4D3ZA

The structure of inactive prolegumain from chinese hamster, trigonal space group.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
406
structure length
389
Chain Sequence
b'AGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHSTSSPISLPPVTRLDLTPSPEVPLTILKRGQIQRLLDARHVIEKSVHKIVSLLAGFGETAERLLSERAVLMAHDCYQEAVTHFRTHCFNWHSPTYEYALRHLYVLANLCEKPYPIDRIKMAMDKVCLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROLEGUMAIN
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
total genus 145
structure length 389
sequence length 406
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4d3zA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3zA01
3GJSA 1M72A 1RWVA 1KMCA 1RWOA 3ITNA 2QLFA 4EJFA 4ZVSA 2P2CA 1NMSA 3NS7A 4JJ7A 2XYGA 4HVAA 2H4YA 3PCXA 2FP3A 3GJQA 4EHKA 2J33A 4ZVRA 4D3ZA 4IEFB 4QU5A 1NMEA 3V55A 4QTYA 1QX3A 1K86A 1RWPA 2DKOA 4NBLA 4ZVPA 5LUBA 4EHFA 1GFWA 1NMQA 2CNNA 5LU8A 1CVRA 3R6LA 2CNLA 4QU0A 2K7ZA 4N6OA 3DEIA 3D6FA 4QUIA 5LUAA 3PD0A 2CJXA 4QUBA 5IAKA 3RJMA 3SIRA 4AWBA 4EHAA 2AR9A 4NOLA 4PRZA 1F1JA 2CNKA 5IC4A 3DEHA 1K88A 4JB8A 5IC6A 5IARA 5IAGA 4DCOA 2QL7A 1QTNA 1RHJA 4QUJA 3H0EA 2XZTA 2H51A 5IAEA 2HBYA 4ZVQA 1RHUA 5IBRA 4NOKA 2H5IA 3P4UA 4JQZA 1NW9B 3R5KA 1SC1A 2QL9A 3D6HA 2J32A 2XZDA 2QL5A 4AWAA 3R5JA 4NBNA 5IBPA 1SHLA 5K20A 3R7NA 1RHRA 4N7JA 4FGUA 4QTXA 1JXQA 4LSZA 3V4OA 2XYHA 1I3OA 3P45A 3QNWA 2FUNB 4N6NA 1RHQA 4QU8A 4ZVOA 1I51A 3UOAB 1I4EB 1BMQA 3PD1A 4JR2A 3IBCA 5IAJA 3S70A 4JJ8A 1RHKA 2H48A 3GJTA 2FQQA 4JQYA 1F9EA 1RE1A 4I1PA 2C1EA 2H5JA 4N5DA 4NOMA 2H54A 2CJYA 2H4WA 4JR1A 2CDRA 3EDRA 3UO8B 1ICEA 4QU9A 2CNOA 3NR2A 5IBCA 1QDUA 2J30A 3NKFA 3D6MA 4I1RA 5IASA 2H65A 4AW9A 3EDQA 3H11A 1PYOA 4QUHA 4NBKA 4FDLA 1RHMA 5I9BA 4FEAA 2Y1LA 1I4OA 3R7SA 3IBFA 3R6GA 3R7BA 3E4CA 4EHHA 1RWMA 3H11B 4EHLA 4EHDA 4JR0A 1RWWA 4EHNA 5I9TA 4QUAA 4QUEA 3KJNA 2XYPA 1RWKA 4HQ0A 1PAUA 4PS0A 4NOJA 4ZVTA 5IABA 3GJRA 1IBCA 3H13A 4HQRA 4ZVUA 2QLBA 4QUGA 2C2MA 4N7MA 2Y0BA 4PS1A 2NN3C 4DCPA 3S8EA 4IYRA 2QLJA 3H1PA 2J31A 4DCJA 4PRYA 1RWNA 2C2ZA 1CP3A 4M9RA 4FXOA 3V3KA 4D3YA 5JFTA 4QUDA 4D3XA 4N6GA 5LU9A 3DEKA 2C2OA 2HBZA 3V6MA 2HBRA 3BIJA 2HBQA 3OD5A 3KJFA 1RWXA 5IANA 4JJEA 1GQFA 1SC4A 2C2KA 3SIPA 3K7EA 4QULA 3V4LA 3V6LA 5H0IA 2WDPA 1SHJA 3KJQA 3DEJA 1SC3A
chains in the Genus database with same CATH superfamily
3CNHA 2YWJA 1SKQA 1HNWB 3ZDXB 3F5SA 1ACMA 2HMYB 4A2CA 5KREA 1H9CA 1RXCA 1R50A 5TQVA 2X0FA 1QCCA 3W3AH 2QEQA 1BJKA 4PSDA 4Q24A 5CJJA 3HKBB 5L51A 3G1TA 3PNKA 1DZIA 2DG2A 4BVFA 1AXEA 1BU8A 1FLDA 4F5WA 2J3LA 4LXUA 1FTQA 2A9FA 3SSNA 1K89A 3KT8A 1VZ2A 2PSEA 2ZJ1A 3ZGVA 1G0NA 1EZZA 2X1MA 5GZ3A 1AKNA 1WUTA 1LI4A 4BMNA 1I7QB 4U2KA 4P34A 3LRTA 4WXYB 1JDBB 3TX2A 4H4EA 1C3JA 4RW0A 3GG9A 4J29A 3QXHA 4S35A 1UOPA 3K2EA 3VHRA 2AZTA 2GPWA 2E3JA 1Y8QB 5JJIA 3EMBA 2ERYA 1Z2EA 3WL6A 4Y9SA 5B30A 1JKJA 3UGQA 4DMMA 1ZHOA 4CKWA 1QAQA 4O4JA 1NP3A 5SZHB 4HNRA 2HBYA 1P3DA 4G5QA 2TS1A 2ZRMA 4KN5A 1ADYA 1C7EA 1U0LA 5HZKA 5ITWA 8MHTA 2AQIA 2QQEA 1P81A 4AUKA 5CIYA 2HMUA 3R3ZA 4KWHA 2ZYDA 4D8UA 4TWZA 2QL5A 2ZDHA 4UVDA 4D02A 1TXGA 1V1MA 2WG2A 2PY6A 4HLUC 1NNI1 5A4FS 3AP3A 4QT4A 1T2NA 1UAAA 2NTVA 1GQRA 2JW5A 1LRKA 2W7TA 4UQLA 1GU1A 2XNKA 4L76A 5BN5B 1AUQA 3JS5A 1GRRA 3WXBA 5K0LA 4MRMA 1T0UA 1JJFA 3G5UA 3ZU3A 1A76A 3L8GA 1HZZC 1S2IA 4O29A 1O94D 5AO9A 4DBLC 5EJ5A 1MJFA 2P2SA 3FRIA 1DOHA 5UKDA 2C88A 4Y98A 3U0BA 3N53A 1QB8A 4B3FX 4DEYA 4DDUA 5I6DA 5KZMB 2I4LA 5CEFA 1PNVA 2DVMA 1E2UA 3AQ4A 3KEQA 5CYOA 4L5CA 1LLUA 4XZ3A 1WZIA 2XE6A 2BHRA 2RI0A 2FPGA 3DOCA 2ZVPX 3KB1A 5A9SA 2HLDD 2CL5A 2RKBA 4MMYB 2QTVB 2ON6A 1JHYA 3PNPA 5DGXA 1GCAA 2D8AA 1EM8B 5ESXA 4CIYA 2WQ6A 1KAHA 3K35A 2G09A 4NG4A 1GLGA 1FMFA 5BRNA 3JZIA 1CY0A 4RZXA 2PH7A 3T3NA 4B73A 1AQYA 3NBMA 1LQ2A 1E6EA 3HCDA 4BJ1A 5ICCA 5IJWA 2X23A 1Z6XA 3CLRD 4FX5A 2HV8A 3OLYA 3PQ7A 2E1PA 4FGWA 5FTNA 1W8DA 2CB9A 4B6GA 4PQEA 3VU3A 1U02A 2FMHA 2L42A 5AH0A 5DCLA 1TLLA 4Y2PA 1DX4A 1HMYA 1DHRA 2ZRIA 3PLRA 5CVUA 1RC8A 2JA1A 5F7ZA 5DYIA 3F6RA 3OT1A 3PGA1 3IEXA 1UBNA 4RMNA 1O6GA 1Z83A 2JIOA 2VAXA 4P80A 1L1FA 4EG6A 4UNSA 4BGDA 1HL7A 2OEPA 4GOKA 4HLDA 4LJSA 2XWPA 2EDCA 4MR7A 2EJTA 3RVPA 3SAJA 4P93A 4GH5A 4UPVA 3ZWVA 5B58C 2Z6UA 3LQYA 2E87A 3OFKA 4NDZA 4WZBA 4EA8A 4EHBA 2C2WA 4U7TB 2QXUA 5HE8A 1I10A 3GTQA 1QWSA 1ULBA 2X58A 2P9ZA 3CJRA 3O4RA 3DAYA 4G41A 1XPUA 5CFPA 5JCOC 1ZICA 1K7SN 1C3XA 3AUYA 4LSWA 4O2BA 1FSZA 4H9GA 3ZU6A 1KQPA 1ZMXA 2WAAA 3IUJA 3NM5A 4RGYA 1VXOA 2ZJZA 3VTAA 5KQGA 2XUOA 3JQ6A 3QVOA 4LY3A 3VAYA 4D3XA 3DSRA 2D1FA 3ICPA 4K8RB 1WMFA 3DMTA 