4D3YA

The structure of inactive prolegumain from chinese hamster.
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
404
structure length
384
Chain Sequence
GKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMSPISLPPVTRLDLTPSPEVPLTILKRKVGQIQRLLDARHVIEKSVHKIVSLLAGFGETAERLLSERAVLMAHDCYQEAVTHFRTHCFNWHSPTYEYALRHLYVLANLCEKPYPIDRIKMAMDKVCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUMAIN
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
total genus 139
structure length 384
sequence length 404
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4d3yA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3yA01
5IC4A 3V3KA 2P2CA 4QUAA 2AR9A 4JR1A 1RHKA 4NOKA 5IAEA 3GJSA 1PYOA 4ZVSA 4D3YA 2H65A 2FQQA 4N6GA 4NOJA 4D3XA 4QU0A 1RWPA 4LSZA 4ZVTA 3EDQA 4NBNA 1KMCA 3UO8B 1F1JA 5IBPA 3V6LA 2Y0BA 4N7JA 1ICEA 2CNKA 3UOAB 1GQFA 3R6LA 4QUHA 3V6MA 4PS1A 4EHHA 5K20A 3P45A 1IBCA 5JFTA 4NOLA 1NMEA 2C2OA 4QUDA 1F9EA 3R6GA 4M9RA 2CNOA 4JR2A 1QTNA 2CDRA 3BIJA 2QLFA 2DKOA 4N5DA 4I1RA 4QU5A 3R5JA 1NMQA 5IAGA 1I4EB 4IEFB 1RHJA 4I1PA 1I3OA 4NBKA 4D3ZA 2XZDA 4QULA 4ZVRA 2H54A 3OD5A 4FGUA 4EJFA 3GJTA 4ZVUA 5IARA 1K88A 1SC3A 2C1EA 1M72A 1RHRA 4QUGA 4ZVOA 4EHDA 4EHFA 1RHMA 4HVAA 5H0IA 4JJ8A 1RWKA 3V4OA 3EDRA 4QU8A 3DEKA 1SC4A 3GJQA 2H5IA 3PD0A 2XZTA 3H11B 3QNWA 5IBCA 5IASA 2HBYA 5I9TA 3S8EA 2NN3C 4EHAA 4IYRA 1RWWA 2CJYA 4ZVPA 4FDLA 5LU9A 3V55A 5LUBA 5LUAA 3PD1A 4N6OA 3IBFA 1RHQA 1SC1A 2XYPA 1I51A 3R7BA 2QLBA 1RWOA 1SHJA 1QDUA 2XYHA 3V4LA 2Y1LA 4AWBA 1JXQA 5IAKA 2HBQA 1I4OA 2QL7A 3P4UA 2C2ZA 1CVRA 1RWXA 3NR2A 3D6FA 4NBLA 4HQ0A 4N7MA 3S70A 4DCJA 2H4WA 3H13A 4EHKA 4JQZA 4ZVQA 3KJNA 4JJ7A 4HQRA 2CNLA 4DCPA 2J32A 1RE1A 4JQYA 3R7SA 5IABA 2H48A 2C2MA 3D6HA 4JB8A 3E4CA 4NOMA 1PAUA 1CP3A 3DEIA 4QTXA 1SHLA 2H4YA 5IAJA 2CJXA 4FXOA 4EHNA 2QL9A 2CNNA 2HBZA 4PRYA 3NKFA 1NW9B 3D6MA 3H0EA 4EHLA 3H1PA 1BMQA 3K7EA 4PRZA 2FUNB 3SIRA 1GFWA 1RWVA 3DEHA 1K86A 2QLJA 1RWNA 3ITNA 2H5JA 2H51A 3NS7A 1NMSA 3R5KA 4AW9A 3RJMA 1QX3A 4QUJA 5I9BA 2HBRA 5LU8A 2J31A 3R7NA 4QUEA 1RWMA 2WDPA 4JR0A 3KJQA 4QUBA 5IBRA 5IANA 2J33A 4FEAA 4JJEA 4AWAA 3IBCA 4DCOA 2XYGA 4PS0A 3PCXA 2C2KA 2J30A 3SIPA 4QTYA 5IC6A 3KJFA 4QUIA 2QL5A 4QU9A 2K7ZA 3GJRA 2FP3A 1RHUA 4N6NA 3DEJA 3H11A
chains in the Genus database with same CATH superfamily
2O1WA 4DSOA 2PWYA 4KI0A 4AB1A 1U2TA 3Q7IA 1WDTA 3P1JA 1FBNA 1XD9A 4XGRA 5J59A 2FEPA 3CPSA 3UHJA 5IAEA 3ZW9A 4MVJF 4XSHA 3U5TA 1N36B 4JN6B 521PA 2WNHA 1EG7A 1WX1A 5JD3A 1S02A 2BIFA 1HG0A 1CNEA 2XGOA 2YL2A 4IIJF 4AJIA 5HTOA 2IYSA 1ZNWA 3CYFA 5HF5A 3UQYS 1ADCA 4IOKA 1KMIY 2CK3D 3W06A 3O6VA 2EBHX 1T36B 1MKYA 1Z06A 2JIMA 3O1IC 5A4JA 1BWQA 5LBUA 4BMSA 3MG9A 1ZI8A 5ALWA 3A36A 1A9XB 1OFUA 2BDTA 2BKLA 3I39X 3PTLA 1UADA 4R05A 3H99A 2V54A 5ESDA 4DKXA 1TVCA 2YIMA 5C5DA 1KQFA 1DNPA 2ZZNA 3E8XA 2IY7A 4UHDA 2WAYA 1R5ZA 1Z0IA 3N8IA 4PC6A 4KQHA 4EB3A 2J3KA 4FILA 1X7DA 4M76B 3K94A 3H2SA 4E5VA 3C6XA 2AOXA 3RU9A 3FTPA 1OLXA 2LV8A 1G41A 1QXSA 4GUAA 2BBSA 1Q21A 2IIQA 4P31A 1IIRA 1WMSA 2O52A 1LDBA 1W1WA 4PYRA 5E9JA 4ENTA 5KOHA 2O5EA 4N01A 5CB4B 4WSOA 4DMGA 3ROMA 3VISA 4G1BA 4EJSA 1BD3A 3GA7A 1SC7A 2G5TA 3P71T 3RFXA 3TWOA 4F04A 4BVLA 2K87A 1RRCA 2YQ4A 2FW6A 4JYMA 1XZJA 1PU2A 3VZSA 1IK6A 2VJBA 4TM8A 2QD2A 2WE8A 3NM4A 4RVCA 5FADA 3WYCA 2GGSA 1OX6A 4D9IA 4C7OB 4LPSA 1ZISA 4ND5A 2CEAA 3UJAA 1QMPA 4RQTA 1Q0RA 3BFVA 3HVUA 1U11A 3Q3JB 3AI1A 4L08A 3H17A 3TIXB 4CM9A 3OQOA 3GFFA 2WM2A 4HJXA 3L4SO 3I53A 1LLDA 3QLUC 3RC7A 5LNK1 4WK2B 1C14A 3V4SA 1I94B 1FIUA 1IZYA 4HQ0A 1KDYA 3WIDA 3L7DA 4OMFG 4CKBB 3PGMA 4QEDA 2R79A 1L8AA 5BSRA 5JVDA 1Z26A 3KAKA 1KO5A 3VC2A 2YMLA 1OLUB 4B6SA 5EIWA 3PGKA 1GL6A 4WECA 1BXGA 5EJ7A 5ERYA 5IULC 1WXIA 1Z2NX 2H4FA 4JVOA 1HDOA 3R6TA 2NZ2A 4JLMA 5A6VA 5BUQA 1ID8A 2I3GA 2WK1A 3DW3X 4YRAA 1HYHA 5I7RA 2NADA 3ND9A 4EGAA 1UPXA 4NYMQ 4F4DA 4ER5A 1RYBA 1T1JA 3E9QA 3KSBC 1W7AA 5D3ZA 1OFHA 4PBRA 3DKKA 1Y9AA 4N48A 1DOZA 1NSYA 4RD6A 1EX9A 4V02A 1GFZA 5FOQA 1NI4A 1WHTA 1X19A 2HHAA 2MMCA 4WK6A 4FPXA 5HR5A 1WD7A 1OYYA 3IERA 3A3PA 3U56A 2J31A 2WVAA 2H1SA 3R7NA 4BAGA 2VJKA 1ND5A 5H68A 1XCGB 4ND8A 1NASA 3MOSA 4ZCQA 4DIFA 4Z4QA 3CLRD 5TVKA 2H1OA 1V11B 9ABPA 3TSWA 3PGVA 1L7XA 1GNRA 2HAEA 4DUPA 5A4FS 1Q14A 2A5FA 2OZLB 2NVOA 1QCZA 4CKEB 1WD5A 2QX6A 1CK4A 1PYDA 4GGOA 2AOVA 1VLLA 2H31A 2ZW9A 3NAMA 3G0HA 2JEZA 3FCSB 1KOLA 4X64B 5CFZA 2JFGA 3VFDA 1Z36A 2AHOA 5BNFA 3MMSA 3ZWXA 2Y1XA 2PX8A 3K0HA 7ADHA 4HYTA 2OV8A 1JKXA 4LXTA 3GQBB 4RZ2A 3KETA 4LZOA 1U3UA 1GZVA 2BEWB 3EPPA 4Q4LA 2X15A 1F9AA 5NULA 1V7PC 5J4YA 3IRVA 4PGGA 3JD3A 1Z15A 2EX4A 3KRTA 2IPXA 3VYVA 4DILA 2QAGB 3ZNOA 3RSZA 2BBWA 2R44A 2AWNA 1M1YB 2RIPA 3EMKA 4EARA 1EQ2A 4O4JA 3ZK9A 1R15A 5G02A 4BCBA 3RIGA 4TZ0A 4KB2A 4GMKA 4X7RA 2CLEB 2HNKA 2PRJA 2ZIEA 2ZTMA 4UREA 4ZOCA 3LPLA 1NJSA 1EVKA 1YR3A 3TR5A 1J23A 2VNIA 3H8VA 1XAIA 4OXRA 4QJ4A 1TIBA 3FSEA 3G6KA 4UTOA 1T4CB 3UCFA 3I62A 1CY8A 4DV4B 1J25A 5CT5A 2ZRBA 5KJ1A 2OBBA 3KL2A 2FW0A 4W7HA 2B36A 4ZIRA 3ZWQA 3L8YA 4XJTA 5C53B 4ZVOA 3WWDA 4EHDA 4MGEA 4W8OA 1GA4A 1HYGA 4I2NA 1OWNA 1QHHA 4II2A 5CB8A 3EQ8A 2BGNA 2HMUA 