4D3YA

The structure of inactive prolegumain from chinese hamster.
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
404
structure length
384
Chain Sequence
b'GKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMSPISLPPVTRLDLTPSPEVPLTILKRKVGQIQRLLDARHVIEKSVHKIVSLLAGFGETAERLLSERAVLMAHDCYQEAVTHFRTHCFNWHSPTYEYALRHLYVLANLCEKPYPIDRIKMAMDKVCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUMAIN
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
total genus 139
structure length 384
sequence length 404
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4d3yA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3yA01
2HBZA 1JXQA 3R7SA 1GQFA 3R6GA 3UO8B 4EJFA 4M9RA 3P45A 2FQQA 4EHHA 5IC4A 5IBRA 4D3XA 3R7BA 2Y1LA 5JFTA 4QU5A 2CNLA 4JR2A 4I1PA 4JJ7A 1CVRA 1F9EA 2CJXA 5IAJA 2H5IA 4ZVSA 1SC3A 3P4UA 1RHUA 4N6NA 1I4OA 3GJTA 2C2ZA 4IYRA 2FP3A 1NW9B 2CNOA 2CNNA 3PCXA 1NMEA 5IBCA 2P2CA 3H11A 1QDUA 1RE1A 5LUBA 4JJ8A 5K20A 2C2KA 1NMSA 4EHNA 4PS0A 4NOJA 4QTYA 5IANA 3DEKA 4FXOA 3SIRA 4NOMA 2XZTA 4QUJA 1IBCA 4D3ZA 4HQRA 4AWAA 3V6MA 2QL7A 2CJYA 4ZVQA 2QL5A 3GJRA 2J33A 4EHAA 4QUDA 1RHKA 1RWVA 3SIPA 1SC1A 1SHJA 2HBRA 1RWWA 3IBFA 3IBCA 3K7EA 3NR2A 3R5KA 2H54A 4FEAA 4N7JA 4ZVRA 4AWBA 5I9TA 5IASA 3RJMA 3GJQA 1QTNA 2H4WA 3KJNA 4DCJA 4JB8A 1ICEA 3V3KA 4HVAA 1BMQA 2HBQA 4EHKA 2J30A 1RWPA 2XYPA 4N7MA 3H11B 2CDRA 5H0IA 1RWXA 2H48A 2XYGA 3EDRA 4PRYA 2QL9A 4JQYA 3V6LA 3DEJA 3NKFA 5LUAA 1RWKA 1SHLA 2K7ZA 2WDPA 4DCPA 4NOLA 2CNKA 4QU0A 5LU9A 3V4OA 2J31A 4JQZA 4IEFB 4N6OA 4NBLA 4QUGA 4HQ0A 5LU8A 4PS1A 2NN3C 4JR0A 5IAEA 5IABA 1PAUA 3E4CA 2H5JA 3V4LA 2C2MA 4ZVOA 2QLJA 4ZVTA 4FDLA 3PD1A 3H13A 2QLBA 4QU9A 1KMCA 2DKOA 4PRZA 1RHQA 3EDQA 4QUAA 3H0EA 2AR9A 3KJQA 3D6FA 4QUIA 4QUEA 4EHDA 3GJSA 3ITNA 1K86A 4N6GA 3R5JA 4QTXA 1RHJA 2XYHA 1GFWA 3V55A 1RHRA 4I1RA 2HBYA 1F1JA 4NBKA 5IARA 3H1PA 4QU8A 2FUNB 3S8EA 5I9BA 4ZVUA 3S70A 2C1EA 2C2OA 1SC4A 4N5DA 1PYOA 3QNWA 2H65A 4FGUA 3R6LA 5IAKA 1M72A 1QX3A 1I4EB 4D3YA 1RHMA 1RWMA 3R7NA 4QUHA 3UOAB 3BIJA 2J32A 4JJEA 3OD5A 4QUBA 4DCOA 4EHLA 2QLFA 4JR1A 1RWNA 4NBNA 2XZDA 1K88A 2H51A 3DEIA 5IC6A 3PD0A 4ZVPA 3KJFA 1CP3A 1I51A 1RWOA 2H4YA 3DEHA 5IBPA 3D6HA 3NS7A 5IAGA 3D6MA 1I3OA 4LSZA 4AW9A 4NOKA 4EHFA 2Y0BA 1NMQA 4QULA
chains in the Genus database with same CATH superfamily
1Q83A 2IXEA 1G0NA 1DWOA 5T5QA 4W5QA 1ENOA 4N0MA 4ZOBA 2MR5A 5AJWA 1RI5A 2RG7A 3L2OB 2O3TA 4OIFA 5FBQB 2G09A 2G82A 3HVIA 1KI3A 2ZPUA 3EH1A 3WHIA 4Z4FA 1G55A 3UFXA 2X9LA 4B4KA 4S2EA 1ISPA 3UV3A 3KQLA 4HSGA 2R8PA 5AW1A 4GMHA 4GMXA 3RVNA 1HEYA 4OBWA 1TRKA 1SBYA 2CUNA 5K6TA 1CQPA 1X3SA 1LDNA 1Y8AA 3HYLA 4PGHA 2FMIA 4KTVE 1MAVA 4L8WB 3O26A 1RE1A 5EHIA 3E7PA 2XUIA 5CCXA 4R1QA 3UJNA 2XGJA 3ROMA 3DEKA 4LHYA 2YYSA 4AULA 3LVRE 3SD7A 1BEUB 5JW6A 3OLYA 4H7DA 3PNYA 2FHPA 1UCFA 4BX2A 4B74A 2E5WA 3CRW1 3WGQA 5LP1A 3SQXA 4EL0A 3GQBB 1T24A 4LS3A 1X92A 4UHCA 5EY5B 1N1EA 3TVYA 2WJYA 3IESA 1I5OA 4P3NA 1I4LD 2W6QA 1A9XB 2BR4A 2A0YA 4IIJF 2CBXA 2O1SA 1WB5A 3CF6R 5DHFA 1SBNE 1LPSA 5AVKA 5IFKA 1QTNA 1NE7A 1SVSA 2NUBA 4ZZIA 1DIGA 2ZLBA 1VFPA 5IF3A 4X5OA 3PTAA 2H2IA 2X2FA 4KK4A 1NXTA 2CHUA 1K06A 1O95C 1OFTA 1RWPA 2VWGA 5DMXA 3T7IA 2YRWA 4FUTA 5ARDA 2KLBA 4BLUA 4I8IA 3ESRA 5E1BA 1QSGA 3INYA 5DNCA 4UMFA 2GEUA 2GJ9A 1HG0A 2D5BA 4G5RA 3BFJA 4PPYA 1DKRA 2NZ2A 1C2YA 3GTKA 1SHLA 2OECA 3GCXA 3HRKA 4I50B 1NZFA 4EPWA 4F6RA 1CY1A 6CHYA 2ASVA 2Y05A 1TOAA 1SHUX 2WVGA 3F98A 5DCYA 4A0QA 4ZICA 5ESWA 4L5CA 3QJGA 2HREA 2J8ZA 1I36A 1Y4DE 5BOSA 2ZZKA 3VOAA 4A0SA 3D0OA 4RNDB 4RJJA 4WLEA 5HR5A 2JI6A 4MVJA 4DNQA 5KYKA 2ZDHA 2Y8EA 1C7QA 4NMXB 5K3AA 3VBCA 4B79A 3M4NA 4Y30A 5WRFA 4XVUA 4K9DA 2XZLA 3E15A 2M6RA 5HA5A 5I5GA 4CT5A 4E4RA 1P1BA 4QUEA 4L3VA 5AD1A 4RVOA 4X1OA 5LQJA 1G42A 2BFOA 4DWOA 2X7HA 4Q7QA 1QIFA 2XYHA 1QC5A 4X92A 2VPXA 4XX1A 5E6RB 4F5WA 3NM5A 3W7BA 4TQGA 3ZU4A 3R9IA 1BS1A 5LDGA 5E7MA 3P9NA 4UHBA 1NVGA 3CCCA 2UUOA 3U3XA 1PYOA 1WO8A 4ZQGA 1DAFA 3OEEA 3HUTA 2JJQA 3GN2A 2X2OA 3WMFA 3GWZA 2VF5X 4OBEA 4BB9A 5JXJA 1Z6XA 4J6EA 4M8KA 4TVKA 2X14A 4DA8A 2JFQA 1XJ0A 1A9SA 1CJMA 1P19A 3QU9A 2P8SA 4EYKA 3GLGA 2ISCA 1OIXA 5EN4A 3S2FA 2MDTA 1TVMA 1DX4A 2DYKA 3BDAA 3KJFA 4Y1RA 5CX1B 5F1YA 2C57A 4E2XA 5HNKA 1LLDA 2P1RA 4FCVA 3FPFA 2YDXA 2AN9A 3E61A 4XWYA 1AE1A 1F17A 4WHMA 3HCCA 5LQSA 1PQUA 4JN6B 3OI7A 3LECA 4RY9A 3WJ1A 2RGEA 1W52X 3JCZA 1PFWA 3UXEA 2VNIA 1JR2A 4Q9IA 1FU8A 1DP4A 4YCMA 2PNFA 3MYRA 1LTHR 3JAMA 2CXRA 4XX0A 4D9KA 4RPJA 3S2ZA 5KNDA 2AQKA 4YLGA 4LXUA 3X2EA 4NE7A 5D3KA 1PT5A 7REQB 1C3LA 3PCXA 1AF4A 2H5LA 3T7JA 2WU1A 2VJMA 4WX2B 3MUFA 4XCXA 2OGSA 5BW5A 1HZJA 4QPPA 3A1SA 3Q9SA 5KNCH 5TARA 4HAXA 4AZ0B 1U3GA 2CHVA 5CLFA 2CJYA 2RHLA 3HDHA 5JR3A 2YWFA 4EITA 5IZCC 2ZCJA 2VHEA 3L8DA 3OTIA 5AM1A 1GPUA 1XE3A 5B3JC 2FSPA 1EI9A 1FBNA 1QZ3A 2B61A 2ABWA 2JFZA 2PCLA 3AUYA 3GHHA 4XARA 3FETA 4ZRDA 5J5AA 1DC5A 1A8UA 3T3IA 4B4DA 4BNIA 2C31A 3N05A 5HZGA 1RYZA 1SY7A 5EJMA 3VZCA 1UKAA 2IUSA 1KSFX 4KC6A 2ZIAA 3ZWXA 1NG1A 4NF2A 3VU3A 1JHUA 1I3MA 2B7LA 2ODPA 3DF7A 1DKLA 1JPUA 2H9IA 2ZKIA 1BCSA 1HFJA 3AERA 1UDWA 1EH5A 2VYCA 3MS2A 4ER6A 2E7ZA 1BVHA 