLA 2FUKA 3DP7A 3KXPA 4EMBA 4CM3A 4R7ZA 4JZYA 2KW5A 3TQFA 3FOZA 4OKIA 2D54A 3QPWA 5I7OA 2WLSA 1A82A 1HDCA 3F71A 4FDMA 2GD2A 1UC4B 3FPLA 1N6NA 1YUNA 2FB9A 2CZCA 3PGMA 3FI9A 1KPIA 1LKZA 5DHPA 2DQSA 1CUUA 1V7QA 2QD4A 3BJRA 4Q5IA 5TPWA 1UJNA 3D5EA 1CT9A 3BXXA 1O6BA 4DLBA 1L5NA 1WS6A 3BBLA 4RGVA 5KYXB 2GMWA 3PXEA 4HNRA 3A1VA 3UUEA 4YMVA 4NOMA 2X2OA 3W2HA 1ZR2A 1M0WA 3VGPA 4OXNA 1EJBA 5LOVA 4LX0A 2BFAA 4H2DA 1FNCA 2XHEA 3HVHA 4RFSA 2JFFA 5JJIA 5EIEA 3MUEA 1RPAA 4BMSA 2RAPA 1H2YA 1BKDR 1M1NB 2PMDA 4UU8A 3WL7A 2XDAA 2FPSA 2GASA 3NVKI 3TZCA 4DSOA 4LBYA 2SKCA 4P4GA 1L5MA 2UXBB 2JK1A 1WCYA 3EDOA 1IVNA 1R9MA 2FQXA 4LC0A 2GPJA 3FCXA 1WUIS 1DL5A 1E6UA 1OYOA 1TUBB 1YD7A 2H0AA 2VQ6A 2V7QA 4LOLA 1UKYA 1Z37A 5JH7F 3R5SA 1CYDA 5FD8A 1VCHA 3SXUB 4XZ3A 1QFZA 1W6RA 2WJJA 1EFVB 2O06A 4XKJA 3TXXA 1YUBA 3LDAA 1YNOA 1CY4A 1WHSB 2VLBA 1VKNA 4KQ1A 4MUBA 3UGQA 4DKXA 4W8GA 3KYDB 4B6PA 3EEFA 4S3MA 5AD1A 1EFAA 1T1EA 3L8EA 3GC6A 3K53A 4GX5A 4ND3A 2G0NA 3BCUA 5A3QA 1HZJA 4L9SA 5KWEA 3PVCA 1XF9A 1SKYE 2BM0A 4P80A 3KBOA 1Y9EA 1EAMA 4P82A 4Z0NA 3ECAA 3W6PA 5L45A 1OFHA 3HP7A 1DAOA 3BGVA 3IJRA 3JZFA 4L74A 4MWTA 5ENZA 3A04A 5EZ6B 4RKWA 2XMPA 2AVNA 4ZCSA 4DV7B 2D7DA 2Z0MA 1YFZA 3MGCA 3NRJA 4L50A 5J40A 1W0KD 2B82A 2ZWVA 1U2ZA 2X40A 2ZYSA 4K81B 3OQHA 2DBQA 3RHSA 4BMZA 2UVQA 2ZRIA 3NEYA 2ATCA 1DIGA 3QVOA 3ZQUA 1RJGA 3WTBA 3LH5A 4XD2A 4KH1A 5HCUA 1EDOA 2ZJOA 1OWLA 3GMDA 4NENA 2I9PA 1DT3A 3SPXA 3DDWA 4MLCA 4DR5B 4KR7A 4RIHA 4BJ1A 3PNVA 4QM6A 3U0VA 3WLKX 1NP6A 3DGFC 1DO2A 3TKYA 4INPA 2P4QA 5C8ZA 1OZFA 3HSSA 4BYGA 1N57A 1EA7A 4ZYLA 4BPBA 4YJ3F 2PUGA 3NQ41 2J7PA 3AF6A 3ZWQA 4UTVA 4LCBA 4MITA 3WLHA 1BVHA 3QEJA 3VPHA 3THXB 4E5UA 1OBCA 1D1QA 1NVXQ 1WKCA 1YQUA 2Z5VA 4TWRA 3R7AA 1OI2A 2DX7A 3IT1A 4BQNA 1ZNZA 1A27A 4C7MA 1Q44A 2J45A 2P2YA 2PA0A 1UJ5A 1DXHA 2O48X 5G0TA 1GGEA 2R6GA 2DRIA 2FG5A 5CUQA 4U9IS 1JILA 4GW3A 4XUDA 5ALSA 5JR3A 4W63A 1WMFA 3LVQE 3ZDRA 2HDNB 1QDEA 4MVJE 2B5WA 2GZSA 1L5FA 3HNRA 2SHKA 1XVUA 1NI3A 3VX4A 1JA0A 3GAAA 4QFBA 4BNFA 2DULA 1X1AA 2OAEA 1J7JA 4K6HA 2V5VA 3QEOA 5A4IS 1H4QA 1YQQA 5E4JA 1W0JA 4X1YB 2Z2JA 2DHEA 2Q28A 1U1CA 1UM9A 4N1AA 1KOLA 1WDKA 3S8YA 4IAOA 1N5JA 2HSGA 3V7YA 1M72A 2GPAA 1RMTA 3UWDA 3MINA 5EQTA 1PWYE 2ZXEA 3R74A 3B13B 2HDOA 3E9ZA 2FRDC 4OLHA 3V8VA 3GLUA 1Z08A 4XASA 1H2AS 5JRJA 3AY3A 5HIAA 3EODA 2JLSA 1C3OB 2VZ9A 3ONEA 5KB3A 4MIYA 4OGKA 2QI9C 4MKXA 3A4MA 3ZVRA 2O05A 3IT2A 4FU0A 4UBMA 3LC2O 3RUDA 4CKYA 2P5SA 3GA7A 5C7IO 1YIDA 4KGZA 1MOQA 4MTCA 2W2KB 3QV2A 5JPIA 2EW8A 4ZCMA 2Q3JA 3H3XA 5CVEA 3ZBTA 2A14A 1DLIA 2L0XA 2BKUA 3QUQA 2PGNA 1NYQA 2E5WA 3O38A 4LC9A 4QUKA 4UVEA 4LHEA 1SJ9A 4URYR 2I3GA 2OZEA 2H07A 1T2DA 1U3FA 4HF7A 5DSTA 4L5CA 3SEAA 4XUGB 4WCFB 4L8FA 3RT1A 4G25A 3LG2A 4GL4A 2G17A 1K4YA 2GERA 4U0KA 2JHGA 2XDWA 4BO6A 2HK7A 2HN9A 2EWMA 5B1EA 1V3QE 3ZD6A 4HUJA 2P77A 2CW0D 5BN3A 2WTAA 1BD3A 2GKSA 4GZLA 1NJ8A 2CVZA 1CZRA 3BA6A 3FNEA 3I2FA 5J23A 1HLDA 3K4PA 4RY8A 4WUVA 3GU3A 5IXSA 3EH1A 4N40A 5GV8A 3S2YA 4D3ZA 1EBBA 4CEJB 1T5BA 1TFRA 1Z4KA 3RRXA 1C7RA 2G3YA 2FN7A 2PH7A 3DG9A 4HD8A 2IHVA 3ETGA 2I62A 3R7LA 4CG0A 2O8BB 3BA1A 3GLFA 1SOMA 3SZLA 2X1LA 3CRVA 1YFKA 1CVRA 1PUIA 2WILA 3QEAZ 2XCOA 1VJRA 3QM1A 1RQRA 5HF6A 1F7UA 1US8A 1CUIA 1H2WA 1HEUA 2HWWA 1MLDA 2Q3CA 2QN3A 3O90A 2BFNA 4R1QA 1NBWB 2J30A 3A4YA 1P8JA 4XPZA 4V1CA 3QF4B 2DFVA 1IBKB 3Q2IA 1ZK4A 1YF3A 4F8EA 2P2DA 1WSBA 2QTGA 4I14A 3BWYA 1EYZA 3IA2A 3A9WA 4IPTA 4BJ6A 3IB3A 3BXGA 5JD5A 1OFGA 2C9OA 3WQQA 5JEDA 4BASA 2AJDA 2EKLA 3LJKA 4H0NA 1E1YA 1VCNA 1ZM2A 2ECPA 4MO9A 1U1EA 3PC7A 2H1IA 3MCVA 2QX6A 3LUBA 4Q9HA 1IAVA 4FE4A 3ZDCA 4XLLA 3SIXA 1IWOA 5AJHA 3I61A 1Q3KA 3UAYA 2C0PA 3LNTA 1JRLA 3OZIA 1Z28A 5BT8A 2V4ZA 2BGWA 5EJ7A 3OCVA 3OWOA 721PA 3DLHA 3E3LA 1D4OA 3QTBA 3ABOB 1KVUA 4YCJA 1L5HB 3ICVA 3TW8B 2FPKA 2Q2QA 3PVSA 3QA3E 3I6QA 3NTXA 3B1XA 4Y2JA 4HXEB 1BMTA 4PM4A 5I9IA 4FHCA 3NHWA 2ZVDA 1AA9A 1PFYA 3OF2A 1MVOA 1V25A 3NM5A 1LLFA 3OLXA 5CVVA 1F3OA 1PSZA 1Z73A 5A5GA 1G16A 1ZP6A 4HGRA 1IQUA 1THGA 2E9SA 3FRHA 1XA0A 5DDIP 4C6SA 1HDIA 3QKSB 4CU5A 4EFNA 3HGTA 4Y0AA 4CV3A 4CKZA 2IPMA 1EWRA 5JZVA 2YJ6A 1NW5A 5GVSA 1ZYRD 1ZVMA 5A4DA 5IM4F 2I2BA 1F60A 5AM0A 2NZVG 5KC8A 2A69D 3QVMA 2YZ2A 1SZPA 5FTWA 3H86A 4EYGA 1MV5A 1U02A 2F62A 1U9JA 2GAIA 2CL5A 4Y2SA 3FVVA 1C29B 1DQNA 1RHKA 3FG9A 3DBIA 4RXMA 1BCRB 5F7OA 2YIMA 1V1RA 1PR3A 2JGRA 4JLAA 4ML3A 3I2GA 3BMNA 3DT9A 4KFTA 2YR0A 3DPSA 1A7UA 5T4BA 1R2QA 3UMSA 2YUTA 4KV9A 3B1FA 1O95A 4YPOA 2RHRA 1NR7A 3LX5A 4M55A 3H4VA 2Q6TA 5JD4A 5K7SA 1P4JA 4ICIA 4DREA 3JQPA 4EG3A 4UEOA 1Y8QA 4PRZA 3DFIA 1ISMA 4JB0A 5H4HA 1XTRA 2ZUCA 3K9HA 1AHPA 2ZPAA 3ADBA 1YS4A 2F3SA 5KX5B 1OSNA 4NJEA 1X42A 3GGPA 2AMLA 3A58B 3MBIA 4PLHA 4YMIA 