2AXQA 4K9OA 3ZLTA 3ZCUA 3AU9A 3N2KB 1YTUA 4JP2A 1PR3A 1AS0A 5DTIA 3M70A 2ZBFA 4GU5A 3ON5A 3RFFA 5SICE 5DW3A 2VJLA 2YCBA 2WTXA 3N7TA 1X7YA 4NRDA 2CXRA 1G9SA 3NHKA 4NONA 5FOWA 3QX3A 1P1HA 1I51A 3KBBA 3VSDA 4TMFA 4V03A 1WQ4A 3RUDA 3ZTYA 3ZU3A 1UMKA 4KFUA 1W4BA 1CZNA 1F2TA 3MUOA 5LQSA 2A3NA 3PITA 1MT3A 2OHGA 3PDJA 1PL8A 4G1FA 3DMYA 5IAKA 1BVYF 4JVMA 5M04A 1GNPA 3P0JA 4LX8A 3PIRA 1XZMA 4G84A 3ZLBA 1QG0A 1DQNA 2FA9A 3R5SA 2CYBA 2X3FA 4LHXA 3N75A 1BRMA 2W37A 3PSHA 3N8DA 1NMYA 2HJ9A 2VNHA 3BBLA 1VKRA 3I9NA 4ZCIA 4AJJA 1WB6A 4WCFB 4QOGA 4HT3B 4AZ3B 4KR7A 3KQWA 3BJIC 3ABZA 3ITKA 1K8RA 2PXXA 3UV6A 3AFNA 4OK6A 2AFIE 5E9WA 5CCXA 4PLPA 3KWMA 3ZKWB 4ZZ0A 5BQFA 2GN8A 2C1XA 2V0NA 4X84A 3HXOA 3EVGA 1PV4A 3UAXA 2QU7A 3TSCA 3IAHA 4I9GA 2P2SA 5TJHA 4WZ6A 2AVDA 3ZTWA 2B1JA 1DIRA 3LXMA 1R5OA 5GZ3A 2I87A 3QMMA 1S3GA 2X3UA 1YKGA 2P27A 2OWDA 2PIAA 3JQ9C 1I6LA 3LDGA 2ID7A 4H7IA 4Y7DA 1E2MA 2NW6A 1N34B 3U9LA 3ROQA 4ZD6A 3PVSA 3Q8XB 1ADFA 3GLFB 4JJEA 3PUYA 1FK8A 3H4IA 1JEOA 1W47A 4KWCA 4PLGA 3VTZA 3PLAE 1QG6A 3KFLA 1RTTA 1YIDA 2J30A 2Z9CA 4G5RA 2P0YA 5DMHA 1GILA 4EG1A 4EPXA 4B47A 3PVCA 1L5WA 2ACEA 3FBWA 3O8OB 3IAFA 1NY6A 3K6JA 4J16C 4JB3A 2O7VA 4M1TA 4P81A 4PONA 4EW6A 4ENSA 1QRSA 3OPXA 2P6MA 3EIWA 4E31A 3W3AD 2GR9A 4C07A 1NJ1A 1BE0A 2YV1A 5KNBA 4H08A 4J7XA 4FB5A 3WIVA 4MGHA 1NUHA 2FGKA 1XWFA 4TKVA 4ZI7A 4ZYVA 2AN5A 3VPFA 4Z9YA 1YB1A 4RVUA 5AOCA 5A4MS 4Y1EA 1GCIA 5I7WA 1G8KA 4E33A 3MQ2A 2RGEA 4JITA 5FBZA 4EB0A 2V9PA 1WTCA 1UANA 2CL6X 2UXCB 4HFNA 2VBFA 3HBJA 1EWYA 3CT4A 4FR5A 5G4KB 4FFVA 2PVSA 1NF2A 3GVHA 1QHYA 2OAQ1 3V8PA 4MR8A 3TB6A 1RMQA 4DMCA 4YRMA 4AC9A 2B7CA 4HMPA 4X3OA 3VPBA 3WNZA 1L4FA 2XOKD 3DHWC 1VFNA 3PKJA 5TQ0A 2V9ZA 1GDTA 3AM5A 2JAWA 4IJKA 5JMTA 5JJKA 3G9QA 1NGSA 1SXJC 4R8RA 4V0ME 2NVWA 4KHPB 3JSAA 3ELBA 4JLWA 1BFKA 4J90A 5FWXA 1JAXA 2GBPA 3PXXA 4HX5A 3T4UA 2IYXA 1E5QA 4K8RB 4RH3A 1ORWA 3H1GA 3PD0A 2B1IA 2A78A 5LCXA 1TWHA 4W9NA 3WYBA 4M9CA 3VO9A 1J8DA 2XUJA 1C8VB 2ARKA 1Q0SA 2X9NA 4UCQA 5CXUA 1UBUS 4ESHA 2AYZA 3AEZA 2AZXA 4GD3Q 3WKDA 3WGNA 3FMFA 4JYCA 3EGVA 1J7JA 4X54A 1UKEA 2C61A 2O50A 4U2KA 3O9ZA 3VU0A 4C4RA 4N47A 1DCFA 4IR7A 4WJZA 2C2ZA 3OQ6A 5GV8A 3HN6A 4E32A 2RI0A 4HF7A 3UV3A 1WG8A 4HXFB 4EITA 1EFPB 3IR6A 4LQCA 5E4YA 3L7MA 3DTTA 2A6ED 2QX4A 4G56A 4I50A 4D8UA 2VTKA 3KJGA 5DHRA 4DJEC 2P69A 1JTVA 5E2BA 3O7WA 4Z4HA 2HF9A 2QD3A 3KYDB 3O92A 2WU0A 3MWGA 3MS4A 4Q9DA 4S04A 3AF3A 4MKIA 3S1AA 1JEYB 1WY7A 2QTTA 2YINC 1E5XA 4JY7A 1K68A 1H8EA 2ZP1A 3AGPA 3EQ6A 2CDBA 1RWNA 5JRZA 1UIRA 5F7OA 1X3SA 2BF7A 1JFVA 4KGZA 1CZOA 4QDUA 1GNTA 1XOIA 1SURA 2ZREA 4EW2A 3HC7A 4N03A 3OCVA 3RLFA 2VOEA 1ULZA 3VR5H 2GZSA 3QPVA 2JH3A 2A1UB 1T3GA 5LOVB 4R41A 2OHJA 2ZYVX 3OUTA 4WBNB 6GPBA 3C39A 1E79D 2ONYA 2YFHA 3L40A 1QFMA 3KOWA 1Y1PA 3ZWAA 4F3RA 4ZYTA 2XCSB 1PHRA 1YJQA 2HRZA 3GFVA 3U7HB 3K1AA 3AFGA 4EMBA 1DMRA 2ACWA 4H6PA 4URYR 1R9NA 3N74A 3WX0A 2CLSA 1PJLA 2EEZA 2L42A 1Z6TA 3CEJA 1UKYA 3IAS6 4DCNA 3FAZA 2RHGB 3A3YA 3V46A 1Z29A 3OJWA 1N57A 3CN9A 3HKDB 1IY0A 1UBHS 2GFQA 3S44A 3L7LA 4MARA 4NX2A 3RRBA 5HEKA 3HYLA 3W34A 4O2BF 3ZU6A 1X80B 1Q5PA 4A8PA 4DNOA 4BNWA 1RKXA 4YT4A 3TZKA 3U44B 4NZ9A 4ZAFA 5K51A 5A0TA 2C5EA 4Y2QA 2G70A 3K6RA 1I2AA 3WV4A 1PVVA 1QTNA 1CUUA 1YS7A 1AJEA 4TRRA 4QNNA 1C4OA 4ILEA 3RRZA 4V0QA 4F45A 3WLTA 3O8RA 3M4YA 5HCNA 5IWAB 1Q3TA 2IYTA 4GPAA 2GVZC 3PF8A 2WWIA 1JBKA 2Z1NA 3NM6B 4RD3A 4RK7A 2G0TA 4CLRA 1ZAYA 2WYVA 3OEHA 2A68D 3CGWA 3KWJA 4TOIA 4ZQGA 3WB0A 1DBPA 3B2NA 4BE7B 3G6WA 3FWNA 4J9VA 4B80A 4J1NA 1W0KD 1N7HA 4YCBA 1SHTX 5FWDA 2Z5GA 3ZHTA 4HVAA 3ML1A 2WAQA 3M4AA 1I7NA 1U3GA 3B6MA 2WJYA 4XARA 3C1TA 2HH9A 2QYOA 2R47A 3LP8A 4IHJA 4Y2TA 3VZDA 4EKIA 2XZTA 3A6DA 3MIIA 1QV7A 3N07A 5J40A 2EEPA 5JALA 1RYEA 2CJYA 2QVCA 1IHDA 2FWIA 4EGFA 2NWQA 4RA6B 3LUKA 4FJ0A 5G41A 5TJ9A 4BQEA 4ZICA 3F8WA 4OB7A 1IG3A 3P0HA 4A8JA 5CLGA 4CDNA 3K1ZA 3CB2A 5HKBA 1QIMA 1W36D 1RWOA 3A4NA 3PS9A 3BA6A 3LK6A 4U2EA 1CJUC 1ODIA 3AKYA 4HO1X 1CEYA 1Q20A 3H2YA 4OPMA 3CLTD 4IJ6A 3WBKA 3AVTA 4B3JA 1JDPA 3TUIC 2G7ZA 2WHEA 3CNLA 2JJ1A 2NQ2C 3U17A 1O1YA 4CV1A 5K0EA 1KR5A 3MJTA 1SZJG 1RR8C 1TF2A 3P9QA 3SF0A 4ZCMA 3SQXA 2B63A 3DWGA 3IRUA 2BGKA 4ER0A 3UJBA 4WBSA 2QZZA 1W5AA 3BWDD 3ZUPA 2ZM5A 3COZA 2ZSHA 2R7NA 3BD7A 3EAQA 4DGQA 4YJ3F 2IYUA 1Q7TA 3Q3VA 2D1SA 4TZKA 2AUMA 1QC5B 4EX6A 3HWWA 4IVQA 3OQIA 4X94A 3ZHVA 3I9KA 3BGDA 2AMFA 3LCMA 1IVSA 4MEAA 5K99A 1E7YA 4IKEA 4N5NA 5F3RA 2XMZA 3IEPA 1B43A 5HZKA 1ZINA 1QE0A 4HN9A 4BVGA 3HCWA 4EG3A 1HDYA 2E2WA 1JR3E 2IEYA 1U2ZA 5A1JA 1UP4A 3TH5A 1JA1A 5TMEA 3B1FA 2FWRA 2IEIA 4XKJA 4XWWA 2CNDA 2QGNA 4PPFA 2ZSJA 4NYIR 1TZMA 1G7TA 2HXGA 1VXRA 2X5NA 1EA5A 1WW3A 3OX1A 4EFMA 3O95A 5KYTA 5LN1A 4WQMA 3N2EA 2Q5QA 3TCNA 3V8RA 4W5RA 3QITA 1S8FA 4DLYA 1DD5A 3B1KA 3H11A 4YV7A 2VP2A 2VC2B 1V6SA 4M0PA 1SM4A 4MVJM 1L1RA 5ALZA 3CPEA 2E4UA 1PGQA 1VPDA 4YI3A 4M1ZA 3IALA 3K70C 3OAAD 3EXG2 1C1YA 1NUPA 1CQZA 1CUDA 3OPQA 2PWZA 1T34A 3QVOA 3AL3A 4A0QA 1DRUA 1IFXA 3JQRA 3I5UA 3THSA 1BHSA 4AY3A 2XECA 3LUHA 3PFNA 5EMHA 4BFUA 1L7DA 4KYUA 2RBKA 2Z0MA 3UHPA 2HQRA 2JH9A 1G3RA 2A3RA 3M81A 1T0IA 3RSQA 2ZB8A 1NLYA 