1DBIA 3T15A 3ER9A 1JDSA 1ACLA 4D8TA 4N8SA 4FFRA 3FIUA 2QTVB 4UM9D 2ZIVB 1S89A 2BC9A 3AKYA 2C94A 4UHJA 5G0TA 4UFPA 7MDHA 4FN5A 4JWKA 1Z4QA 4B76A 1JECA 1PKEA 3BRCA 4Y9RA 5JJBA 2XA2A 4QBTA 3PNVA 4ALKA 2W2KB 1DNPA 3MELA 1PSDA 1A8SA 2PD6A 3RS8A 2IV2X 3HCFA 4R71A 1Y1LA 1QNFA 2DKOA 4GM4A 2NWQA 1MAAA 2O7QA 3F8WA 3PNKA 1XL0A 2AR9A 3GHYA 4YT2A 3KS9A 5J1SB 2WMOB 3QKUA 1XTZA 4O2BB 4EI8A 2O8CB 5EKXA 4MK4A 4GU5A 4W4TA 2YV1A 5DIZA 4D56A 2PFKA 3BGIA 4DMCA 2PR2A 1PIWA 5BT9A 2R2AA 1Y3BE 5F3DA 3HA2A 3T3PB 1PL0A 4E09A 4HSEA 2GAFA 5IN5A 1H3NA 2W2XA 3BA1A 1N33B 2Y3IA 4L02A 3NNDA 2ZR7A 2RGNA 4OA8A 1RP7A 3CINA 2QSYA 4FOPA 4WGFA 2BY4A 4EECA 3M1IA 5KHOC 5A6SA 3AZPA 1H2BA 3FXAA 3IUBA 5FL7A 1PG0A 2JAXA 3QBJA 4TZ0A 2ONZA 3O31A 2ZIEA 1JT2A 3EVFA 3FKJA 5KJFA 1KDOA 3BILA 4KVZA 4EB8A 1HBJA 2GTPA 5EE9A 5ER9A 1WOMA 1IUKA 3PDJA 2C1XA 4AF7A 4C7BA 1TJ3A 1PFQA 1RQPA 2NYRA 1N5JA 3FMPB 3MT7A 2XXAB 2QQEA 2Y93A 1Y1WA 4AZTA 3NBZC 4F04A 3FIJA 5BSGA 4QRDA 4DV4B 2P78A 3ECSA 3R6GA 5JS7A 1DKMA 1PBNA 1PDVA 2QVYX 2RG1A 4K2AA 1NTOA 4PNPA 4E14A 5AOAA 3Q41A 3HG7A 3UKJA 5EIHA 4LF5B 1ZK3A 4B3MB 3JQQA 4AKEA 3AMVA 4QBFA 2HGZA 4DA7A 3H3XA 4ND5A 3B13B 4CG0A 2FEPA 3K09C 4P22A 2XVYA 2QROA 1DAKA 3KO8A 3DBRA 3PEWA 1QQBA 1Z8FA 4I2NA 1YAJA 1E0SA 2AMVA 3FPSA 4KEAA 2YYZA 4Q03A 1F14A 4B17A 1QHEA 5IJZA 3ANYB 3JU3A 1E1QA 2X5XA 2J0SA 3KSMA 5ALGA 1TO6A 2XIJA 4NU5A 3EVCA 4RV9A 3TAXA 4HGOA 3LUHA 3IUSA 1GCIA 2H9YA 4XIIA 5HF5A 1DEXA 3GDGA 1ZUNA 4KFSA 1RVV1 4NBWA 4D8UA 1BKSB 1SCQA 5JPCA 3AB3A 1PNTA 1QZXA 2X23A 2IOQA 3WHLA 3UJAA 2R7LA 4NH0A 1FTYA 2FCRA 4I1VA 4IJVA 1DEKA 1VKNA 3JQ8A 2O2GA 4XYLA 2HO4A 3J81k 2QSZA 4I1SA 3M89A 3GXOA 2RH5A 4TV8A 1FFXB 1WSDA 1X87A 3GMIA 3E9RA 4ISCA 4BLPA 4IVPA 3R5FA 1X0VA 4J1SA 3ZBTA 3DV9A 2ZSFA 3T5GA 3ZJTA 3ILHA 3JTEA 3U7RA 3DLTA 3HXQA 2W2TA 1J2TA 4CMAA 1EVJA 3HWWA 1SCKA 1OI4A 2GZSA 3RVMA 3GT7A 4ND7A 4H16A 4G9GA 4UVGA 4LGMA 3KBBA 3IIIA 1RXWA 2WDPA 1L5RA 3AESA 2DHCA 3SQDA 3E0QA 4FMCF 3JD4A 4K28A 4YJHA 1U3TA 4Z6KA 4CMIA 1OGIA 2PSHA 2LVBA 4WW0A 4PAGA 2HAEA 1H85A 2R68A 5L7WA 3M3HA 3H1FA 2VTDA 1DWQA 4P7GA 1CJKC 1P5FA 4JBWA 2Q3EA 4K9QA 1ECBA 3R5XA 4YJ2B 3ZDFA 2FH5B 3OJOA 4UBOA 4BNDA 5KOYA 1UM9B 2WG2A 1A5BB 1TL7C 4LYFA 2B9SB 2JRLA 5FTMA 3JYLA 5E7QA 2ZQ5A 5BN3B 3JASA 2PH1A 3H3FA 1J8FA 1SOAA 2R62A 2D1SA 1S8NA 2NUAA 1QMGA 3Q9LA 3UPUA 1NF3A 2J87A 3HJUA 4MV1A 4D0GA 4JVNA 3ZH2A 3ZTYA 1MVNA 3I4LA 4D9GA 1MPXA 2X8JA 3JZMA 2Z9DA 4UJ3A 4A0HA 1ZVQA 5GJCA 4KAWX 1QYVA 2Q7DA 4BMNA 2FUEA 2Q5IA 3CURA 3AVQA 4LOJA 3D3JA 3EXG1 4JDPA 4ZMRA 1NX9A 1I1OA 3MNFA 5AHRA 5T67A 3B1WA 1FK8A 2XZDA 2NSYA 2I03A 1SUIA 3KWFA 4JC5A 3ZHOA 3IV7A 5F9FA 3QX9A 2H4YA 4P32A 4RXUA 5IBPA 4DDHA 4HN2A 1GL3A 3TXAA 4LRUA 1L0BA 1UZMA 3RRNA 4C4AA 2I91A 3SSAA 3EPRA 4BBZA 1X42A 3S8MA 2H29A 5C2JB 2Z58A 5CPBA 1J7KA 1F38A 2CJFA 1VHDA 2O3JA 2PGDA 3NNSA 3O3CA 3BAZA 4X1KB 2B0CA 1AZLA 2XBLA 4WNAA 2D0IA 3BD7A 1HL7A 4F2WA 2WQ6A 3R0JA 5JV5A 3K0CA 3MCZA 3ABQB 4DJDC 1WZUA 4OQFA 3ZDXB 1JTVA 4PYKA 5JY6A 3QEBZ 2IYVA 3CLSC 2A0XA 3OKFA 1JSXA 3QHQA 5FXMA 3T5BA 4CIWA 1O9HA 2JD2A 2QS9A 2AZ4A 4S0ZA 1PT9A 2ZAMA 3M0EA 3A9TA 4UOQA 1UKCA 3NV7A 3KIPA 1JFRA 2A0UA 2K2WA 3K8ZA 3A05A 3HL4A 5DBGA 5CVTA 2Z3VA 1VKJA 3QOYA 1SZCA 2D4AA 1O6GA 4KBGA 4FXOA 5AP9A 5U4XA 4X8HA 5DK6A 4DOMA 1XHEA 2Y1EA 2INGX 2JLSA 3MFQA 3EG9B 2YHBA 4ZKDA 3Q88A 2D1QA 1V6AA 3IPRA 2POQX 2QUIA 3UK6A 4JGBA 3HSKA 4FQ7A 1HG1A 1SG9A 3H9EO 3GOQA 1YR2A 1XMIA 3KFLA 3P9PA 1ISIA 2P9CA 1OXKB 1E3WA 2GD6A 1S8OA 1EQ2A 2H4WA 1EFRA 4G81A 3EZ2A 4XH9B 1E2JA 3U16A 3Q7IA 2GK4A 2NZVG 3MXTA 1ZRNA 3OZVA 2FWIA 4KYUA 1WB9A 2HWKA 4Y2TA 1UBCA 1DO0A 1FZQA 1QAQA 2VSNA 3HNOA 1RAIA 1C50A 4GD3Q 4MRRA 1E1CA 1GGNA 3ANSA 1Y1QA 1NURA 4TOIA 1U8TA 1L7PA 1SVMA 4RBNA 1QYIA 3BOSA 3QVLA 3OE4A 1NJ5A 2ONJA 3EMBA 5I8WA 1KF0A 2UZAA 1N78A 1NOIA 3DMTA 2NNLD 1ORWA 4NMLA 5CH8A 2CFOA 3UB4A 1QO0A 3L7BA 1ULBA 4HLDA 4P3XA 3BTOA 4QDTA 3W8EA 3DSRA 4ALMA 1U5CA 4BBPA 2NO0A 3E3MA 4KUHA 2VUMA 5KINB 4X7PA 3O8DA 5K3BA 4WUTA 3EGWA 4JELA 1RCTE 2C9MA 3S44A 2V96A 4ZCTA 5A3RA 4PYQA 1D8TA 3H0CA 1JG3A 2PEZA 2WF8A 2ZI6A 1IVSA 1W1IA 2JEOA 2ID8A 2ZB3A 4C76A 1C9MA 3QIVA 4DWJA 4FFPA 3K9HA 2PGLA 5AVQA 2I3AA 4AUNA 1K63A 4RD6A 1T1EA 1NYLA 4L9RA 4RK6A 1CZOA 2UZIR 2X5JO 3WMEA 4DN6A 2RIRA 3FBWA 4QDXA 3OUUA 2Q4DA 4NBKA 4IV8A 2EKLA 3SIWA 3ZEIA 3QVMA 1ONSA 1W30A 2Z4RA 3RUDA 1NI4A 4I5FA 2CXUA 3FTQA 2LRHA 5AK4A 5DWQA 5BPHA 3DE2X 5PNTA 1NT4A 1AC5A 4BAUA 2SKCA 5HS6A 1M1YB 2KS6A 2VP2A 5AVTA 2Q2NA 1XNGA 4C6SA 3MJTA 3GROA 3I5AA 3UGJA 3U2QA 2IYWA 3LO8A 4D9EA 3PWTA 2FI1A 3VR1A 4KMSA 4B2PA 3M6XA 1BH2A 3KVOA 3DC7A 1IRXA 1RLJA 5K9ZA 2ODQA 4KXWA 4WY2A 1CUWA 4ZOAA 1Q22A 4LF9B 3Q0TA 1YDMA 2YWGA 1JJFA 1ZQ1A 3C8HA 3LKVA 1UZNA 2FNAA 3QMWA 1IBLB 2J6HA 3OZEA 5JZ9A 2X2EA 4PSCA 5EPUA 4I4TB 3DP9A 1JI3A 4YDRA 3FI9A 1OC2A 2FOIA 3C7AA 1USGA 1CIJA 1J0CA 2PUDA 3RGGA 3RF6A 5LQMA 4R2HA 5B55A 4IY1A 3URKA 5C5EA 1CV2A 3AO0B 1SPXA 2HIAA 4CI9A 4YHBA 1F2DA 1RZUA 4M49A 1H23A 4INAA 2PWAA 1NFRA 2DEUA 3WJ7A 3CE6A 4GOMD 2FP3A 3A4YA 1PR9A 1Y6JA 1KERA 4XM1A 8LDHA 5KTPA 1Y4UA 3KJIA 3T3GA 2CBGA 3B60A 3DO6A 5AUQA 1GVNB 3DLIA 3U4QB 4EJ6A 