1PW5A 1VG0B 2RE8A 1C3OB 1DKLA 2V3VA 3BORA 2F67A 2DECA 2YBEA 3FCYA 3G5AA 2W93A 2D8MA 3KB2A 2Y4OA 4E09A 1N57A 3TLBA 4MICA 5BNTA 2N9UA 3PXGA 4BMYA 3O3OB 5K4AA 4BNNA 5CNMA 4BB5A 3I9MA 3D3JA 4R5HA 4I6GA 4KAAA 1XJ5A 3HZZA 2OGWA 2YYYA 4C7BA 1GGFA 3L8MA 4OQYA 5EKUA 1JR3E 1T9HA 3LTEA 1CUHA 2E49A 1CDDA 3BGDA 2B69A 4QYTA 2ZBQA 4A5SA 4PY2A 2HR1A 4NXNB 4JB8A 4IKPA 2PZJA 1G8SA 2OSVA 3CMMA 4URYR 4GPD1 1HDZA 3SEAA 1VGVA 3B52X 2BKXA 4LX8A 2LVBA 1IXRC 1MQAA 1SBIA 2WDZA 4PLFA 5DHSA 1Y5RA 2XBMA 1N8TA 4XI9A 2N0SA 3H0CA 1ZJJA 4MULA 4IGKA 4WKPA 2MR6A 3TL6A 1WF6A 1BKSB 1JKJB 3O3CA 2VHJA 4KAXA 4UATA 2RGYA 3CX4A 4CKWB 2ZE8A 4MW4A 4O4JB 5IBPA 1T6BY 1YR2A 5IJAA 5EWJA 4DV3B 1SH7A 2V58A 3LT0A 1MTOA 2L17A 2CUKA 3F1KA 4XUCA 2R44A 3ABIA 3IV9A 5JO0A 4EB3A 4JI4B 3NI2A 1DIRA 1V1MB 1QONA 2BUBA 3LOQA 4WXHA 4F9GA 3KQHA 5DWVA 4WI1A 4YRKA 4NZNA 1Q0QA 1SIUA 2YV5A 1UT6A 4OXNA 4I1PA 3EXFA 3ECCA 4MRMB 1CPYA 1M66A 3LX5A 4R2KA 2AKAB 5DYTA 1XN4A 1DCTA 2C03A 3VR0A 3UICA 3AY0A 3WYAA 5JYEA 5HPYB 3A31A 4LXQA 5KSYA 2FUKA 2OCPA 3OJFA 3SZLA 4XKJA 4BCCA 3LQQA 4P8RA 2CEKA 4ZN6A 3Q6IA 4U9UA 3W3AD 3WZMA 2AN4A 1CEYA 4C88A 2FPGB 2ZJ7A 4DMFA 5A9SB 3S81A 4QD3A 4CFSA 1ZI9A 5DK6A 3ND6A 1N5OX 2HJGA 2Y0DA 2JGAA 3S6JA 1WR8A 2Z95A 3DXXA 2OSBA 2J3HA 4X3CA 2P3QA 5I7SA 5JAQA 5J1SB 2C9BA 2FNAA 2W4QA 2WTAA 1RJGA 4IGFA 3TRHA 4FYYA 3NKLA 2P35A 3WRXA 2OBMA 5BWBA 4E13A 2WSSD 3BUSA 4K1LA 3JQAA 4MO2A 2Q3DA 1JDTA 2XGOA 4KE7A 3DDNA 4YYEA 4ZQCB 2XZLA 4K9DA 1OXTA 2ZWIA 1YR3A 2DUUA 3A1NA 4WGFA 4W1RA 4CLEA 2B92A 5AVXA 3D1JA 5DLQC 2EBFX 3B1VA 3TEJA 2OV3A 4UEOA 2C5EA 3ANNA 4LYFA 2QTTA 2QW8A 3E8XA 3FETA 3OT1B 3SOZA 1XTIA 3L05A 5IRCD 3L04A 1K5DA 1RAEA 2JANA 1R9MA 2Q4OA 3EIEA 2HA0A 3NB0A 1MCZA 4N3BA 4MR7B 1GSAA 3CX6A 3HVKA 4CDGA 3V6LA 3BIFA 2LXNA 4WZBB 5FADA 2MMCA 5C8YF 1JG1A 1Z2NX 4DWJA 1OWNA 1UXOA 1PQUA 4MPDA 4N54A 1SUCA 4IRUB 1A4XA 1KQFA 2RAFA 4A92A 2YV3A 2Q3JA 1QIFA 3PCXA 2VH5R 4O2BB 1W73A 2CLSA 3FPJA 1JL3A 4NATA 1O6CA 3N0WA 2W2PA 4D3ZA 2F9MA 1IQUA 1JU4A 1DS6A 2Q1UA 1Z62A 2Z5FA 3OEEA 2J5XA 2I6XA 4IEFB 4JUIA 1D4FA 3HABA 4POAA 1NMEA 4WK0B 5ECYA 6GPBA 1TCAA 16PKA 4BO5A 1M7HA 4ND4A 3TFOA 2Y0SA 2OT3B 3HB7A 5IM5A 4RWEA 1TLFA 4X5OA 2Q3LA 5AESA 7MDHA 1N0IA 1Z18A 3L0PA 2I55A 2X9QA 3EXG2 4HMPA 4RSHA 2IEGA 3WNQA 2YXEA 4C0QC 4XM0A 3KE8A 3K6SA 3F6PA 4GZ3A 4Y6RA 2I2AA 4RCVA 4H0NA 4HAUA 3BE6A 3PNOA 2ISSD 1UOQA 1ZUNA 1XZAA 3DDWA 2N1MA 3PFCA 3DE3X 4ASUD 4NJMA 3COYA 3VSDA 5DPMA 3KVRA 4HYEA 3DGEC 2GM3A 2P1RA 4U4AA 5DT9A 4P36A 2Z3ZA 1OFIA 1Q0UA 2XCOA 3V9PA 2VEDA 4D1YA 3H8WA 1AN0A 4KB5A 3HSKA 1V6AA 2QW1A 1WKVA 4D25A 2CD9A 1CJVC 1LLQA 1Y4SA 2X6TA 3Q4GA 3ZU4A 4V0LA 1XTQA 3LHSA 1PJ4A 4FYMA 4OQLA 1I3NA 1S02A 3X43A 2VXBA 1K8YB 4E2ZA 3RVOA 1Z68A 4LBVA 4XD7A 3UKDA 5EZ6B 5IJXA 5EWJB 3HZHA 1Z7BA 2YVUA 1U7WA 2JFYA 1R0WA 3BXOA 4ETIA 1OTXA 4AJ2A 1P1JA 1KFKB 3R3VA 1KI6A 5FLXA 4RNCA 1PHRA 1FFWA 1U1GA 2H54A 3U56A 1YZTA 1TM4E 2C00A 1AGNA 4ZQEA 1D4ZA 2GJAA 4J49A 2R47A 4PZCA 1D2HA 4BO3A 4KREA 5AM4A 5DLDA 4DSNA 4WACA 4GW3A 1W52X 3LXXA 3EXFB 3OQ6A 3AEQA 3GEHA 1LDGA 4I3HA 5AVSA 5KVCA 2BCGY 3W5UA 1BXZA 3KVVA 2E1RA 4TTSA 3AG6A 5LBUA 3X2EA 1OFUA 2P9CA 3IE0A 3L6UA 5K5EA 2F2TA 2ZS8A 3VPCA 5JADA 3RUFA 2G8NA 3KV1A 1TZCA 2D5LA 3GR6A 3MB8A 4E4RA 3ICOA 1IIRA 3GEIA 2PGJA 1Z0ZA 3I28A 4JR0A 1GP2A 1NF2A 2N42A 2V5VA 2BE9A 3Q3IA 1MO4A 2A88A 5L40A 3EJWA 3MG9A 3DKIA 3GU3A 4RVSA 4LTMA 2BONA 2YWXA 1F0YA 1A88A 3E3AA 3HNOA 2VCEA 3OHMA 5EJ2A 4CV2A 2I0FA 2FPPA 2YOGA 2M2IA 1H1DA 3BJIC 1YCGA 4HX2A 1E98A 4F3TA 2ZRNA 1FS4A 2FLWA 3GEEA 4FLMA 3SMQA 3KSRA 4IFEA 4K88A 3EH1A 1GPMA 4GFQA 1KRHA 2JFGA 3NJ4A 3OQPA 4FGJA 4IEEA 3JQAB 5IN5A 2JAOA 4Y18A 2IHTA 3ZVMA 1LDEA 3EIQA 1QAMA 3D5QA 4AYWA 4D0NA 5KMGB 2R6AA 2VJYA 4ESVA 4EJ3A 1YT5A 2DETA 2O20A 5DK4A 3E1GA 4WOKA 2ALJA 3ETDA 3K0FA 3ZC3A 1JG2A 3KDSE 3GL9A 2WSLA 2YH2A 2I65A 4GM1A 1B76A 2GBCA 1NJFA 1IHUA 2BP7A 1RU3A 4OAOA 1JR2A 1W6UA 2XUIA 2JAHA 4QVKA 4EMTA 3HYLA 3K9CA 2R8YA 4R2HA 1PTJC 3AIKA 5KYGA 2VUSA 4G01B 1DL5A 4PLPA 1KFEB 1B00A 1I24A 3KR1A 4G07A 5AK0A 1RKBA 2WTMA 5WRFA 5D3ZA 4C3ZA 1JHAA 5KTYA 3ADCA 2LKDA 4G2NA 4PLGA 2CXHA 4L57A 3DHEA 3HUFA 4BYMA 1KI4A 1TLTA 1UPAA 4LYHA 4CCWA 1EFRD 3KKLA 3AR4A 1KU0A 2XUQA 4WKOA 3GDWA 1FDSA 1WIWA 1GY8A 2Z2YA 3KZVA 3V2GA 4GLJA 1NXVA 2BJVA 3K58A 2GH1A 1ZPDA 1RI2A 1WTCA 8ATCA 4GI7A 4PW0A 4CV3A 4OX9Y 1QG4A 1QIHA 1WCYA 4IQ8A 4QFBA 1G1MA 4C0KA 3PPIA 1VLZA 4OGKA 2PZLA 2HDOA 2WYIA 2O8NA 4RZ2A 3K70C 1WUHS 4JQZA 4RACA 4WL0A 3VPFA 3IOMA 1VKNA 2WSIA 4W7SA 2VXCA 4RLQA 3K6SB 1UKBA 3MJRA 4QRHA 5CFNA 5ADWA 4D44A 4GOXA 4UZSA 2A84A 1ZUNB 1I7NA 