5J5CA 3BG5A 2PNJA 1YD7A 2HCFA 1A9ZA 4FFBA 4HG2A 2ATVA 2Q1UA 2IP1A 4MPDA 3P9ZA 4IEFB 1BYIA 3C7KA 4N0EA 4CIVA 1YJ8A 1G4AE 1T8SA 2BCGY 4S1VA 1BFDA 1BAPA 1KAGA 3COSA 3EIXA 4BCCA 1ZW1A 1UZMA 2ZRCA 3C5CA 4LVOA 2RGUA 4L5YA 4FOPA 3VH2A 1U3WA 1U28A 3GJ6A 5CAEA 4BVEA 5ALHA 3PHJA 1M2OB 3UG7A 3W6NA 3HACA 1KI1A 5BW6B 4RHFA 1XLWA 1VL0A 5IN4A 4I8IA 2XZLA 2BFBA 1CS0A 1BNCA 5FNVA 5BMVA 1ISIA 2VWQA 4XLLA 4V0RA 4DQLA 3I2FA 2GN4A 2XHZA 1LWNA 2Q0SA 1FFSA 4FSHA 1OPXA 1Y6ZA 3KEGA 2P79A 3CEHA 3KL4A 4JFAA 3H2ZA 4M89A 5UKDA 1RD4A 3JASB 5KVVA 1SB8A 2JIQA 3SR4A 3GLIE 2H5EA 1ZESA 1SVLA 1JMKC 5FAKA 4UTNA 2J6BA 4M0UA 3PC6A 3ZJ5A 1YVPA 2DWCA 1X1SA 3NWBA 5P8WA 1N0WA 2O2YA 4L8GA 4MVJA 2DBQA 5TARA 2RKOA 1RXUA 2VQ3A 3NTLA 4MQ4A 2FPPA 4ETWA 4HB3A 4MB2A 5DLQC 3MAJA 4JBNA 4AD8A 5CB4F 4IIJA 1SKUA 4JAVC 2BONA 2VKQA 3MUNA 5HE9A 2PXHA 1J2TA 1TLFA 2OHFA 2PUHA 2RAFA 3I9JA 9GPBA 3E03A 4MS1A 2CV1A 1PJ3A 2CNNA 3MGGA 1RT9A 1B8OA 1VI5A 4ZO7A 5FTJA 4BN5A 3T12A 1EFRD 1HH4A 4CLOB 5K2OA 5IJ0B 1M5TA 4G8JA 3SDZA 1TW3A 1GPKA 3TQSA 4F5DA 1ANKA 4RMNA 3PLNA 2Y71A 2I76A 4G65A 1IM8A 1GFWA 1Q95A 2I7XA 3M6LA 4LYJA 2JIPA 5EN4A 2FHSA 5LBTA 5KDDA 3NHBA 2VNJA 4XM2A 2C2XA 4ZT3A 1ZFNA 2EKZA 3H5WA 1VSVA 2ZSAA 3OIWA 2PZAA 1PNVA 2NU9B 1B41A 1V95A 2VNAA 5IDXA 2OXTA 1V2GA 4QT4A 4PSUA 2EIXA 3WI7A 3R7WA 2O0LA 2OCDA 2RH4A 1IPHA 4H59A 2N46A 2QMUA 3CHYA 3CXUA 3ICCA 4JX8A 4L7VA 4C3UA 3X0DA 1L2TA 4L73A 1WCV1 1P1BA 3T4PA 5JIBA 1B0ZA 3QPBA 2JFFA 1OGIA 1XKXA 1NUQA 5HDBB 2GAJA 1N6OA 4WNAB 2G77B 1R16A 4R1NA 3JQDA 4QUAA 1PQUA 2XD4A 4H4DA 4ICIA 4FMBB 5F7JA 3NDIA 4N8EA 3BICA 2QZSA 2UZ0A 2FEWB 4HQOA 1MR3F 1WEHA 4FFSA 4RF5A 4A91A 3HS3A 3DOCA 1W35A 2VDMB 1DZIA 1RCTE 4UASA 4ONEA 4MRSA 4M4SA 3JPWA 4MQFA 1JIUA 2QV0A 2PYZA 2R86A 4YBRA 1VPEA 2WMYA 4HDCA 4IICA 3FNEA 3TOVA 3ZX4A 4AFNA 4ZGWA 1ENZA 4DQUA 3KUCA 3HUDA 4G36A 2FP4B 2IYZA 4NV0A 1ZNZA 1AA6A 2Z08A 5I3ZA 5DPMA 2RH8A 4GPBA 2IUUA 5IX8A 2EJBA 3KQYA 2A5JA 5BOSB 3E7DA 5HIJA 5IJZA 2PY6A 3UHAA 5U4QA 4NBKA 5B1IA 5EGSA 4YS6A 3SSNA 2QJOA 2AN1A 5DF1A 4BXOA 3FUWA 2XCTB 2J0QA 1ZMOA 1N2IA 4HZUA 3MOIA 1UXJA 2FN8A 4MGZR 1ZVKA 2NXWA 4CQJA 4EKYA 5ENVA 4EIWA 4BFVA 2OV1A 4IMIB 2PSDA 4DANA 3W5BA 4RZ3A 1D2MA 4PFKA 1C8LA 1NZJA 1Z47A 2YYSA 1NKSA 3QPUA 2C8JA 4JXKA 4M99A 4YQEA 1G16A 1Y6JA 4DRXA 4YMIA 1E77A 4JODA 1LW6E 1MAHA 3EC1A 3FCYA 4GC5A 4JXJA 5FLKA 3D7LA 3G0CA 3WMEA 1B26A 4P2BA 4YP0A 2ADOA 1EK1A 5B6JA 3IAM1 4XUDA 5DBIA 5IT9A 1LNZA 3K5NA 2EKQA 4MO2A 4UDYX 5TB5A 3EXFA 3KIPA 3N2YA 2GS9A 3S29A 3VR5A 1VKHA 4D79A 2A5YB 2F3PA 2JJYA 2NYAA 4ENWA 2XB9A 1MQSA 3OH8A 3U49A 4X62B 2QRHA 3C98A 5FR2A 3RVDA 1G18A 4I4TB 4BJ1A 4MDEA 3FOCA 4EO4A 1GCGA 2OQ2A 5LQRA 1C0LA 2AFIB 1NJFA 1JU3A 2XUHA 2HDNB 2QN6A 1BCSA 3JZAA 1SXQA 4DM4A 3GP3A 2PKYX 2LCQA 4QL3A 5EXTA 3O3NB 1NRXA 2P41A 4Z86A 1U7XA 3H19A 4JJ6A 4X0EA 5CURA 4EUNA 2Y0SA 1UT8A 1LK7A 3CZCA 5DZSA 2COUA 3HY3A 1TT5B 1LBTA 2WE7A 1GG2A 5EAIA 2V0CA 5LLSA 2JFUA 4AXXA 5C1DA 1X8KA 2ZRHA 3KR2A 1J24A 5D7NA 3ZE7A 2NUTA 5TPWB 4Z1OA 1E3SA 3HP1A 3M0EA 1M8KA 4HSGA 4QWWA 4F5ZA 2AOTB 1R8SA 2VPXA 4IP0A 3SIXA 2FFJA 3PZBA 2P11A 1W5TA 4CHTA 3PC4A 2MYUA 3T99A 1DJPA 4UULA 1I5EA 3JARB 4ND4A 2Q2VA 2CDCA 4JT9A 1ESNA 2TECE 2J4CA 5J4HA 1U9YA 3O3MB 4Q24A 4YP1A 3DGFC 1BYUA 1Z82A 5ILOA 1E2LA 1G7RA 3UKDA 5CVUA 1QHSA 3BF7A 3UJCA 3AVOA 3KHTA 2C0QA 1NTRA 4G0MA 2C5GA 1YZUA 2R7AA 2ZJ5A 4N7BA 4XWKA 5JRJA 1E3QA 2DTEA 1C7QA 3GTGA 1M0TA 2FSHA 2P67A 3FFXA 4XDGA 3NP9A 3HBLA 4X85A 4Y9DA 1RKUA 3AVUA 1KIMA 3B20A 3C3YA 1FP4A 2P35A 3VZCA 3P5BA 1IBKB 1JN0A 5AK0A 4ND6A 4YAIA 1RXYA 3MJCA 3Q40A 3QOWA 4P82A 3ILSA 3AOGA 3GR6A 3T0FA 4HV4A 3PC3A 3L3BA 2GEBA 2QVYX 2QIOA 1VKNA 3PGLA 1Z0ZA 2ZVPX 1O94D 1W96A 1X7XB 4J0CA 1ZBDA 2WILA 3BXXA 4TSKA 3DLCA 5BPFA 3LTEA 4EJ3A 3NM5A 3QFRA 1JSLA 5BNZA 4I1OA 4P35A 1LX7A 2QZ9A 4GIBA 1KO8A 1ENPA 2NQ8A 5EP3A 3GUCA 2V8BA 4H0NA 3HU2A 1JDTA 4CQMB 3F6YA 3ICVA 1NBMD 4KVAA 3UM9A 4C6TB 1U2DA 2PJUA 5C18A 3NYIA 1OQAA 1HE3A 1SXJD 1PFQA 3WGTA 1JPUA 3PGJA 1ZXXA 4X8MA 1F8YA 3O9MA 2O0MA 1JA9A 3KOZA 1RAEA 4J2TA 3PEVA 3CPHA 2R6JA 1SCQA 1MBZA 5EHNA 4KDFA 2J9ZB 2B98A 3KDAA 2XITA 3OFVA 4BMDA 4D8XA 1DRKA 4I3HA 4EECA 1GZHB 3OKCA 1T13A 2IFTA 1Z7BA 4DIOA 1VIMA 4KP7A 4E07A 5CDGA 2AKYA 2HI0A 5F2EA 1NZDA 1YBFA 2B9VA 1C2YA 1XAJA 2C8VA 3DOUA 3MT8A 2HCBA 3Q0TA 4FNOA 5LA6B 5HKKA 5ADVA 2RGXA 4E2XA 4IDPA 4LCJA 1ZUNA 1AURA 1LZLA 1WLSA 3VC7A 1LB1B 3NT5A 2F1IA 1XTSA 3FOAA 1P4JA 2Z6VA 2QW1A 3HL0A 5HW0A 2PUEA 3O8QB 5BSMA 1Z2EA 4LHWA 2Q9UA 2AE1A 1KI6B 1VC2A 2CYCA 1MC8A 1B3RA 1XQ6A 2FY8A 3C5HA 3CW8X 3DNPA 4G4GA 4QXRA 4IFTA 1ZITA 5BN4A 3SYNA 1MOPA 2I80A 1E8DA 3VZQA 4EAAA 1ESMA 5K3FA 2BSAA 2ZYUX 3DBLB 1DOAA 1WJGA 3JQ6A 1H22A 3QU9A 1K8YB 4OQZA 4UCXA 4M54A 1IUKA 3GA5A 3QFSA 1FQJA 4G0ZA 4QVIA 4OB8A 3UT0A 1RRVA 1S2NA 3IH5A 3PNQA 4EEKA 1OC4A 2J0UB 1KDTA 2UZ1A 1GADO 2FPRA 2FRVA 1F4PA 5JBNA 2EXXA 1K6JA 4NENA 2ERCA 5DEIA 5C4GB 4MW9A 3IVMA 4M0DA 3KVNA 3VVLA 1RWBA 1X1AA 2E4VA 1SB9A 2X5JO 2XHEA 1U0GA 3IODA 5FPHA 3ZGNA 5IJAA 3THRA 1XZHA 1VHTA 4X1OA 1O0CA 4P3NA 1BKDR 3UC5A 1XN1A 2NO7A 4F1WA 2XYQA 4W5JA 1K7YA 2F1OA 4CTKA 5J4KA 3ZGLA 4HNSA 2OC4A 5A4KA 