3BC1A 3ZXIA 1BMFD 1U65A 3DV0B 1MQAA 2HOQA 3C5WP 5CIWA 5BSUA 1YFZA 4CM4B 3VDXA 1YBVA 1WSAA 4IGEA 1Z0AA 2PU5A 5HPYB 3KYCA 1EWTA 4FZRA 3Q3HA 1NI5A 4KH0A 4AS3A 4EHAA 5JS1A 1DS6A 2OCGA 2RGWA 3L0BA 4DTIA 4WCFA 1ZP6A 2OEPA 3HJBA 4V1CI 2ZUWA 1TADA 1OZ0A 1KKLA 3PJRA 4IX1A 3H2JA 2IS1A 1GRVA 3BHMA 4LOIA 1J49A 2AKEA 4H7FA 1EVIA 5F1OA 2ERCA 1OH7A 2GXSA 3LBIA 3CLTD 2GTIA 4TWIA 5SZJA 4PTYA 2E9SA 2JA2A 2ORWA 1JJ7A 5H0IA 4FC7A 4WVFA 3LLSA 1ZQ9A 3Q5EA 1O58A 1XKLA 2IIPA 4IUBS 4X95A 1SGWA 1FEZA 4JXXA 1QTIA 1QFXA 1K9VF 1WMFA 1E79D 2WZBA 4FLFA 2BTQB 4YQYA 4ALNA 3TGLA 3KSZO 1IQUA 1VLZA 4G0NA 1X7GA 4IQFA 1DDGA 2CCJA 3R3YA 4FFBA 1MB4A 2I7XA 1XK6A 3H5OA 3PYLA 3S5UA 2QAJA 3G82C 3QNMA 4BMYA 1BFKA 2GMWA 3T3HA 3ZLJA 1V37A 2P5SA 1JLRA 4FWIB 4HWRA 1NBWB 4KGVA 5DNWA 4NP6A 2EP5A 1YCFA 2GF2A 4B32A 4BZZA 1CY0A 3D3QA 5JH7F 3ZVRA 4RWZA 2VHCA 2ZRKA 3A7EA 4LJRA 3NKVA 4J0DA 3VJLA 3W90A 4W63A 3AIOA 2NPFA 3HHEA 2C3PA 2VZ0A 2FXVA 3U3DA 4DRYA 4ZK6A 2BCJQ 3RD5A 1K89A 3MCUA 4FI3F 4XAQA 4X8OA 2X0DA 2FQ1A 4ETWA 5D5QA 2O3QA 4R0VA 2J5RA 4KQEA 4MWZA 3TNYA 1SBQA 4Y2UA 4Q9HA 5JS6A 3G2KA 4XRRA 2JFGA 3OM1A 3O4JA 2DY1A 1D1QA 3HEBA 4LGCA 3AOGA 2Q9AA 1HYBA 4Q4JB 1YE8A 1IN7A 1MQSA 2HHCA 2Z2YA 4NQZA 3AHFA 3QLJA 3IAS1 3IXLA 1E62A 1SUEA 1IULA 3N8DA 1WDTA 3KYJB 1M66A 2VJQA 4RPGA 5EMMA 3W5UA 3W5JA 1NN5A 3C6XA 1VMKA 3FKSA 3CLRC 2XRFA 4U7DA 1RJFA 5KPJA 5CVDA 4PLGA 1F60A 1HZZA 5D3MA 3AT1A 3K1AA 3GYGA 2TECE 3KLBA 3N0TA 3MTQA 1P31A 2PX2A 5BR8B 3T3DA 4N01A 2P40A 3BXHA 3KSAC 2AGVA 1SIBE 2REBA 2FF5A 1IN6A 3PNBA 3WLMA 4JHLA 3WNBA 4CI0B 2RGRA 3GJYA 1KJNA 4ZIRA 4P33A 4XGNA 2P79A 5DTRA 2DAPA 1TU4A 3FBGA 1NV8A 2D2VA 1T5HX 1SBCA 2QQGA 4BVLA 3WDMA 1NQXA 2CVZA 2HT6A 1CR1A 1KI8A 4X8LA 4CNBA 1SFOA 3IYLW 1OLUA 4DCNA 5JAPA 4C2AA 1RABA 2FRDC 2Z2XA 3BS4A 4O02B 4JLNA 3T0GA 1HMYA 2NVXA 2R4QA 2D5LA 2E4XA 2ZQYA 3HYTA 1NVEA 4ALIA 4W9MC 3G5MA 4Q9DA 2N46A 1EM8B 1SD1A 3VM6A 1B73A 5ECGC 1YA4A 1E4EA 1CY6A 2BKEA 3AR3A 3IAFA 3E22B 1G60A 4DKJA 3W8RA 3EASA 3VSAA 2DWPA 1AZSC 3ONFA 3JRWA 4M9UA 4AMUA 1NAIA 1NY5A 4PBSA 4EKNB 2YZGA 2RGGA 3UK0A 3T5CA 2YV3A 3IAEA 4GX5A 5J58A 3FOCA 3H05A 3ZY5A 1DOZA 1L4HA 1U8EA 2ZBGA 3O91A 4WKBA 3V5NA 2OHHA 3ZPXA 1JR6A 1Z7BA 5I48A 5K3OA 1LBTA 1U7PA 4L5BA 1EFLA 3EZGA 4YACA 2XMQA 4DV6B 3QFTA 2MSWA 4H9GA 3PKZA 2JIRA 1G291 2HQOA 3I9MA 4L6AA 4ASUA 3HPQA 4AIIA 3V6LA 4MEAA 4R7ZA 3AI2A 2DSTA 3KUUA 1HA3A 2F59A 1PGPA 2HA0A 2CLDX 2Q41A 5J5CA 3AINA 1FFAA 4ZCRA 3K9BA 3RI3A 5H70A 3BJRA 4M9SA 4DNFA 5FORA 2JKVA 4CKEB 5C9ZA 4HQ0A 1WMAA 5JNRA 3OLCX 2Q3HA 2Q2VA 5AJHA 4OXKA 5EZQA 1XPJA 4NZOA 4EMBA 4WJLA 3DTVB 1ML3A 1X9GA 2C2MA 3REFA 2FPGA 5E2AA 2FSGA 3JWGA 1RLTA 1DQPA 2AEEA 4C87A 1LPNA 1UBLS 3KEOA 3GLFB 2PBLA 5KVSA 1KIFA 4M89A 4NZ9A 3C97A 1WD5A 2DUNA 2ETXA 4DQUA 1QB8A 3EUFA 3GY0A 4HLCA 3ZKAA 3GCZA 4ERNA 4F6CA 2IYXA 4J1NA 2J08A 2XUGA 3AHCA 3DQPA 1RHJA 4Q3OA 5DYGA 2NU8B 2MYTA 4OYDB 4E03A 1ORHA 1XU9A 1P4GA 3LYUA 3LQKA 1QWOA 3PIRA 7MHTA 1II9A 1M2OA 2FKNA 3CX4A 3I2IA 4JLOA 4PU0A 4RCZA 3UMCA 4DNPA 4M86A 4M99A 3OMXA 3AEKB 1E2FA 5IAKA 2GERA 1BFUA 1C0IA 1K8RA 4WL0A 1NR7A 3K5MA 3F8SA 1XELA 2XKBA 2ZRIA 4CCYA 3W5CA 4JLRC 1A2OA 2GXQA 2LDXA 2E4VA 4TTRA 5DBOA 4FJ0A 4A27A 4WK6A 4F5ZA 4FSDA 4I5EA 1JALA 1DPGA 4LVNA 1SIUA 1XLTC 1GZUA 3EFHA 1G8MA 1A4IA 5DGTA 2PGOA 2J1LA 3TUZC 4BVJA 3VJRA 1VYTA 4YRCA 1J8DA 1XCGB 4UBLA 1MORA 2RK3A 1BDJA 2J07A 3C5CA 4KAAA 4KK3A 1KK2A 4ADSG 2IL1A 2SICE 1SQ0A 1PGJA 1WXDA 3IALA 3GLIA 2BFCA 2P7HA 3QEKA 3OT1A 3UO8B 2WIGA 3JYNA 1GXSA 4BNUA 1SXJB 4XFDA 3RQIA 5GIPE 3C74A 1QE3A 2XVXA 4D3SA 4D9FA 4EY3A 4GZ5A 5LPNA 4FB4A 4WBNF 2C7VA 2QY6A 3PUXA 4C9BA 1I4OA 4EY8A 4WDQA 2BGJA 1CY7A 3I0MA 5AKZA 1IK6A 3BMNA 4OK5A 4AZ3A 3H9BA 3SC4A 4DMRA 4YJ3A 1AJEA 4GOND 3HKCA 3DFUA 1GFZA 1B16A 1T43A 1AVTA 4FEYA 5LBTA 1QKIA 4EMSA 5BVHB 4E08A 3N87A 4Q1BA 5ES4B 3GFGA 1OI3A 2E6KA 3FUUA 4NONA 3K20A 3VPBA 3S81A 4QYWA 4YRLA 1QF6A 3K2BA 1YSCA 2QL7A 3OG9A 3NT4A 3AKCA 3G5AA 2IT1A 4BP3A 4C4RA 4CKCA 1E2LA 2VTVA 1P17A 3WRWA 1UDCA 4F7DA 1ZMOA 3ASYA 3UFXB 2XT0A 4DV5B 3THWA 4QXMA 2LP4Y 4QFDA 1U1FA 4CF4A 2HT1A 3BGDA 4YROA 2WU4A 1GNRA 3TIFA 5B58T 3H5NA 3AEQB 1DTSA 1DDOA 3L9XA 2YXEA 3WNCA 1FP1D 1G7TA 1AKEA 1WW3A 4M8SA 3UBMA 3BORA 3BKXA 1UWLA 4E2ZA 4YYZA 2FPXA 3FKQA 4PRYA 1OV4A 4GEGA 3SK0A 3WAGA 3RS4A 4EFDA 5IEJA 3BICA 3D7RA 3O9VA 4YCAA 2ZULA 2PD4A 4MGIR 3EGEA 3W77A 1NKVA 3PNSA 3ND7A 1LBHA 5COAA 3UAXA 1T2AA 2NO7A 1LV7A 1YS4A 1PR2A 4UVIA 5TJ9A 5DN6D 4GVPA 3OD1A 2PRYA 4EO9A 1T3LA 3JQFC 2A9QA 3D8RA 4B4UA 3HI4A 2IITA 1IHYA 5C46F 5JNVA 1RWBA 1VYHA 2OY0A 2C2WA 2ODTX 1USWA 3JS5A 4IQ8A 3CVJA 4EGFA 4GIBA 4HB2A 5K4GA 2YVUA 3ZIAD 2ZXEA 4V0KA 4L85A 4FFLA 4PZZA 5AW0A 5AXAA 1APBA 2OQRA 3X1WA 2BMFA 2J0VA 3QTTA 4DC1A 3X0DA 1P1JA 1AUXA 2HX1A 4F6RB 2C3YA 2PMEA 4MA0A 2YC4C 2GF9A 3BG5A 4XLTA 3NAQA 1U8FO 3A6LA 2BISA 3C3XA 4WXHA 4Y18A 2WKPA 1N2CB 1E6CA 3B52X 3DP7A 2H11A 3GFOA 1SURA 3KZ1E 4UMVA 2YNMD 3HYRA 4UVDA 2LV8A 4O3FA 3ROFA 1THMA 1IDN1 1R0SA 3STYA 3T1OA 1RC1A 1W46A 3AUXA 3IP3A 3M6AA 4RVNA 3TH5A 4KDDA 3D02A 4NDAA 3TSYA 4LJ7A 2PUCA 3KOWA 2BOVA 5GZ1A 1V5IA 2BN4A 3ICEA 4ABTA 5JECA 1Y6GA 4DA9A 