5I7HA 3FOWA 5F9FA 1O6GA 3A6KA 4JSYA 2I6FA 3SE0A 4IHJA 1E9AA 2Z2ZA 4PRKA 3G89A 1PKEA 2IHBA 1ZGGA 4Y1EA 4AYTA 4OMUA 2F1HA 2DHCA 4KR6A 2BP7A 4PNPA 4Z0PA 3WGUA 2J7KA 3EDMA 4O2AF 4KDFA 4PGMA 5P21A 3FKQA 1JHRA 2YL2A 4KB5A 3GFVA 4QYWA 1QGED 4L8VA 1O3YA 4TL6A 5CLJA 3KOMA 4K87A 3PIIA 2GR9A 3OLQA 1GAJA 2CF5A 5EGSA 1Z8HA 5FA5A 3GVPA 5F51A 4LF7B 1R0SA 4MQFA 5CGZA 3VMMA 2Q4RA 2D2XA 2W4MA 2XYGA 1RHMA 3MCAA 3CNQS 2R6JA 2ICAA 2WF5A 2WNSA 3L5KA 3UK7A 1XZMA 3N2KB 2GEFA 2IZ7A 3I9JA 3KT0A 4TV9F 1GUZA 1T1IA 2XUFA 1GLGA 4YRRA 1QTRA 2PLRA 3F7NA 1TM1E 3HBFA 3T7SA 3ADDA 2GBPA 3KZVA 1I2CA 4C3ZA 5F7XA 1YB4A 4F3CA 2BC9A 3STTA 4Z3OA 3BDVA 4GBGA 4M9RA 2FK8A 3FAKA 3JCZA 3S1AA 4EB8A 2VJMA 4E94A 4H18A 1VG9B 2CDNA 1HDXA 4G5YA 5B12A 1O8BA 3B53X 3EXIA 4OP1A 4ECAA 1L3IA 3A4LA 4KLZA 2NPFA 4PICA 1DWPA 1F6DA 2FCRA 4NWIA 1IBMB 3KP1A 3V8MA 4MWOA 2WTBA 3I9NA 5AW6A 1JTVA 2W9XA 1AA6A 3O9MA 3T52A 2FOIA 2O59A 5CEJA 2WHYA 4GI3A 1C0LA 2QVZX 1E8NA 3O7WA 2CXXA 5BWNA 4R3NA 1FNSA 2C3MA 2ZT6A 3PUZA 4JKOA 4O4JF 4YLGA 4JVNA 3OZRA 2HSEA 4PQEA 2VDJA 4KN5A 5AHKA 3UJNA 4FDTA 2JA6A 5COAA 3I12A 2R8RA 1CPYA 1AQLA 1JHQA 1LX7A 4RM3A 3OX3A 4K05A 5ES4B 4X1KA 3H1BA 5GADl 2VYNA 5BSFA 2DT8A 5LDGA 1SB8A 1JZQA 2HMSA 3A6FA 4Y7CA 5H59A 5T8KC 4XGIA 1GUFA 2JHFA 3ZWCA 5HRCA 9ATCA 1M1ZA 1Q6ZA 3OAAD 2J85A 1BVUA 1UZLA 5E3JA 3CNHA 2HEGA 2QVCA 7YASA 3RARA 5U9CA 1M2OA 5DU2A 1T2EA 1QJCA 4YV1A 4IGFA 3BJZA 3BXEA 4HN4B 3H5TA 4IDEA 3ILVA 3MOSA 4DIOA 5JMTA 1RJ9B 1WW8A 3CZPA 3H9QA 3L01A 2ZYUX 4G1BA 5AJYA 4ZDIA 1AGRA 2XTZA 3ASVA 3UENA 4D98A 5TEWA 3LKDA 1R8QA 2VH2A 4NBRA 2GPTA 1NKTA 3SYRA 4KQIA 2H48A 4EG5A 3VKUA 2QQ0A 1URPA 2X2FA 5B55A 2VHQA 4DUPA 1FXWF 1JMVA 2X4IA 3CXRA 2ZGVA 2Z9DA 3PDIA 1B00A 3KLMX 3GRRA 3LLVA 4G41A 1DOAA 2BFWA 5EMHA 4FQ8A 4N3NA 5L3SA 3BN3A 2MJLA 3SYTA 3LMKA 1AV6A 2QW0X 1QH8B 1WDMA 1OQAA 1Q1ZA 3QUCA 3PQEA 5TX7A 3L0OA 4LNUA 2IA5A 1AK2A 1W9HA 1QZ3A 1KI2A 3DONA 4LXXA 4N6GA 1JVBA 1JAYA 4QFDA 3UFXA 1L8AA 4EMUA 5JWRA 1DG9A 4BEBA 3KJNA 2O0JA 3GJ3A 4HN9A 1FC0A 1PGJA 3F2IA 5EJ9A 1DEOA 1VHDA 4J29A 3SSOA 4B43A 1BD4A 3RYIA 4JI0B 1C8BA 2EKZA 1JLHA 2QSJA 3D2BA 4MYHA 4C4OA 4U3JB 4LJ4A 1KI6A 1H66A 3C43A 4K9SA 2EEZA 2B3TA 4JXJA 3UMCA 4RJLA 1WB4A 3CW8X 5G4LA 3WAKA 4DGSA 5ITZB 5AWFC 5B3JA 1AE1A 1NRXA 1XA4A 5IBRA 2CZQA 4XW2A 5BSWA 1IHUA 2J0UA 4XJTA 1C0IA 3KRTA 2IELA 5KTYA 1JIKA 3C3YA 4DLUA 4YWJA 4OJMX 3EY9A 3GFGA 4AN0A 1O8CA 1MTOA 2BW0A 4MKFA 3USES 2JA7A 3T15A 4DJJA 2PT7A 3NT4A 1JEEA 1HURA 2FSPA 5AUNB 2NP6A 4JNCA 3DW3X 4QHSA 5FF9A 5A9SB 2W6QA 4Q1FA 2P9EA 4D3FA 3HR7A 1M9NA 3QNMA 1HA3A 2JBHA 3KS9A 2ZVPX 3IEPA 3IKVA 2K2QB 5REQA 4L78A 3ROEA 3RADC 4JLJA 5ETJA 5AVQA 2JVJA 1VYVA 2B36A 1VGQA 2G76A 2FQYA 2XKAA 2XUIA 4HDKB 5TF0A 1PX0A 1TK3A 3SR3A 5TVGA 4XRRA 1WHTA 4IUDS 4MUKA 3N8NA 4Y3UA 3DAHA 5CDSA 1ZN7A 3N74A 2D62A 3OD5A 4ME6A 3I6YA 1Z35A 1RLTA 4OUKX 2XQFA 4UE6A 1U5BB 3GN2A 3PQDA 3RI3A 2XXBA 3PPWA 4YDHB 4MYCA 3STVA 2VAPA 3O7MA 4RV4A 4DVGA 5HJ7A 1OBOA 4HEHA 4X8LA 4XD7A 5JCOA 2QBYA 1F8UA 1ELOA 2CNWD 3L1UA 5FTNA 3G5LA 3IQZA 4MXDA 4F11A 2JVIA 3EMVA 2F4VB 2AK3A 3E1KA 4MUGA 2IHKA 2A4MA 4L4YA 2R4QA 2P2LA 5KIAA 2OWDA 3AR7A 3W5JA 3V7FA 2IDKA 3UOAB 1QG0A 1VYUA 5EWMA 2Q5LA 4DG9A 2A8YA 3MIIA 3A37A 1DEAA 1L5WA 3OD1A 3UM9A 4KQEA 2NPOA 3TOVA 2UYOA 1TOAA 2P90A 4MVYA 4N5HX 1JDBB 3U3XA 1QDLB 3T0IA 4RL4A 3FIUA 3AQ4A 3BEOA 1NBEA 4GIBA 1E9EA 3BT7A 1FVXA 4L5JA 5DM2A 2F3PA 1U9YA 3IJ5A 5J5VA 1SVWA 1JZTA 4KBGA 2ZAYA 2NUAB 5JNUA 4R0VA 4HDSB 2GN4A 3A2LA 3FCAA 5I8PA 2WEKA 1TU3A 3GXOA 4WKOA 5LQSA 5AVOA 1NA5A 1QOZA 4Q12A 3PDJA 1CQPA 3ZVMA 3WYGA 1M1YA 2P79A 1PGPA 1TJ4A 3USZA 3FMPB 2ZYWX 4QOHA 1ZUNA 2IPAB 1SBZA 3VVCA 2AN5A 3PRJA 3QVGA 1GKUB 3AZQA 1E9RA 2KSQA 3MTQA 1LDYA 1B1CA 1OZGA 1XE3A 2BL4A 3SHFA 3TXAA 3GH1A 3WGZA 2IYPA 3QLEA 3X43A 5EJIA 3VR2D 4RWZA 5EQDA 3VHRA 4DRYA 3L1IA 4P98A 2WJPA 1WCWA 1KVRA 1E66A 1K4MA 2FFQA 3ON5A 1TWHA 1Y8AA 3RVPA 4YCAA 4IWXA 1LLCA 3JZDA 1UKZA 1XP8A 3KUXA 5CFNA 1NQUA 3M1IA 1TEXA 3PHGA 3Q11A 2FSSA 5SYAA 3OFVA 3VPCA 1LLUA 5K6AA 4TX1A 1NJSA 4R1NA 2Q29A 4UNRA 2PS1A 1PS0A 4ZZ0A 1UJCA 2HK6A 4HH3C 1RBZA 3EXEA 5ARCA 1MXFA 2VRNA 4HPJB 2XUKA 1ZVQA 1N25A 1JG7A 1ND6A 1ZM4A 2R2GA 4FEEA 4M9UA 1QRRA 2ZPTX 1KP3A 4RDHA 4F60A 2DFKB 3WFZA 1PQYA 3N86A 4IXTA 3TQIA 1EJ0A 4G1EB 3MJHA 1IBRA 2BTQB 4ZAFA 3HYSA 1XJQA 1FNNA 4I99A 3RC8A 3K2BA 1NR1A 1T8PA 5I3ZA 4LMBA 2DCUA 3HY4A 1V71A 3VHXA 4P3YA 1EX7A 5IAJA 1KSFX 2OFPA 5JRDS 3NANA 3ENQA 4LZWA 1FEZA 5K3CA 1CUGA 4G5XA 5HZHA 3DTYA 4JBLA 3L6DA 4QPNA 3RC9A 5FWDA 1CEYA 3IV9A 3HJBA 4MWZA 1XN1A 3IT0A 3C1AA 1K68A 4FE7A 4YDQA 1AMOA 1ZVKA 2HJSA 3L7DA 1Z38A 4AO6A 4BVHA 1MJNA 3IJPA 3K4HA 3NTOA 4YBZA 1RWXA 3RV4A 3THOA 2IXGA 2WB2A 5KWJA 1EG2A 3O8BA 1Z0KA 1J22A 