3ED5A 2PK3A 1P0PA 5C1IA 4JKIA 5FA6A 5BMOA 2FR8A 2ZB3A 3E70C 2YTZA 3PFCA 4L4YA 2BGRA 2OV2A 1SIBE 3DZHA 3I1IA 4JEUA 4K86A 1WMBA 5BV1A 2HK7A 2HSJA 1K1EA 4KXXA 1X7WA 2HRBA 1ZMXA 1IUNA 3AWIA 4FNMA 4J1SA 1C8BA 3SKVA 4CLXA 3A4VA 2IEDA 1VGVA 4ZHQF 3KQLA 2B2XA 1GO2A 1TAHA 5D2CA 5IJ9A 1G5QA 2PV0A 2ZDQA 3LPNA 1M6WA 2I4LA 2WPDD 4RK1A 2B4QA 4ZAGA 2H2IA 4IGIA 3EEIA 4FGLA 2CBZA 4B4UA 2XUDA 2DQSA 4GP9A 1H05A 4QFMA 4M22A 3E3NA 2WP0A 4UTXA 3LBIA 3UAGA 4DUGD 4NVRA 4XIJA 1VZ3A 2XT9A 3N8NA 1IJBA 3V8VA 1T2AA 1AXRA 4BE9A 4O63O 4PZPA 4RA9A 4N7JA 4IDAA 4PBSA 4BZZA 1Y9ZA 2YVUA 4H4EA 4UOEA 3DF7A 2XIJA 3FTEA 1C1DB 4HGOA 4R7ZA 5SY9A 1P4SA 1NVMB 4QNRA 4CG1A 2P7HA 2ZUVA 3UB2A 2BI7A 2YBEA 3GG9A 3UQZA 5G53C 4AJPA 2Q5FA 4HCJA 4JR2A 4BBZA 5J47A 3K0SA 5GJBA 2IOFA 3AHDA 4S05A 1CBUA 1OLSA 1WOMA 2FUKA 4JJAA 1ZVMA 4JP8A 4KQJA 4MS4B 4UXJA 4WBNF 3NVAA 2R6DA 2XNKA 1M7GA 2FOIA 3F3YA 2JFNA 1OXTA 3AUFA 3K9CA 1WXXA 2R9VA 3TFWA 4F84A 5T57A 2J9FA 2N42A 3NNDA 2E6KA 3UMFA 1DO0A 4KIFA 2RHRA 4B9EA 3T15A 4AK9A 1ORVA 3B7PA 3CZPA 2OORA 2O2CA 4H7KA 1KGSA 1S89A 3I9OA 1UJMA 4OL0A 3OZWA 4GUDA 4A0FA 1X1CA 5DHQA 1P0CA 2PMBA 3WLIA 3EA5A 2CHGA 1SO8A 4OHBA 1Z33A 2ON6A 4GSYA 3T3PB 3UWKA 3D8SA 4G26A 2IVZA 3LFUA 1FU4A 3MSXA 1V0JA 4REQB 5K01A 4J0KA 4WADA 2J41A 4K0RA 1GU7A 1D4AA 4FCWA 1HOTA 1PEDA 1ZK1A 2PEZA 3STXA 3A9CA 4BO5A 3WY9A 4F5WA 3H1TA 3NONA 3UMBA 3SPXA 5K4GA 2AH5A 4FOLA 3NO4A 1OFUX 4TRNA 4QPZA 4TN1A 4L15A 4LHZA 1COZA 1QTRA 3IBSA 5CEFA 4JI0B 4D4GA 1V7QA 4O4IB 3GDWA 1NV9A 3M5CA 2BF4A 3W5AA 1VLJA 1BDHA 1EVJA 2A0YA 3R23A 3P9YA 5TPZA 1NLFA 2YS7A 2BGIA 4PZLA 2H48A 2BHLA 2SICE 3D7KA 1POXA 2XUPA 5F73A 3PK0A 1Y8AA 3UWDA 3T3IA 4J9UE 3K8OE 1VB3A 4O2BA 4PSVA 3TO5A 2GUWA 2Z4RA 3D43A 3AR6A 3I61A 3DE0X 3GTQA 1E3EA 3A3KA 1XNQB 2OBYA 2H5LA 3DEYX 2ANBA 4TPKA 4FU0A 2JPDA 1KHHA 1GPJA 4WOJA 3D6NB 1R0RE 2G88A 2RCNA 4RXTA 3E9EA 3LX8A 3GEEA 4MUHA 5K45A 3ZGZA 1QONA 1B23P 1M1NA 5F76A 1E1CB 2P77A 4GMFA 1IH8A 2HPHA 4OO3A 1S5PA 1XTJA 4B35A 5JHHB 1KMMA 4G0VA 1JQDA 2RBEA 4RLHA 3L92A 1OU0A 1PR0A 3I1YA 1UFKA 2HJRA 3NU1A 4WK0B 4LYFA 1MC1A 5CDTA 5AI9A 5IMSA 3PQEA 3HJTA 1YR6A 4Q1BA 3I9MA 3A1CA 4RCVA 4RYLA 3I5YA 2H4XA 3DQPA 4H7HA 2FR0A 1RI4A 3V7NA 4I36A 3HKZA 1YQGA 1W0JA 3NVKI 2WYUA 3LHIA 5IDWA 1OAAA 1DPGA 3L7JA 3SSAA 3U7FB 4UCFA 3ZJTA 1CDOA 4ZEWA 3K70D 2Q3HA 1WF6A 3ZHOA 4LGMA 3OQBA 4QCLA 3NC0C 3AEQB 1JE1A 1GPMA 2IYNA 2CD7A 3AHFA 1K89A 4DB2A 1Z56C 1GD1O 4PXAA 4D3YA 3BOSA 4RDCA 4R8LA 2O14A 1Q7CA 2X58A 3WGOA 1Z8DA 4BRUA 1ULBA 1NPYA 1WUTA 1KFEB 5JJBA 5CA0B 1AHHA 4KW7A 4R9NA 2W2KB 3TPCA 4FZ3A 2C82A 2GPBA 4RGYA 4JNCA 2NLOA 4B74A 2HHHB 2QQ0A 1TYCA 2G83A 3QYFA 4I6GA 3ROPA 3UCXA 2C2WA 2FZKA 2WHQA 1SKBA 3EVDA 3G2PA 1A5ZA 1F9EA 1U2PA 1PHPA 1XP8A 2ISSD 2YJ3A 3P26A 4GG1A 1TUBA 1XROA 1D1PA 3AX6A 3G2OA 3GZNB 3NTQA 4HB0A 5FHRA 5IJXA 1PO7A 4RZIA 1JQEA 4KRYA 1LRJA 3HCCA 2IOQA 2HA2A 5KYXB 3NBYC 5CVVA 4RE6A 2F3UA 1AIPA 3MTJA 1NNLA 4XVQA 1X9HA 2H54A 1XVUA 3GELA 4MYHA 3A9SA 4MA5A 7REQB 3IOEA 1Z22A 2FMUA 1BU8A 4KWIA 2C95A 1WUJS 3GAMA 1WEKA 2MR6A 4F2GA 1YI1A 5LQKA 1M8GA 3H42B 2E4XA 3MPOA 1GXSB 1DLIA 1NYLA 2GM4A 1U0JA 2X0IA 2OAP1 1SU4A 3VOAA 3IUJA 1P3DA 3F6CA 5F9MA 2VPZA 4M88A 1T6YA 1CUSA 3SC4A 2R1UA 2VO1A 1YVRA 5GONF 2HF7A 3HMQA 2QLBA 3EEOA 3EPJA 1JIJA 4RJJA 3FPJA 3KSDO 3B5IA 3IGFA 3IKJA 2POCA 3MUEA 1UBCA 1XZGA 3EUEA 4L95C 5KYKA 3T35A 5LYYA 1U2GA 1XEWY 1IM5A 3VJLA 1TMOA 4QTZA 3LF2A 5EHGA 3ENKA 1TPYA 1YDWA 1Z3IX 2ZVDA 3A6KA 2YJGA 4G9GA 2VUUA 1L3BA 3I76A 2J32A 3WLHA 4FBLA 2WU8A 1JS1X 3WK6A 3OUZA 4CMKA 4PSAA 4Q4JB 5FJIA 3OHPA 4RFSB 5HKOA 2ZWAA 1ISSA 1G2PA 3FXAA 4EHJA 3GI1A 3ULKA 4LX0A 4NDAA 1U31A 5IVHA 3LC7O 3QBEA 4OK5A 3K6SA 1ISPA 2CFSA 2W6CX 3KUDA 3G2JA 3S1LA 2XKJE 2V5UA 1G5FA 1QQ6A 1MRZA 3ROEA 4F8JA 4KN5A 1E64A 5DIZA 2VLBA 1N6HA 1GU0A 1R2QA 3EGIA 3EGDB 3EXHA 3HSKA 4A2CA 1QO9A 3MVEA 3DO8A 1NN3A 2VNSA 3H8SA 2ZGVA 4NPHA 4D57A 3D0QA 5I9NA 2MOKA 4RHUA 3REGA 1DCTA 1SIOA 2BGMA 4JBHA 1DC5A 4E3ZA 1Z5OA 4AP6A 2A9RA 1SCDA 4X1IB 5FQNA 3S2ZA 3ZDZB 4MV3A 1BDBA 4OYHA 3BN3A 4TXNA 1QBGA 1RADA 2WNSA 3U9SA 4OJQA 5CFMA 1XZAA 1BE1A 3T7EA 3MB8A 4QM7A 1BS1A 4M6WB 4LYEA 3WJ1A 3PU6A 4DL9A 3CNNA 2CUZA 2FUG6 4LQ4A 5BQOA 4UFPA 5J58A 2WC1A 3IEVA 1P3Y1 1W29A 1DAHA 3I34X 3SE7A 4F4FA 1E7SA 3ROXA 4WVFA 3M6XA 3FA2A 3HRKA 4IMJB 2Y1KA 4DWOA 4Y9RA 4D7AA 4IDFA 1T24A 3F1KA 1Z4LA 2A4KA 4AZTA 1Q1AA 2FHPA 2XLCA 3A37A 5I01A 4RTJA 3JTMA 1ZJ5A 5FUYA 1RWQA 1E96A 3WYAA 2HLNA 4G8DA 4KLZA 4UDOA 1XLTA 4YJHA 3VHQA 2F3TA 2R751 1HZJA 3JD0A 2RONA 3KWLA 1BIFA 3AP1A 1N0VC 1UH5A 5FPTA 1VG9B 3E7XA 3H7AA 5F2NA 3T9BA 1KEEB 4K9PA 4PZAA 2HQBA 4ER3A 3I45A 5B1YA 3EZLA 2ZXUA 2XXAB 3D5QA 3GLGA 2JJ2D 2OCXA 4R2JA 4C0WA 4RNCA 1NQVA 3NJ8A 4FLMA 4L27A 5IAGA 4EWLA 3EXIB 5K3SA 2BJVA 3HDHA 3QE2A 4PR0A 4MV6A 4XIFA 4C0QC 1F2VA 5A71A 3SYMA 5KEIA 4ZVNA 3TX6A 5A7FA 1E6CA 3NNSA 1E32A 1KSJA 3T7SA 4EYOA 4C7OA 2X19A 1KJWA 3DAPA 3GVCA 2RGYA 2FW9A 4YEDA 3VYSB 3C3JA 3K0AB 1JDBC 3PUKA 3TGWA 1SCNE 4Z8YA 5JS6A 2G67A 4BLRA 2WWVD 3M6VA 2AI3A 3FHLA 1A50B 5DHPA 4ZAVA 5AW4A 2I9PA 1KC3A 1TMKA 3KLPX 5CHYA 3HZHA 3K0CC 5HMLA 1CQPA 3R20A 2XUKA 3EEBA 1Z0UA 