3BXEA 4ZYXA 2CE2X 3D4PA 1T0BA 1KKMA 3ZKWA 1DO8A 1QC5B 2WB4A 3WLJA 1P0IA 3CX3A 1QHGA 3NS7A 4UNSA 5J23A 2LUOA 1Q1ZA 3IAHA 3K15A 5E4FA 2P1DA 4ZV9A 3MMZA 1EA5A 3ZXSA 3HADA 3A4MA 3OQPA 5IJXA 3QWBA 3F4KA 2C29D 2HBZA 4M0PA 2PV7A 2GOYA 2DFLA 3B78A 1MC4A 1NJ2A 1X7WA 4UAVA 3COJA 5KKAA 4D0NA 3IIEA 2YW2A 3ESYA 1SU8A 3X44A 4XDZA 4WCDA 1VZ2A 3V3TA 3P4UA 1E5TA 1LPPA 2F7SA 3WBKA 1D1TA 1I0ZA 1ZN2A 3OO1A 3FRIA 4URXR 4N5LA 4JSRA 4PLVA 4KMMA 3VR6D 2FVYA 5JSZB 1N7JA 1MG0A 4JVLA 1S9DA 2VQSA 5LNK6 2BHRA 2XLBA 5L3SA 3IC5A 2JI9A 1H6CA 2C78A 2F8TA 3A04A 2B4TO 3G13A 5KJ6A 2W6ZA 4D25A 1JW9B 4GI1A 5CLQA 5TPZD 4ZVQA 4O4IA 2GD0A 1CR2A 4KLZA 3F78A 1KETA 2G08A 1TIPA 1WG8A 4L95C 3M81A 5C1OA 5FA5A 1E6LA 4XX0B 5BOVA 4WNIA 5KYTA 4MUKA 1NVAA 3VSEA 3ZQUA 4UE3S 4REOA 3WWEA 4DZTA 4AICA 4ARSA 4MWBA 2CE7A 2NV6A 2JH8A 2JDIA 1LZLA 4R40A 3ROQA 3LBYA 2VJMB 3VR5A 4UTXA 1C0PA 1OLXA 1HYQA 4Z2AA 3VUEA 5CNMA 1BE1A 4MUHA 4Y0AA 4E4YA 2JGMA 2IYTA 1ZGHA 1H5QA 3W8NA 4K03A 1YFLA 4BO0A 1I1QB 1P6UA 3K0EA 3UWOA 1ZVMA 1NHWA 4QYTA 3TD9A 1BG6A 4OHFA 1YNND 4HZIA 4HNAA 2RI6A 2WT8A 1G8PA 2ILVA 1QIMA 2VEDA 1MMFB 2JJ8A 5DOZA 3KCQA 3TS1A 3VKUA 2VXCA 4B6FA 2HRZA 4CG3A 4L51A 5HYVA 4QO8A 5FPYA 1RAEA 5KTYA 4K26A 1YQTA 4HPJB 4L4XA 5F1PA 4A26A 3EQ6A 4LZPA 4AMZA 1GY8A 3I0ZA 5CBPA 4PC6A 1BCSB 3AERB 3SFTA 1G17A 1Z36A 3QU5A 3A8TA 2EJWA 3ROPA 3H97A 3SFVA 1PJLA 2AJ8A 1T9GR 1Z26A 4L73A 4N03A 4QTXA 5KYVA 4CKBB 3JYOA 5ALLA 3U9LA 2OBXA 1UJNA 1SVLA 3DZDA 1FP4A 1Q3KA 3C39A 4MR8A 4ZQHA 5H3CA 4LF4B 1IG3A 3ZWDA 4NFLA 2DUMA 3CKMA 4FMCB 3OHSX 1R8SA 5J47A 3A4TA 4RULA 1I3CA 4PXSA 3FY4A 3WZLA 3E9ZA 4KXLA 2X9VA 5FNVF 2PMCA 1A76A 1P18A 2FR0A 1YDEA 1G1MA 3L41A 2QRMA 2V7QD 3GELA 2D0DA 3N2GB 4FK8A 1NP6A 3UCXA 2ACEA 3HUEA 3OLWA 4UXJA 3RTGA 3SXPA 2PMKA 4G24A 4QWWA 1JMVA 4D4KA 5IC6A 5J2UA 3QEOA 3PHJA 5LBIA 2ZYSA 1VBNA 3CT6A 3O7WA 5GV8A 3SS7X 5KQGA 4CKCB 1U7WA 1XO1A 1VJ5A 5AVXA 4OXYA 3ZCSA 1FJ2A 4X3OA 2D62A 2ZT6A 4FMPA 4KQ6A 1G8JA 1W0CA 3IT3A 4X97A 4ZRMA 3I1FA 2AC4A 1T8RA 4YJGA 1LDEA 2I1QA 2VNJA 3R7BA 5A6SB 1WS6A 1GAEO 4HVLA 3PJDA 3EEYA 4JEMA 3OE1A 3GMSA 5IAJA 4PQRA 4DLXA 2GO7A 2VDUE 4PW0A 3PQCA 2ZR0A 3WR5A 2CNWA 2HDWA 3G5TA 1Q0PA 4JC4A 5AM0A 2R5WA 3KELA 3V1NA 3OJCA 1NKSA 3SZOA 4N8EA 1HT3A 3H6GA 5FR2A 2D6FA 1OB2A 4IM7A 2O1EA 3G8YA 2Z6VA 1C1DB 2GFQA 2O2IA 4O25A 4OMFG 4D8VA 1A4UA 1NUSA 1G7CA 4NYMQ 1PYDA 3MLEA 3ZC3A 4ZI2A 2PZKA 4KGDA 1NI3A 1YZVA 1B3BA 1TEZA 1EJ6A 1O9BA 3HDYA 1RAGA 4R01A 1Z07A 3RNLA 4TKUB 2OLEA 4IIXA 2W6OA 1TF5A 3H7IA 5CT9A 4G8JA 4HQLA 2F1KA 3AFNA 4M98A 4U9IS 2ZJFA 3DBRB 5G3ZA 3E3OA 2EFJA 1H2YA 1EBUA 2WJVA 3D64A 4JOCA 4KQGA 4YDQA 3UMYA 5LZ8A 3KKPA 4YTEA 2XYPA 1JZQA 4AMBA 2BMEA 1G9TA 1JXOA 1OFVA 1W1WA 4BIIA 1MW9X 2Y2VA 4F21A 2IHYA 1XAHA 2DUUA 2C9DA 2C88A 4EO4A 1ID1A 2GEJA 1P2FA 4HFMA 4QG7A 4BLWA 3FZYA 4HUQA 1U0EA 2W5UA 1R4MB 3NU1A 3V8EA 2QV0A 4DV7B 2R4UA 1W8DA 1D9ZA 3ZV6A 2CHGA 4PNEA 1Q8IA 3HA3A 3K4PA 1WUKS 3ICPA 2AF4C 3MWKA 4FP9A 5CAEA 2FR8C 4HAYA 1S1CA 3UZUA 3IE1A 3B7GA 1A4RA 1DMRA 1OTXA 1YHYA 2H1WA 3E5MA 2A7XA 1KO7A 2QK4A 1S2GA 2B9EA 2HIMA 1AHHA 3C14C 1XMSA 3FNRA 3NOVA 4J1QA 4MV7A 4TV8B 4W8HA 1IQRA 4BEJA 1ZJZA 3DE5X 4UULA 3J81A 4NZMA 3L7AA 5JIBA 4G63A 3FD8A 1KZ7B 3WYCA 2DF8A 2C8KA 1RPZA 3B1FA 3GJSA 3GEDA 3JQAD 4L4YA 4D0LB 3L40A 5JZBA 3P2EA 1G6OA 5EJFA 3HY4A 2HV8A 3K5HA 4TZKA 3M3PA 3I9FA 3T06B 4CODB 2AFHE 1GOTA 5EAIA 4NFSA 4QJ5A 4CMIB 1F8UA 3PC8C 2J4CA 1OD6A 4NJMA 5HKAA 3TQIA 3GF4A 5E1OA 2G0AA 3LHDA 1HOTA 2Z5VA 1P9NA 3DONA 3M82A 4FGUA 3WNQA 1EX1A 1ECJA 3HP1A 3SJCA 1XD8A 3RT1A 2R1TA 5ILGA 5TMDA 4CDMA 2XECA 4JIGA 1ZOPA 2DC1A 3UGQA 4B2YA 3FRJA 4JHXA 3GJ8A 3HVHA 4JJEA 3WSTA 3DL7A 4X63A 4BNDB 1W4BA 2V97A 2W22A 4V0RA 2GJ8A 5THKA 1R9GA 4FEGA 5EKUA 3CSUA 2VDJA 3BWCA 3VPSA 3F8TA 2AKAB 4JD5A 5DLYA 1AKRA 3G85A 5AUNB 5HOQA 4XQGA 3JASB 4GG1A 1EEHA 2F1IA 2CWWA 5BWMA 2C7BA 2VEOA 1SWWA 4AW9A 1NF8A 1V8BA 2C4WA 3N75A 1E9DA 2NUAB 1NMQA 2VRCA 3EGXA 3H9QA 4RZ3A 3FYTA 4AC9A 2OPHA 1GQFA 4IEIA 1J0XO 4D81A 4U39A 4R81A 2NUPB 3FDXA 2WRZA 1HQDA 3LA8A 1UWKA 2ZUDA 2X8JB 4OJYA 1QQ6A 1E9VA 2WHXA 2FXIA 3A6KA 3WIOA 1FPQA 3O4VA 3ZDRA 4DANA 1NXWA 1E0DA 4PG5A 1YI1A 4ICIA 5DE3A 1VE5A 1YS9A 2PVPA 1HE4A 4QEZA 5G4KB 4LFAB 2GAJA 3R7LA 2F9LA 3TYXA 1FSGA 5HKKD 1HK7A 3OX3A 1Z34A 1QH8B 2EZ4A 4HY3A 2BBOA 2A92A 1ANKA 1CERA 2PWBA 2RH4A 2XUQA 3QA9A 5EPEA 2OPBA 3UHJA 3ENQA 3W2EA 1YQDA 3AXSA 4ARZA 2JIZD 5EIEA 3FOEC 5KNCD 1MG5A 1KNXA 3MM4A 3HM2A 5MF6A 1PJCA 4BNYA 1G64A 2ORIA 3KKLA 2J33A 4LTNA 2DPXA 4MLZA 4LZZA 3VPAA 5IWAB 5A9RA 1RPJA 5B7GA 1SRRA 3NDRA 1HNZB 2CWDA 1GUDA 4NPHA 4NE2A 3HBMA 3BT7A 4LCJA 4DBZA 1I2ZA 2ZSIA 2WUEA 3ICOA 3FSGD 1OX5A 4EUNA 5B7QA 3HM9A 1ESNA 4ZRNA 4HVAA 3L7NA 1EZ4A 3JQRA 4MVJP 3C41J 5CYOA 4N7MA 4PLYA 2B21A 3O1IC 5ALEA 3LPDA 4PQGA 2LIVA 4A0FA 4K9PA 4MVXA 3W9UA 5K0ZA 1H0SA 5AUPB 1FCJA 3EZFA 3NRJA 3TMKA 4JV5B 1IU9A 1YTLA 1B8VA 2W9XA 2HF9A 1UFRA 4LDAA 4AN0A 4DQVA 2O8EA 4PLCA 5EZ5A 3L3BA 5IM4A 4JJIA 4LW8A 2HGSA 2P69A 4KX3A 3DO8A 4MWGA 5FOWA 5SZIA 4LTMA 2O20A 1QYRA 4TSFA 3S29A 4NK4A 4Z4GA 3PVZA 1U0GA 3H9UA 1J56A 5CXQA 3AF6A 4GZ6A 2FUKA 2X1VA 1ZW6A 3CZAA 1L5ZA 2H17A 