1V3TA 1G7SA 1VXRA 2WM2A 4DNQA 2VL7A 3AW8A 4IJ6A 4H6XA 4MI1A 3GJZA 4NJMB 3FHTA 3Q10A 5D51S 3OU2A 4EUNA 4FMDF 2H17A 2IUFA 2YR0A 3LY5A 4B0OA 1XZJA 3Q8LA 3CEAA 1PT9A 5F21A 3QLUA 3SOPA 1JXOA 1VB3A 2OV1A 1SUAA 2IUTA 2L69A 5FFFA 5I8PA 1PFWA 4FTWA 3NLLA 1T10A 2FSPA 3I5UA 2IBMA 3T5GA 1D4AA 3ZVLA 4DDMA 3E9RA 2GPYA 5FBHA 5AW8A 3HVIA 3F9CA 4RK5A 2X5OA 5JNWA 2P0EA 2EJCA 4FGLA 4KPYA 2AXPA 1KOGA 2ZUEA 1A8UA 3KJXA 4LY9A 2JAPA 3PDWA 3BFPA 4Q1VA 4I4TF 1XIVA 3KLMX 1T8UA 4F6LA 3SR3A 1NVXQ 1H94A 1S3GA 1KI6B 3LL7A 1TEHA 4G1MB 2VJLA 4HMOA 4NBKA 4PIPA 4RELA 5ALOA 1R5ZA 1CSEE 2WKQA 3N75A 3LGXA 2VT7A 4HFMA 4CG3A 3ENKA 4OB6A 4RTOA 3ZV3A 3PITA 1MQSA 3UG7A 1FZQA 3E3MA 3EWAA 1ADGA 3HYNA 1SC7A 4AJ4A 1J8MF 3AEQB 2IH2A 3UANA 3E9YA 5CTJA 3PRKE 3EARA 1F3LA 3HRHA 2PUGA 5CITA 1JHDA 1EE1A 4MDYA 4INZA 5IABA 2NSYA 4P4GA 1FEZA 4WA8A 4CM9D 1YFLA 2OAEA 3AZOA 5DLYA 3SKVA 2BEVA 3HCOA 1RLOA 4CW7A 2ZPTX 4WKNA 4FZRA 3UWSA 3I6MA 4R1MA 1Z08A 1XOIA 3TZCA 2FPPB 3UC5A 5I4BA 5C52B 5F77A 1E1YA 3ZVRA 5A5DA 3TE6A 1OPRA 2Z5LA 2BUAA 2VSYA 2IEBA 4FWIB 2BMDA 4LJ9A 1AIPA 3WL7A 3GRVA 1GL3A 4CG1A 1YRYE 1Q6YA 2J3EA 3L18A 4QYMA 3SDZA 4ZAGA 4D9HA 4Q1EA 2YZNA 5GY7A 2L82A 3OUTA 5M29A 2NYRA 2R6CA 3F9IA 1RJ9A 4V0ME 5F35A 1Y9ZA 1Y34E 4G86A 1AZSC 1Q7GA 3N2GA 5DYNA 1F20A 2Z4TA 2RHCA 5JS8A 2Q5QA 3CSSA 5JZOA 3K0FB 2H1FA 1JFLA 4OF4A 1DKUA 2FH5B 2JGIA 3ZZUA 3QPAA 3GK3A 3TEMA 4DV5B 2ERXA 2FX3A 4IICA 4H35A 4UUNA 4ZU1X 4P5PA 2BP7B 4TKZA 4C4TA 5LDHA 4JJZA 1TADA 1OLOA 1JQEA 1PEDA 3G85A 1YQ9A 1J33A 1ZD3A 3AKCA 4OTZA 1PJSA 2OQ2A 1C9JA 4U8GA 3RSZA 4Z4GA 1YKGA 1EJBA 2XMQA 2J87A 4ETMA 5FA5A 4LHEA 1PO7A 1U5BA 1YS9A 4NR0A 4NYIQ 4OFBA 3TOVA 4DNXA 4NZOA 4UTPA 1Z3IX 3FPLA 5D3QA 1YRHA 3WNVA 4E5DA 2AN9A 1OUMA 3HWRA 2CFOA 1WUYA 1WVIA 2BDEA 3CVYA 3Q3JB 5LPNA 1UAGA 3TLXA 3IILA 3E0XA 4RF5A 2QD3A 3IUBA 4WSOA 3BGSA 1JHUA 2WJIA 1RRPA 2DLCX 2FEAA 5TMPA 4MVXA 1YB1A 1P4HA 4RVNA 5KQLA 1UWVA 1X38A 1PGNA 3HXOA 3MJDA 1WZEA 2VDRB 1TM2A 1CZRA 1V43A 2X8LA 2ZCUA 2ZR7A 3HDTA 3PXXA 1CR1A 2JCXA 2Y1XA 4N4AA 4CIDA 4FGUA 4HFJA 4PQFA 1UINA 1VLHA 3MYYA 4FONA 3D5TA 2EEPA 5GJCA 2DCUA 4D9JA 3UXMA 3NTLA 4WOBA 1M5TA 1I2MA 5EKSA 4XB1A 4NBUA 4BFVA 2BFOA 3U3XA 4X62B 2UKDA 5BURA 1DC6A 5FI0B 1NNLA 1UJCA 2H4ZA 4M0UA 1P7WA 3L4BC 4FYPA 2VYND 1MN6A 1ZJ6A 3OWHA 2H48A 4UDYX 4E1BA 3RTGA 3CZRA 4KQJA 1X9HA 1IC6A 1T9GS 1UJNA 1ZUD1 2HCJB 3AJRA 3M7IA 1WS6A 3GMIA 3OFNA 3MJCA 4DUGD 4P2BA 2A9QA 4BWYA 4IDBA 4G0UA 4IIBA 5EIOA 1ZMTA 1R8SA 3JYPA 2GZMA 2FJ0A 1FX1A 4YMVA 4TN5A 4K9MA 5L53A 4B6PA 5JQGA 1NC3A 3RYHA 3NVMB 1HT0A 3VDNB 3QKTA 4F46A 3I12A 4K05A 1G20A 1ZRHA 5JXIA 4L4XA 4PYNA 1XXHA 2FPXA 2XYRA 3PNBA 3KL4A 4ACBA 4XH9B 3PE6A 4TVOA 5AXAA 5HQTA 3I9KA 4ZAWA 4PCAA 2R3SA 4Q0MA 3OCCA 4FR5A 5D86A 1BZYA 2VK1A 3T6KA 4EVRA 4KRXA 1DARA 4PWYA 4EW3A 3ZU2A 4UNQA 4LRXA 1VHJA 1LVUA 5CAEA 3U80A 3DP7A 1NZJA 3G79A 1U1IA 1FU8A 3EXEA 3TG8A 1BQ3A 3QELA 1I3KA 3H5RA 3IP6A 2D7DA 4MGIR 2G67A 1JDVA 3LQ1A 3KJIA 3QTLA 4ILKA 3ZWPA 1B2RA 3CRZA 3H19A 4FXOA 3VC2A 2C82A 1HO3A 3QU7A 1AF7A 3LCVB 4IHKA 2MHCA 2FU5C 3E61A 3WFIA 1JHVA 4C89A 4PN3A 2BEVB 2ZRQA 1E4EB 1BFKA 5BPFA 1QH0A 2F3TA 5FR1A 1B6RA 2V03A 4FD3A 1U2DC 4CYMA 2P2GA 5D5PA 3CH7A 4AJNA 3LUAA 2C3YA 4TYPA 3B1ZA 4OY3A 4A0RA 5AW2A 2E9SA 3S2YA 1L6RA 3DE6X 1BE8A 2KBEA 3R44A 2PSFA 3HNRA 1K5HA 1CLUA 1D7OA 1VOTA 1Z37A 2NWQA 3BXPA 3DDZX 5EHIA 5A0FA 3KQLA 1XZFA 1AGXA 4CIWA 3QYPA 2GN6A 2P9BA 2PX8A 6ABPA 1H3EA 4DA7A 4MROA 4UNNA 3U09A 1UXHA 1DFGA 1E3IA 1RJ9B 2AI2A 2LV8A 3QHAA 4KXXA 4P53A 2Z58A 3N2GB 1BGXT 4FNMA 4M83A 1SCDA 1GRNA 1V3QE 3TE7A 5EG5A 1IOVA 2X40A 3I04A 4Z6KA 2ZYAA 2VZEA 2V7VA 3BB4A 4J2TA 2X8JA 2B94A 3KP1A 3RIXA 2ZSKA 3KD3A 3ZVNA 4JBYA 4WUVA 1W25A 1JLRA 5C7YA 3WGHA 3WP1B 3HBFA 4HKTA 2G4LA 4AFNA 1KVSA 4MV7A 1G63A 1VJ5A 2C42A 3BIOA 3DEHA 5E2AA 5I4IA 5JJBA 4S04A 5KSWB 2YVQA 1U0JA 3AF0A 3V80A 1J97A 3GRFA 1XE3A 1ISRA 1NJ1A 2MR5A 1U5BB 3DE2X 2BI8A 4JBNA 4ZT3A 4AIRA 3HCFA 3SS7X 2EKPA 4PZ0A 5CHEA 4DKJA 2E37A 1GFSA 4N1AA 4WCFC 4M6WA 4MWCA 1CUCA 3STWA 1OYWA 1R2QA 2YWEA 2QIOA 1ZK0A 1OGIA 2C4MA 4IXNA 5DCWA 4BCDA 3E9NA 1EVKA 3UZUA 1Y5LA 2G63A 2R60A 1RS0A 2VHWA 4QE3A 4EJMA 3UPTA 4ZZ2A 2OC4A 3ZHBA 4BRSA 2OAQ1 1N3LA 1AZTA 4Q3KA 3EY4A 3LP5A 3PFNA 1CF9A 2JPDA 1VGRA 3ZE8A 4DHEA 3IBCA 3VPDA 3T3IA 3OP4A 4JOQA 5K45A 1ECPA 3I42A 4X1KA 5D2CA 5LLDA 3DLTA 1QYCA 2ZAGA 1CR0A 4MWZA 1JDSA 4X92A 1GVHA 4JENA 2IV3A 3RUDA 4E6PA 1AGYA 1ZQ1A 4M1MA 4IOMA 4PYMA 1QF7A 4QRDA 1CJBA 1OXBB 4U7HA 4NLLA 1X8JA 1L4MA 3UTDA 2IELA 4DR4B 5K8JB 2IYWA 1RHMA 5CLFA 4PTZA 3OJWA 2DB3A 2IYFA 4RE5A 3F8TA 3U37A 2JG3A 3OCYA 4M21A 