3UGJA 1IVSA 3IAS6 1JYFA 3MWLA 2WZCA 5DLYA 4FP9A 3EA4A 4MV7A 2JRCA 2OAGA 3PFHA 4N9QA 4EEZA 4HLCA 1ZNWA 3PKIA 5IT4A 1MRNA 1QC5A 2IT1A 4FMPA 1N0HA 2PCLA 1GL6A 2DQ4A 2QLFA 5FWYB 3WHKA 1PDVA 2P68A 5CBPA 1TZMA 2CLCX 3RBXA 1RI1A 4U9HS 1GV0A 4KVAA 3SS7X 1Z4MA 2ETXA 5D01A 5ALXA 1YZYA 1P2SA 1IK6A 1KPGA 1L6RA 2JEOA 1OILA 4LYAA 3ZKAA 3E48A 4P08A 1WCIB 2RGNC 3RJMA 4MVJD 3VR6H 2RARA 3OTHA 2VHCA 4PYLA 2A0XA 3WGYA 4EVRA 1I3LA 3TI9A 3E7DA 3WRXA 4XAQA 5JCOC 1UANA 1CZUA 1UXIA 5FFMA 5B1HA 3SSMA 5JANA 2FUCA 2FZGA 4ENVA 1RJDA 5J5CA 1MAHA 1ZISA 2GT1A 2A1TR 3ZCXA 1BXGB 1PJBA 4IMIB 1RE0A 4CM6A 5KOHB 5JEEA 4BNXA 3AR5A 1KFJB 1ZJZA 2ZJ2A 2ZROA 1OA1A 3WNCA 2HJWA 4JUAA 1EDEA 1GA6A 5FOVA 4C5BA 3H5IA 4QYMA 4B46A 1WEKA 4ND8B 1SXPA 4IRUB 2FLKA 1XCMA 1NQWA 2OBMA 3DAGA 4WBNB 3CT4A 2QUZA 3RD5A 3D2CA 3GTMA 4M38A 4R2JA 4JUFA 4WACA 2B20A 3PI7A 1F0KA 4UXIA 4FFLA 1XTIA 1KA9H 2WT9A 3BILA 3RGGA 2R87A 5CPBA 3R5KA 2GZ3A 2PGJA 2A30A 2K2WA 2Z8XA 4QPPA 4EMTA 4QGBA 1YDMA 2IS1A 4UD6A 4CR7A 5KYWB 2VSFA 3ISJA 3K0FA 5B4VA 3W5BA 3E9NA 3ENWA 4B4UA 3PIRA 3M6WA 1R0WA 2O1WA 2B0CA 5E95A 2IHJA 4YUYA 1TZJA 4IICA 1P1JA 1W5BA 4F86A 4H77A 2JCVA 1SN7A 3BKXA 1KJNA 1NBMD 3BSWA 2O0LA 3UW1A 4AMZA 2HLNA 5KEIA 1KRWA 10MHA 1N32B 2P1DA 4X64B 2WVJA 4F93B 3BTUA 1XHFA 1Y42X 2N0SA 2X5OA 4LRSB 4DIMA 1MOSA 2WF9A 4Q05A 1FFXA 1K2VN 2A1TS 2AF3C 3DNFA 5JSHA 2GGSA 4BN0A 1NI4B 1OLXB 5DW0A 3DVSX 1Z2OX 1ZQ1A 2OCGA 2WZDA 3OM1A 4CMIA 3CH6A 3OCCA 1SG0A 2HB6A 4L4ZA 3VA7A 1SH7A 3WLSA 1VJCA 5K20A 1NI5A 3EGIA 2Q5EA 2LW7A 3CE6A 1SU6A 1U1FA 3P97A 3PQ5A 2QQGA 4BCBA 4G56A 3OKPA 3Q40A 4WKCA 5F5LA 2Q7XA 5GVRA 4AJIA 1HI9A 3OE5A 3FFXA 4YCCA 1T6NA 2NT4A 3UJ9A 3SZMA 2E6KA 1ZSNA 2O57A 5EKXA 2DHQA 1Y1RA 4EJ3A 1MQSA 3FJ1A 3AEKB 1W49A 2ZULA 3W9BA 1WXEA 3JARA 4TT8A 1QPZA 2PY6A 1OREA 3SX4A 1K86A 3AIKA 2FZCA 5HM6A 4KXVA 5CG2A 1GLNA 3EZFA 4PV7A 1TW3A 1XZEA 3D4OA 3ISVA 4NS1A 1H4VB 1U31A 4BLTA 4F8JA 1TJ5A 3NTQA 4DM4A 1XZLA 1X80B 1VI2A 2LKDA 1IZYA 3EIWA 4UE3S 1O6FA 4GKKB 2UYCA 4ZCTA 1MVNA 3UUFA 4C4AA 5LQCA 2JLVA 1N9GB 4CF3A 2BFCA 2FPIA 4HXYA 4J2TA 2J9FB 1Y3BE 3K6JA 1XZFA 3PIDA 4PLFA 4PCUA 3SBXA 3N0WA 5ALGA 1TVKB 2YV2A 5DX0A 5H02A 4L6CA 5B1DA 2QMZA 5DCUA 2PLAA 2PUTA 3HFSA 1NPTO 1V5IA 1GZHB 3NHFA 3OPYB 2I8AA 3T8YA 2VKQA 4H3TA 2CLEB 5BSKA 1MO5A 1QQ5A 3FDXA 1WPGA 1FMLA 4TUYB 5WRFA 3RKSA 1ZD5A 3UICA 3G9QA 4G85A 5NULA 3EJWA 1KFBB 1CHDA 1MCZA 1BFUA 4OHFA 1FTQA 3IR7A 3QPDA 3DKVA 3JQRA 3V80A 4HNUA 4IINA 4D45A 4W4TA 5BSTA 4MI6A 1P0PA 1P29A 2IYRA 3DE4X 1Z4QA 4PZCA 2WB4A 2WM9B 4E2YA 4XVUA 4GVXA 3AJRA 4LHVA 5HIIA 3EXFB 4WNAB 3L0SA 3PVZA 2RC5A 1I7DA 4EHJA 4X6LA 2CLOB 3R75A 2L42A 3I5YA 4O26A 1L1RA 2ZRDA 3I8OA 2QTWB 3OJFA 3W8FA 1N5MA 3I23A 4WV3A 1FMJA 4F45A 2IKSA 1EWVA 4XOIA 2XYPA 5F4ZA 2W6ID 4U6NA 4YPFA 4F3NA 4MROA 3IDOA 2VHYA 4QPDA 4RZXA 2Y1LA 5G41A 1DE0A 4IV0A 4EYQA 1KORA 3FYUB 2IX3A 4MDEA 4TGLA 4MB2A 4OBBA 4PLCA 4Z4EA 3KKPA 1Q15A 4NCHA 3KR2A 4BB5A 3DV2A 4ETMA 3KZKA 1FP2A 2BTOA 2XNDD 3IVXA 1OXUA 1OX4A 3FNHA 3QVJA 3V4SA 3KEFA 4RSHA 2FHSA 3B6IA 2WNIA 4BWYA 3MT7A 3AR3A 4HC4A 1G1AA 2GH1A 4QHTA 4CKBB 3E7XA 3EMBA 3CJRA 1TLTA 3D8SA 4Q4JB 2BGGA 5LSAA 4OD0A 2IUTA 5EC8A 2QVXX 4ID3A 1JH9A 5JBQA 4ZI7B 2GZ1A 3ZTYA 1YRWA 5MN6A 5DNDA 2WFLB 2YRFA 4WEQA 2KBFA 2P5TB 2GAJA 4B83A 2ZYVX 2C9CA 5JDIA 1IXSB 4OYDB 1Z2AA 2FKNA 2PWBA 2VJPA 2WWHA 1HDYA 4JSRA 4M6WB 3IAM6 3G88A 4L02A 3BXOA 3D2LA 3HGQA 4JT4A 4P2BA 1X7WA 3UAVA 3W1EA 4EJ0A 3WZLA 2JLUA 4RCVA 4N5NA 1RKQA 3THRA 3NMUF 4HDNB 2D0IA 3QELB 2YYZA 4BQSA 5JTUA 2GN8A 4MRPA 3ROZA 1Z4OA 2VYVD 2WVHA 2J4DA 4UNSA 3ZS9A 5IN4A 3VU1A 5AM2A 4Z4IA 3QYAA 3T1TA 3ZWBA 3THWB 3K5OA 4M7RA 2OUKA 3VKGA 2IYZA 2OCIA 1W36D 3MMZA 4I5FA 2R5WA 4G0YA 3UCEA 4BWFB 3S1SA 5GJCA 2BDTA 4XGKA 3ABRB 2GHRA 3AIOA 1WSDA 5H81A 3EPJA 5DBEX 1A8QA 1R66A 2C04A 2YINC 3GDGA 3BGDA 3HA2A 3SYMA 1MQ8B 1YMUA 3DJYA 4W5RA 1NFRA 1WMAA 3HJUA 1P5HA 1TJNA 2E4AA 5IAOA 2EATA 5EESA 4U2KA 2XCSB 1JEYA 4CMHA 3R7WB 2AOUB 1YIOA 2O8VA 2VSQA 3RIEA 3TUZC 2N47A 4COKA 2QU8A 1PJ2A 4LSWA 3GRFA 3MD9A 2C54A 1JKJB 1N75A 1YZFA 3LP6A 2YFHA 3OY7A 4WI1A 3EVGA 3SU8A 4B7UA 3NDRA 4BFVA 4ESHA 5C32A 3FF1A 5FQNA 2XXAB 4DW8A 4JU8A 3P7MA 2P41A 8GPBA 2E48A 3TOXA 1WPRA 2WBLC 4TT3D 1JALA 3VSBA 1DINA 5K8UA 2O3QA 2HADA 1GPMA 4BKQA 5CA1A 3E2MA 1T9HA 2W6ZA 2VK2A 2ZUBA 2FOXA 3AYZB 2JLBA 3IHLA 4WY2A 4FR5A 4GXNA 3AUYA 2DEUA 3M5CA 1T26A 5ITWA 3ZV6A 1SCUA 1Z83A 5K6AC 4PSUA 1AHNA 4RVSA 3PNMA 1G4UR 3QW2A 1RE1A 2YZGA 4XYLA 5A1JA 4OI0A 1HSOA 4IG9A 3W6UA 1Q0RA 1GZ4A 2PEZA 2VDPB 3E5HA 4KO8A 5DGXA 5HS6A 5HHTA 4R3WA 3GPLA 2G9ZA 5KJ6A 3E9YA 4FMDF 1GTVA 3HKEA 5ESWA 1G3RA 4NK4A 5F3DA 4Z0HO 4OHRA 5GPBA 4UASA 3LT4A 5BQXA 9LDBA 5LYJB 1NUSA 3OOJA 2IYAA 4H1VA 1UC5B 2C2XA 5ICMA 