1E1CB 3O8BA 2PPVA 3QOWA 4QE3A 5CM2Z 1Y9JA 1O97D 3D6FA 3RHFA 1TWHA 1CWUA 4CM9D 1GPKA 3IR5A 2GYUA 3X1YA 1SKAA 3HO6A 4DYDA 3B85A 1KJJA 2CLMB 2P0YA 5ANRB 2BONA 4GH5A 3GGCA 1S4MA 4DILA 4YRDA 5C31A 2GJSA 3HS3A 5ALVA 1TL8A 4LHWA 4HS9A 1T8UA 1CQJB 1RYYA 1V1RB 1Z4JA 4INPA 4M6WB 4XTCS 4NV1A 1V8PA 5HX7A 1IPFA 1NLUA 2ZDQA 5E2BA 1SRQA 1UOPA 1ZOLA 1KP9A 4DUGA 4IG9A 4Q00A 3FCYA 4Y2PA 4BGIA 1RIIA 2QE7A 3ND9A 3X2SA 4MW7A 1EXVA 2Q7XA 1Z0KA 2C5BA 5JSFA 1E6UA 4L4RA 3P7MA 5HQTA 2EP8A 4WA8A 5ALOA 4DCOA 3D8TA 4XYMA 1C2TA 1OFUA 1P7PA 3HTXA 4ZXPA 1HDOA 3LZ6A 4LKRA 3CSDA 4U7JA 1RJ9A 1KPIA 2QP9X 5HGJA 4CEJA 4M87A 3IVCA 2GZAA 3RKRA 4KXNA 4JI8B 3W6PA 3VPDA 5H82A 4J4HA 5A4MS 3HRIA 3ZD6A 2N9UA 5BQ5A 4MGKR 1NI4B 2P9BA 3D8HA 2DXIA 4B75A 1TWAA 4JVOA 1X1DA 2AOWA 3BSYA 3S28A 1EWRA 2V5UA 3P45A 1X7XB 2WPDA 3L1IA 3O5AA 3PDWA 4FXPA 4OK6A 1NUAA 2P35A 2AMJA 1KAQA 2EKDA 1TU0A 1LK5A 3FNEA 3OAAD 4AJEA 5AW6A 4GPD1 5T6BA 3HP4A 4LSWA 1ZLXA 2D5CA 1OKKD 1KR2A 1UC5B 2QXTA 2BMVA 5LWHA 3CH5A 3PI7A 2QRLA 1U0NA 1DRWA 3HFJA 4LNHA 4RIHA 4WKGA 3IPXA 4MLPA 4RADA 1SCIA 3AVVA 2YY7A 3U3MA 1TZ2A 4OHPA 4RSMA 1SVKA 3C8DA 4ZPJA 1C3JA 1TJYA 2V5VA 1QDUA 3EDOA 3TIIA 3VOTA 4C7XA 4HLNA 5EA2A 5TQVA 1GKIA 2BGNA 3IB3A 2KYRA 4ZQEA 1XR3A 3D3EA 2LCQA 2Q5OA 1RJDA 1PNVA 1VHQA 3WYAA 3BM5A 4D9MA 2PQ2A 1Z6ZA 2VK4A 2BUAA 3DYVA 3G59A 4PNHA 3UJPA 2QRNA 1AS3A 1RT9A 4MULA 3WADA 3AYZB 4P4SB 4F3EA 4Q3AA 1ZEJA 4EMTA 3U7HB 3DXXA 2VWHA 1JBQA 2QR5A 5HEKA 3RIMA 3FPBA 1O0SA 3BGVA 4IW3B 3BFPA 4AKGA 3VAAA 3IOEA 2Q0HA 2J45A 3OZBA 3HVJA 2EKBA 4Y1FA 4MVJG 1NNUA 5EWMA 3VYSB 1U98A 1GKLA 1WCWA 3LP8A 3ZGLA 2QW1A 3DR5A 4C3UA 4KQXA 1Y81A 2WTAA 1GGMA 3WTBA 1B2RA 1THZA 2GBIA 4KACA 4X62B 2ZSHA 1M33A 2W83A 3O2SB 3KYCB 3KU1A 4IMPA 4P34A 3GXBA 4BFUA 3DKVA 3FM9A 3TKAA 5A4JA 1KEVA 4MRPA 1VMAA 1YIAA 2FFRA 1KC1A 1O94D 3FVTA 4G84A 5F73A 1PF7E 3T5MA 3MQFA 1R0BA 1T1SA 1KVTA 1X7HA 2AT1A 5JYEA 1NPDA 4QXQA 5EC8A 4Q7JB 4X44A 2XUAA 3WVNA 1T6NA 4NG5A 2R8EA 1RD4A 5A6VA 5C80A 1A27A 5DRTA 1R0CA 2OWEA 1KK0A 4X1YA 2TMGA 3ZR4B 4DIOA 4J8PA 5CURA 2VCEA 2PX3A 2BHNA 3K96A 3F7NA 3PUIA 3LUPA 5HSGA 5L51A 2QN8A 4A8TA 1YDGA 2C97A 3QMPA 1GFWA 4FFBB 4NLLA 3VOSA 5ICCA 4H7HA 1UAYA 4EB3A 1G21A 2HMWA 3FSJX 4OJMX 4LWQA 1UXGA 1DEAA 1UOOA 4MUNA 2DE0X 4RMIA 4CDNA 2BGIA 2ESRA 3R8CA 4BRWA 5LQDA 5H3LA 5BN1A 2DWCA 3I0NA 1U8UA 4MA5A 3UMGA 1GA6A 1OA0A 3BE5A 3FTDA 1Z83A 1ZK1A 3L7KA 2X4GA 2OHXA 2OWDA 2P90A 3GT3A 5LCXA 4TWRA 1E2KA 2X42A 3A0UA 1NVWQ 1GZ7A 1QVRA 4J2TA 5F2OA 2W70A 4WADA 4QZVA 4N48A 1QP4A 2J9ZB 3VUFA 1MJNA 4UTRA 3REQB 4QGBA 3B9PA 1J99A 2Z2KA 4AUEA 1M2EA 1PL7A 3C2QA 1CZLA 4BPRA 5LWQA 5DASA 3TG2A 4LTDA 1DV1A 3AONB 2PKXA 4QOJA 3WJAA 2VZ9A 1TZJA 1YRLA 3HJTA 3TEJA 3JQBC 2A67A 4W9RA 3WIDA 4B80A 2IYPA 5CCEA 4QPJC 3NYRA 1ZUWA 3ANLA 2V98A 2B1RA 1GTJ1 3D7KA 4BAZA 1SXPA 1R8JA 3KOMA 4HDRA 1S01A 1NJGA 4FJ1A 3RVJA 4BJ6A 2X1LA 3GTLA 3IBTA 4MCAA 4DCGA 1Y3AA 5DBHX 2FTKE 1E2QA 1CUEA 3GUYA 4BV3A 4P7FA 5ADHA 3QVVA 4DJJA 5J2TA 2ZSEA 3IXMA 1PQWA 3KT3A 3QIAA 3PZBA 3SJUA 3ZY4A 3O6VA 1GWNA 16PKA 1FMLA 2J3QA 2UYQA 3ESCA 4R1PA 3U09A 2E21A 3ZCVA 4HH3C 4AF8A 3LWDA 1GM5A 2WHPA 2QMZA 5D3MB 2OA0A 1YR3A 1VA4A 5BN4A 1XMJA 2IZ5A 4ZZ0A 1PNRA 3T5PA 1G8AA 5DNYB 4PFQA 2QRVA 2VNKA 2I4IA 4DPKA 2BGMA 3II6X 4DUYB 1QBGA 4JGIA 3V7NA 4LQDA 3LUFA 3NHAA 1NN1A 3VGJA 1KPGA 4ZIRB 3TFOA 1J09A 1YRAA 3UK7A 4JS0A 1V43A 2O05A 2ZROA 4RK4A 4HH1A 2JHFA 5TQ0A 3HXKA 1XTIA 3MLAA 3VZSA 2C82A 1V9CA 4GWGA 3HWRA 2CDAA 3SYTA 8GPBA 4EB0A 3O8QA 4JVMA 4RPLA 2ET6A 5BNFA 5I7WA 2CUZA 4LK2A 3HMKA 1ZJ6A 1K0FA 1E4EB 1UJCA 2OYCA 2FWPA 3IVAA 1AOXA 4RK0A 4EUKA 4UUMA 4GOXA 1SNYA 2JS7A 3MTGA 3RBXA 3B38A 1I9GA 3QTBA 4EKIA 2CCGA 5IVIA 1W35A 5B1YA 2BDUA 3DAGA 4BVEA 1PTJA 1TI7A 2Q5CA 3K72B 5JCOC 2GRJA 4CKWB 4JJGA 1GRQA 3IQEA 3KC2A 1QV7A 3M4XA 2NSHA 5KI6A 2ZKLA 4X3CA 3DNPA 4LJ6A 3AY7A 3L6DA 1W9HA 2IS4A 2YXPX 2B83A 1WBDA 3MMPA 4ZK2A 1P74A 4UEQA 2Y9PB 3IUNA 3OQHA 4GX2A 1ZCAA 2X4LA 4KXQA 4B40A 1J2YA 4FGKA 1PCXA 3OFJA 2XTAA 4JLKA 2FWRA 3LF2A 4GP7A 4RHFA 3RHZA 2FUG6 1X1BA 2GYVA 2Z3WA 1LTKA 3WRXA 3AR5A 4L07A 1N0WA 4J3JA 3KZXA 3GD7A 1SCDA 3GA7A 3GP8A 4ZZ3A 2P1ZA 5JPIA 2EW1A 4MDYA 3IQZA 2X19A 3LW7A 1B7GO 3AM5A 4V0QA 6REQA 2LKDA 1LWOA 2PX5A 4AVYA 1EHYA 3A4VA 1Q7GA 5FDFA 4W5OA 4PGAA 1Q1EA 2JGRA 4QGAA 5C51B 4H7EA 4KHPB 4LF8B 1SHTX 5E38A 2NSLA 3VKFA 4DXHA 1O0BA 1FNSA 2QLTA 3B6JA 3JR3A 3PXEA 3JWPA 4RUKA 1R88A 1QHHA 5CDUA 1ZD8A 4B3XA 5A02A 1H22A 1LDBA 2OZPA 1PHPA 3SYLA 1T0JB 1MNQA 1XJWA 1XYYA 2DLNA 2WIAA 1MOPA 3LL7A 4MUMA 5IKXA 2G63A 1G2PA 2Y1LA 4B0OA 1AQ6A 2NT4A 4ROTA 3R0ZA 2ZT8A 3EA0A 3JZFA 4HUJA 1SXHA 2EZ8A 4GICA 1HDRA 4V0ME 4CQJA 1FRVA 5CDFA 1A9PA 3WSVA 1EHCA 4X66B 5B2ZA 3IEMA 4DZZA 2G06A 4C29A 3FYDA 3DZKA 4UM5A 2HRDA 4F60A 2ZJ7A 4HCJA 2VQDA 4PQYA 2MSKA 1JT9A 1C80A 5JQGA 4UNIA 3KEMA 1NVTA 4EI7A 3FTFA 1VI2A 5CFLA 1NXQA 2XUHA 3COSA 3VYWA 4IOMA 2BFCB 1YFKA 3OT1B 1LJUA 1K7CA 1GZSA 1TGVA 1TYAE 2WNHA 3I04A 3RTBA 3V8NA 3KR1A 3W2GA 3H04A 4MQFB 2I6FA 4R0MA 5JO0A 2P2SA 2P5TB 1EFVA 2CFIA 3W5IA 5I8PA 2WUGA 3DB2A 2GARA 2LGJA 3KPVA 3HCRA 1E5DA 2WKWA 1I50A 4AZ3B 3EVEA 1Z9BA 1PUJA 1ZIXA 1PEKE 