1SD5A 5BUSA 3FCEA 3CNOA 2CGEA 1YIOA 2XAUA 3FROA 3PTZA 3HKZA 1RVV1 5E7MA 5MLC9 1RJDA 2W70A 4E5KA 2YNMC 3PSAA 5JQGB 3GPLA 1H2WA 2BBSA 1Z8HA 3ASYA 3A2NA 4GLBA 5AT1A 1EJ9A 3GXOA 3RYHB 6AT1A 5CH3A 1ZZGA 1CUZA 1DPFA 1M6VA 1G20B 2NXCA 2VK2A 2ZE6A 3MOGA 4GWKA 1XXHB 3M89A 4RZIA 1NXXA 3WRVA 4TXMA 1CR2A 2PZMA 3FJYA 2C0PA 4JGBA 3OOJA 4P22A 4HVTA 2Z3VA 5CQGA 4I55F 1KIAA 4WPGA 2XD9A 2HJVA 5BRJA 5K99A 4E14A 1RR8C 5CAEB 1YB5A 1V9LA 2C99A 4R2WA 3EXEB 2WHPA 3L9XA 1NJSA 3QELB 4U7WA 3VR3D 4W1PA 1PEAA 1W5FA 4UNPA 2EJUA 4NHEA 4WV3A 4P38A 1JZTA 4BAGA 2V6IA 4RVHA 1S2MA 4YV1A 3HWWA 1QZ3A 2Z56A 3ABSB 4HAIA 3OU6A 3ZXUB 2G7MC 4FFBA 3V55A 3H0GA 3P9KA 2OCIA 1Y9EA 4FN5A 3RRYA 2YCLA 3UNXA 3DL4A 4RD4A 3VYSB 3U5TA 1PJ3A 1BX0A 1HURA 1A82A 2HSWA 2PLRA 4B84A 4DB4A 4GKJB 4CNQA 3CR7A 3ON5A 3K6KA 3PQDA 2B7BA 3OG9A 1BDBA 4OU5A 4RJLA 5A5FA 2Y1EA 2XW6A 2JATA 1EVLA 5F78A 4OH1A 3ZS9A 3TR6A 2DBYA 3RSSA 3EB9A 3NJ8A 2YJ5A 5KQMA 3FBTA 1E63A 2R7AA 4M9SA 1HOTA 1K1EA 3LBHA 5HS4A 3FVVA 4Q7QA 2JFNA 2D74A 1FP4A 3FUCA 4NJEA 5ALIA 4QUIA 3DEIA 3A3OA 3BXHA 1YZUA 1ZMOA 5BNFA 1R74A 4KG7A 3EZYA 2XGSA 1KZ6A 1E3DA 1G6OA 3DYBA 3QYJA 3K5LA 3IESA 1GRQA 2YHSA 1JEEA 3H1BA 2X8JB 3IPRA 1LPMA 4PYQA 3VKVA 2LRHA 3KXDA 4DCOA 3W5CA 1CJCA 1G5IA 2JASA 3KHTA 1MQ8B 2RHMA 1LI7A 1UBHS 1FSFA 1IEVA 2VUTA 3FPEA 3K0BA 3LVQE 4RVFA 4NOKA 1JFRA 3NWPA 4BNFA 1PR6A 5JAOA 2GXUA 4ZGWA 4ZAYA 2Q6OA 1GFIA 4DW8A 2XQGA 4F8YA 4AYTA 4JBLA 1F4PA 3QKRA 1LX6A 3QVTA 1KXJA 4RL6A 4Y2JA 5KVVA 1V5GA 1GAXA 4LG1A 3RS8A 5IULC 3U39A 4CTJA 5DNAA 2AS0A 1RKXA 1NBMA 3D2CA 1MJGM 2ZW9A 3ETEA 2FR1A 3FCAA 3UHJA 4M6WB 4J0JA 2VFAA 3KSUA 4YROA 4LVUA 5ALZA 1WBDA 4EFNA 1FA9A 2I1LA 4Y0NA 2PQ6A 4CUZA 1ZJ5A 2UZ0A 1EWRA 2P2LA 4IDNA 4WGGA 1EGVB 1GAJA 1H9BA 1KZ7B 1Q7CA 4M37A 2JFZA 2VNAA 4F2HA 3RG8A 1K83A 3B1YA 4RFLA 4LMOA 4EYKA 3KHSA 5IVHA 4DG5A 2UVPA 4YMUA 4J1TC 2CDNA 4P4NA 1RADA 1KK0A 3HO8A 1V7QA 2X4LA 4EKEA 4X1KB 2QG4A 1OLSA 4XCXA 1TAUA 1L5WA 1SRQA 4DM7A 1S96A 1VM6A 2ECPA 3FA2A 4YUVA 5EHXA 4MAFA 3RWOA 4D8VA 3IXQA 4LVCA 2O2XA 4QLAA 2PJDA 3C43A 5EIAA 1A77A 2A9PA 4BFLA 3OM9A 1ZOPA 4DXHA 1FSPA 3NTOA 1C4KA 2ZSEA 2XH8A 3PHLA 2EYUA 1PAUA 3EVEA 2BRUA 1ZH6A 4OBEA 4M8KA 1QCZA 4JU8A 3PJFA 4S24A 1VSQA 4W4TA 3TR5A 1YK1A 3V3TA 2NM0A 1G55A 1N6IA 5FF9A 4H7EA 8OHMA 2I87A 3T52A 1GTG1 3NYRA 4KFRA 1WHTA 1XU9A 4M36A 5JSQA 1M6VB 2RC6A 1SVLA 1BMDA 1HQCA 4GEGA 4JVSB 4OAQA 3TECE 2IU3A 1TKRA 3CZPA 1JMVA 2JLAA 3FKSA 1SCAA 3PENA 3RSOA 5I4KA 5LU9A 3DUFA 1W36D 4TTQA 2IOHA 4GZMA 4JBIA 3Q7RA 3PJGA 4K8OA 4MLZA 4O2BF 3BG5A 1CNMA 3E03A 3OAAA 3K5HA 4KO1S 4BB0A 4DWVA 1SHTX 3EK2A 1ADJA 3H8JA 3S2IA 2IP1A 1L7RA 1SHJA 4RTQA 2WHPB 1NYRA 1FVOA 3VJRA 4ARZA 4A0SA 2A6HD 4KMSA 4OHOA 1YK0A 4FOLA 1NPTO 2FHPA 4OK3A 1HDIA 1MZPA 1A3CA 1G5HA 2O2DA 3KWLA 4IDQA 3KDAA 4MV5A 4GL4A 4N18A 2NXJA 3O8CA 4PFSA 4FFBB 2EFGA 1BN7A 3RYIA 5JMTA 1EP2B 3OUUA 2YWHA 2OK7A 4LHXA 1ADFA 3FBGA 3KZCA 3X1DA 3FRJA 4RVDA 3GLSA 4RGVA 2CKMA 1FDUA 3NNNA 2E4YA 3UIEA 3VU9A 1E61A 2QY6A 2P6NA 1GGKA 3DMFA 4UVIA 3T34A 5FYDA 2DX7A 5KHAA 4H31A 4C4OA 2WP8J 3FUWA 2CJWA 4ZXFA 1V5IA 3PNSA 5JS6A 3H9EO 2R8BA 1OROA 4NJEB 2ZJ0A 1FP4B 2PUDA 2OXEA 4QJ4A 1QTNA 1K08A 2VIIA 4X94A 3VOTA 1E4VA 5JDCA 5F1OA 4ZZ3A 1LC3A 3X1JA 1QBKC 3M4JA 2G1JA 1JYFA 1EFDN 4C21A 2AJLI 4IGIA 2JLVA 1UBMS 5EJ8A 1ZJYA 1HDRA 1H4TA 3NTXA 4F11A 5B7QA 4Q34A 4X8MA 3I8SA 2XTMA 3LVFO 5HKLA 3PUWA 4HZGA 4TLDA 1QVVA 4O1IA 8LDHA 3HXMA 4EPVA 2O2HA 1ZJZA 3QKRB 2KI5A 1G8YA 2VKTA 3J7TA 5AK5A 1MAVA 4CVNA 1E89A 3A6LA 2PS3A 4IG4A 4S1OA 4ZMSA 5BNIA 2XCLA 4A2WA 4N01A 1Q91A 4ERNA 2GK3A 1DLIA 3FMIA 1OBFO 3HA2A 3I1IA 3OPYA 4R1LA 3P8ZA 4A8TA 1V26A 3WYFA 3ZWQA 1HNXB 1U0SY 1J49A 1BFDA 3HHPA 3KTAA 3GLGA 3CW8X 3IMEA 1RWQA 1I7SB 1YDGA 3PIDA 2X0RA 4LRWA 2O2GA 4B3GA 1ENYA 1OYYA 1YS1X 3NYWA 2OHIA 3LM8A 5G41A 4OJTA 2DTXA 3C3XA 3G8YA 1ELOA 3EPKA 1F14A 2PL9A 4CI9A 4PC6A 4KDEA 2WHYA 4R3WA 5MFPA 2YINC 3CNQS 4R2JA 2B6NA 5ERXA 1P8AA 1U7HA 2UVPB 2BR4A 4UBIA 4AI6A 2QQ5A 2OD2A 1NRJB 4ZYZA 3STHA 2O19A 5E38A 1QK5A 1PQ4A 1XSEA 2EHDA 4URWR 4YGXB 4EHLA 3RVSA 3IOBA 1OLSB 1COWA 3LGAA 5KYVA 1NSFA 4QPJC 1Y1WA 1PJ8A 5HUQA 1K3UB 2VAVA 1PZNA 1GDTA 1CUSA 1R64A 4MW0A 3ER6A 5CVEA 2WF7A 3SQDA 4YRIA 5EVJA 4B1FA 2V6JA 5T3YA 3RDPA 1TJ4A 3UOGA 4B7AA 2GBPA 2W2OA 5EWMA 5SV2A 4ABYA 3FWYA 4RY0A 2NZVG 2VCYA 2HD4A 1XPJA 3ZCPA 2R86A 2YIJA 4LZLA 5CGZA 1AJEA 1LJ8A 3C3WA 3Q8XB 3WLTA 3RIGA 1PYGA 3ZE0B 4BFUA 1ULTA 2JIDA 3LPCA 1KY5A 2SKEA 4PPGA 1IOWA 4GGPA 4MLCA 5LZ8A 1T9BA 3ET4A 3IIJA 2E2IA 1WHTB 4DM4A 2AKYA 5LJLA 2QSYA 2XVYA 5EMHA 2VTEA 4ZQFA 1YA6A 4OKSA 4RKWA 4DLZA 