3BWEA 3GZJA 4R2KA 1Q7BA 5IT0A 2O54A 3AERA 4UAUA 2HLDD 5H7XA 4K9DA 4FR0A 3QKSA 2VCEA 1HORA 1TT7A 3MBOA 1A4IA 1KDPA 1K08A 1YJXA 1ZCZA 1OLUA 3K96A 4HWRA 4NEQA 1ID1A 2IJGX 1GPBA 4IH4A 2HA4A 4CNBA 1SHJA 2D2EA 2FPLA 2G82A 2GCOA 1TIPA 5FB3A 1KJZA 3TSOA 2HA6A 1OIVA 1YI8A 5JZBA 1M7BA 1GUFA 2RFLA 4QQFA 2TMDA 4P0QB 4ZQHA 4RTPA 2IHUA 1CUHA 1N77A 4INPA 2W5UA 1F8GA 1GITA 2PX0A 1Q77A 1XRNA 5IKPA 3CVYA 4OHYA 5AKEA 2C0CA 5DO9A 1LXCA 1GL7A 1V1MA 1U4SA 3SLGA 3TM5A 1SQ5A 1CUAA 1QH1B 5KTRA 1X7GA 2DPXA 3GMDA 3MHPA 5FPKA 1E5LA 1V25A 4Q03A 3RC3A 3C3BA 3GLRA 4B7XA 2QL9A 4HP8A 4PHTA 3I1FA 2OXEA 4DZZA 1KU6A 3EVBA 2ZIXB 4M7WA 4MP8A 2ADFA 1Y8RB 2GQ0A 4D4JA 4Y9TA 4WK4B 4PX5A 1QVZA 3EYWA 4LDNA 1XZFA 1DTEA 3IEMA 4K2AA 1O58A 3TTXA 4Y2XA 3JYLA 1DKRA 1GLVA 4G1MB 4HXEB 4EK9A 5JCJD 4MKHA 3OLXA 5A05A 3U4QA 4GOKA 3NIDB 4TT8A 4I4TF 2QMHA 3IDZA 2EC5A 3L04A 2CZGA 4K40A 3WDKA 3STTA 3DDCA 2HFKA 5ICMA 2D1TA 3QXXA 1XZQA 4FYXA 2Q49A 1Z45A 3KXDA 4HGPA 5AOAA 3UJ6A 3W90A 3GQBA 7MHTA 3RVKA 1I7QB 1KVQA 4CKXA 1JA0A 4QTYA 5JSYA 1N4AA 3G59A 4FWTA 1UXIA 1Z8NA 4E14A 1V3UA 1D09A 4QFCA 5JAOA 4RADA 3EC7A 4DC9A 4FEEA 4Z0HO 3HQ4O 5ALMA 4YONB 4QJBA 3K4HA 4W4TA 3T5AA 4LF7B 1P29A 1U1DA 2WZQA 3RQIA 3U61B 2YMMA 1KS2A 2C5SA 3DD5A 3V3KA 3UOWA 2WUVA 1CRPA 1DWPA 3R41A 4L76A 3ASVA 2HCTA 4YRLA 1QTQA 3N0RA 1O9BA 5JNUA 1L5FA 3PNPA 4CF6A 4MQBA 3GUUA 3R9KA 1SGWA 2HIHA 1VDZA 4E5MA 3ZXXA 1XMJA 2ZU6A 5DYWA 3I4CA 1T4CA 4XYBA 3SQLA 1J1UA 3UUWA 4UD6A 2DXIA 4M0KA 4ZO9A 3K5WA 1XQVA 5AK6A 3ZWBA 3VNUA 3BRSA 2REQA 4GZ6A 1UFVA 2GM5A 2ZIGA 5F5XA 1M8PA 2C7VA 1TTPB 2XB6A 4EGQA 1AGXA 2EZ9A 4QG3A 5I47A 3JAMA 2AX4A 3JU3A 4CG0A 1ORIA 1XTZA 5LMZA 3BDAA 2WFLA 1Y48E 1XRRA 4HDAA 1NW4A 4Z53A 2WQ7A 3E5NA 3PDWA 4BO4A 1PJQA 4AKEA 4CPDA 2BMFA 3AJ8A 2GCPA 2B7BA 5CW1A 4J94A 4R3UC 3AL2A 5I7OA 5JJCA 3ZGOA 7AT1A 2AMVA 5EKUA 4MRPA 4GPIB 1SY7A 2IXDA 2I2BA 3T0IA 1DFGA 3EULA 1RDFA 2ZSBA 2EIHA 4CRWB 1N3BA 2PWAA 4WNYA 3GB9A 1RJGA 1WXDA 2CNWD 1XTKA 4RDIA 2PJRA 2FZVA 2IOYA 4NICA 4BMZA 1NBEA 3TKAA 1E7WA 3ZHQA 3GIWA 1JEQB 1I3CA 1SA0B 4B44A 3PZRA 1GFSA 1OXXK 1PT5A 4WCFA 1SBTA 3WFJA 1CEEA 4AZ3A 3FBTA 1JHYA 2HUPA 1PTJA 3DJYA 4GZ5A 3O4VA 4QOHA 1K6MA 3WSWA 4ZGGA 3JVUA 5IH7A 2CJPA 3UBTA 3LBFA 4RPJA 4RGBA 8GPBA 4GE3A 4BRZA 3T1NA 4JLBA 3EPHA 1U2RA 4RV9A 5LFAA 2B78A 3R0VA 3VAYA 8LDHA 5IKEA 3QNUA 2HEGA 3RSGA 1ZDMA 3MCAA 1L4HA 3EW7A 1WDWB 3AEUB 2X0RA 4DJ5X 3PRKE 2E9SA 3KQUA 1YQDA 4O4HB 4MJ3A 5B7GA 3PJFA 4W63A 1WPQA 4B43A 2VDVE 1WXFA 2ECPA 2W2LA 1N5IA 1USIA 3FYCA 2KLHA 5A2GA 3U3MA 3BSSA 5ABPA 5A5VA 4GKAA 1V3TA 4ABYA 3GLFA 4JA0A 1JVBA 1D9XA 1RKQA 2G1PA 1HE1C 4YQFA 1DKQA 2LZ0A 3K7EA 4FOSA 3GMIA 4FFMA 4BAUA 3WGYA 5DSXA 3EVFA 4E3WA 3F9IA 3HGMA 2P1DA 3O8OA 3NYRA 1A8PA 4MA4A 1XRLA 2D1RA 5HIIA 4DDWA 4ED9A 3PQDA 4M53A 2Z09A 3KLMX 3PX2A 4XM0A 3RJMA 4BFTA 5B3LA 1Y1SA 1UM9A 4PIMA 5EMMA 4EATA 4OQLA 3F7TA 3E3AA 3HEBA 3Q98A 4C0XA 2APJA 1OYOA 3LC0A 1U65A 4QATA 4C0JA 4P4TA 1W49A 2XDQB 2PCLA 1JBQA 4BNMA 2ZQZA 4BX2A 4BFWA 1QAQA 1GHTA 3CEPB 4KAWX 4QYMA 1GZUA 1RAHA 2VWHA 3OEEA 4PPNA 4CTJA 3C41J 2Z6UA 5D5HA 3E3OA 4TM7A 2IYYA 1RZRD 3F8TA 4LRUA 2ZOSA 3AM3A 2VYVA 1MIOA 3KJIA 5KJ6A 2WYWA 3GPDG 5G4KA 6Q21A 1PL7A 3HGQA 5IK2A 1B0UA 3LECA 4R9UC 3A9WA 2A94A 1Q11A 1PJ8A 2J6HA 1QUEA 3GEMA 4OGKA 4TV9A 4ZVTA 3TZCA 3ZCTA 1H1TA 2CF6A 2IDKA 2R8PA 5BV7A 1P75A 3LYAA 2Q6IA 2KJQA 5LWHA 1LNSA 3DLPX 1JZTA 1A8QA 1RACA 3E9ZA 3DMTA 2PTGA 3EEQA 3AJRA 1NF9A 2F9MA 3P45A 3S7TA 4WZBE 2VTBB 5E38A 1SOUA 2AMLA 4NOLA 1O2DA 2XMQA 2XMDA 2PKEA 2PAFA 3AVPA 4O0LA 3TD6A 5TE9A 3UICA 5CXXA 3WKAA 4Z49A 3BWVA 4ZYZA 2E1PA 3RGGA 1ZZEA 1SKAA 2DBZA 4MQMA 4B6OA 5K3OA 3K3PA 1IYZA 3QVLA 2XB2A 4UEWA 5CD1A 1LDEA 3DZJA 4E1AA 5BQPA 1OJ7A 1E9BA 2A6HD 4ZQCB 3SYTA 1G1AA 1S8NA 3G8DA 3NFYA 1UBLS 1YQTA 3W6OA 2Y1CA 2QE7A 2G1JA 3OLVA 2WYOA 4A92A 4YR9A 1NG1A 3A04A 1IQRA 3JYPA 4PYLA 1LLUA 1X9GA 1XXHE 3HN2A 4XEHA 5FULA 1ZUWA 2NACA 3AHEA 3OLYA 3KXLA 2I6QA 3KE9A 3SJCA 1PCXA 2NZVG 1DI0A 1QH8A 1NUAA 3G82C 3PBKA 4DG9A 1NYRA 3SQOA 5ETJA 1MD9A 3EZFA 1V45E 3H83A 4DV7B 4TYYA 5E1BA 3O4JA 5FI5A 2WD7A 2WV7A 1UR5A 1E5TA 1HO3A 1HLGA 3KXIA 3H2GA 3P2JA 3KC2A 5J9FA 2IKQA 4PE5B 4F4CA 1OY1A 2Y1FA 3L8GA 3R77A 4FYIA 4FT4A 4MVWA 2YWCA 2YV4A 4URZR 2Y1LA 5CLHA 4LEIA 2NVUB 1EX1A 3ZYZA 2F90A 4BNZA 4AO6A 3WL5A 5HP4A 2A57A 4DOMA 1IWBB 4F2HA 1OT3A 4BB0A 3WKCA 3BSFA 4YUYA 2PM8A 5CLFA 4C88A 1JEYA 3DCJA 3CTPA 4LDRA 2C5HA 1NTOA 4RMGA 4IH9A 4PQFA 4D0LB 2D5LA 2FDRA 3VH4A 1X14A 3BWYA 3D4PA 3Q7SA 4RQAA 5I7HA 4B87A 2ZJOA 1LVHA 4CEIB 1K75A 3ZKAA 2F3SA 1KZ6A 3A11A 3T7JA 3UTCA 1C9DB 1PBNA 1R00A 2YJNA 1WTAA 1RRMA 1J7KA 3MT7A 3O4HA 1UBRS 4QC2A 2J45A 4G6ZA 4IO0A 1AS2A 2HFJA 4KXMA 4ZXPA 2A1UA 5LZ5A 3UZUA 1F2UB 2QYTA 4IQ0A 3VR4H 1XZDA 3LE8A 1Z4QA 1H8HA 3PIDA 3WL7A 4H4CA 4U8GA 3IE1A 3A3OA 4WBNA 1HC7A 4MV9A 4RXMA 2ZI4A 3WQSB 4BKRA 2C3PA 4DT1A 4FFPA 5K3EA 3L9WA 3HDQA 4R2LA 2WDPA 1P2BA 2R4QA 5T64A 1V8PA 1CIVA 1Y7IA 4G0WA 2ZE6A 4O4IF 3W8NA 1XVAA 4AMVA 4BJ6A 1QZTA 3OTOB 5TMBA 1KXZA 3AZOA 2PL1A 3GEPA 4NL4H 3CX8A 2YKGA 4K9QA 4BMOB 5BOVA 1SVIA 4JUAA 4BB5A 3F71A 3HKDA 2OMEA 4RVDA 5BORA 3S8YA 2PGNA 1CZKA 3NGXA 