3CWZA 3AVXA 1QRRA 2HJ9A 3KXLA 1M6EX 3EGDA 4KDFA 4Q16A 3W9SA 5ISMA 3OZTA 1L7VC 3BQMB 5ERXA 2JFFA 3HCPA 3L0CA 2C77A 4MAMA 2JAQA 5B2EA 2F43A 3IUPA 5AKYA 2JZOA 1IMJA 1XYVA 2CT8A 3ILYA 5DF1A 1FUEA 3PPWA 3NATA 1JDNA 2G07A 1UMBA 4AUKA 2ZUEA 2GLTA 1MGPA 3Q2OA 4GSKA 4NE9A 1E0AA 1XZKA 5HQ3A 4LRQA 3THWB 4UTPA 3R0XA 4GS5A 4GDFA 4MEJA 4MXDA 4BL5A 1U11A 2QQ0A 1RVDA 1NVFA 4YUWA 1KVUA 1R5JA 1R0WA 1VG1A 3BIOA 3GFPA 4NESA 3RFXA 4FNOA 1ZH2A 4O59O 3EAGA 3C1TA 4ML3A 1JN0A 1NV9A 3UAOA 2XNJA 3G6WA 3GMDA 3N86A 3AC0A 4ZP1A 5E8RA 3TRFA 4K0KB 1Q50A 3CWCA 3GTOA 1WU8A 2N47A 4IMRA 1ZXLA 3ZBQA 2IHNA 1YI0A 4CIBA 4E5YA 1U0SY 2IFTA 4QEKA 5L9AA 5IW8A 3I5XA 4AHCA 4DDUA 3HRHA 2VLBA 2B4KA 5LL6P 4LZJA 2ZBRA 2GKOA 2X6TA 4FCTA 4F1WA 3A6PC 1T9BA 2PZBA 4XIGS 4QRIA 2CLOB 1YL6A 1EK8A 4YCJA 5DT2A 1NUTA 4IIDA 4M8NE 4R1TA 4C3OB 4GP6A 3CNEA 4IP9A 5EJ7A 2E85A 2CLSA 4JBGA 1V11A 4UU8A 3WB9A 4AL4A 2QLFA 2CLCX 1Z6PA 4FSXA 5K8IA 2EGHA 2YVKA 3TRIA 5KYYB 3WHPA 3E81A 5FNZA 4PSKA 3A58B 3W4JA 1F6WA 4YRAA 3JYHA 1AUOA 2KW5A 4DV0B 1RMTA 1G4HA 4QXPA 5JSBB 4S12A 2WWVD 1ZN9A 3U19A 1X80B 3PNPA 1E96A 4L3WA 1TDJA 4TTQA 4OFBA 5B3AA 1FP7A 1V7CA 2YZKA 4C5CA 5KEIA 1J1UA 1JLHA 5ITVA 2Z5LA 4CL0A 1R6TA 3ECAA 1SVNA 1FQKA 5EXSA 2B5OA 4I1PA 3OPYB 5BYBA 1WBBA 3SX2A 1NFQA 3IUQA 3SGLA 1IWPB 4AJ9A 2J85A 1WNFA 2ZYRA 4QD3A 3TINA 3GI1A 3FHLA 4FYKA 3ESDA 1EP3B 3RC1A 3ZKWB 4ECAA 2HMUA 3H4VA 4RH0A 3C3AA 4EFMA 4WH0A 3ZHUA 4G1VA 2PCJA 1WXGA 4D3FA 1KYVA 4JXKA 4ND1A 4O4LF 2OHIA 3FNGA 3N9IA 3WKAA 1UQUA 2O2XA 2XUFA 2DCMA 1VP9A 3SEFA 5DNUA 2B20A 4G0QA 3C3JA 4QVGA 1X7WB 4GKAA 4QX6A 2RB5A 1TWCA 2EGGA 1MB9A 2DQYA 1U81A 2O7RA 3I6IA 4LZAA 4OGFA 4R5MA 4S2UA 4RLSA 4V0NA 1MO3A 1R6UA 2YMPA 3FNBA 3ZWYA 1JVBA 2O2CA 4GBGA 4BV2A 4L5YA 4DMMA 2M2IA 4G01B 2P27A 3FOWA 1KDZA 1P7CA 4FONA 1L5HA 2QT0A 2OOSA 3N07A 5C3MA 2BUBA 3GRCA 2XWSA 3MCWA 1U90A 3CLUC 1AF7A 5L3SB 2DFNA 1GHTA 1J2JA 3E1GA 2HTFA 1E2PA 5B4TA 3GU3A 3MGBA 4DNOA 3PF9A 1KI4A 5E7IA 2ZBDA 1Z08A 3RNOA 3WMGA 3JARB 3HSYA 4O4IB 1EUDA 4MUBA 3EF1A 3CUEF 4NPAA 3TTXA 1L1EA 1CLUA 3ASVA 4NXNB 3W05A 3A1UA 1CETA 5L8VA 2FFBA 2AD5A 4G4IA 4HR7A 5EFOA 2Z30A 3SEZA 2C4NA 2FRVA 3FGPA 2QORA 4JNCA 3CF2A 4OL0A 5FA6A 5G1NA 2BR3A 1AXRA 3TQFA 1XKXA 5IAEA 1J06A 1U5BA 2JFHA 3FVRA 4A4DA 1HL3A 3H2GA 4E1VA 3LCMA 1PQPA 1JAYA 3DB1A 2C98A 1U99A 1MC1A 1OLXB 4FE4A 4Z0HO 3M7IA 5DSXA 2NTJA 2WF7A 4OOEA 2Q4OA 3FJYA 2JLUA 2I2WA 3T99A 2FPRA 1II8A 2R1UA 1UP4A 2GJKA 4IHAA 1W9MA 3LCJA 1WHTA 3RAPR 1O95A 1AV7A 2MYPA 3PFIA 2O1XA 2WIDA 3PQDA 1A04A 3ZE6A 1OLOA 3P5BA 1UBEA 4LWOA 2XKKA 4M1WA 4KAJA 4CMGA 4QQ8A 3DKKA 3CVXA 1AIPA 3GEHA 3UJDA 5CG2A 1ES9A 4EB6A 1DLJA 2EFHB 2XE7A 4MNTA 1PZXA 5DIFA 1H65A 5CBPB 2EWWA 4M8IA 4PG7A 2SCUA 3EA5A 3FZNA 4R1OA 1SU4A 5K8LA 3OJEA 1TPZA 2IDMA 4HYQA 1YUNA 2FLWA 4BQSA 4LHSA 4U0KA 1Q1BA 4P58A 4OQYA 3MBOA 4EDHA 1FP4B 3G8BA 3LCCA 4G26A 4MR8B 1N4AA 3WYFA 2HQRA 1VLLA 2JCXA 1J70A 1UPUA 3STUA 2P2LA 3K1YA 4PZPA 1GRNA 4BJ5A 2IBTA 2EBFX 2NU6A 4EJFA 3ESQA 3OX2A 3OETA 4M9RA 3OZAA 4WFJA 5KOJA 2O4CA 2VSYA 4LRYA 2JAPA 3UK1A 3OCUA 4Y1GA 4NJOA 3O1JC 2WWFA 1E5QA 1T2UA 3MQ2A 2ZJ6A 4F3KA 2I7DA 3ZGXA 1MUUA 3PDHA 2H5IA 1M34E 4V2IA 3CMCO 1RZVA 2CEAA 1KJQA 1EUCA 4W5WA 3FCCA 3O4HA 3QUTA 4U8HA 5J2UB 2H4XA 5DI9A 1IE3A 3E70C 2HA3A 2Z2IA 3I9JA 1KRXA 6ADHA 1DHTA 4JOBA 4K1LA 2Y0CA 1WULS 3FCAA 1TKBA 3WWYA 3DBHA 4I7EA 1H66A 4ZOLF 1W5SA 5AQEA 3C3MA 2GGSA 2OZLA 3BH7A 3C0KA 1XTJA 4YJGB 1RHKA 2YWCA 2V4ZA 4XOUA 3X1XA 3D59A 3HH8A 3L02A 1A96A 5D3QA 5I9IA 4K8OA 5IHPA 4U7GA 4ITRC 3Q2IA 1BDIA 1R0ZA 4WOCA 1BMTA 2DMRA 5T41A 5JALA 4JB8A 2P3OA 1IQPA 1BOFA 3U0VA 1N7HA 3DOOA 2OCPA 4QUKA 2X9QA 4JA0A 4UASA 3DMPA 2O57A 2PYZA 1HEUA 2BDEA 4LUCA 4WNCA 2P6NA 4QOHA 4EI2A 5L3VA 3W0LB 5SZKB 3WB2A 3GA5A 1Q0ZA 1LNZA 3H5VA 1FXWA 2WFLA 4RZXA 5D7BA 3UXMA 5LUAA 1AQYA 5KSWB 1SUBA 3PS9A 1IEWA 2CNKA 4YA6A 2CFTA 4O4JF 1ZYRD 4N0DA 1YU6A 5CYFA 4RMGA 3RK4A 2PV0A 3GB9A 4BYMA 1KMQA 5DZSA 1RFLA 4Q3CA 1NXXA 1O7JA 4IIEA 4BTLA 2DPYA 1EGQA 1OMOA 3DKRA 4WJKB 3L8ZA 5IZCA 1EGHA 3D2AA 3EOZA 1JHYA 2WAMA 5BUCA 2PKQP 4UDNA 5B3JA 5KNLA 1QLJA 2PRSA 1H8EA 2QGFA 3GVHA 3X1JA 1FFYA 4OQZA 4HUTA 3ITNA 1QQ7A 3F6RA 1V9LA 3OQJA 2WIBA 5KVQA 3U17A 4HUQB 3RS2A 2NO4A 3W2HA 2Q3DA 2YWDA 3A9WA 2POCA 1NZJA 5K3FA 5T4HA 1DAOA 4A16A 2CN1A 2Q4TA 4A10A 1PFYA 5CAEB 5C3UA 2G5PA 3LBHA 4P53A 2BGGA 3A70A 2BJVA 1A72A 1F06A 3TQTA 4FM9A 3PDUA 4U02A 4C21A 3FYSA 3ZN2A 4A2CA 2JARA 2Z98A 4MQLA 2JW5A 4D8WA 2FRXA 5SYNA 3CLHA 1SA0A 5FUVA 3SDBA 3OCYA 3ZE9A 2GZMA 1DJQA 2ZUFA 5ALDA 3LDFA 1DIOB 3DHYA 4MAAA 2ROQA 4C6RA 2QR2A 3EN0A 4BFLA 1SOUA 4EL5A 2Y1XA 3KKQA 2DFDA 2I22A 2GETA 3HZZA 3FHCB 3DVRX 2H2FA 3FPHA 4ZVPA 3BHNA 1JTFA 5LZ7A 5AOCA 3TZ6A 3TCNA 1N6LA 1LWNA 2GESA 4LSZA 1MX5A 3DLPX 3RS7A 5BSKA 1OHHD 1BQ4A 1WV1A 3S2UA 3VPGA 3UH0A 2ZREA 4GI3A 3UJ6A 2GR9A 3BK1A 2ECKA 4EY6A 1PNQA 1K6EA 1FYVA 4ENQA 1QJ4A 4UPEA 2R1TB 3H5IA 4YAGA 1UL1X 2DBVO 3CLVA 4G0XA 4JX8A 3COZA 1WQ4A 3G0BA 1LX7A 5H16A 3GPLA 4JT8A 4DT1B 2A7QA 3MPUA 1J00A 4YUXA 5SY9A 1NG9A 2PX6A 1PWXA 1KQGA 2BT4A 3TKYA 4BO7A 1C29B 1M2HA 1NH3A 4KB4A 1CLEA 5K6RA 1TVEA 3R9KA 5EE5B 1NLZA 1FDIA 2RGNC 