3RANA 4KK4A 2H2IA 4MQ6A 1EX6A 3DUFB 5SY9A 3ZJUA 3D9QX 5AOVA 1MX3A 2XNHA 2I1VB 1NLMA 3LUKA 1QFJA 3FDXA 2IUEA 4O0LA 4ZO8A 1WULS 5JNVA 1ISIA 1JGTA 3ENQA 4KXYA 1X3SA 2I4IA 4O4LF 1ENOA 4Y2UA 3FMVA 3TFWA 1URPA 4ARZB 1K7YA 1SOAA 3WJAA 3H99A 2P6UA 3PCRB 4DDVA 3KWJA 4C0AC 2JBWA 5C51B 5CTAA 1D5WA 2Q0HA 3C7CB 1XQWA 5LIRA 1K86A 2UZ1A 5T64A 3LGSA 3HFSA 3V7YA 4A0QA 2HDHA 4REQB 4FUQA 3QEAZ 1P5HA 2PX6A 1YKSA 5ECDA 3RYIB 4D3DA 2BHLA 3OEED 3UAGA 1ONSA 1WWKA 2O5CA 4XE5A 1D1TA 1Q1GA 1RLUA 2R6FA 1V8PA 3JQRA 2I2FA 3A6JA 1HV8A 3AILA 5AXDA 5LIPA 1Y7TA 2FW1A 3GFSA 1AGPA 1EH5A 1XP8A 3HH8A 5AJZA 5ES4B 1GUBA 4L27A 4DZTA 3B12A 3JVUA 2W48A 4OPMA 4CM3A 3S1AA 1ZXXA 2XBLA 2QLTA 4AICA 5B3JC 1TM7E 1NT2A 4M1QA 1QGYA 4UE3S 2QI9C 4AN0A 2CJWB 3A4YA 3DC2A 4K26A 2VHXA 3V8VA 3CN9A 3FZYA 4LQCA 4WQMA 5CGQB 5BR1A 4KN8A 2HIMA 2ZATA 4E2YA 4HX9A 5JZBA 4ZO9A 3KLNA 1GL9B 1I01A 4Z4CA 4DV1B 3U48A 3OQVA 4WBXC 5EJ4A 1OJ7A 4DLXA 1N75A 1NFQA 5DM60 2QQFA 1E3TA 2XF2A 3WSVA 3UUWA 3KJEA 3TINA 3UCEA 3I2YX 1JLKA 3S40A 1GTJ1 1YVDA 4MLPA 5LOVF 3Q7TA 1KK3A 2B83A 1SO8A 2WIJA 5DBEX 4S1PA 2C4HA 2FR0A 4LGCA 4UU0A 1E0SA 3FR7A 1PYDA 1RHKA 4E30A 2HTFA 2B21A 4ENQA 1KU6A 4AJOA 1DSSG 1M3SA 3I73A 1EUDA 1PDWA 2H2AA 2J4DA 2W58A 4H3VA 2AX3A 2XOEA 2ZT6A 4JMPA 1VJ1A 1PVVA 2JZCA 3R4VA 4HUTA 5KKNB 2QSJA 3OZFA 2I91A 4AW9A 4L4ZA 4QPZA 2UXBB 3A32A 3OPYB 2B0JA 4AD8A 1BHQ1 1ZGAA 3NIDB 1AC5A 1ESEA 2AEJA 3SX0A 4DLLA 1AHNA 3KTAB 3GLGB 3ZQ4A 4OQDA 4G5YA 3R3UA 1SZJG 2BD0A 4RJIA 5LQSA 2B1GA 5CLQA 3LIIA 2AOWA 3BD7A 3DAOA 3PQ5A 1OLXA 2FW8A 2NZXA 5DHAA 3K71B 4C08A 4Z0NA 4ZRDA 5FOUA 4KB4A 1Z56C 3N5KA 4MYCA 4Q00A 3T4UA 4BDSA 2QVYX 5A2GA 2EDAA 4L5BA 3LQKA 1RRVA 4BNZA 1FQKA 1X9GA 2QPTA 4J16C 4Q9LA 4GQBA 2B4YA 1NW7A 1DI0A 1NZFA 4QOEA 3RBZA 4F5DA 1WP4A 2Z2JA 1L7DA 4JYZA 2O5EA 2JBAA 1PJAA 3LT1A 5JSUA 3PWSA 2QN9A 2EOAA 4PX3A 4GMFA 2XNSA 2OZPA 2HK9A 3RI3A 1K8QA 4QEDA 2QRKA 5D3KA 3KOXA 1JE1A 1XZIA 1DCMA 1JXAA 1WRBA 2HQ1A 4LYYA 4ME6A 4X85A 1Y1LA 4LISA 5EWMB 3K20A 1QAOA 2PUBA 3JD0A 4DV4B 4P4LA 4B0PA 2F1IA 3CKMA 2Z2XA 3CN7A 2OAP1 4NQRA 3MVEA 2I4MA 1ONOA 5AHWA 5IKXA 4Y2XA 4EX7A 3L4SO 3QU2A 4MYUA 2PJRA 1Q7EA 3K0HA 4Z9FA 3FCSB 3PHCA 1C29B 4ND8A 1IUOA 4KYVA 1P60A 2CW0D 3VU0A 1N5MA 1G2OA 2VUIB 4IKEA 1FLVA 4PO8A 4TSRA 3LL4A 3EPLA 1SB8A 3R7FA 4N3CA 2YV1A 2QK4A 1VIDA 2O8EB 4A23A 1XP5A 3PLAE 3TM4A 4TXHA 3FZQA 1X1EA 3DPUA 3EX7C 2AG6A 1YL6A 2CB0A 1NAHA 4H1HA 4CHGA 3LUHA 4LQ4A 2JGMA 1NQWA 2UZ1B 4KQEA 4Q9DA 5C8DA 4B7UA 4PRZA 1FPMA 1ZEJA 3F90A 3P2MA 1MO5A 2WC1A 4XR4A 2XCQA 3TZQA 2CHGA 3DOOA 3RHZA 4QUJA 3VO9A 2DR0A 4AG3A 3HVRA 1PR5A 4YNBA 4ZVQA 3VR5A 4KNWA 1HQMD 1R4AA 2IKQA 4FHZA 3A8TA 1QP7A 4UVEA 5F5LA 1ID1A 3QXCA 1SVMA 4PPYA 4AKHA 2DPXA 4V24A 5U4QA 1EFVA 2ZUCA 2KM1A 3UWKA 3MWGA 4CM6A 4EY4A 2IX3A 3L93A 1O9GA 1RRFA 3ESRA 3S1AB 1Y6GA 2I4TA 1DINA 1XVIA 2QD5A 3WB0A 2R7NA 1IIBA 3RRMA 1G6Q1 1I94B 1YHNA 2RJ3A 4MWGA 4NMMA 1NVVR 3NASA 4N6NA 3TD6A 3QX8A 3IPYA 3OBBA 5I7HA 5IUNC 2CDCA 3BXXA 3U3ZA 1P1CA 3MA0A 3LPLA 4JR2A 4X1YA 3PRYA 2BBOA 1T8WA 2WV9A 2ZRFA 5DSZA 2NVXA 1AHIA 1WB6A 2V4ZA 4XTCS 5EXTA 5H3HA 1NUPA 2WTBA 4XX0A 2WU1A 3R8CA 4EVSA 2WICA 2SCUA 1UBEA 5ILGA 1XFAA 4QBIA 1YBHA 3CJTA 2H7VA 3MSXA 1TWHA 5H8WA 3C1OA 4QSHA 1EUDB 1RMTA 4QQRA 4Z9AA 1L1EA 2QZ4A 1XMJA 1YNOA 4C4PA 3KFVA 4D98A 2XDWA 3A9SA 2O1XA 3FPHA 1IN4A 4FFPA 5DWQA 4HWOA 4K0KB 1NRWA 4YQZA 3AR2A 1QP8A 1JEDA 1JG3A 1U5CA 1XNJA 3RVRA 1QQAA 3N1UA 4CEJA 5HKBA 3E2MA 3CINA 2FRVA 2XRYA 1L5OA 1OLXB 2R6ZA 2XQKA 3COPA 3Q41A 5D00A 5EUMA 2ONCA 5LA6F 4QVGA 4DC1A 5E6RA 1MAWA 4R0MA 4PQGA 5LWQA 3H2KA 4AROA 1L4HA 2QJWA 3NNSA 3C8ZA 1VMAA 2JKVA 1H3NA 2EFJA 2PS0A 4H7IA 4MR9A 2Z09A 2ZYSA 1SOWA 2FXIA 1ANKA 3BGVA 4MMXB 5BMOA 4ND7A 2FP4A 1HKUA 2WRZA 1VPLA 1XR3A 2Z30A 3I04M 4KXFB 4MZDA 5B5SA 4IIHA 4EGAA 3H97A 4BX3A 4WH0A 2J6BA 4AS2A 3ZZNA 1EQAA 1QHXA 2CKDA 2TSYB 3ZV7A 5BVHA 4B2PA 2JBAB 4KXQA 4BQIA 4RH1A 5I9IA 1IVNA 4HZUA 3X44A 4EHAA 2A68D 3I4CA 3BICA 4YFYA 1RTTA 3T1VA 4JVLA 4K9NA 3NAZA 3LMKA 3CE6A 3JQFC 3PX7A 1H2XA 3LY9A 1YQDA 4LE2A 3CBGA 2C8LA 3DAHA 3GRRA 5IJ9A 4I99A 3MCZA 2V45A 1XD8A 5CLHA 1OA1A 2HQOA 1SK8A 5F52A 5I5GA 3F3SA 2P2YA 1GWNA 3L0IB 2GD1O 4G85A 3CSUA 2JCGA 3A2LA 4QU5A 4ZOEA 4WERA 3SJZA 4BLUA 3I05A 2VJMA 3LA8A 3ZV4A 4LJ8A 1RVDA 3M3DA 1WMAA 4ND8B 5J43A 4FDUA 3D6FA 3FWKA 1ZRSA 4NMLA 1NATA 3F2VA 3EPHA 5B7NA 2C3OA 4LHSA 4WFJA 3AVYA 3QIVA 1SEUA 5MHTA 1E3QA 4MRAA 2WQZA 2QYOA 3TQHA 4Q21A 3ROZA 1O6ZA 3TSYA 3EZNA 4AP6A 4HLQB 2WWTA 1WZCA 1YJBA 1WQ4A 4N3GA 2YJ6A 3G23A 3IP9A 3U1BA 1BVRA 1SQGA 3JYQA 1VL0A 3GPIA 1DUIA 4RIHA 1W93A 3BBLA 3KG2A 4Y9TA 