4W5NA 1E9SA 5G02A 2H2HA 3HB1A 1X74A 4FYMA 3FVWA 4FYYA 3U61B 4UDNA 2DPYA 1S4MA 2C5EA 2PRSA 5HJ5A 1GE9A 5LUAA 2P9GA 5DYYA 2IIQA 4X7PA 3BFVA 5JAHA 3ABQB 2ZCJA 1M0EA 4FMCF 3HMKA 2YQZA 3VGJA 2PBLA 5TSDA 2I29A 2R6AA 2NVUB 2M1XA 1YRAA 1U8EA 2A9JA 5TV2A 1UQTA 1OV4A 3ZWMA 4EG0A 1EPUA 4YT2A 3JRXA 2PNFA 1MEEA 2AH5A 2X8JB 1XSEA 2BGIA 4S24A 4FC6A 1DWOA 4XB2A 4Y0NA 5C8YA 4NC9A 4P32A 1VRVA 2X9VA 1ICEA 1V8ZA 2NU6A 2QTBA 1G20A 2JBWA 2PZ8A 3URKA 4EPXA 2QK4A 4KHPB 1E3MA 1DPGA 1FVOA 3K9NA 1HL7A 1QZXA 4AD8A 4B74A 5THQA 1QGZA 3ZNQA 5HWSA 1Y4DE 1U0OC 3BFXA 4D0RA 3K92A 2ZRGA 4UZFA 2VXOA 4QARA 3NONA 1DJQA 1P73A 4QXRA 4CF7A 4OLAA 2VNJA 1UJ2A 5E0OA 4HRYA 4Z2AA 2E85A 3ESQA 2H7CA 3U3RA 2BF4A 4IDFA 5GIPE 1JT9A 2AFIE 1PG5A 2C83A 4DQVA 5FDFA 4WLOA 1QS0B 2NV2B 4WT7A 4L72A 1E64A 2Q4EA 3FOEC 4EY4A 5CJ2A 4LWPA 4BCCA 3N59A 5AXCA 4L1KA 4UHBA 1NXOA 1P1RA 1NFQA 1E6LA 1N6KA 3L93A 1I0ZA 3WO0A 5BUZA 3Q3VA 3Q6IA 3RIYA 2XCTB 5FV4A 2BONA 1LDGA 2B7CA 3RS8A 4BGUA 3FLAA 4U7FA 4QUIA 3ZHCA 4JC5A 1DBVO 1EUZA 3NIWA 4ES6A 4LDNA 1CB0A 2WHEA 1NW8A 3KKZA 4QQKA 1TMKA 5JYDA 3GGGA 5C4GB 3AEQA 3BJMA 2DERA 4ZYUA 4XM0A 3TL2A 3HK2A 2LNDA 1J4AA 1MQ9A 4UHHA 1BH6A 2CLDX 2VPXA 4YAEA 5FOSA 5BNIA 4I6JA 3KQQA 2Z2XA 4U7GA 2BMVA 2NO4A 5KKNB 1LBSA 2VHZA 3VPAA 3VYVA 4EX7A 4JB3A 1IUKA 2GAFA 2QTAA 3R3XA 4X97A 3WKCA 4JWTA 1W35A 3KYLA 3L06A 2B94A 3K58A 4CL8A 4KNWA 2ZRMA 4E32A 2J33A 2FEOA 5A0VA 1WF6A 1M5RA 2PMBA 1CW2B 2HHHB 2X0EA 2OE2A 3DMDA 1RWPA 3U5ZB 1EP3B 1Q11A 3DB2A 3Q15C 4KPYA 4C20A 1E9VA 3UMYA 3K6KA 3PFNA 1ZW1A 2FMIA 5F2EA 3WGKA 3M1AA 4ARVA 3ZCVA 4BDSA 1M8GA 3LCRA 4J0JA 1TWAA 3F8SA 1K7XB 3HSYA 1UPAA 3C87A 4TQ9A 3WHLA 3UB4A 5JZBA 4KR2A 3EWSA 3N3BC 4CU2A 3FGOA 1KETA 2BMAA 2OC4A 2PSEA 4JD5A 2RK3A 4JLUA 3ZWAA 5AW1A 1OC4A 4MUHA 3HR4A 1R0KA 3R09A 1Q0UA 2IEGA 2UKDA 2XR1A 4MUYA 3OFND 4XQEA 4CKEA 5FYDA 1ZNXA 3KR1A 3BGIA 3LBIA 3NGXA 4WLUA 3H1FA 3UTDA 4ZO7A 1EIZA 1C9JA 2JIMA 1USIA 1VG8A 3K7EA 3EVFA 4E3ZA 3UB3A 4FVTA 2JK0A 4O8ZA 4J43A 5I51A 4BBJA 1CK4A 1DJPA 4M0UA 4CKXA 2XJ9A 4KV7A 4J94A 1V6AA 2V0GA 3EG9A 3OP4A 3ORRA 3DFKA 3UMGA 4I2NA 2BFEB 3F5SA 1NW6A 3O4JA 5SY6A 3GF4A 3GGSA 1L7BA 3OKCA 4LSGA 2GN2A 4ZV7A 5AVWA 4NIMA 4ID9A 5BSMA 1GQFA 5LUBA 1VSQA 1I4TD 1CHNA 4QXOA 1E9CA 4Q47A 4A15A 1DMSA 5A7HA 3CLHA 4DA8A 4O2BA 4JI2B 4LC1A 1PK7A 3NIDB 4ZO6A 1ZXLA 5JWHA 3ENKA 1NVEA 5LMNB 1E69A 4OHYA 4C7OA 2PVPA 1YZUA 4LDJA 3I6MA 3KHTA 1RRCA 1DQPA 4UTPA 1DAMA 3BWCA 4MP6A 1ODIA 2J09A 2EZTA 4I50B 2G36A 4GZ3A 2QM3A 3H87A 4G0NA 1YRQA 3A4VA 4KWCA 4DQXA 2W2NA 1P5JA 4ZI5A 3PWSA 2WJWA 4ZV4A 2HY7A 4YH1A 5ECWA 4AMYA 2AGVA 4X6UA 2A3RA 1RBYA 3NFYA 4GEGA 4KHZA 5FL7D 3CF4A 3G2OA 4O4LB 3WWOA 3G9TA 3PX2A 4GKVA 4IIEA 1SBIA 2B8NA 5AXDA 4BO8A 4ZVPA 1SXJC 2HU2A 4D80A 4GPTA 2YY7A 1KOGA 2AEFA 2QTHA 1YMQA 3HB5X 3PC3A 4PS1A 2AQHA 2XZPA 4WJKB 4FFMA 2G5GX 4KYVA 3RK0A 3UMVA 1QIFA 4L8IA 2P3QA 3MA0A 1Y33E 5FOWA 4C7BA 6YASA 1OVMA 4NPCA 1IZ7A 1GPNA 3AJDA 1AQ6A 3G0BA 2JAUA 3MTGA 4G2NA 4C0KA 4WVLA 1L5QA 2G04A 3L0DA 1EHCA 2A67A 2OSVA 1UC8A 4PTZA 3S2GA 1PNQA 1SCQA 3P5SA 4KR0A 2GM5A 3F97A 1ENOA 4OQFA 4Q4AA 2GF2A 2P35A 3IEXA 3DVRX 3S3TA 2W8BA 1AQIA 4TWAA 1BDMA 1B2LA 1VKHA 2H1RA 3CKYA 4RACA 5EMJA 3VRHA 1Z2NX 4PFJA 4B3RB 1LUAA 1Q17A 4R1SA 1WW2A 2XYRA 4MYSA 4CETA 1LDMA 4XE5A 4OI1A 3TQHA 5HR5A 3V1NA 4IRMA 1GGKA 4GBMA 4KVGA 4LGYA 4DSAA 1YR6A 1ZMOA 3WC4A 3WGQA 2WHXA 3ZHOA 1I10A 3EUFA 1FL9A 4MR9A 3EQ8A 1TTQB 6Q21A 3UK1A 1Z0IA 2DF8A 1IN4A 3QH4A 5DK6A 3CF4G 1U8FO 4IGKA 4WFKA 4E31A 1XL0A 3SX2A 1A9XA 1USGA 3RVOA 1RU3A 1U11A 3AVVA 3IPYA 3PA6A 2NVBA 3GUHA 5AW7A 1TECE 2YS6A 4RD2A 1PS9A 1P4GA 1TXGA 2FETA 4DJDC 1JLRA 2WAMA 2QA5A 3Q5GA 4P33A 1JXOA 1G7TA 3R7BA 1SKQA 2DVMA 3ZDAA 3VSEA 3AO0B 5ESDA 5EJ5A 4ZT6A 5FBHA 5B58C 2BR5A 4D79A 1UFQA 2W6JA 2IW1A 1I2AA 1KC1A 3WA6A 2QUAA 4MMZB 3PNOA 4YV2A 3C6XA 5AM3A 3H0CA 1YHZA 1JBKA 3DOOA 3GT0A 3NHSA 3SYLA 1NNUA 3H1PA 1WLSA 2FPUA 3H8SA 4JBIA 4G8JA 3TVYA 2IDJA 1KJJA 4CEIA 1N34B 3O8QA 2P4EA 4RDIA 4Z3DA 2D0DA 3IBTA 3IXLA 3EWAA 3EZNA 3FB4A 3I9LA 5DNWA 4GPZA 2G80A 2VHXA 1LQTA 2VK1A 3AIMA 3L04A 1N78A 3T9DA 4L28A 3GARA 3LO5A 4BXOB 1EK6A 1NMXA 1P5FA 1W4ZA 1IQRA 1C30B 1OAKA 4Z8XA 5JMPA 4BBAA 1ZH2A 4QXAA 2O4CA 4MOWA 4ZZ1A 3AHCA 1QHGA 1U2SA 1PZGA 3D8RA 2CF6A 4RD4A 4UZEA 2PX5A 1CUSA 3T6KA 1T8TA 2WIDA 4RF4A 3U2QA 5FX2A 3IR6A 5G0WA 4IFEA 1CZOA 7REQA 3E9CA 4HX9A 3K0KA 3MF4A 4FIZA 3UWMA 5EWJA 2A35A 4CIYA 5E7QA 2X6QA 4H7PA 5AOBA 4E33A 1Q7CA 1WVIA 4LSMA 3CLRD 3IAEA 4A03A 5HK9A 5I9NA 3PUVA 3CVWA 2PG3A 1QHHA 4XWGA 5DX1A 5MN5A 4GP6A 1OB5A 1ZCJA 1RYYA 2GJ8A 2WHQA 3CKMA 1Y7HA 3JZMA 2ZS7A 4EB6B 2OMKA 5JCJD 4KGXA 4B5LA 2B25A 2RHOA 1HTBA 1JHMA 1Z2PX 1NIPA 2FH5B 2O2XA 3FFTA 3JQGA 3KU1A 1HDOA 1R0BA 2Y1KA 2Z3ZA 