2GBLA 1C7FA 2JATA 3TKYA 4YAKA 1ND6A 3UH0A 1U8AA 1Z2CA 2CVOA 1MTZA 4BMPB 1K5GA 3U44A 5ENZA 1YDEA 1CFZA 3H6KA 2LCFA 2V9CA 3IKMB 4A23A 4EJSC 4LMRA 4OHCA 4GXRA 4NTZA 4KNYA 1YZLA 4C29A 2EFCB 2YXNA 4PNHA 3THXB 1MRNA 2ZSEA 3EBPA 4RKEA 4ASUD 3E9YA 4B6FA 5C51B 4CCAA 2ONJA 3T61A 4DLTA 4X1YA 4QNMA 5IXSA 2I65A 2RKBA 3AR4A 1HI9A 2GUGA 3EY4A 3RH0A 1NR1A 1ZNXA 1RJEA 2VA9A 2GO1A 1WCIB 1KEZA 3KCQA 4GVXA 1XKTA 1HDXA 3ZVKA 1OFIA 2GKSA 4PN7A 5IAAA 2C7RA 1PL0A 5LQMA 3QMPA 1TQHA 3R4CA 1E6UA 5BWNA 3EJWA 3DEFA 1SPBS 2WWYA 1A04A 4JP5A 3TLZA 4DBZA 1ULTA 4X90A 4ZZIA 1EXMA 3Q9UA 3NBKA 1FJGB 4G09A 3JR7A 3OIUA 3PR3A 3ND8A 2JBAB 5JG7A 2A5GA 4C2AA 2VYCA 4FMDB 5CA0F 4M8KA 1CUWA 1NQOA 2OG1A 2PUTA 2IHBA 2EFGA 5A9RA 5AM0A 1MEJA 5EXDA 2UV8A 4CQNA 3F1LA 3RGWS 4WXHA 1QOQB 4IAOA 3IBFA 2ZPTX 3WICA 3IV9A 3KOOA 3JWHA 4FZVA 4V0KA 2AA3A 2QSUA 1REQB 2OCIA 2ZRLA 1JJIA 2GYVA 6PFKA 3A2LA 1GZ6A 1LK0A 1U98A 4TS3A 1KEUA 5EJ2A 1Y1TA 1KI2A 1QC5A 4JZYA 5FOXA 2JZCA 2YR0A 3OBIA 2OKCA 4MVJI 5HUJA 5BO5A 3HCDA 3D8BA 1RRFA 1DFIA 4GVLA 4ISBA 2YWXA 4RD1A 1GE9A 3D6UA 5BSKA 2CEKA 1XDSA 2PZEA 3VNBA 2YWDA 4GOND 4KXWA 5JAQA 4UTRA 1YAJA 3R44A 4B6PA 3WGUA 3BJEA 5DP1A 2OBXA 4DIKA 1FC0A 1FX1A 4Q3AA 3DMRA 3FB1A 3H9GA 1ZC4A 3FUTA 3IUEA 3KOMA 1V26A 2KWIA 3M5DA 4RSGA 1CX9B 1ZN9A 3HB5X 5JAMA 1P2UA 2QXYA 5JXHA 5GP1A 3G2MA 3WWEA 3W77A 3SHFA 3K9FC 3UAOA 5CR9A 4PGFA 3L6EA 3T0GA 4CKYA 1E60A 2OGSA 4D9KA 1P0IA 1O5OA 5IWCA 4N9QA 2FB9A 3ORYA 1TAUA 1J9ZA 3CRMA 3WRYA 3VU3A 1E1QD 5B1EA 1FMJA 1ZIDA 2KI5A 3DZIA 3WRXA 4ZOLB 2PUAA 2MSNA 1R64A 1XDDA 5IANA 4U7DA 2P3OA 1BGXT 1XEAA 3NYWA 4PY2A 1N2XA 4ZTUB 3MTEA 1RBMA 4LJLA 3NHLA 4WN9B 3EA0A 2BFEA 3CH4B 3GUVA 3EGXB 3KQHA 3VAZA 1II8B 1AKQA 1BEZA 4HI0E 1U7OA 4L3VA 1MO4A 2QL5A 5MLC9 1GPAA 2JGMA 3AUAA 1KJ8A 2UXBB 1JJVA 4ITRC 3GQVA 2WMOB 1BO6A 1H5QA 4LGCA 4W7SA 5EUMA 3ZG6A 1PWXA 3AKDA 2MR5A 5IKXA 5HZMA 3ZH9B 5F9HA 1EJBA 1JLHA 2FXVA 4J03A 4L7QA 3RUCA 3T9CA 5KVCA 1PYOA 2Q07A 4MV1A 3V4FA 1R6VA 5L7YA 1VGRA 3R0QA 4LSZA 5J3JA 4UVHA 2O0JA 3TTUA 1XZLA 1FFAA 2PSJA 4HFRA 4LDAA 2FRDA 1RVDA 1Y98A 1YS1X 3GF4A 4J1TA 3V97A 3ZLUA 4BLUA 5EHXA 3IP3A 3KFXA 3ITEA 3U40A 3VR3A 4YO8A 1ZK3A 3GT3A 3LCJA 4G37A 4CFSA 1T91A 2F1RA 2O57A 1Z63A 1QUFA 4ARZA 3OPNA 2Q5JA 1E3TA 3JQAD 4RHTA 4AUNA 1H2RS 4EMUA 1EFDN 1ZN8A 1OU4A 3ETJA 1DELA 2GPNA 4MW7A 2XCRB 1JNXX 1P4RA 2G0NA 1X39A 3E5HA 3RBAA 4FYHA 3OFJA 2JH8A 1GTVA 1QKKA 4PYOA 1ETHA 3OF5A 2AWOA 3IVCA 3QVXA 3V7YA 1W1UA 2QROA 5ARCA 2F4VB 3ANNA 4YALA 2VQEB 3RC8A 3T1TA 5K8CA 2PR2A 1QU2A 3TRIA 2VT2A 3I04M 1ONBA 2DWOA 3R1IA 2NP6A 2JZNA 1JILA 3AEXA 4KIUA 2G72A 5GINE 4JOCA 3P94A 2YOHA 1RRGA 3S1SA 4PXSA 4JL5A 2XDYA 4HRYA 5D86A 4B3SB 1G6HA 5TQJA 4OSPA 3DPIA 5AK3A 2IEZA 2W2TA 2ODTX 4G5GA 4OXNA 2BTOA 5DI3B 5JDCA 3PD1A 4KSYA 2O0HA 3X3HA 4DMFA 1O96A 4M86A 4KAJA 4YJ2B 4RPLA 5IZ4A 4Z7JA 2AW5A 1ISGA 4PZYA 1EFTA 4MNTA 1GTSA 3AP2A 3I6MA 9MHTA 1XD2A 5A3RA 1IIBA 1ZKDA 2HJHA 5B6PA 1W59A 1FW6A 2PFGA 3S0JA 5IUJC 1A5SB 1V16B 4YAJA 4WY8A 5HS6A 4JI3B 4TXMA 3D4BA 1NAIA 5DOVA 5CB0A 3BCSA 1PUIA 3QI2A 2NT3A 1C50A 1CZHA 2E89A 3CO5A 1PSDA 1TL8A 1E2UA 1JKMA 4DR3B 4OFBA 4FXOA 2YX1A 3U7JA 4YCCA 1QYRA 1R50A 2Q1XA 2P6OA 3O26A 4M0MA 4NHEA 4E6EA 5JRDS 2OFPA 4IFEA 3K2IA 4MHOA 1QFZA 4PPYA 1ZXLA 3I6QA 3U3JA 3EH2A 3LI2A 4LZPA 2DQ4A 1I36A 1CUCA 4TX1A 1MH1A 3DVQX 5ALYA 2O07A 5LB2A 3RTAA 2QGZA 4OF4A 5DM1A 3TXAA 1K98A 4GHWA 4DQ0A 3PR2B 4EUKA 4HDMB 3HP7A 4JD5A 4WNAA 1UDWA 3SR0A 4INAA 3TR0A 1T1RA 4EKGA 3DDUA 4Q4HB 1FZTA 3RVLA 2GJAA 2GCEA 3SQMA 1Q3KA 5EUBA 3UK1A 4PG4A 3PXCX 4MWCA 2BM0A 4KXNA 3I04A 2W83A 3LUCA 1GU1A 1PI3A 3P96A 5LC1A 1TEZA 4JT8A 4UZSA 2ALJA 3WQRA 4EI9A 3VGPA 4BQOA 2VDRB 3NHSA 3P0EA 4HY3A 5KIAA 2PPVA 4PNEA 3TF5A 1SN7A 3P9SA 1KH1A 4CG2A 1I1NA 1N5OX 5MFPA 2BRUC 4GXNA 1B74A 1C7JA 2BR4A 4R5MA 2FP4A 5HIKA 1ZRSA 4DLAA 4W9NC 1H1DA 3SG0A 1D03A 4AF7A 5BOSA 2MSEB 1AU9A 1QRAA 2IEBA 1L5OA 5JWOA 1USVA 4D2IA 1JFFB 1HM5A 3C4QA 3N28A 4DWJA 3QVJA 4MRMB 1RI1A 4I8XA 4LYYA 5ALUA 2XUFA 3NEPX 2F7SA 1BROA 5AKKA 4ND2A 1LBHA 4KPYA 3PRYA 2ORVA 3F7MA 1FY2A 1H2ZA 3WYEA 3AKCA 3K59A 1R3DA 1QFXA 2CE2X 2HLPA 2I6TA 2V7QA 3E81A 4J0QA 4N5DA 1FVXA 1SUAA 5DIFA 5DGTA 1A82A 2UVDA 3RCBA 4BV2A 4EZIA 3E1SA 3OM8A 2JLUA 1OMOA 2CCJA 1W5EA 5CLJA 4PZ9A 1DBRA 4MMYB 4JJFA 4H60A 1GCAA 1QIIA 1V5IA 2D4AA 3SHVA 1X70A 2GOYA 4Z8XA 1FJ2A 1D2AA 1CY2A 2D2IA 1J39A 1UK7A 3UTDA 1KETA 3I6ZA 4P4UA 1ZGHA 2TSYB 1FP7A 1KSGA 4DG8A 5KQRA 3RNLA 1PE0A 2OM2A 1LV8A 1YR2A 2PN1A 1RSZA 3IO3A 3QNWA 3RODA 4I4TA 4OTZA 3WP0A 1MT0A 3TLEA 5BSEA 2HCRA 2XLBA 4H1TA 1MC5A 4X97A 3QVTA 1JDZA 3DNMA 4J76A 5E8JA 3SD7A 3QU7A 1OAKA 2AFIA 3NEJA 1ZD3A 3RIHA 3S55A 1RXEA 2C2YA 4K7JA 3IPLA 5CT8A 2QUHA 3KLNA 2UZAA 3PHLA 4YMGA 3GFPA 2LPMA 1WXEA 4HB4A 4WOBA 5K0TA 1VCNA 1OC2A 2P9FA 1QE3A 1QPGA 4WFKA 3BA1A 1TT5A 3NG1A 4YLEA 2FZ5A 2HRDA 1SZCA 3Q3CA 4RPKA 4YRSA 2R6FA 5AUNB 1HYQA 1LSUA 1EH5A 3DS8A 5HJ5A 3VA7A 4TTSA 5TPWA 4LYGA 3TRFA 4OKNA 4KE9A 1TJ4A 4B8WA 3G7NA 1G2OA 1T3LA 1P8AA 2EG5A 1RU3A 1QQ5A 1E69A 1FXSA 2P3SA 3MC1A 1BN6A 1T4BA 2XI4A 1HDEA 1NQAO 1RXSA 1IVYA 2H0QA 1FUKA 3CVOA 4U2BA 4ZOAA 2VUMA 2R1VB 3KV1A 2QTWB 