4XYMA 3WNDA 4ZEVA 5CFOA 1OW3B 2X5XA 4D5EA 4LF4B 2H2WA 4AWAA 3F2IA 1BA3A 1SQ6A 1Z2DA 2HJWA 3EC2A 3NTVA 4N9QA 3RHFA 2PNFA 1K06A 1KVUA 1PL7A 5TMDA 2ISQA 3DWFA 4IO0A 3OIUA 3WB2A 4YBRA 4IX1A 4JHLA 3SQOA 3UQYS 3SM9A 5A2QA 4HPXB 5JFGA 2IQ5A 4DC0A 2DY0A 1EFVB 1HNZB 3SCZA 5IDWA 4L73A 2JFUA 1KBQA 1P3Y1 3WK5A 3RIMA 2P0AA 4QPPA 3ZQKA 2Q1TA 2IYSA 4N5HX 1KO4A 1T3SA 3IC5A 1TAHA 4YPVA 4LBYA 2GF2A 3UF0A 2FWIA 4EGQA 4IXDA 4NWIA 1NV8A 4X1YB 2H00A 3AHDA 3RWBA 3DZJA 3AR5A 1B6GA 3F6SA 5AM1A 4ADSG 3OFND 1XCMA 4WASA 2FPMA 2JFXA 4XX0B 4AKGA 2PKXA 1QGAA 2SCUB 1HTBA 3D8RA 4TYYA 3SC2A 3NW9A 3L92A 3WGZA 4U3JA 2C8KA 1G2IA 2VPWA 2KJQA 4KXWA 5CU7A 2GXAA 2E18A 2PQ0A 2YVKA 3OZCA 4E5UA 2I3AA 2DRIA 1P2TA 4ZOQI 3T3EA 1SUEA 1V11A 1IBCA 4INOA 2XB8A 3EHEA 4XW2A 2JFQA 3EGIA 3ZX4A 2VP2A 4I4LA 4KQMA 2FJUA 4TS9A 3REGA 3AL3A 3UK1A 3FHCB 2QX6A 2Q1XA 1Y3IA 3A05A 4CEJB 1P91A 1CS0A 3GWZA 1RLJA 1U80A 3NOXA 4GNRA 5BYKA 5E6RB 2SHKA 1LDMA 3N7UA 5ALUA 4IG9A 1B7GO 2UZ4A 4IYJA 1P1BA 2NO9A 4MR9B 4LJ5A 2HK7A 4YIKA 3MK31 1PQPA 1U3GA 2FP4B 4OI1A 1KJJA 1HI9A 2GPAA 3GFTA 2WPNA 3KSAC 1UKAA 4TS4A 1OV6A 2OBLA 4P3NA 4ZQGA 2C5FA 2KYRA 3FWPA 1R12A 3JQ8A 5TQ2A 4F72A 5EJ6A 4EUEA 2B3DA 3OJOA 2XCIA 1RWOA 4JBHA 4ZICA 3BJEA 4OJMX 3SX2A 1XRNA 4B3IA 3VTKA 4EQ6A 5BVHB 4YAOA 1KEKA 1IUNA 4HZUB 2AVNA 4IWYA 4MAAA 4QICA 2C3UA 3WX0A 1YR7A 3JVEA 5CXSA 5EPUA 1APBA 3N07A 3LWDA 1CUUA 4URVR 4UAVA 1W5AA 3W2HA 1QIEA 2ATXA 1RQ7A 4EG8A 1KFBB 2B4AA 2RH4A 2BMEA 1XZHA 3RC3A 5IJ9B 1Y3CE 4C2MA 4N3AA 4QU0A 1CUDA 3HLYA 4GYWA 3UMJA 1NBIA 1YD7A 1V4VA 2Q6LA 2YOFA 3UAVA 1Z0FA 3WV4A 5IT9A 1QANA 4XWGA 2VA8A 4H16A 1YRBA 2VJMB 3WZLA 3NBKA 2FVXA 4RHXA 3WKEA 4N8SA 1VE9A 1AKQA 4PRKA 3PUHA 4CIAA 2I80A 5H70A 2PCLA 2OXTA 2PQMA 3EEIA 3T95A 4TTVA 1UQRA 2ZBPA 4KKVA 2QL9A 3ZI7A 3UK0A 4C87A 1PR0A 2ZWMA 2UV8A 3QMVA 3AVUA 4JDPA 5KWSA 2ZYWX 1C1XA 1B43A 2DYKA 2FVYA 3M83A 3T0GA 2VNHA 4G1VA 3N28A 2ZDQA 5I7RA 1RM0A 2OZKA 2YFQA 3BMCA 3CNBA 2QAIA 3KK0A 3PKJA 1CUFA 3V34A 2ORED 3VR2A 3ZWKA 4FI3C 5BN3A 2NVYA 2BUCA 2XVZA 5DP2A 2CC2A 4UTVA 4YT4A 1MT0A 2OBYA 1FMCA 2MYPA 4DIDA 4UM9D 2AC4A 5KHOC 4CKZA 3HV0A 4I4CA 1Q1AA 1DD5A 5JYBA 3CXUA 1TX4B 4XCQA 1F9EA 1EGMB 1VI2A 2Y1DA 2GJSA 4FFMA 4D41A 1MH1A 2LNDA 3PQ8A 4IIJA 4DV7B 1BXKA 4TV9F 5CA0A 1L5SA 5A4IS 1CZNA 3ED1A 1FU4A 2P0YA 1H2HA 3BN3A 2W4IA 3U7GA 1J70A 3DGFC 2R6R1 1E0JA 1BWQA 1DKNA 4D2IA 2F8TA 1E7WA 1T0JB 2YZ7A 4EWLA 5ALEA 1OQAA 1J7KA 3OCVA 1EUZA 3NWBA 1KAEA 3T7RA 2FG6C 3K9HA 2C2GA 1T3HA 2ZI3A 4FR0A 3MWKA 3TNDA 2EP5A 1B14A 3D64A 1CJUC 2FWMX 5L3SA 2NVWA 1DT3A 4OO3A 3L01A 5K8UA 1R0XA 3GGCA 3SC2B 1KJIA 1ZR2A 4G5RA 2B4QA 4DJDC 4TSFA 4U3JB 3RJTA 4EF6A 3BFJA 1YUBA 3PG5A 4YO8A 4AZTA 1BXGA 1PJRA 5ED4A 4J90A 2CMFA 5IK2A 3OX4A 1E5DA 4ROSA 3EDMA 3GN2A 1X1AA 1V11B 1IH8A 2P75A 5BPHA 2WTUA 3C8HA 4ZZ1A 2IT1A 3LC0A 2JLZA 1DWUA 4GP9A 1MEOA 3MTQA 1ODCA 4GGOA 3V6MA 1L5ZA 2HBRA 3C74A 2WF6A 5LVAA 3QENA 1CS0B 1IB6A 3CEJA 1U2RA 3AWDA 1CG6A 2NYAA 3QE2A 5ETJA 4JI3B 1T3LA 2H1LA 4WVLA 3V4LA 1ABBA 3WISA 3DZGA 4ARSA 5CM8B 4AQYB 1QYXA 3D2BA 3LNCA 1M2KA 1TO2E 3KZNA 4JCOA 1UM8A 4QXAA 3GJYA 1SVNA 4IHJF 1GTRA 4R8KA 5BQOA 4AJEA 3UJNA 3RUCA 4XDYA 3ST7A 4DMHA 5HKOA 1F51E 2EZUA 2BMFA 1H6AA 1ZN9A 2NZ8A 2WLTA 3AESA 4V1CI 3KQNA 2LWIA 4BBZA 3PUXA 5TQ2B 2AL7A 1VBFA 1T3GA 2Y2UA 5C81A 3FVQA 3JQ8B 3CVVA 2WP0A 1Q5PA 1JTEA 3E6AA 3ULKA 5JEEA 2V65A 2KLBA 4M1EA 5HDBB 3LDAA 2I2BA 1RW4A 4B9EA 2FWPA 4EQ6B 4R7ZA 1M73E 3TUZC 4U7PB 4BX0A 5ADHA 1N6KA 1PFKA 3L7LA 4LNAA 1I4LD 2R6HA 4CMBA 1FFYA 1KSGA 4MYSA 3SXPA 4LPKA 3EVGA 1R5BA 2WB1A 1SULA 2IC5A 3P32A 721PA 1CNFA 4XQ9A 2JAUA 3U19A 1EP9A 4WJLA 5H59A 3NHSA 7ADHA 3AZQA 4LDRA 2FN8A 2YQZA 3KFXA 3A9TA 3BC1A 4IJQA 3T0FA 1TK3A 3DKVA 1P5ZB 1XRSB 2TRSB 1M34A 2I4NA 5T8KC 3K5OA 1ZUHA 5I47A 5GJBA 1JDNA 2P5UA 2BC9A 4ZCRA 3EULA 1USUA 2ID8A 4F21A 2DTEA 4C0JA 5JRZA 3T3GA 2RKOA 4NCIA 3NHWA 4QGGA 5K03A 2PX3A 1JHQA 1P8JA 1AKMA 1NP7A 1Y1SA 2RD2A 5GQSA 3V1LA 1UEXC 3K4QA 1VQ1A 4IUCS 1KSFX 2VCHA 4YACA 3AUTA 3BMQA 3C24A 4WOJA 3FIUA 4L6CA 5JH7A 5BW8A 3NP9A 3EWSA 2VBFA 1C1XB 5SY6A 2PGXA 3TXYA 1DMSA 3ROTA 4BZPA 3DTYA 1NBMD 1ZCFA 3BMCB 2GN9A 4Z99A 1I4TD 5DYWA 4M1TA 2FOXA 4W5JA 2AJCA 1QPGA 5BN3B 4NFYA 4XPIA 5AP9A 1XRMA 1HE3A 2VOJA 1ECLA 4KO4S 1SU8A 3QOYA 2VP4A 5AM5A 3VBCA 4TVSA 1XRQA 3I32A 3LCRA 4IIJB 2ZBEA 4IIYA 3L6CA 3MYRA 4PANA 2Y0CA 4RKRA 1RCFA 2OMEA 2ZSHA 2DQYA 2PLAA 3A9RA 1UMDA 5GV7A 5HE9A 1IN6A 4C7OA 2WUVA 2VJDA 2HA2A 1MX9A 2RH9B 1DC7A 5C32A 1TYDE 3BWDD 5LBTA 5LKRA 1CHDA 3SZRA 4M8SA 2IBSA 1UL1X 4DEVA 1FFBA 3FZGA 1GNSA 2BFMA 4KIWA 4NENA 1JPVA 3GDHA 4OMUA 1B41A 