4PLPA 4B9AA 1CUGA 1DC6A 5JD5A 5H1YA 3AVTA 2XCLA 1PG5A 4A5SA 5DXJA 1IEXA 1VYUA 2ZCVA 5C4MA 1TTTA 2CFSA 2W2LA 3H4MA 1ZVJA 2NO9A 2Q9BA 3HZHA 3IGFA 4QPCA 4B6PA 1HX7A 4EBFA 1M67A 3Q7EA 1ZNZA 3K2QA 5J4LA 3C3PA 3A1CA 3E5HA 5DHUA 1NXOA 2VQ3A 4UZSA 4X7RA 4ENPA 4DLPA 1YJCA 3EUEA 1K3FA 4I4LA 4RGBA 4J7AA 3P20A 1XJCA 4YO7A 1ZGBA 3P8ZA 3OCCA 4OF4A 5B64A 4CUKA 3EEFA 3LH5A 4PR3A 3PCRB 5GV7A 4O3MA 1WX1A 3LDUA 4ARZB 1WXIA 2YMQA 3BAFA 3CZRA 4RNCA 4TYPA 2WM8A 3VNSA 3DE1X 1BCRB 2AFIA 2NACA 2QWXA 1P2DA 4N12A 3K09A 5KDOA 5JTTA 3FOBA 3PPYA 1B14A 1LY1A 3WB0A 4HDSA 2A0WA 2HSWA 1WZIA 1W88A 2QMEA 3CX6A 4YS6A 3OOJA 3AHIA 1SUWA 2B2NA 2PO7A 4WIAA 2PANA 1AKQA 2Z8YM 1IUNA 3DDSA 2FMHA 3LTEA 3OY2A 4H7KA 4LDJA 4MGZR 4YASA 3RV3A 3EH2A 1PK9A 5KZMB 3AWDA 4XB2A 1LTQA 5E3JA 3W6OA 4D2IA 2BEUA 5IUJC 2OCLA 5GJVC 4EKEA 2M1ZA 4MV5A 1W0KA 5H5JA 1JPNA 1QONA 3LGXA 4E5SA 4Z7OB 3KB1A 1WETA 4M9ZA 1NDQA 2CVFA 2NVUA 1OXSC 1YZLA 4I8XA 4DV3B 4JI1B 1GZ5A 2KE5A 4DDKA 1KSGA 4DQLA 5C7YA 4LC0A 1I01A 1N92A 4ZT4A 5ADVA 1R15A 1HH4A 4DM3A 5EUMA 2O8EB 1QGAA 3VU1A 2R65A 5IH3A 2C00A 1B0PA 1V3QE 2PBFA 2Q0XA 1VSTA 3HGTA 3GVPA 3OA0A 3TBHA 5A3JA 3JQ7A 1JH9A 2IDJA 4DR3B 2F00A 3DAYA 1U0FA 2DWOA 4BLTA 1Y4SA 3K71B 2AV6A 2WOJA 1R74A 4PE5B 2C2YA 2DHQA 2WHRA 1DBSA 3BTSA 5CA0F 5ARCA 2AOUB 1QX3A 4O4HA 4DC0A 4K6MA 2A2ZA 4I9FA 3AY6A 3QEAZ 1TKAA 2X41A 4PIMA 3E3AA 4HI0E 2IV7A 1JILA 3RSFA 4JJAA 1UKVY 1PQ4A 5EIAA 1N9KA 5C4IA 2ZPAA 4ER0A 3GNSA 4ZZ2A 5KDLA 1HDEA 4ZJYA 2QX8A 3PV0A 3K92A 2A33A 5KWSA 1ZKDA 2QVXX 3T9DA 1C8VB 3ABOB 1TNDA 3FOAA 2AN3A 2H52A 4DJEC 3DD5A 4IZ6A 4F5EA 1SMKA 1XXHE 2OCBA 2D1TA 3KYBA 3RARA 2FW1A 4YBZA 3D2CA 1VB5A 2VSQA 2Z08A 1AA6A 2G83A 3B7PA 3EUWA 2IF2A 4H0FA 4IZIA 4P9NA 2HJVA 1TC1A 4QTZA 4JFAA 1XEXA 4TYNA 1JHVA 1QCZA 3WK5A 2DJ5A 1F9EA 1T2NA 4FFDA 3JD2A 4ZT2A 4QRHA 1L4UA 3TLJA 3AHDA 2WT9A 2EX1A 4KIWA 2I6XA 1QZUA 2W2QA 3R9XB 3LT0A 5EIBC 4X41A 5F3RA 2V45A 2Y6UA 4CEJB 2CL0X 5EMJA 4S1OA 5B7NA 3AM4A 3MD0A 3OPYI 1IHXA 2BELA 3OEHD 2ZB8A 1ZLYA 1HE2A 4QUJA 5HIMA 4KLNA 1VCMA 5L3RA 3PFWO 4WZAE 4EG1A 4Z7JA 5KWVA 2JIBA 3SZ3A 4BLRA 4UNRA 1XTKA 4MYSA 1XX6A 3CFYA 3CRQA 3TW6A 3BMCB 3PR2B 1ECFA 2ADMA 3KD2A 4JKIA 2FWAA 1QBKC 1E8DA 3P9XA 3PUYA 4G0PA 4WZ6A 5AXCA 4AWBA 4BWGA 1XPOA 4I3GA 4LA4A 1NT2A 1XP8A 3KXPA 3NWJA 1ODSA 3CS3A 5CMLA 5FUYA 2LBPA 3WGIA 1EIWA 2BKXA 4WE3A 2VDMB 3VVBA 1LKZA 2H0QA 4UATA 4EQ6A 3SHTA 3V32A 1D0SA 3QXGA 4XM0A 1RR8C 4HP8A 4R9NA 3P2JA 4EY5A 2AZXA 4M7PA 4GL2A 4NG4A 2KMLA 4UUBA 4A1FA 4B6QA 4M0CA 5BRAA 2JHPA 1HLDA 1QZZA 1JPJA 1T2EA 4QYMA 1IWOA 1GTVA 2GRUA 3ZIAA 4J03A 5CFRA 2ECPA 4X6UA 2XMCA 4DLLA 1CS0B 2GS9A 2B1JA 4Z86A 2GM9A 3R4CA 3LVBA 5CB4A 1YS6A 1GGKA 1Z37A 1GVHA 1YZUA 1BVYF 3RIYA 4B7XA 2YXLA 1L9KA 1M1NB 3Q0EA 2B98A 3QX8A 3SQWA 3YASA 1WCXA 3FWHA 1CT9A 2JGFA 4C4OA 3IMEA 2F1RA 3P9IA 3SLGA 1XDGA 2FK8A 2Q2QA 4V24A 4BCDA 3TJZA 1OWNA 4NULA 4BKPA 2L19A 3IPCA 3ZD7A 2LNDA 4CM3A 1RU3A 3R6WA 2Z6QA 2I2AA 3RBZA 3BZWA 4PIPA 1DJOA 3E2PA 1RXCA 1RC0A 5DGCA 5FB3A 5GOZA 1KWGA 2A6ED 4EHDA 1I13A 4YMWA 3USZA 2ZP1A 1DINA 2BLLA 4YYEA 2KBEA 2NZJA 3GRKA 5CRIA 4EEXA 4YCNA 1B41A 1MGOA 1OFGA 2WKQA 4N65A 1QIEA 3E9YA 2F4VB 3ROGA 3BE8A 5C81A 2PX4A 5IYZA 2G9ZA 3F49S 2QUJA 2PLFA 4G5YA 1G41A 3DT8A 2QP3A 4AJIA 2ZS7A 2WSLA 3GFRA 2AZTA 1RM4A 2QL6A 1YB4A 3PVSA 3JD3A 3QE3A 5DHQA 3VKVA 5JAIA 3E2IA 1VGRA 1YNOA 2WWWA 3QY0A 2X3YA 3LT5A 3UWKA 4JB3A 3ZHYA 5KU1A 4YP5A 3CNHA 4X1YB 3GLHB 3RJ9A 1UPXA 3R7WA 1Z82A 2GRAA 4JJKA 1DOAA 4RS4A 2DHDA 3Q8MA 2JLQA 1EWKA 3HKDA 2IYNA 1ILEA 2A5JA 3DE0X 1U1IA 4NI5A 1J39A 2QENA 4QGHA 5BWBA 3I9LA 4F7WA 1BEZA 3MSCA 2D1FA 5AW4A 4R83A 3RWMB 2NYVA 2P6OA 4GRIA 4ZMSA 1M6YA 2CZGA 4WT7A 2CD7A 2CGEA 4KRGA 1E7MA 1IHOA 5CITA 2YS7A 3RREA 4KWTA 4M0DA 4DAOA 1AB5A 4GNKA 1O89A 4F4UA 4MICA 3WYGA 2QYSA 4DBLE 1WY5A 1TLTA 3H16A 3QVGA 4YECA 5DBEX 1FBTA 3FSRA 4TXHA 5DBIA 5CDHA 1T1RA 3NAMA 2VNHA 4LF6B 1ZCZA 4U7TB 1BN6A 1L8OA 4LVCA 3HBFA 3C5VA 1FF9A 1YB1A 3KWMA 4G0YA 4HQRA 4B81A 3ESAA 4HMQA 3BERA 4FNGA 3WWZA 2AYXA 4LQ4A 3IV9A 4IDQA 4ZEMA 3QQPA 1BYIA 1EAYA 1KO5A 2Q1UA 2V03A 3TOVA 3IEKA 3U3ZA 3ZWQA 3WA7A 3K1JA 5JJIA 5IASA 3LJKA 2QRUA 1Z39A 1Q16A 2IYLD 2JJ2D 3T9AA 3TZCA 4B6OA 5MGBA 3DWGA 5J2TB 3K70D 3KL4A 3SR4A 1Z3IX 4NTZA 4BVBA 2RGXA 4FDAA 1BH6A 2WHPB 3CG0A 4LYYA 4N3AA 5ER6A 4YH1A 5BN4B 3F7MA 2F1OA 1G66A 4AJ2A 1N1MA 4ZOQI 3L7MA 2ZIXA 2QRVB 1EE2A 4GPBA 1RACA 2XVZA 4IJMA 3L05A 3PJFA 2ZRCA 4IV0A 4N8DA 4RENA 4XQEA 3FLMA 3RT9A 1UMDA 3STVA 2PVSA 1AUQA 4WSOA 1L7AA 1U0HC 3G49A 2H7XA 4OQLA 2C58A 5HILA 1PV1A 2COUA 2VH1A 4HDMA 4LRWA 1NDUA 1TCCA 1R12A 2O0MA 2OG1A 2OORA 2RB4A 3ELUA 3I2HA 1HSZA 4R6XA 5HRUA 2EKZA 2E4UA 4X54A 2Z57A 1P91A 2GSDA 2XAUA 4V02A 4CZ2A 1JR3E 2ZBEA 3D0QA 3IX7A 3DFZA 4FR0A 5KO2A 1W5BA 1GA1A 1P60A 3M83A 2WLSA 4PLTA 4EPXA 5E6SA 4ARAA 2UUBB 4QSHA 3GG9A 4ZJUA 3H9CA 3EYAA 3K8OE 3ZDAA 3F4BA 2QYTA 4V0OA 5K0NA 4MW1A 4RGVA 4QPZA 5DSTA 3G2PA 2WHQA 1OPXA 5DEIA 4DBVO 4KRFA 3IUYA 1E77A 1TTHA 3GGDA 2OYRA 4YRZA 5AW3A 2C7RA 3IODA 1TUBA 2RHMA 3TTVA 1FS6A 1C14A 2OHOA 3B3FA 2NV2B 3B48A 4WASA 4ZWNA 4BATA 3C8UA 1PJBA 4AJHA 4BFXA 4IJ5A 4WJZA 1UZUA 1UJ6A 2R7KA 