4ZAYA 4F93B 3AFOA 3CVUA 4G86A 4WXRA 3NWEA 2HMAA 2IHTA 3HDVA 4AHCA 4N0QA 3CBGA 3HDYA 3HG7A 1SCIA 2NZUG 2L82A 2R11A 3E35A 2ZE7A 3IP5A 3LWDA 3OQHA 3HUEA 2PDAA 4Q7JB 4CFYA 4KBYA 4MX8A 2CUNA 4C5AA 3OCXA 3DP9A 3FNFA 3MIZA 2X6TA 1KIAA 1XMPA 4G23A 4HTAA 1SUSA 1TVKB 2YW9A 4YI5A 1NBWB 3N8KA 1G9TA 1KYZA 2OUKA 3JZDA 3QHPA 4XDYA 1KZGB 4JQSA 1PK8A 3CCFA 1X13A 1GQQA 1S7CA 2OD2A 4H7PA 4LRYA 1SQ0A 2GMWA 2ZR0A 3PB3A 4Z3KA 1AKVA 2VCYA 5KOYA 3L0OA 3OG9A 3WWYA 1OWMA 4LJAA 4YP9A 3ME5A 4B75A 3AIMA 3KPWA 3BL6A 1K4SA 1X7XA 3F3MA 3BQNB 3KVVA 4O4HF 4QECA 2NO0A 5GVRA 5DFAA 3GJRA 3WGIA 4J0IA 2Z8XA 2VEDA 3L5OA 2WFZA 1UBOS 3FSJX 3HJCA 1Q44A 3P5SA 4CT0A 3HSYA 5KKNB 1KAOA 2J7PD 2P2CA 3HPQA 3SICE 4E22A 1B14A 4WZBB 1XWIA 1QYWA 2W6MA 1YL5A 1Z28A 1YGPA 1RI5A 2W90A 2FNAA 1AQYA 3QVUA 4G97A 1YE8A 1KMCA 4NBNA 4R1SA 1FFDA 4V0MA 5CNKA 4AZ0A 1YHYA 3HJGA 2PL9A 2XRFA 1I0IA 1L4UA 1DPFA 1LTHR 4A8JC 1SCUB 2MINA 1WV1A 3NMUF 3T5PA 3AVQA 4UARA 5CTAA 2CWWA 3WQBA 4C0LA 4QXPA 1UWLA 1U4NA 3AR8A 4UVDA 4ZO8A 2GSDA 4ZYUA 2NXNA 2NSYA 4MYSA 4CF3A 1EUYA 1F0YA 1PS0A 3R24A 4RXUA 5FOUA 4D6YA 5I7UA 5HRAA 1AE1A 1XXHB 2BUAA 3W05A 3K32A 4F4UA 2WTUA 3O1LA 2A88A 4L78A 1WDLA 4M7OA 2VPWA 2ZUWA 5LA6A 1N1MA 3UAVA 1KEWA 1B15A 1BFUA 3L9XA 2F8LA 3PQ5A 1ZHHA 4RTMA 4X20A 4EHFA 3DGEC 3VR2A 1FU7A 2OXRA 3O8QA 2BFFA 1SVOA 1Z3CA 2DECA 1TGYA 4MCIA 1KI6A 4LZJA 3ZHSA 1IHUA 4IUYA 5L6LB 4ZXFA 2IIPA 3ILXA 4RDXA 5BUZA 4WINA 4GBED 2RC6A 1ZOOA 4MWBA 3FMPB 3A6FA 2WUEA 4CIYA 1L8OA 4JL8A 3DBLA 4Y3UA 1VSTA 2AG6A 2QW8A 4GT1A 4DMKA 1W87A 1Y7LA 4J3FA 4DB4A 1MZPA 1ZCBA 2PQMA 3PXUA 1OHHD 4H15A 4BNNA 5CDYA 3MWEB 1UAAA 1F38A 3SJRA 2VPPA 4Q1AA 4P5PA 1JJBA 4LI0A 4UM5A 2HJVA 2J0UA 1N6PA 3W4JA 1AMUA 4GLOA 1OX4B 5EMNA 4B4OA 1F06A 1R9GA 4OHWA 4IQGA 5K3BA 4OP3A 3GCXA 4D0RA 3O31A 3RFCA 4BKMA 2BV3A 1IY8A 3BAZA 5I48A 1NBIA 2Z04A 2ONKA 2SECE 2CNLA 2VJAA 4PTZA 5ES3A 3KPVA 2EWMA 3GLHE 4KFTA 2J3EA 2JFHA 3RDPA 2X8LA 2AG8A 2W8ZA 1UDAA 2VSYA 3KJXA 5H4HA 4E1BA 3EC2A 5ITSA 3W6ZA 3WB1A 4CXMA 2B5OA 1NAHA 1Z0FA 1MJGM 3AI2A 4KJXA 4QQ8A 4R84A 4RY8A 4B3XA 2WIGA 1Q12A 3IJRA 3WJ2A 3MYYA 2PZFA 4WXMA 2ZE5A 3BPSA 3D4OA 4QYTA 3CNOA 5IFLA 2BGWA 1RRKA 2LGJA 2Y68A 2HSZA 3BMXA 4RCYA 3OPMA 2XD9A 3DLBA 1FS4A 3ONWA 1NFRA 4PFJA 4BHTA 1Z13A 3OICA 1VJRA 1KFCB 2HBRA 5LYJA 2GDZA 1ZIYA 1X1DA 3JQPA 1ZN2A 1U9ZA 1H42A 1ZSYA 3EARA 3H5IA 3WAGA 2Y6VA 4DR7B 4P3YA 3IQZA 3SQDA 5REQA 4UUOA 5K6AC 2PPLA 3ERCA 1ZXBA 3W5DA 4OQXA 5CFRA 2AF4C 2YWBA 1KI7A 4NBUA 3TDMA 3BMCB 3D0OA 3M5WA 2X5KO 3IHKA 5DHAA 5BVHB 3F6PA 2YJZA 2ZT8A 1BJRE 5DCUA 1U5CA 4OMUA 2V6GA 2EP5A 2V5AA 2Y27A 1M1UA 1U28C 1D3AA 3D54D 1C1DA 3QEMB 1I32A 1XRSB 2FAXA 3EGWA 4NYIQ 5FL7A 2WP8J 3TNDA 3UXYA 3MPUA 1KBZA 3BXZA 4YXWA 5KYYB 2CV0A 4IFIA 3EXAA 3MJDA 4I5FA 3O75A 1O5TA 4RVHA 2OZVA 3FD8A 1G4UR 4MS4A 5LDHA 1NKTA 2YJ4A 4C4TA 3BTOA 4TRJA 1N3IA 4EELA 2AUTA 3EDOA 1N1GA 1XEFA 2LW7A 1HTTA 2P2ZA 1VPVA 4FIZA 4ZCPA 4CM9D 4E7PA 4DDHA 2PZMA 2P30A 5EZ5A 4I55B 3DDNA 5EMKA 1VRWA 4Q66C 4IV5A 3RS5A 4KV9A 1QYDA 4F11A 3PNKA 4XXHA 2D0DA 5BRAA 1JKFA 1XX6A 4JOBA 2R3SA 4F71A 1TA9A 2QTVB 3N59A 2CMGA 3ROGA 4JMPA 2ID8A 5CVCA 3RC9A 3TEFA 2AYXA 2H7CA 2XZOA 1YJ5A 2QZJA 3GGDA 4FJ1A 5E1OA 3D3WB 5KWVA 1XQ1A 3GJTA 3OI7A 3FM9A 5B1SA 3GGOA 3G8BA 1TF5A 1CZRA 3CKKA 4HVTA 5HJ2A 3QOYA 4F6CA 3G0OA 1MJGA 1T25A 4REQA 5B2FA 4TQUS 3E0QA 2CXPA 3WA7A 3COWA 2YW2A 1KPIA 1I24A 4O25A 2BELA 1QE5A 4RPIA 1RJ9B 4ZI3A 2A30A 4ZTBA 2O06A 3UMCA 2C42A 4MYTA 3H0CA 2QWXA 3ZIDA 3N86A 1A98A 4WESB 2NSHA 3RRXA 4GS5A 4WTOA 2AK3A 5HOQA 2ZXFA 4KMSA 4O4IA 1GLNA 2POQX 3T1OA 1F48A 2X5OA 4BLPA 4D4HA 3HB1A 2P4EA 2PZBA 3TRDA 1CF9A 4OJMX 1WKBA 3LRPA 1QFSA 2I33A 4MYRA 3TLJA 3NOOA 2QM0A 1QLWA 1JR3A 1K2VN 3NXKA 2ZI7A 4KQEA 5IN5A 1GYRA 3E1GA 2RK6A 3UJ3X 1TU4A 2ZYAA 1OZAA 2QNRA 5FTLA 2CLLB 1A4UA 2JCBA 3OM9A 4MCAA 5LB4A 5LDGA 4F5EA 2BBTA 2OUIA 1EDEA 4NU5A 4QDXA 3ZZ0A 5LJLA 2PH7A 1B16A 1L7VC 3RUIA 2VBCA 4BQIA 4DPLA 2GN0A 4FMDF 2H9IA 1E1CA 1QOZA 5BN5B 4Q3BA 2W6IA 2R6HA 3GZ4A 5EWJA 3ZBUA 3AI7A 3DAFA 5ALTA 4R69A 4FYMA 4DYHA 2GXQA 3LVFO 4E5DA 2R7KA 3LCRA 1OAOC 1NOIA 4HS9A 1WPGA 3CCCA 4IP9A 3NBFA 1JPNA 2KB0A 5AI8A 3O47A 3Q11A 5E3JA 1QGZA 3VNRA 5AW7A 1O97C 1KE1A 3VSBA 3KWFA 4PLCA 4IJQA 3IPXA 4HWPA 4RSHA 4JYAB 2XA1A 3HH8A 4EA8A 5K2MA 3LP6A 1NDQA 4YFVA 1S7GA 4FFDA 5KHOC 1MEEA 1NQWA 1P1JA 4ZU3A 3PICA 2Z6AA 3PPXA 3FMGA 1GGHA 3I32A 3SSMA 2A1IA 4MW5A 2RARA 3HY6A 4YRFA 5F4BA 2LTAA 1J09A 3N2ZB 3SXPA 1T5OA 3QUTA 1JAZA 5CA0A 4BKOA 2W2KA 4UFOA 4FYVA 2QTLA 1L6IA 2OPBA 4YNBA 5AW3A 2ZVJA 2HDOA 3C70A 4YRJA 2R92A 2ZM6B 4LE0A 3HV0A 3JXEA 1UKBA 4KQMA 5J1TB 3GZNA 1JR6A 1W94A 3DBRA 2HDWA 4J6FA 5B3JA 5CH5A 2QRNA 4ER7A 4OG2A 3ANSA 5LZ7A 5CCDA 5KYXA 4RZUA 2I4NA 1D1SA 4BZWA 1CNFA 2J9RA 3FDFA 4MMZB 1T4DA 1FS6A 1VA5A 4P1ZA 1TJNA 4EA9A 1A1VA 2D7JA 2JFBA 2BLNA 2GBFA 1ZGZA 3OJEA 3NT2A 4P93A 4RF4A 4B4VA 3U19A 2N0SA 3DXXA 3PPWA 4DM7A 2GXAA 3LLMA 3R9WA 3W5IA 4QIHA 1K9SA 1WUIS 4MLPA 2C7QA 2XQJA 3JQ7B 4I1RA 3HXQA 2JA7A 4MQ6A 1U99A 1V4BA 1NH3A 1GXSA 3B6EA 4WMLA 4PZEA 1V41E 1EB9A 4U9HS 3FSGA 5DNCA 3NWPA 3DE5X 3GLIA 1VL2A 2JAOA 3F8SA 4DLXA 1P77A 4C14A 1PFWA 1NNI1 