4OH7A 3LF2A 4DCCA 2MYUA 4JI0B 1T1GA 2ZM6B 4JB3A 5IX8A 2B5VA 1E1KA 5L3SB 1CIPA 2VA9A 3HJAA 3PE3A 4CMEA 4ENPA 5LQNA 4QEKA 5BWLA 2ZK7A 1WABA 1YMVA 3M8KA 3R3JA 3IT0A 3VTFA 2YXNA 1GR0A 2AZDA 4AZ0A 1BXGB 4F9FA 2JVKA 2FB9A 4KO8A 1A72A 3F3MA 3SIWA 5HZGA 1KY2A 2QUIA 1I1OA 1V0JA 2LW7A 4ID3A 3UJDA 3L9WA 1YNJD 3EEYA 3K7EA 5A3SA 1E5TA 3HJHA 1W2HA 3TZLA 4PC7A 5K8CA 3EQ2A 3FKSD 3GJSA 2KPOA 2X4IA 1X7XA 2AFIE 5DV9A 4V2IA 5TC4A 4DGQA 2R62A 1LPAB 4UCQA 1N6HA 1GT6A 3OE7A 2W6MA 3CRW1 3OAAD 2REQA 1SHUX 4KDFA 1P0QA 3W4JA 4HVAA 1AURA 1GILA 3GNLA 5C7LO 2NPOA 1WXWA 3O4IA 1EWQA 2E7ZA 2XUKA 1I2AA 3U1VA 2Q7OE 5IM4A 5J2UB 5EE0A 3IMGA 3P9RA 3TQQA 1V45E 3AESB 5AJVB 2WWHA 1X6VA 1BDIA 3F71A 1ND5A 1Z8DA 2GWHA 5KU1A 5IAKA 3I1JA 1RQGA 2P2DA 3OECA 3TFQA 4Y0AA 3ZK7A 3FPGA 4QXMA 3VNAA 4DJJA 1HYBA 1Y3FE 4ALIA 4HEQA 1C41A 2QYHA 4RIEA 1T8PA 2FZCA 3AJ9A 4EJ2A 1X92A 3I0MA 3L8HA 2GXSA 3VC3A 3ZQJA 2AFVA 2X2PA 3CU5A 3GTPA 1SXGA 3AVTA 1Q92A 2GQ0A 1EVIA 2CCGA 1UJ2A 2ODEA 2G7ZA 4YPFA 3E53A 4BVLA 2VK4A 2OQVA 3PGXA 5KWEA 2Q2NA 5AJHA 2OL4A 3N2NA 2Q1SA 1M34B 3S29A 1KORA 2A57A 4ENUA 3R9IA 1AA6A 3RCBA 3IIKA 1XDZA 4YJHA 4E7OA 3LOUA 3DCIA 2GI4A 2YICA 3DW3X 4DR5B 4JJ8A 4IAOA 1VGQA 1EX1A 3O21A 2CL0X 1QC5A 4YJ2F 3ESYA 1TC1A 3BMQB 2A67A 5JH7B 3TAUA 4MTLA 1G5TA 2A0KA 3AXTA 4RY2A 1ESNA 4FEYA 5ENDA 3TI7A 4D5GA 5IWAB 4RDCA 3SP1A 1O9HA 3PT5A 1NMXA 3CLVA 4Y8VA 2RHTA 4Z0TA 2IV7A 2X1LA 1NHWA 1I4DD 5FV7A 1V16A 1JJIA 2NACA 2PT6A 1MNAA 4XPIB 2O57A 5PGMA 2L18A 2GXQA 5I7EA 2CCJA 3ESZA 2FMIA 1SXJA 2IRWA 4RYLA 3QJYA 1J23A 1OZ0A 2CLFB 3LBFA 3M6WA 4PNEA 5FPPA 9ATCA 3CTMA 4L8VA 2OCYC 3FNQA 5CBKA 5EHQA 4QDTA 2BMWA 5J5CA 3WBJA 4BNLA 3ZOKA 1YBVA 3PWZA 121PA 1UMDB 2I62A 3KUCA 3GJRA 4C7OB 1U2ZA 3BGIA 2XT9A 1WE2A 4PN7A 3C98A 3GEPA 4CTMA 1L5LA 1COWD 1PJLA 1Z16A 3HBMA 3DCYA 4NENB 4I7EA 1G9TA 1Q7TA 1VLJA 3E82A 4L4UA 4YEDA 3DMDA 3NM4A 1JYEA 4GYKA 4IF4A 4K6HA 4PLCA 1G38A 3BL5A 5DM4A 3A9WA 2F7SA 5H9VA 2E5LB 3PICA 4UUAA 1W7AA 1ZD9A 2CCKA 5EZYF 2HBQA 1YIDA 4EI8A 5IU6A 1QHYA 4TYQA 4K9OA 1IOZA 1L4YA 2AYYA 3C5VA 5LZ9A 1F7VA 4I8XA 2QM8A 1QOPB 4Q5IA 4AZ0B 4BQQA 3OZXA 1P5FA 1DRJA 3R7NA 4MGHA 1LTHR 4OQXA 3PC6A 4IBOA 4RY8A 3CRQA 3SD7A 3Q40A 4KITB 3P20A 1B1AA 3HB4X 4YFVA 1IZ0A 1XTVA 1PL6A 2JCSA 1XHFA 2ZJ6A 4CMJA 1RI1A 1K6EA 3C16C 4E03A 4GQAA 4MUMA 2WJGA 4RWZA 1X7XB 1NQTA 1JX6A 4OLBA 1O54A 1ZZEA 4QTYA 2JLUA 4ZT5A 4ZOAA 2QT1A 1OX6A 1HORA 4JQOA 3OKPA 2REQB 2XOKA 1PP4A 1QB7A 2IF2A 4WNCA 1IYZA 1SKYB 2LCQA 3SC6A 3IT2A 1HYEA 3TN7A 3WDLA 4NFHA 1HLGA 4EVQA 3B1JA 4V03A 4YHBA 1OTYA 1CYDA 2H16A 2Q7DA 2GUWA 1D2AA 3NEAA 4JROA 3T7EA 3V5NA 1JWLA 1LS1A 3W5HA 1TGOA 4YECA 2FDXA 3NRJA 4WIAA 3S8MA 3HKCA 1LVHA 4ZFNA 4I46A 2HK6A 2RG1A 4F84A 2ZRLA 3OF3A 3H0EA 1H2BA 3ZZTA 1E1QD 3ZGNA 2HCFA 3RAJA 2WMYA 2GHTA 3WLAA 4EI2A 4YRMA 2XKJE 3I9OA 4W9RA 5BWMA 5CX1A 1IXSB 2QD1A 4JQCA 2O5JD 4OP1A 1B8UA 1J2YA 2FR8A 3TL3A 1GYQA 3C5WP 3WO0A 1GZ5A 1E2JA 3BRQA 4PQYA 4FQ5A 4LIPD 1SMYD 4AHCA 1TTQB 2ILTA 4OM7A 3H65A 2XYHA 5B3AA 3ZLTA 1O08A 1FBTA 3FIJA 4I9NA 1J9EA 3FDIA 5AVJA 1GG9A 2HPVA 3H1AA 3KZOA 1A9PA 2SBTA 1GAEO 2ZKIA 3CLUC 1SURA 3IAXA 3TVYA 3DAFA 2FMKA 3B8EA 3AUFA 3N2IA 3PJEA 1FTGA 1IULA 4JA2A 2GT1A 4YJKA 3ZHZA 3KIPA 4TWAA 1ZGGA 3HADA 1E20A 3T5PA 3B3QA 4AY5A 5A71A 1U4NA 1Y1QA 2WHRA 3JAKA 2YL2A 3MINA 2A9OA 3ICVA 2OVFA 3BTUA 1E9RA 2CDRA 3QKWA 4YJHB 4EM6A 4DIEA 2CNOA 4Z4IA 4LE0A 4OXQA 4JUFA 2TMDA 5CVCA 2CZQA 1CCWA 5AFSA 5J23A 1QC5B 3OIDA 4NZ9A 3UCFA 3EOAI 4KE6A 3RVQA 4UASA 4ZCMA 5A6SA 4EQZA 3N0RA 3R0IA 2A4MA 4RD0A 4UCXA 2WB2A 3QUTA 3AV3A 1CD5A 1H5NA 1MZVA 3GP5A 4YDHB 5KWVA 3MJSA 4DQ0A 3CG0A 1V16B 3VYTB 2CLOB 1L8AA 4RF2A 4MB2A 3TRIA 5D6OA 4BS9A 1QQTA 3MZ0A 4LBZA 1SXJB 5KC9A 1AS2A 3K9BA 4E94A 1KI3A 1NN0A 4OHKA 3LK7A 3BB1A 2NN3C 4G26A 3DDHA 3QV2A 3M6AA 3VVCA 1K5GA 3K2IA 5FO0A 1D2GA 1X1TA 2V7QA 3DU5A 4GOJA 2A7XA 4R9VA 2XZPA 4CV0A 2CMHA 1WSAA 3HZRA 4ZEXA 3ZWWA 2C0QA 3LBIA 3PGLA 1IPFA 1RMYA 3DOUA 5TPZA 4XFJA 3NHFA 4HJXA 4ZJPA 4OLFA 1UBTS 4OHFA 5H3LA 2DSTA 1KO5A 3WGNA 3PYMA 1OY1A 2V7UA 4EOGA 2G1AA 4QQNA 3H9JA 2UUAB 2YKGA 5KTNA 2Y0PA 5DXFA 3I8XA 1A71A 1D4OA 2R85A 1W2WB 2YW9A 3M6UA 4R1OA 4L0QA 3D6VA 5FTWA 4BIMA 2HQSA 3C5HA 1EK2A 2P2NA 2HWXA 4H1UA 3HRIA 4BFCA 2ZCVA 1T24A 3L7YA 4WCVA 1GEGA 1Z4QA 4NPHA 4ZVLA 2J7KA 5BXYA 1Y7HA 3Q7EA 5HZHA 1UKZA 1EFHA 2GEBA 4JA0A 5A3RA 3ZNOA 1OH8A 3N86A 3GW8A 1J2EA 2AK3A 3OSZA 3CE9A 3CHYA 1X8LA 3G0DA 1FJ2A 4P31A 1XJWA 4CETA 3ZD9A 3P94A 3L1UA 3VR6A 3DBHA 1KK2A 1MXFA 1Q3KA 3F5FA 1TZMA 2O3SA 3JX9A 4ZK6A 5EJ9A 5KYWA 3D6TB 1SD1A 2FSFA 2REBA 4ALJA 2CZGA 2OCGA 1QYIA 2PVCA 