4WK4B 4X9XA 1H9AA 2H4ZA 1QNLA 1RPNA 4M8SA 3CWZA 4GG1A 3N3AC 1YR8A 4N01A 4P7KA 5G1OA 3GEHA 5AM4A 1Y7IA 5C1PA 1MJGA 1W36C 1KJ8A 4QVGA 1D4FA 2XWPA 5AI6A 4P0PB 3RNLA 4JBXA 3U7EB 1PJZA 3WKAA 2CWWA 3A25A 1QFYA 1CUAA 1IQPA 4MUEA 2LIVA 3ZWXA 1RMYA 4F3EA 3TZQA 4YT8A 2FXIA 1II0A 2FW0A 4INAA 1RZRA 1XRLA 3WK4A 2Y76A 4DZRA 1PWXA 4Q21A 3WX0A 1UXJA 3D7SA 2A9PA 4LVUA 4M8LA 5CEEA 1MX3A 1W19A 3RRZA 5IYZA 3FPGA 1SRRA 4NYJQ 2H7VA 2XB4A 2BDUA 5JOQA 4WESB 5L9AA 2NUTB 3IUMA 4W5WA 3HJTA 4B2YA 3FLBA 2NX2A 1XCOA 2QRUA 2XGOA 4KWIA 2I7TA 3AEUB 4MHTA 1RRJA 2B92A 3NBUA 4LX8A 1LK0A 1HFKA 1YCGA 2C2OA 3E0XA 4PO1A 1XEXA 1WQFA 2CT8A 1K0FA 4PTYA 2YZKA 1VPVA 3LC7O 2GO1A 4R6WA 5CX1A 1J2RA 1OT5A 1TJPB 1QGOA 2YFQA 1BX1A 2CHUA 4QYIB 5JASA 4YRQA 3ZCTA 1MORA 2FZ4A 4BV3A 5ALFA 3FCSB 5KNBD 4X92A 2XCUA 3TLYA 1W29A 4MMXB 4E0BA 5A2QA 2QXTA 5IJZA 3TAHA 1G98A 1Z9BA 2QAGB 3E23A 3PENA 4QJBA 3TRJA 1JFSA 2QYTA 4P4UA 1KY3A 1Z6ZA 3FPSA 5KJCA 2HF9A 1YDHA 2JW5A 2J3KA 2FPGB 3GMIA 1W8IA 2CLFB 1ISSA 3M3HA 5J9FA 3LUGA 4RTPA 1IG3A 1DDOA 3REGA 5HF9A 1G2QA 2BHNA 2H1SA 5CLIA 4Z4GA 1QRDA 4U63A 4BE4A 4ZXPA 3K0CA 2YMQA 1ZL2A 1JU4A 1E9DA 1S2DA 3D31A 2H4WA 2VAMA 2WOJA 3E27A 4W9RA 5EVJA 4EB3A 1CF4A 3O2JA 2BFDA 1A04A 2PRIA 2WUVA 1ZOPA 1SGWA 3MJSA 3ROQA 1ECFA 1PG0A 2TRSB 3HU2A 4M76B 5AVUA 3LQKA 1WSAA 2WIBA 3P94A 3LS2A 4WA7A 3B38A 2IH4A 2CXPA 1QIGA 2IPXA 5FIUA 4MUMA 3CZMA 3D6NB 1IHPA 4MPTA 4B1FA 3VZBA 4B35A 4F9EA 2HBQA 1UZAA 2I33A 5ECYA 3DMGA 4BGIA 3M4AA 3T12A 2X0IA 2P6OA 4NBWA 3DGEC 2FSHA 2Q46A 4EL0A 4ZV9A 1EFUA 2IBTA 2ODEA 5CB0A 4EVSA 2D8MA 3CA8A 1FYVA 3CB4A 5FI5A 1UFKA 3DKPA 3IAHA 1CR4A 2ZVQX 3DUFA 4BMVA 1B14A 1VIAA 1C2YA 1CR1A 2IP2A 3HCOA 3RYHA 1PJCA 4Y2YA 3WGTA 1YU6A 5FPQA 4Z9BA 5BYAA 1CRPA 4C03A 4B6SA 3JASA 1JV2B 1L5VA 1UQUA 1ZJWA 2BBSA 1QVVA 3M49A 5B1SA 1EEHA 1GPJA 5GONB 2H0RA 5FPSA 3MTIA 1Z5WA 4JS0A 4ZOLB 4BU1A 3AGQA 5EHIA 1K6JA 3P2YA 3D5QA 1XJWA 2UV8A 3N5CA 4UEKA 3T34A 1DZ3A 5K01A 1NN0A 5BRNA 5EIBD 4BVGA 5EIBC 1RKUA 1N8TA 2D1TA 2F8LA 2HQBA 5J63A 3GGJA 2BFFA 3BB1A 3I8XA 4Q9AA 2G9QA 5L4SA 1Q8IA 1JQEA 4E70A 1ZMBA 2QUHA 3GPIA 4FOSA 4Q3OA 4DC1A 5IEJA 3PI6A 3WVOA 1XHEA 1L2TA 1N0UA 1X7XB 1T43A 3C2QA 5DXFA 1D2RA 4B47A 2ACEA 5JADA 5AM5A 3OPXA 4KSCA 4OKNA 4C30A 4MSUA 1NNSA 1Q91A 5IKEA 4BNJA 4C2UA 3ZWPA 2IUEA 4J4HA 2Y67A 1CF9A 4AULA 2FWRA 2W2TA 4ASUA 1WLYA 4OU5A 4G0WA 3L05A 2NZYA 3L18A 2Q9AA 3SBEA 2QQEA 4MR7A 1FRZA 1MIOB 1YKFA 2V7BA 3GLHE 1A2QA 1BXZA 3R0QA 4G5OA 5D5PA 4KB2A 4KVFA 1OZ0A 1VE1A 5H3CA 3QEMB 3CNLA 5CIQA 1JYEA 2W37A 1UBOS 3EY4A 2GN9A 3SHVA 4ENSA 5LL6P 2E5LB 4IDAA 1VIDA 1E5TA 1ZW6A 3EOZA 4L0CA 4BNMA 2IZ1A 2I4TA 2ZTLA 3L8DA 3P9IA 4P4NA 3PICA 4C6TA 5A4KA 5TMPA 3IKJA 4PX9A 4TLAA 3SM9A 2ZJ3A 5A6SA 2EP5A 1T2VA 2GK3A 3EBLA 1TL7C 3C6ZA 3KJIA 4QU8A 5DJ5A 3RVSA 1UQRA 1VIYA 1HNNA 1WL8A 2CDBA 2QB5A 3K0EA 3KEQA 3VO9A 2CJPA 4P0QB 1N33B 2I34A 2NQ2C 2ZW9A 5AT1A 1SG6A 1IN7A 3GHHA 3QE0A 2JFHA 1CLUA 3S68A 2RGBA 1CRQA 2QPLA 4C88A 3MMSA 2J48A 5BSRA 1KS2A 4TM7A 4GKAA 3ZGXA 1XFAA 3VKHA 1KDYA 2WT8A 3IUPA 3PQCA 2WVAA 3MYRA 3RC1A 1Z7BA 4YCNA 3P52A 4G37A 4QL3A 4KMMA 1D2MA 1UOOA 4Y30A 5KU1A 3OZSA 1KO5A 2R1VA 4LZOA 4IR7A 1NYLA 1B8PA 1JLLB 1QZUA 2OG1A 3VR6A 1RWMA 1QR6A 3LBNA 1NTOA 4OJTA 4CE6A 2O5CA 3OQ6A 3PEVA 3CLSC 2QTVA 1FNBA 3I28A 3MERA 1EFRD 3AY0A 3M1LA 3G2PA 4IIVA 3EXHA 4BQFA 4HJXA 2XF2A 2GFHA 2XA1A 3BC1A 2Q8QA 3K71B 2ZAIA 4Y6PA 5JXHA 3VR5H 3N53A 3TSCA 1CRLA 1M34A 1R1DA 5BMOA 2H9AA 2NXJA 4EJSA 1I24A 1MB4A 3DYIA 4HSGA 4PYJA 3WP1B 5FUQA 2OCDA 2PJZA 5E1MA 5F4BA 4PLTA 2DKFA 1ZLXA 5EJGA 1CX9B 2Y1CA 4LYEA 3A6PC 5DBHX 4KPUA 2GF0A 4A0HA 4MUAA 2RMKA 5ALZA 1E7SA 1K7EB 1GFSA 1ECBA 2CKDA 4X1IB 1B2RA 1D0SA 2ZTMA 1BIFA 1OJ7A 4G67A 4Z9YA 4BLWA 1W6UA 3E9RA 2K5UA 2BBWA 4RADA 5EJEA 1QXSA 3REQB 4D6PA 2NO5A 1LPQA 2XB6A 3BSFA 3NORA 5FBVB 4JFRA 1EFHA 4BUZA 1SXJE 2YN0A 3A11A 4G0PA 2HU8A 3O4GA 3RABA 3L6OO 4CM7A 2BYTA 2OA0A 4B6FA 2XTJA 2P69A 4I66A 1X1BA 5JSZA 2ISQA 5CB4B 4EW1A 1GTG1 1RQNA 1YC5A 2VS1A 4QDUA 1HDZA 4NEHB 4V0OA 4DM3A 1IRIA 1NUTA 2DXIA 2BV3A 3MMXA 1SKUA 4GLLA 3U62A 3AG6A 4OYHA 4EG4A 1FNDA 4HDMA 3AJEA 3IVMA 3UGKA 4AZTA 5F9MA 2DHDA 2PRYA 1XCGB 1ZRNA 5AJZA 2C96A 5LA6A 1U4SA 4JKYA 2BKLA 3WZ2A 1Z6YA 4HRAA 2QIPA 3E3OA 3H84A 4PU0A 4X41A 1XCLA 1E3EA 4K88A 5HZMA 5KJFA 1M34B 1WO8A 3VQTA 1U2DC 1ZA2A 3DE1X 1DKPA 5FEMA 1MFZA 4B34A 2Y93A 4BZWA 5TMEA 4UC0A 1LPAB 5E9QA 3F73A 5E6UB 1RLUA 2UUCB 1DIAA 1TWGA 2JLAA 1XTZA 1UT5A 1XK7A 2QZPA 4I4NA 4B6OA 4D9FA 5F98A 1F0YA 3H83A 3TIFA 2IHNA 4S2UA 4XB6B 3U49A 3RS2A 2LCFA 3H5OA 2V59A 2R1VB 4R3UC 5DYGA 4I8DA 4YRKA 5AW2A 2DH6A 1IOZA 1V5EA 3ZLVA 7GPBA 1XZBA 2WTEA 1V1MA 3FOCA 4HTFB 3RB8A 1QPBA 1MAUA 1R8SA 5E8RA 4E4TA 2ZJ0A 1UBFA 4HO1X 4TVBA 1N6OA 