2VK1A 3VUFA 4QM6A 2FSUA 5I9MA 4BNJA 5ADUS 3D6JA 4EGSA 3RFUA 2PWPA 1GNLA 1JXOA 2QJFA 4URWR 1YBVA 1ST2A 3PEEA 3ICEA 1DJMA 2V7EA 3IQGX 5JJ5A 4WOKA 1HQDA 3ZK7A 4AJ1A 4C3VA 4B3DA 2VRCA 3EWAA 3T7AA 2IH2A 3L0IB 1KZYC 2CD9A 4KFRA 1LBIA 1T8PA 2XYPA 4R8SA 3RREA 1JQAA 5LIRA 2H92A 3UN1A 2HPVA 4Q4JA 1T5SA 4LV6A 5AKHA 4RFSA 4JI8B 1TKBA 4YMLA 1QGYA 1JYEA 3SX4A 1AXEA 1M2VA 1HR0B 5ITZB 1FDOA 2EZ8A 1ODSA 4I5EA 4TVKA 2JARA 4BWFB 3OZIA 1NVKA 2WWHA 4Z4GA 1AN0A 4EQZA 1EZZA 2ZJ6A 2WB1A 2QTHA 4DCPA 5KNBD 5JR3A 4MV8A 3O1JC 4PRLA 4WLNA 4JV5B 2ZJBA 4Z5XA 1PEKE 1XTIA 4C2TA 2I3ZA 3EGDA 1LD3A 4RTSA 4M55A 2W2MA 1M76A 2FPMA 4RY0A 2UYOA 5E7IA 1LC3A 2HWYA 2EQAA 5I9SA 3QFTA 2WQ6A 1COWA 3G5AA 3HA7A 3HE3A 4X1IA 5FORA 4C6HA 4DBLE 4CEHB 4QBFA 1U5BB 5TMPA 5A6SB 4YJ2F 4RAQA 4RC9A 1AQNA 3H2BA 1ZMBA 3O0TA 4PTLA 3E58A 2AW3A 1SUEA 4M6WA 1Z4PX 1YNJD 2I2CA 1I3LA 1K4MA 4RMHA 4R9VA 1KO7A 1Z35A 2O3TA 4FEGA 3SF8B 1Q8IA 4BUCA 4RWZA 1E2PA 4KQ6A 1O0SA 2P9GA 2ZRIA 3DKIA 4M8IA 2ZRFA 2HOQA 1JTFA 3CR8A 3ST7A 4R2MA 1C7ZA 1N8NA 2VK4A 5KYUA 1CQJB 2CW0D 1ZICA 4YAGA 2WIAA 3FTNA 4Q34A 1D6JA 3CXRA 4L8LA 1RM4A 2G71A 4KX3A 1TQ6A 3PX3A 3WHKA 1F6BA 2B2NA 4CIXA 3ZR4B 1TTTA 3FNQA 4QU9A 3LRTA 2O8BB 4RLFA 2X76A 2OP1A 2Z2IA 1X1BA 2QRQA 4J75A 5KOJA 2ZJAA 3VNAA 1NC1A 1KEEA 5JAPA 2G1AA 2HU2A 4LWZA 2XXAA 3L0YA 2QRJA 5TT0A 1DLJA 4GM4A 2DFNA 4B7CA 4B3FX 2WMNB 1QH0A 2QRKA 1ZUHA 2B83A 4NZNA 1EFUA 3OM0A 4NC9A 1C1HA 2IBTA 1JYSA 3DCIA 1FXWF 2HA5A 4FYPA 1J4AA 1ZEJA 1TJYA 4GPZA 4NFHA 3CA8A 3T52A 3FWYA 1ZR4A 3B52X 3DA8A 4HBZA 3F4KA 4ZU6X 1D8TA 2RK4A 1OH5A 1U4OA 1KI8A 3PGXA 1SUCA 3BULA 3JQCA 3NIBA 4BGUA 2PS9A 3OLWA 3VYTB 4KNVA 1FFBA 3MJEA 4XPZA 3GG2A 4BOYA 2QPAA 4UBKA 4EG4A 3FOZA 2Z58A 3T3MB 3LZ6A 5IPFA 2CN1A 3B9BA 1IZ0A 2EDCA 3DL4A 5DNWA 2XB4A 2OA0A 3ZBPA 5IRCD 4QVKA 3ZDCA 3KDPA 2VF5X 2I4MA 3MGBA 1ZLXA 3NW9A 2J59A 2C1ZA 4FSXA 2NNWB 3ZZ1A 1N0HA 3WGLA 1EFVA 1H8ED 1QGAA 4G4SO 2P5SA 2CLDX 1Z6ZA 3O2SB 4F2PA 2IHKA 1V6CA 4RHYA 4DLKA 3AHJA 5L3QB 3K09A 5GIPE 2SBTA 2WABA 1X7ZB 4UBJA 3ABOB 3CLSC 1NW6A 2W2OA 5ECGC 2DWPA 5FEMA 3VYRB 3IE0A 2BEVA 4BX8A 1GZ3A 2B8WA 2FR8C 3A3NA 4CM7A 2IXTA 1VKOA 3KQOA 5EWMA 1OH7A 4F3CA 5TEWA 4HZGA 3TZ6A 4LHYA 4LZNA 4AP9A 1C0KA 1YOVB 2ZIXA 1O6ZA 4MVXA 3MEQA 5F12A 1A3CA 3GJ5A 4C30A 1Y6FA 2JD2A 2ESRA 4FDUA 3V48A 3KBOA 4IOMA 1IWPB 3VX4A 1CU1A 2PX4A 3ASYA 1H2EA 4QJ5A 4IPTA 5DEOA 3AVXA 1XP5A 2G80A 4B46A 2H18A 4HDKB 4BB6A 4I46A 2VJYA 3FYDA 3Q5GA 4E09A 4ZT6A 4OREX 3Q8MA 3VDMA 4UC0A 5T5QA 2PMDA 3FI0A 1A9YA 2R6GA 1OWOA 4XUGB 1NP7A 4NEHB 2AOUB 3IC5A 1RM5A 4HNTA 2QBYB 1YB6A 3ZDYB 1L4LA 3CVWA 2AFVA 1Q0ZA 2NT4A 2J4FA 2VHTA 4F21A 4QUJA 3RIEA 1E6KA 4MS3A 1P91A 2XBUA 3V8EA 4JLOA 4MROA 2XA2A 2QXTA 5JXWA 2F4QA 3F3KA 4O2AB 2F67A 1TMGE 3O94A 4ZPXA 5CA1B 3ZQ4A 5IC6A 5KWSA 3KSRA 1G60A 3WK8A 4FD3A 1CB7A 3M89A 2CE7A 4NULA 1JZQA 3C15C 4HEA6 3H97A 1W9HA 2OV3A 3SZLA 4B4KA 3EQZA 4JBYA 2NQTA 2OORC 1EWTA 2AS0A 1JIXA 4OOFA 3OECA 3TJZA 3VZPA 5LPNA 3LH5A 3GHHA 4TS4A 2ZYGA 3UUGA 4X66B 3MAQA 3PHHA 2IUTA 2F48A 2ZJ0A 4GL4A 3EBLA 2VSXA 1G8AA 1SXJB 4Q3KA 1AKMA 4MR9B 4PIVA 1ICEA 5CH8A 5LQCA 2VHJA 1AV6A 4EHHA 1MAVA 3FRIA 3MB5A 3GV0A 4TUYB 4EHIA 1WZEA 3UYLA 1TADA 3Q10A 2KPOA 4LRQA 2Z9DA 3MA0A 3OPYI 3OJOA 4LUCA 4R1MA 3W2HA 1IN7A 3QKIA 2OOSA 4UDNA 2ORYA 3VKHA 3C48A 2VZEA 5K0LA 4HDNB 1V35A 1JDNA 2FE4A 4RESA 4WERA 3OZBA 2NAPA 1YRLA 1T0HB 2A9KA 2W2XA 3EIQA 1SAYA 1RZVA 5INTA 4RAOA 2QLLA 2FMTA 1G2QA 3WGKA 4MWZA 1QPBA 2J3JA 1TWGA 1L5QA 2IA5A 2YXLA 3RVRA 2WVHA 3EY9A 1WE2A 3I3SR 5HKLA 4BL5A 3ZCSA 4DMRA 5BVGB 2RGNA 5CB6A 1NW3A 1JEQA 1Z0JA 4QELA 2GHQA 3PDHA 3JW8A 1WXQA 4KQ2A 3RFTA 1L9KA 5JQGB 3PQ6A 1XZCA 2HT1A 2HRRA 2QJWA 3EHEA 4ZYLA 2P91A 4RVFA 3ZHUA 1X1TA 2C9BA 2OESA 3DMNA 1G3IA 3GT7A 3CMCO 3PF9A 3ER6A 1Z2PX 2SKCA 4GW3A 2EF0A 1PFUA 3KU4A 4C89A 3EIFA 1T5LA 5JAZA 1E3MA 4ZEOA 1J90A 2A5LA 1OVMA 2JA1A 2M32A 1M6VB 4O08A 1J8MF 1ZI6A 2O3QA 4LBZA 5B7QA 4YP7A 4PN3A 4Q9HA 2PXAA 1XZBA 1Y3FE 3TLKA 3C1OA 4YRKA 3GLHB 4YMVA 1P1KA 2ZIUB 3LUBA 2Z30A 1R6BX 3CR7A 1XRPA 1ULAA 1X87A 2VRBA 2KYRA 3BJZA 3CFYA 4HK4A 3I23A 1ZJYA 4JEMA 4L22A 3VH1A 2CF5A 4EYSA 1NL3A 2QMQA 3ICWA 3DUFB 4JQZA 1OI3A 5BXYA 5EE3A 1PTKA 1RQNA 3P2OA 1FVHA 5A3JA 2P4UA 5JI2E 1FOEB 3MM4A 3X2EA 4M9QA 1F6WA 4XCQA 3ROTA 3EX7C 2YOGA 1CVIA 3SZRA 1HLFA 1XRMA 5TMDA 2E5FA 1DOHA 1Z4MA 3I2GA 4QLOA 5JTTA 2CB0A 2FWPA 3L43A 1KWKA 3WGVA 2R8OA 1JMYA 4A6PA 4TYWA 2XDQA 2P0EA 1XC7A 4IJWA 1RLOA 1YCGA 3G0GA 2F1HA 1G7CA 5ALOA 4CU2A 5K4HA 5EXEA 4OYYA 1XCJA 3FMIA 4OFZA 2WEKA 2IS6A 3LVQE 1UZNA 2VDLB 4MPJA 3WWCA 4BFZA 2AQ8A 5AVTA 1QFYA 1EP9A 2WZCA 4BO6A 2I4RA 1FNSA 4GPTA 4HC4A 2XKKA 3LK7A 1VPLA 2IX3A 2A8YA 4UU0A 3ANMA 5J2TF 4PS0A 3HJAA 1U5AA 3DE7X 5CYOA 4IV8A 3V4VB 3A14A 3A7DA 3OKAA 3MJHA 3QXGA 4CMIA 4LZWA 2FFAA 3QXHA 4Q1DA 4AKIA 3G8AA 2IYAA 2L18A 1UOEA 3QSGA 3D4NA 2PZJA 1C30B 2FI1A 1Q16A 5ESWA 2AC2A 1PK9A 3B36A 3K9WA 1A77A 4IWNA 3KEQA 4L2IA 1P60A 5ALGA 1G8GA 1RXIA 2GF0A 4U0KA 1LFDB 5LWQA 2CBXA 3AXTA 4YAEA 2PNFA 2Q1YA 4LOJA 2WB2A 1YL7A 4G5HA 3T41A 5BWMA 4Q0MA 2H1FA 2QX8A 4OI1A 4OA8A 3ZBQA 1U0TA 2EVWX 2HV8A 1CXZA 2BUCA 2H3HA 1KMHB 3INRA 4F7DA