1UT6A 2RH9B 4GLBA 1X8JA 4OHCA 3RFFA 3NT5A 1HOXA 1IY1A 1B93A 1YB7A 3DCYA 2XT9A 1I94B 2H1CA 2V1XA 2XTNA 3IE2A 4GFDA 4R68A 4X20B 3K8QA 4EFLA 5HOEA 1H1DA 4Q1AA 5AVVA 4KOAA 3JXEA 4W8GA 3K30A 4JC8A 1DXQA 2D5IA 3IAYA 1DJPA 1Q3HA 2IEYA 2QRKA 3EW9A 3TQHA 5B12A 5KDDA 1GEEA 2WA2A 1QOQB 1SXGA 4JQCA 4OD0A 4L8YA 5DO9A 3SC3A 4NX2A 2G9RA 2BM8A 4Q37A 1IL0A 1YVEI 3AR7A 2HR1A 4XI9A 3EISA 1L7DA 2YXBA 1MXFA 2F4NA 2V7UA 2X22A 1GKKA 4ZO8A 1EE1A 4ZARA 3TSZA 2CNBA 1F20A 1P1CA 5IDWA 3FCUB 1TA0A 2B30A 1VJ1A 1MHPA 1QPBA 1WXWA 2PPLA 3H2SA 3IQIX 6REQB 4BFZA 3TUIC 2CJXA 2JLCA 3NDPA 3U48A 3WWPA 2RHCA 1B0UA 1T9GS 3OOSA 4AAYA 1GGJA 4MUAA 4QODA 1FDTA 1N3LA 3FMOB 1DXOA 2C5EA 4RVSA 4BB0A 4C4ZA 1N2OA 1M8PA 2C5GA 3EPPA 5FJIA 3B5JA 3SM3A 1JFVA 3QK7A 3PK0A 5LUBA 2OBMA 4GW3A 5TMEA 4EOGA 5DMHA 2OENG 5JVDF 4BZXA 3W7AA 4ZANA 3RC8A 5BYAA 4LHXA 3MWGA 4MRNA 5LMCA 3EF3A 1FRNA 4KPEC 5L4SA 1XLWA 1XQWA 2VP4A 4IO0A 4PAQA 4YWHA 5L7TA 1GRCA 5LA6A 1HQMD 3OE7D 3MT0A 1KBOA 2G5CA 5REQB 3UHFA 4G25A 4IOJA 2P4QA 3ANMA 4PLZA 3RAFC 1H1TA 1F4PA 3NTUA 4K2HA 3LF1A 5JXGA 4A0RA 3KE9A 3UNXA 3C6MA 1X1AA 3KALA 3FUXA 2ZT7A 1M1XB 1XVUA 5EMLA 1G9XA 2NOAA 3TVDA 1GIAA 1K2WA 2X8BA 3DAPA 3GJ4A 4UQPA 4URZR 1IBKB 3IJEB 1TEHA 4AJJA 1I4TD 1V16A 4I55F 4LMOA 2Z3ZA 1VCHA 2FRDA 2I29A 4IINA 1DQZA 1RXUA 1AO0A 3KQPA 4RF5A 3CZQA 1XMXA 5DYNA 3FWZA 1OAKA 2J7PD 3CO0S 3HU2A 2XTJA 2AK2A 4NDNE 4N82A 3SZMA 4BNWA 3DE7X 3OQIA 1KAOA 4Q3EA 3AL0C 3ZHRA 4HT3B 1SN7A 1AH2A 3R3XA 2IXFA 4LDZA 2IE0A 1ZHOA 3TOXA 4YV2A 5H4HA 1SUCA 4IHJA 2GVZC 4RH3A 1UQRA 4ZU6X 1EWQA 2ZTUA 3H9JA 1C3OB 4DHWA 3FPKA 2YJ6A 4I0WB 1IB6A 3ST7A 3ELBA 1LBQA 1O96A 2QD3A 2Z6AA 1IPHA 2H9AA 1OT3A 2Y0DA 3BDVA 4ZREA 2F43B 1OZAA 2P3SA 2VJCA 2WPNA 4JDUA 3KR2A 3WLFA 3ZLUA 2VT6A 5LP6F 2WYOA 1O8CA 1N9GA 3E03A 3K5IA 4J7XA 3EIUA 3MRVA 1I7NA 1ZN7A 3NWPA 4FNMA 1UMBB 4KR0A 1F0PA 4LDPA 3FI0A 1M2VA 3DHVA 2A94A 1O77A 3NM6B 2G8LA 3B6MA 4O8ZA 2AKYA 4R9UC 2H2HA 3CF0A 3V1TC 4E33A 4MMZB 1JEEA 4ZC1A 1PYGA 1CUCA 3H5TA 1Q7BA 1QIHA 2AMFA 2Y66A 3MBIA 3PEFA 4LRSB 2FWBA 5EE3A 4BMXA 4XQ0A 3CVYA 1W36B 4J43A 2O5VA 1U9YA 1Y9AA 1J1ZA 1ADJA 1S6YA 4LZNA 4OQMA 1XA4A 1PLLA 1V4BA 4X45A 5TS2A 4AFNA 1ODIA 3KTDA 1E7SA 2ZG6A 5E2IA 3OFVA 1GZ6A 5BQXA 3OF2A 1CY8A 3DDNA 1WKCA 5BV8A 3PB3A 2PFSA 3IKJA 3KVNA 3PYXA 1T6BY 1WBJB 4MLDA 1QH0A 5F64A 4ERXA 3D7SA 4OX9Y 1OY1A 1VCOA 2Q5JA 1JZTA 2GF0A 2DR2A 5M2QA 4I46A 5F51A 4D4HA 5CNIA 2CHEA 4HGQA 2YYYA 3WNVA 2Q1XA 4PZ0A 5EL0A 4RW0A 3AJDA 4MJ7A 3PIIA 1X3LA 2A9KA 2Q3LA 4KNWA 3UKOA 2XA9A 1VLVA 3BHIA 1P44A 1UPTA 3ZZMA 2VRNA 4G86A 2AR7A 4TROA 1AMOA 1WQGA 5IC4A 3NJRA 5KTRA 2A5YB 3W3AH 5LQRA 1G20E 4ZDIA 1TAGA 4J75A 1I80A 3TO5A 3ZCRA 3ZCQA 3ADPA 1V11B 2RFLA 1AS0A 1XOIA 3CV3A 1BOOA 2PKQO 1GZ4A 1X1RA 4HNSA 5GZ3A 3Q8KA 4KGXA 3KFXA 1QGOA 1SG0A 2FZWA 4MMXB 5T6MA 1NNLA 4TUYA 1A5ZA 1SVUA 3L07A 1TIBA 1AB6A 4CM8B 4EYGA 3I6YA 5JO9A 5IG2A 4D3ZA 3I28A 4C7JA 1TAQA 3QBTA 3OZGA 4TWZA 3MAAC 4B45A 1HC7A 4OQXA 1LV8A 1RWVA 1VKOA 3I3SR 3C43A 4QXRA 1WSWA 4URFA 3UFBA 3OM8A 3NBXX 2R7AA 4ENVA 1XLTA 3IP6A 2Q3FA 4JFRA 3ZIDA 2P5YA 5JEDA 1SK8A 1C30B 4RHXA 1XCPA 3AYXB 3G9UA 2VAPA 4AMYA 3PICA 3NHUA 3QYJA 1A77A 5FIUA 1PT8A 4FDVA 2C42A 4Y3UA 3T7DA 4C0WA 2XMGA 3NQ41 2JFWA 1FFSA 1T6ZA 2D06A 2F3TA 2Q6VA 2VP6A 2X0JA 4RL4A 5KYUA 3V4PB 4WWHA 1OH5A 1KY5A 2F90A 2C0QA 2QOEA 2YRXA 4PYNA 2G9QA 1AM4D 4XR9A 4YMIA 3ZGYA 4HN9A 4B3BA 1HTWA 3V4ZA 4M53A 2HW8A 2H3HA 2ISSD 4JENA 3GC6A 4CNQA 1QVZA 7ABPA 1T26A 3O95A 2PS3A 4JLBA 2C9CA 2HZ7A 4WXYB 1C5KA 3FDZA 1JFFA 3D6TB 1R5BA 2DR0A 1M1ZA 4HDCA 2PSDA 4ZOLB 4AJ1A 4A2QA 1JR3D 1C7FA 2YHSA 4RA6B 4ZKEA 4DQXA 3C4VA 5CEFA 1WB6A 4RTRA 4Q7MB 3DXYA 1TAHA 2VDLB 2QT9A 2CDNA 3V4LA 3E05A 1NNEA 4MQUA 3LOUA 4DRZA 3X1DA 1CUSA 1HNXB 2XR1A 1GFIA 4H08A 4YJKA 4IIUA 5F76A 4AECA 5DNAA 1YH3A 4YAWA 2A9OA 5AKIA 4OL9A 4YXWA 5A5VA 2JCVA 4XFKA 1V9SA 4RVFA 1YR6A 3LDGA 4IIVA 1EUDB 1IH8A 2IEGA 5JUWA 2V6MA 3GO4A 2OMKA 1HE5A 3G23A 3JR7A 1VE3A 2Q5EA 3NIBA 4XKJA 2XAAA 5ALMA 1RCUA 3GPBA 2FG7C 3S8EA 1TQ8A 2C8LA 4O4JB 1I0LA 3G79A 3OY7A 3O3OB 3SKYA 4L9SA 4CF3A 5IK2D 2P7IA 2ZVPX 3JVIA 4PXAA 3V97A 5C35A 5KOIA 1OAAA 1KZ6A 1CULC 1GILA 1O6BA 1KDTA 2V65A 1VXRA 2BLNA 3EMKA 2RHDA 3I9OA 4TLBA 4IAOA 5TEWA 1Z5NA 1NQTA 1I2AA 2A6PA 1EM6A 3PE6A 3RODA 3RROA 2TYSB 1AN9A 1QFZA 1MQ9A 2A4KA 3GAAA 3JQFA 4HGNA 4C6HA 4NU6A 3GGJA 3TE6A 3UW1A 3ZHZA 4KPUA 3C7KA 1WHTB 1YCDA 3OPXA 4CM6A 2B82A 1I2BA 1YDWA 4AYTA 2UXDB 3GG2A 3RAEC 3RG8A 1YKGA 1U3DA 1PWEA 5BNTA 1BE8A 2VJDA 1JXQA 1OBFO 3COVA 2I4OA 3CUWA 3F5SA 1OBHA 3NIDB 4UQOA 1MF7A 4WXRA 1P1RA 2GNAA 3GOHA 1DRKA 4ZQIA 5JFTA 1JP7A 4Y2SA 1LD3A 5K3CA 3HJRA 3CTMA 1V95A 1NVVR 1H5UA 1A9ZA 4R2IA 3WLPA 1F3OA 5BW4A 2WVAA 4TMXA 3U3RA 4AYBA 4EAAA 3ZS9A 5K09A 1J07A 3DHEA 1LSUA 3ISTA 5DTEA 3OQMA 3EK2A 5E7JA 5ES3A 2N1MA 4C01A 1KOFA 3I05A 5HJ7A 2CNOA 4G1CA 4YRNA 3DFFA 1E89A 2IQIA 2B34A 2YJTD 3L06A 3L82B 2ZR8A 2JD0A 3MT9A 4M38A 2OQ2A 3E0XA 3ADBA 4CEIA 1G98A 1R5OA 4MMYB 3WNDA 2MCFA 3LBNA 5LXTA 4HFNA 2JLXA 4KN8A 3N74A 3TIVA 4TLCA 4LK3A 4TXMA 2J0UA 3JTMA 2GCOA 3RV4A 5F2KA 2P9FA 4TLDA 1Z7GA 1HURA 1TE2A 1M3SA 2FEOA 2R8ZA 3GJRA 3QVKA 4ZU1X