3GPDG 2QG9A 3ZKWA 4GI5A 1VMIA 4LGCA 2GK7A 1NV8A 4FHEA 3WIUA 4DJAA 1DCKA 3MN1A 1YBFA 2WV7A 2NAPA 1T3SA 3BH0A 3K1ZA 3MT9A 3VPFA 5HZGA 1ZAYA 1A2OA 3P0RA 3UAXA 2OK8A 1ZO8A 1CNEA 2AT1A 4JLVA 5KAMA 3CBQA 1KJQA 3G5TA 4ZCIA 4C6TB 3LRXA 1G6HA 5BQPA 3A27A 2EZUA 5JS8A 2YV4A 4CQLB 2FMXA 5ALNA 2ZI5A 3KELA 4QUBA 2WT4A 3K09A 1RYDA 4BAUA 4BQPA 3TFOA 1A77A 2DSTA 4G0MA 2Y4NA 3GVIA 3JY6A 3QXGA 1JHUA 4TKUA 3DBRB 2Z3VA 4XSHA 1EM6A 4YMHA 1Z5UA 4GPIB 1NT2A 1XZAA 3L0ZA 3DA8A 3G2QA 4GOMD 4KBYA 4A8JA 3KT8A 5IJWA 2I03A 1LS1A 1MZPA 1BTOA 1W0JD 4KN6A 4MLPA 1R9NA 4N3AA 3V5NA 5HRUA 4X00A 1YQTA 2VP2A 1RI2A 3FVQA 3PHLA 1H1DA 3ZXXA 3ORSA 2AV6A 4BLQA 2HFKA 4EPVA 3WJ7A 2XADA 4URZR 4FLMA 5E4FA 3C3CA 4ZT7A 4JBWA 1Y8ZA 2OORC 4XGQA 2NP7A 3LCJA 4DCTA 1GU7A 3FHOA 3GLHA 4FSXA 2OGTA 4L2IA 5BSVA 3OH8A 1GN9A 2H31A 2ZS9A 3PRKE 4FFRA 4L4XA 4RJKA 4YJKA 3SFVA 2ADOA 2Y68A 4IDPA 4KAJA 1NJGA 2FR8C 4B9AA 2BFFB 1YACA 3R0JA 3A1EA 3ZQ4A 4GFQA 4AYWA 2NN3C 3GT7A 3PGKA 4BMOB 4N0PA 4FGUA 5CG1A 2YJ5A 1R6VA 1Y1KE 2PBRA 1VZ2A 2OP0A 4O4IF 3KUCA 1N5DA 4ZZIA 3BFPA 3ML1A 3SOZA 1L7RA 1BMQA 3D02A 1P9NA 1QK5A 2GEKA 1L5LA 1JR3E 1SULA 1H8HA 5EXEA 4Q7QA 4UPDA 2HUNA 2QSUA 3HUDA 1RP7A 1TYDE 1F8GA 1FFWA 1JDPA 4JVSB 3LE8A 4C0WA 1A3CA 2HQRA 4WXPA 3TNLA 4NBKA 2YWBA 4PLVA 4D97A 2QW8A 1TT5A 3F1KA 3GUUA 4EVIA 2YQ4A 3SZGA 3D43A 1TQ4A 4N03A 3RYHB 3KL2A 3ONFA 4IJKA 5A3RA 1NRWA 4ZQCB 2I5PO 3U7RA 3OEHD 4QLOA 1E4OA 4AJPA 4A27A 1NJ1A 3X1MA 2V7WA 2B9VA 3N7UA 3OM8A 5FPHA 3ZWKA 5EIXA 1XD2B 4L9WA 4M0FA 4G2TA 5LLSA 3WDLA 4CIDA 2AQKA 3G5UA 3F3KA 3GHYA 1RWWA 3VJLA 4XWWA 3A05A 3UJAA 4YLYA 4WZZA 1AUXA 3EISA 2I4OA 4FNOA 2H54A 3IP5A 3QLJA 4Q00A 1Z63A 1PL8A 1JQJC 3PUIA 2X4GA 3UAGA 1ANKA 3JTEA 3O47A 1GEEA 1TO2E 1VC2A 4Y2HA 3VAZA 2FNAA 1EZ4A 2JDIA 3M4YA 1LQUA 5IAEA 5TY0A 5IABA 2PH5A 2PXAA 1YQEA 2REQB 4XQ0A 1XZPA 4LMPA 4AY3A 2CYAA 2O8FA 3KX2A 2BFDB 3A1TA 3II6X 2Q41A 2ZR8A 4PYNA 5B58T 4OL0A 3LOUA 2ID8A 5AOCA 4YO8A 1JQ5A 3RS3A 4GRDA 2O5JD 4HGNA 4BNYA 5JS7A 2FSIA 1N9KA 3T5GA 4B2PA 4LV5B 1Z07A 2JC3A 1TKAA 1H2FA 2QV7A 1JJVA 2VVTA 2FPGA 1P2UA 1KJ9A 1DU4A 2CD7A 1KNQA 3A2MA 4YP0A 4WFQA 2ATXA 1ORTA 2J9GA 3SG0A 3TBHA 3WMGA 5FJIA 1T36B 4C3VA 5KTMA 4DMKA 4C2AA 5JHGB 1W2WB 3RVLA 4A4DA 2IDZA 4O4HA 3OCJA 1I0IA 2O8FB 4MI3A 2REQA 4GO1A 4QG3A 2C5HA 1NSTA 1PZHA 1YS1X 5IJXA 2H29A 2X41A 2PV7A 3RG2A 4AJJA 4CG3A 5L8VA 3V3TA 3IE0A 1WU8A 3WLOA 2Q99A 3L4EA 2A9RA 3SEQA 4A0FA 5JYBA 2VBFA 1DAHA 1H69A 1EB9A 1JMKC 2R60A 1Y37A 4OH1A 2D0OB 1G21B 5B1IA 3BAZA 4OQPA 4KO1S 4LCJA 4W82A 3DNMA 4FGZA 4FW8A 3DZDA 3IP6A 4LPSA 3PNLA 2C4MA 3HA7A 5D00A 1XD2A 3A9TA 3EEYA 5ALQA 2WPDD 421PA 2H5LA 1YWGO 2Y1EA 2JBAB 4LHWA 5EP4A 1Q83A 2ZUEA 3GVCA 1Z06A 1Z74A 2FRVA 4QULA 4G4IA 4KPEC 3V1KA 3LKVA 1DAPA 4JBNA 2ZBEA 4OCZA 2Z1NA 4KGDA 4YYZA 3EEOA 3AF2A 5HKAA 4I1PA 1OWNA 1A2BA 4YASA 1DC7A 2L69A 1ZX1A 3P1JA 4H6VA 1JSCA 1W44A 3BSYA 3JS5A 1T2AA 4OIMA 1KI7A 3QMVA 4AWAA 2OBFA 3K20A 2E0IA 3L92A 3V4PB 4JLPA 2ET6A 3WBKA 3JQAA 3SD7A 1RVV1 3EVNA 1S2IA 2BZ1A 3NZEA 1QUEA 5KYTA 1EUQA 2R8XA 1WOMA 1WY5A 1X1EA 3JQGB 4UKDA 4YT5A 4ZCPA 1H2XA 3IQEA 3UYKA 3A32A 1EUYA 1M34E 1HNXB 3GDWA 3FBTA 4JJGA 4ZVNA 5TS3A 1T8IA 5AKHA 2BEUB 3DMTA 2WJYA 3N0VA 3HNOA 4K0RA 4ZRNA 3WRWA 2NO7A 3PK0A 5L3ZA 4EYOA 3TMAA 2GXUA 3DEJA 1PGOA 1EAYA 3GLHB 4PLWA 3QLUC 1CIJA 2XOKD 4KPGA 2PYZA 1CY8A 1OC2A 4L73A 3AONB 1GLVA 3ACDA 3O2SB 4E7PA 2AUNA 1GG9A 1L8LA 1KGDA 1YGYA 3AI3A 3DHNA 3I3SR 1OE0A 4KFRA 4ZU3A 2DHRA 1FBNA 3IKLA 1UBUS 2FP3A 2GEVA 1O08A 4ZQHA 4US1R 1PEAA 2L19A 3A7EA 3BL6A 1GQQA 3BD7A 5A5EA 3LNCA 4BO1A 1BW9A 2IOYA 3I01M 1QZTA 1TNDA 1Y9AA 4BFUA 1DAKA 3KT6A 4WJLA 1YZ3A 4P4TA 2B34A 3RSZA 3I9MA 3GCZA 1CRWG 3OZAA 3HUFA 2E55A 4D9BA 4KYIB 4CQLA 3LDGA 2I7VA 4NMXB 1E1MA 5BQOA 3TQSA 2I7DA 3K6RA 1J09A 3WNVA 3UXHA 4MJLA 5BURA 4HQRA 3GJ6A 4QAQA 1WMEA 3EFBA 3C48A 3U1TA 1DAIA 1I5RA 2G88A 2ECFA 4CEIB 5HKKD 3S8EA 1ND5A 1IPEA 3OU2A 1OLOA 2HMVA 4L5YA 5IZ4A 1U2DA 4F8YA 2YV1A 1UPFA 5FO1A 2JCYA 3IPRA 1G1MA 3O3NB 2H18A 1Y98A 4LJYA 3RSSA 4AKHA 1KDRA 3LZ6A 1OD6A 1V1MB 2E89A 4KI0A 4RU1A 4QWMA 4V0SA 4D9CA 1E2GA 2NV6A 5AKKA 1H65A 3ZV3A 4GM1A 3OQVA 3PJRA 1A72A 5ALJA 521PA 4ETNA 3ILXA 2ZIWB 3V4LA 4WLEA 2X5NA 4AM8A 1Q21A 1A8SA 2I1LA 2Z4SA 3VPDA 4BMYA 1YJCA 4TZ6A 3UXEA 1OKKD 5ALLA 4OYRA 4PIVA 1NN3A 1KYVA 3O0TA 2F17A 1EUDA 3KWLA 4M1MA 5AK6A 1IN1A 4C2MA 1T5HX 2Y92A 3DCIA 3L7YA 5EMLA 1H93A 4MQ4A 4Q1AA 1ZG3A 1W4RA 4HQ6A 2ON6A 5A9TA 4AKTA 1V35A 4NG5A 1CUCA 4XUCA 3CUKA 2FFRA 5BV7A 1AKNA 2O8DA 1FS5A 4QO7A 5E9WA 4AN1A 5K8CA 4R71A 5FLXA 1O5OA 4DV2B 4C04A 3HA5A 1YCHA 4HB2A 4JASB 2ASVA 3RTEA 1V43A 5C1OA 2XMZA 4N5IX 3C3AA 2IEBA 1TEVA 2FFHA 4CV2A 2ZVJA 1YBHA 3GH3A 2A57A 4RJIA 3TD9A 3WYDA 5EIWA 4A0RA 1IBLB 1G0OA 2JATA 1B8NA 3ORHA 1R6XA 5LMZA 1USUA 2NZUG 3D1VA 3Q2KA 5F1KA 2Z9BA 5ICGA 3IC5A 3W6OA 3GEMA 4LHSA 3NAQA 3ND5A 5LMUB 2QVGA 3A3PA 1TTTA 1JJAA 1GDDA 3K70D 1XZJA 1AF7A 2KBEA 3IB6A 1I4DD 3RTCA 1EI9A 1ID8A 2LKCA 3FCYA 4NYMQ 3PQ7A 3QPVA 1M75A 1XTSA 1YSCA 1B6RA 1TDJA 4TWBA 3O91A 3RFUA 3E15A 3REQA 4IVNA 5EQFA 1Z7GA 5F9HA 4WWHA 2AUMA 4R6XA 1PNOA 3OIWA 4M9ZA 5DISB 1E5QA 3W78A 3A06A 2FEPA 1QJ4A 4L95C 1KYXA 3E5RA 1EVIA 2HO5A 3K32A 4W5JA 3AUAA 2XSZA 5EAIA 3TGPA 5BNWA 1QG6A 1NQOA 1M7HA 1TGOA 1ZGZA 2IYYA 1ZHFA 2RHGB 3OC6A 4OB8A 2H59A 4QBHA 1HQDA 5DBIA 5CCDA 2JFZA 3CF2A 3F67A 3FTNA 3MBOA 3N8HA 3AVUA 3K9WA 3LHFA 4I50A 1F2UB 3KL4A 3PJGA 1CG6A 2C29D 3HFRA 3TLCA 4EJSB 2YUIA 2QDKA 3B85A 4IGAA 1SOUA 1Z2EA 2XVYA 3B7PA 3LQYA 3SFTA 3WO1A 1Z22A 3O84A 5LMCA 3CW2A 1MG0A 4ZKEA 3NHKA 1W2HA 1TM3E 2WW8A 3MSXA 2CBGA 5DXJA 5LLDA 1LU9A 5C35A 1DUVG 1F38A 1N7JA 4BS9A 2Q4OA 3EDCA 4BMNA 3OE1A 3JV7A 3B48A 5DZSA 2XBMA 4HL6A 2MSCB 4DQLA 1YZQA 4UW9A 3DZBA 1R27A 1OYYA 3OURA 5LZ2A 1CJBA 1OYWA 3ZBQA 1H05A 2ZOSA 2WAYA 3MTBA 4BQOA 1T8SA 1YC2A 5FBQB 1X15A 1P18A 4HFMA 4GM0A 2RB5A 2D74A 4IEEA 3ZLBA 3PQ2A 1LRLA 3O26A 2F1JA 4FN4A 4H31A 1RI5A 1Q6YA 2I55A 5CDYA 1XP5A 3WA7A 4ZVQA 3IV7A 2P5YA 3L82B 3ZNOA 3ZZTA 1Q1EA 2F4QA 2ZQYA 1Q22A 1KEKA 4UD2A 5A6SB 2DFPA 3J81k 3MXTA 2MHCA 3CLVA 1P9RA 3KDAA 1BS9A 4GU5A 4BFXA 4EZIA 5C5IA 1GNSA 4W7SA 3K5HA 3D3KA 1AZLA 1QF7A 1VL1A 3QWHA 5FI3A 4EI2A 3RU9A 4B84A 3DTVB 3DU6A 4DXDA 5A4FS 2FJPA 3KM0A 1CJKC 4MR7B 4U7WA 2FSUA 4Q4HB 3U7IA 4NCJA 4BQEA 1RXVA 4OP2A 1ZSYA 3M2TA 4KITB 4Q1DA 3U44A 1JIQA 4NESA 3LPMA 3MRXA 2FA9A 3WK5A 4ER0A 1T0PA 3FPEA 1JI0A 5DYWA 1DKMA 1UWKA 5DHSA 4RK4A 1CFJA 1WB9A 4UU7A 3PS9A 4KQXA 4L6IA 4LBVA 1UDRA 3AEXA 5K3FB 1VG1A 4KXNA 3WGVA 4ZVOA 5CA1F 4BV9A 4YT4A 3ZHTA 3KOWA 3RHZA 2VQ3A 1F8FA 3B3GA 3TJRA 4F5DA 3DQZA 5FUXA 4ENRA 3L0IB 1KOFA 3J7TA 3DD1A 4TMKA 2HEIA 1VSBA 3RREA 1RRVA 3D6AA 3GEPA 3A70A 3AF3A 3Q9UA 1O87A 3ZE2B 3B5IA 4M46A 4ILKA 2B83A 3DHVA 3O75A 3NIFB 1TVEA 4WZBE 3SNHA 1TU0A 3K6SB 5J3JA 2EF1A 1GG2A 2IEAA 3FLMA 2WIFA 2R7KA 3CLTC 2J67A 1SPXA 1SUSA 3G2IA 4FFDA 5KJEA 1RAGA 3KLPX 4RDCA 4O4HF 1IJFA 4CR6A 1OB2A 5AO9A 3ZZ0A 2SKDA 2YY5A 4ZEWA 4WBNF 3L02A 3ASYA 3JASB 5EYPB 1QQTA 3M1YA 3W77A 5EHGA 1E5LA 1P72A 4R1OA 2IHZA 3KOXA 5F2OA 5TE9A 5HSGA 1E58A 2YJGA 1CU1A 1O96B 2JCBA 3KV3O 3TM4A 5JQGA 5IPFA 4MB0A 4MICA 2IZOA 3NV7A 1NW4A 3K8QA 1ONOA 2CMDA 2YZMA 3JVIA 3KVVA 3QPAA 1IY1A 4AZVA 4CBVA 5HPYB 1L7VC 3P9PA 4H4CA 5D87A 3NYIA 1TCVA 3FN4A 1DD5A 1UT8A 2EWWA 4JQCA 3HZOA 3N0XA 2IUSA 3B70A 4H1WA 2GHTA 3LWBA 1QV9A 3QENA 3JYQA 4KRGA 1LW7A 3BMOA 3RSOA 3LY9A 5KUTA 1ZOLA 1YVPA 3UCFA 2BHRA 4X94A 1G20B 2F2TA 3M6MD 1HLPA 2NU6B 4G97A 3DZIA 4BC1A 2BJHA 3BK7A 4LW8A 2C57A 2NXEA 3TINA 4BNTA 2PWPA 2ALJA 3D3EA 3I0ZA 3QYFA 3JSAA 4LVOA 1AK1A 1UK9A 1M74A 2GPBA 4LI3X 3GW8A 3V4VB 3Q8KA 1Q19A 1MDBA 4TVKA 3IHWA 3RJ5A 5GZ3A 2NSHA 2BM8A 4JQZA 4W1PA 1H2ZA 1UKEA 3BRWA 2D2IA 3DCYA 1YQDA 1PHRA 1FP6A 3ABZA 2AFHA 3D7KA 3U81A 1Q95A 1UEXC 4AZSA 1KZGB 2AOWA 4DR2B 4PEVA 4KAXA 2LP4Y 3F7OA 4KXLA 4IKEA 3LT5A 2FLWA 2PEYA 3H9CA 4TV8A 3ZVLA 5HQTA 5DWDA 2QAGA 1K8QA 2PT9A 2PZFA 2ZUVA 4JBGA 1WCXA 1Z13A 5EPEA 1NPDA 3CZRA 4B75A 3HKBB 3L4KA 1XO1A 2GXAA 121PA 1W4CA 3DF7A 3PDHA 2QUJA 3B3AA 3HV0A 1LNQA 3E5MA 3FE2A 1KVTA 2BOVA 3HKEB 3LSYA 3LWDA 1XWIA 1VKJA 2VJCA 3A9CA 4NBUA 3LGSA 3SI7A 3C45A 1XEXB 3B9RA 2WWYA 1JWAB 3DT8A 4RY0A 3V1TC 1E3LA 2RI6A 3MPUA 2J8ZA 4PNEA 1ZVJA 1NNI1 3W2IA 3MQ4A 3PL5A 3F4BA 3JYLA 1TAHA 3QKTA 2DKOA 4LAFA 4PZZA 1T2UA 4DLZA 1NX9A 2PM8A 2V7UA 3AOEA 3CIOA 4ASUD 1IL0A 3G8YA 1DG1G 5KYGA 3SVLA 1V0JA 5JQGF 4HAZA 1RACA 4WESA 4FYXA 1KHHA 1EG7A 4GGOA 1CR6A 4DARA 2TMKA 3D0OA 2J3DA 2VBIA 3E58A 3P9SA 4FZRA 4QOFA 5CA1B 5IYZB 3L7NA 4UJ5A 1B8VA 2VWHA 4YCDA 4J75A 1E0SA 1G5TA 3EDQA 1R64A 4PHTA 4OSEA 4D44A 2E7ZA 3GOHA 4A16A 2YMLA 3VISA 2ZYIA 4B8YA 1U81A 5CT9A 4UTRA 5IHPA 1Z2CA 1BQ3A 4A26A 3RASA 5BW6B 1PWZA 2X76A 3IMCA 3VNSA 4EAAA 1DI0A 1TTHA 5HMMA 5K6RA 1EGQA 2OXRA 3O4VA 4ZVLA 3R7WA 4DOMA 2QW1A 3DDNA 3HXOA 2WSLA 5PNTA 4MEBA 5BORA 4I1IA 3HVKA 2P11A 1GAWA 4ZICA 1IIRA 4PBRA 3TX6A 1L5RA 3I5AA 2GBFA 1SC7A 2PZMA 3H11A 3LGAA 4L51A 2ECKA 3MWYW 2VYQA 4LKRA 1A9RA 4PLGA 2QL7A 1U7PA 5FH9A 2OV1A 3COYA 3WV4A 2QPAA 2YXBA 1KDVA 4RPIA 1QMPA 3KFLA 3AFMA 1RHJA 1T8UA 1WF3A 2QLMA 2DUUA 2HMUA 2BDEA 4XFKA 5FADA 3R7SA 2C95A 2G6BA 3DBOB 3FXAA 5FWAA 3RS7A 1P1KA 4PX2A 1P2BA 2FI1A 1PDWA 3JXEA 4EJSC 3E4CA 4WFIA 1S7CA 3JQ9C 3HDJA 3W1VA 1RJWA 3DW1X 2PRJA 4BRUA 2QY6A 4UPVA 2NW6A 4DCNA 2HV8A 2QM0A 3LXXA 1P6UA 4TXHA 4DCVA 3NYQA 3VHQA 5KNDA 1C9MA 2ZB7A 4AS3A 1ZK3A 1D2NA 1X7WB 4YTEA 4AI6A 1EXDA 1RRFA 5EWJB 2I54A 4Q7EA 1U3UA 1EFCA 3GG9A 1SOWA 5GWXA 4X60A 3ZHRA 3I72A 1RRKA 2A9KA 1J25A 2FWIA 3KZXA 1BE6A 5L51A 2WFLA 1XRSB 1I7NA 4CIAA 4TL8A 4YP9A 1CP3A 1W46A 5HKLA 4DSUA 3HQ4O 2Y0SA 3R0VA 2M2IA 3WHPA 2ZWAA 4OHCA 1VECA 4Q4JA 5FXMA 5LC1A 3WBJA 1DADA 4C22A 3SSAA 5JATA 3MFQA 5HG0A 4BXOA 3AU8A 5KPDA 4ARIA 3VV3A 2XMRA 3FD8A 1RADA 4R16A 4V3CA 4JYAB 2IS2A 1CYEA 1NQTA 1I6KA 1LY1A 1RAAA 2X5JO 4HAVA 4K9PA 1OX4B 2WFMA 3AKCA 3LXUX 4JC4A 4UMEA 2CV0A 4OI2A 3NHUA 3QFHA 1LDEA 4YECA 5IARA 1M1UA 1QHFA 3FDFA 3FYUA 6REQA 5J47A 4JT2A 5EA2A 3PEEA 1P2GA 3UW3A 5LP6F 1DQRA 2FZEA 5JDIC 4J7UA 4ZHSA 3FPJA 1EFTA 3OE4A 1E2EA 2O7RA 3TWOA 2EQAA 1FUIA 2IHTA 4BFTA 3MGBA 4ISBA 4L6AA 5JE8A 1I9GA 2Y1FA 2WSYB 1PFVA 4KX3A 2XGMA 4WNAA 3SXPA 2GXSA 5T64A 3F2VA 3GEEA 1X38A 3DL7A 1MW8X 2QENA 4Q93A 1ZD2P 3EIOA 1LPNA 2OMEA 3RRMA 1GADO 5CBKA 1IE3A 4WCVA 3PEFA 5KKCA 4HH0A 1DKOA 3HXKA 4QEDA 3CY6A 3GIWA 5DGHA 5AXAA 5J4HA 1U0HC 2M98A 4IY1A 2DWCA 4TUYA 2Q4TA 4JOBA 5D7NA 3CX7A 2VDVE 2CHGA 3DE6X 3M5PA 4PQRA 5FNZA 2HPHA 1ZHOA 1OFIA 1YI0A 4MYDA 3OPYA 1Z7WA 5ES3A 2FG6C 5JSKA 3ZW7A 1Z0FA 3HN2A 1WPQA 1AQJA 2QEQA 5M34A 1O0SA 5HVNA 4IQFA 1E3SA 3JAWB 3RIHA 5JU6A 2QGFA 1MX1A 2FPIB 1IEWA 3TZLA 1VE6A 3VH2A 1N9GA 4URWR 4DG5A 1KZ7B 4LF4B 4PHCA 2ZBFA 4UFPA 1F0PA 1BDBA 2PANA 3D9QX 2D1YA 2DPXA 4AJOA 2O2GA 2I6GA 4ZC8A 2GRJA 4K6MA 1HO3A 3D0RA 3VYRB 1F6BA 1DKUA 3ORYA 2ZZNA 4MRAA 1ARZA 4TVSA 4BX8A 5IXJA 4DWVA 3RRBA 3VH1A 3NYRA 1DAFA 3KT3A 1NE2A 4O63O 3HNPA 2A6ED 3JARB 1A5TA 4OB6A 1MENA 3QBDA 3AEKA 3IDZA 4QJIA 4JQYA 3OJLA 4RA6A 5H0IA 4E1AA 4F12A 1G5FA 4HVCA 2HC9A 3TW4A 5J2UF 2PMKA 2BI7A 3VXKA 2XNDA 4GLBA 2BZ0A 4KOEC 1UOEA 1FPMA 1WBJB 3CWQA 1QF9A 3CX3A 5EHNA 4FM9A 3P20A 1VE7A 1G60A 4PPGA 4OM7A 1SY7A 2AG1A 3PR1A 2C0CA 1SCBA 2EEPA 3L43A 2BFPA 2Q5IA 3DZ8A 5LCXA 4H7HA 2VAWA 2YHAA 1IYZA 4MS3B 1HQMD 2EWVA 3G2NA 3EYAA 4W6QA 5FKJA 2RH9B 2F64A 3SVTA 3L4SO 1FSPA 1RYNA 4NCNA 2ATEA 1NI4A 4G81A 5AVRA 2WP8J 1LPSA 1N8NA 2VLIA 3QJGA 2CLSA 2AE2A 4GI1A 4J0GA 3H8JA 3CF0A 2CLKB 1Q1NA 2G09A 1VXOA 4UMFA 3TLKA 5I4CA 2JGJA 3HM9A 5KO2A 1EWYA 3B2QA 2PPLA 2CL7X 1CSEE 2HREA 2YMPA 4MGEA 4ZVRA 4IXMA 4DILA 4MKHA 4C7OB 3NFRA 1PUXA 1M2JA 2CHVA 4RK6A 4TZTA 3A1UA 5I8WA 3EPKA 3PP8A 3NJ4A 2B63A 3Q4GA 4Q34A 5AMXA 5LBUA 4BQQA 2EBWA 4NE2A 1ULSA 4Q7MB 5DHQA 4C07A 2H92A 5JS6A 1XRMA 5SV2A 1XPRA 3KJXA 3MGAA 4B7ZA 2M6LA 2I1QA 2P7HA 4QXMA 4HEJA 1V8FA 3NR2A 3OOSA 1O94D 3R3JA 4PX5A 5CMLA 3K0FB 1G19A 1KAMA 4Y9UA 1ZCFA 1OXVA 3IAFA 4G5FA 5T6BA 2OQVA 1WAMA 4L8YA 5AESA 2UAGA 1F7VA 1VB5A 2QT1A 2V5UA 3MB5A 4JUIA 2K4MA 5GGXA 3LY7A 1DC6A 2WJAA 3AUXA 2GLTA 1M7BA 4JA2A 1THTA 3ZK8A 1FIUA 1MJ5A 1J00A 3IAYA 1IHYA 5HTOA 1Q16A 2C2GA 1JFRA 1YS9A 3K35A 1JGTA 2CUNA 3CMMA 1K9SA 4J90A 5ITVA 4NL4H 2WUEA 5KOJA 5H3LA 1EK0A 5AW5A 2WY2D 1EU1A 5JXIA 2XI4A 4H0FA 3GB9A 5I7UA 1YXMA 1Y7LA 4J4BA 4EO4A 5FI1B 1AGYA 4IEIA 4MW9A 1IS1A 2A33A 3GDFA 4I9UA 1BE1A 1E99A 1DARA 3NB0A 4M0DA 1ORIA 2PKYX 3C7KA 2GD0A 4XIFA 4B48A 4B09A 4ZCLA 1P5ZB 4ZVTA 1PL6A 4YGXB 4I8IA 1J0DA 4I5GA 4ZK2A 2EG5A 5KOHA 5HYVA 1RBMA 1GXSB 1T1JA 5HBRA 3E8MA 3AEYA 1BXGA 2C4UA 1BMFD 1TU4A 4ND7A 1G3UA 3OTGA 1IY9A 3R3YA 2O2HA 1ULTA 3FUXA 4OHXA 4KN9S 3TDMA 1VDZA 2EX1A 2ZP1A 1W52X 4LOHA 5D8DA 4EDFA 1WNTA 2WZQA 1M5UA 3FJOA 1UEJA 3T7CA 3QHQA 4DAOA 3QG1A 3TE7A 2ZR0A 3NV9A 1UMDB 3AL3A 4D9NA 5LIRA 1M8PA 4MS4B 5GOTA 4JXKA 1BKYA 5JO9A 2FN3A 4XTCS 3SP1A 3PUWA 2X8BA 3BWEA 1IQ0A 3RV3A 1HY3A 1NYTA 1JR2A 4UCWA 3JQAD 5CT6A 5LWHA 4GC5A 3K70B 1X8KA 2J5RA 1NKVA 1IBCA 1IB6A 4GLJA 5FNVA 3BWVA 3AEQB 3JRNA 5L3QA 3GLTA 3KZCA 1A0OA 1G21E 1RC1A 2JNWA 2WI8A 5DO9A 3RLIA 1YJ5A 4ARUA 2XUGA 4RTKA 3HCFA 2V7VA 1PZMA 3DS8A 3I52A 2IW3A 3K2QA 1SCDA 1G3QA 1XZIA 2HJVA 3EOAI 2R93A 2PX2A 3BAFA 4DN6A 1CQJB 4LY9A 3GPCA 3Q8XB 2WG2A 5IVIA 4OGLA 4QRHA 5IT9A 1Q7BA 2YXDA 4PAMA 3FHJA 1GCOA 4QOIA 5AKIA 4F85A 4Q9LA 4BLRA 1MHPA 3ANSA 2VJQA 4J0FA 1QV7A 1Z6QA 1QGUB 2QRHA 1U04A 3NT5A 2RSLA 3HGMA 2P3LA 5CT5A 5IC4A 3PFGA 5HQ3B 5I9TA 1QS0A 2PGIA 2QQ5A 1U7DA 1O54A 4A8HA 1KEVA 1SVOA 5F78A 4EI7A 2Q21A 1N77A 3I2YX 1CUBA 2YVAA 3JR3A 3UAOA 3NKVA 4R9UC 1BCSB 4K6GA 4RQAA 1MB0A 4K46A 3DM9B 1G3MA 2GCNA 1R7RA 2LPMA 2OECA 3UIEA 4Y1RB 1P7YA 4FDVA 4KJZA 5JSUA 3EF1A 3FNFA 2XNSA 2W0SA 3BHMA 4EG1A 4ZMBA 5JS1A 2YXLA 1JLSA 3PJEA 3IEMA 2Q6KA 1BJRE 1F6WA 2OTCA 4JI1B 1I51A 4M87A 3OCYA 4WAUA 3A28A 1E2MA 1T3HA 5DSZA 2X8JA 3IHTA 3K9CA 2WJGA 1CJMA 2GJ4A 2ORIA 3I9OA 4C7JA 3AHJA 3QE3A 4Z4HA 4GWKA 4JL6A 4OQDA 4R7GA 2PTGA 5MHTA 4D8YA 2OBBA 3HB7A 4OKSA 1EDBA 5I3CA 3LOQA 3HC7A 4D4GA 3BL8A 1QG2A 1OIVA 4DBVO 4TRJA 2IS4A 2ZRNA 3LWNA 4HAUA 2YNMD 2ERXA 2EFCB 2YNMC 3W79A 2R1ZA 3CR8A 1INLA 1F4VA 5TGTA 8ADHA 3IP9A 3FUTA 4EFDA 2AHRA 2Z5FA 4O1MA 1H5QA 2LDBA 2Q7DA 3I8SA 4IVRA 1QAQA 3QVGB 4CLDA 4P4SB 3DAOA 2ACKA 3NATA 1FS6A 3PBKA 2C3YA