3BRSA 4PHCA 4G0XA 5JC1A 2XMSA 3F96A 2FPWA 5EXXA 7REQA 1W1IA 3DV9A 3HPQA 1W5TA 1X3LA 2E21A 4BV3A 1ML4A 3H4TA 4R8VA 4J91A 1OA0A 2O23A 4HDSA 2IVZA 3RU9A 2WKPA 5BN1A 1WCWA 3D7RA 4L07A 1YCHA 4MRVA 2C58A 5G0SA 4DPKA 4E11A 2WAMA 4AO6A 2O4CA 2XNDA 3HKCB 2NMVA 4C3UA 4XDGA 4JC8A 4PLZA 5D3MA 5TQ0A 3ZHCA 3UW3A 3L43A 1LUAA 1GAQA 4V2UA 3HJCA 2VYVA 1XRRA 3LP6A 2WPDA 3OWOA 1E3JA 3L7AA 4L4YA 4OU4A 4QTXA 3UOWA 1DWOA 5CX1B 2PXXA 3ZDAA 1J2JA 1N9GA 3I01A 6CHYA 4ZTZB 5KNBA 4OXXA 1A2BA 4S12A 4IDFA 4FMPA 1ZWLA 3OC0A 4OGWA 1ZJ4A 2NO0A 4CQJA 2KE5A 2XODA 2AE2A 3CZ9A 3KOWA 4KI0A 4TTTS 4MK4A 1Q0HA 3A1FA 1O4VA 1JDBC 3RSQA 3D3EA 2IYNA 4DHWA 4Z8XA 5A62A 2PH5A 1W5SA 3EC1A 2RHOA 1VZ3A 1AGRA 1IBKB 3TIGA 1BKDR 4YWJA 2JD1A 3DFMA 2C7VA 4Z4QA 1EK1A 1XDGA 3G2IA 3JAKB 3NV9A 3MINB 3QF4A 4GRIA 1DBSA 2B0CA 3F7TA 4IFIA 4RQBA 2IPNA 3KKOA 3TBKA 2NO7A 3VPAA 3TW8A 4E3WA 3H5AA 4QPNA 1JBKA 4BLQA 4W9NC 5DHUA 4EJ6A 4JSYA 2C5LA 5LB2A 4I5GA 1W34A 3CPJB 3WGTA 3ID6C 2PM8A 1WOMA 2P5YA 2XYPA 4UZEA 5A6SB 3ZHYA 4B3JA 1YHZA 4PX5A 5MF6A 1G4AE 4L8FA 1O0CA 5DMHA 2Q4EA 4MQUA 3NYIA 3OJ0A 4NAVA 3WYCA 1B15A 4LZJA 1YCFA 4G0WA 9MHTA 3H6HA 4DUZB 4AYBA 1L2TA 3HM9A 4N7RA 4JI1B 1JR3A 2IBTA 4AQ7A 1KE2A 2W42A 4DE5A 3SNHA 5ECWA 1XYYA 3L5OA 3C2QA 3HWX1 3L4KA 1JMYA 4TZ6A 1GUDA 3UB4A 2QG9A 4KWEA 4W5WA 4K6FA 4KMMA 3T1YB 3RRZA 1SC4A 4MPPA 1IK6A 3AJ8A 4FZ5A 2PZFA 2CBXA 1V1RA 2MJLA 2B5WA 3R5XA 4J0HA 3W6ZA 1SC3A 5FAKA 1LU9A 2WJJA 4BMSA 1DIBA 4FB4A 2G8LA 1FQJA 4RKFA 2P8SA 4UBNA 1WSBA 3MAGA 1M1YE 4MOWA 3ETHA 4P08A 3A9CA 3R75A 4CL0A 1PDOA 4CMAA 4BL5A 4DIKA 4YUZA 1OZFA 4IIXA 2ADMA 4RTMA 1QVRA 2WSBA 4I4IA 1GPBA 4PXYA 1P6XA 2IQIA 1US8A 3PV0A 2WBLC 2JLQA 2Q9BA 5EMKA 4F4DA 5B1HA 2BLLA 5EIFA 2EQ5A 1UPFA 4EI7A 2ONYA 3F7MA 2BGIA 4KN9S 3V48A 4UUQA 5GGXA 3B9QA 3FZEA 2ZSIA 4I50A 1ILWA 1N2EA 1RAIA 3U81A 2XZOA 2G1PA 3H4MA 1JQ5A 2QGNA 1GD1O 3H04A 4G9BA 1CUVA 1AS3A 1NFRA 1R6TA 2H85A 4GBJA 4LI0A 4P3PA 3T54A 2X1HA 3AI7A 1L5FA 1ZC3A 5JV5A 4Y6GB 3AH8A 4L5IA 3WFZA 3DBHB 4ROTA 5KYWB 4RESA 3LQ2A 4YAFA 2G0TA 4N49A 4QX6A 5MGBA 3QPWA 2JGNA 1D0VA 2EG9A 4ITRC 3WQSB 2HSDA 1ETHA 1GYRA 4AO8A 1GADO 7REQB 1DAFA 3GQVA 4MKGA 1AK9A 1I5EA 5GADl 3HPRA 3KPYA 4BX9A 5KOJA 2POQX 3ZV6A 2PPVA 4HDSB 3K94A 4EZIA 2NP7A 5KYYA 1T5OA 4U2CA 2OPHA 2ZI9A 2O3JA 5HCNA 3MBKA 1WXFA 5IFKA 3PL5A 1ZM4A 4PONA 2EF0A 4X6XA 5D3MB 1JSCA 5H1YA 5TQ0B 1DBWA 5LYJF 2IH5A 3DHYA 4TKUA 4LF9B 5C35A 4MEAA 4RORA 1FL9A 4BTLA 1HWYA 2ZJ8A 2ZYUX 2EW1A 3MMZA 1FVFA 1N9GB 1NULA 3ANTA 2O7SA 1RLTA 1ZIOA 4Q01A 2ZAMA 3KELA 2JHAA 1HEYA 1YHYA 2R48A 3FKJA 2NLOA 3OURA 1QHGA 3HY3A 1RRCA 4RKEA 3FG9A 2IYOA 3JRXA 3WGLA 4GZLA 1XU4A 5KX5A 1CFZA 1G3QA 1XMXA 2B1QA 4DFDA 3CLHA 1T3ZA 3EQ8A 1AS0A 1USVA 3BZUA 2JFBA 3GBSA 1Z0KA 3IT3A 1Y1KE 3IKJA 1Y3AA 5DSTA 4B87A 5IDYA 4EHDA 3QF4B 1B0ZA 1OXXK 2WJWA 3MLBA 1XRLA 2ZRGA 3LDGA 3OE5A 5FXMA 1ISHA 5BQ3A 2PIDA 2VZ8A 4ZDIA 4RCZA 5FPSA 5HBGA 1GEEA 1I5OA 3T94A 1N2SA 1GPUA 3O90A 5K51A 3TW8B 3VQTA 1GV0A 5KUTA 1X74A 2IHYA 5CW2A 4HNUA 3HJGA 3SWWA 3RRNA 4IDAA 4F3RA 4A6DA 3D6AA 4PRYA 4RD2A 1KNXA 2AG5A 3K1ZA 1Y37A 3OEHD 4A4DA 2I76A 1EM6A 3SZMA 4I6JA 1LBSA 4LMRA 5ALHA 1VCIA 2C2OA 4QARA 1ARZA 2A7QA 3M5DA 1ODLA 2WVHA 4BFTA 3CRMA 1BSVA 1PJ2A 2PFGA 2C4TA 3RRBA 4F3CA 1OPXA 4RCYA 2A33A 5F51A 4Q47A 3T9CA 5LC1A 2ZFUA 4OB8A 2R4QA 2Z9CA 1CY6A 1BDMA 1II8A 3S7TA 2VP3A 3DM9B 4AO7A 1KF0A 5FPKA 2VN8A 2FF7A 2Y6VA 5B4UA 2IPOA 3NS7A 5T4BA 3DE5X 5F2NA 2I6SA 1V1RB 3D8HA 4KCGA 4Q9IA 2IY9A 3V8RA 1LLDA 2HU8A 3AVPA 4JELA 2O54A 1THTA 1CF2O 3DVSX 2IYRA 2KS6A 2FYTA 1N3YA 3OMWA 5I9MA 2NZWA 1C0EA 1Z12A 3ES9A 4IJWA 1F4LA 2XVAA 1DLJA 3UCXA 2WSMA 1CVRA 2C29D 4GSLA 3B6KA 4AMGA 3HJFA 1US8B 1ZISA 3K1AA 1D2CA 2OWEA 2ZJAA 4QG7A 3V00A 1Z7GA 4EFLA 3RTDA 3DLIA 2JL1A 1XD2A 1ZH2A 1PRYA 5F4BA 3DQZA 2QN7A 4WTOA 2G08A 1WOYA 3KCQA 3F0TA 2DKNA 3QUAA 1DADA 4I50B 1IN8A 4LSMA 3TRFA 3ZIDA 3ICQB 1PGQA 3RWMB 1INLA 3S99A 1EG7A 2VQ6A 3FHOA 4QTUB 2AMJA 5J2TF 2ZJFA 2G83A 2XB4A 3L1IA 3Q6NA 4RSMA 3D6HA 1Y1TA 4QYIA 4BNJA 3A26A 1IRIA 2V0NA 2QNBA 3N8KA 3I53A 4O5OA 1I0ZA 3RC8A 3ORHA 3MTAA 1KP9A 2HWUA 5F2OA 1U6JA 1PWHA 3UXYA 3WRYA 2Y67A 1JIIA 2VNSA 4IJKA 1UEIA 2VF7A 3H2YA 4D0LB 1NR5A 1EHIA 4QXQA 4OFXA 2Z6VA 2GHQA 5CIWA 4D56A 3DMTC 5E1OA 5KOJB 3ICEA 5JTUA 2OGTA 1RZVA 3C3DA 3OMXA 5KYYB 1QP0A 1OZAA 3VR2D 2ODNA 1CZOA 3W6OA 1H0SA 3U3RA 4AY4A 5CVTA 2Z9BA 2RH8A 1IZ8A 4E51A 1NI5A 4TKUB 4BKOA 4QL3A 1FVHA 2HV9A 3NVAA 4PG6A 3CUVA 3IR6A 1WL8A 4Q15A 3H2JA 1H4SA 2BGJA 2BE5D 1HDGO 2DBQA 4EFKA 5C3UA 1UPTA 1E2IA 1W47A 4FXDA 3OWXA 1QZXA 4L0MA 3FFXA 1A69A 3OO0A 2W11A 3Q9NA 4ZHQF 4EFMA 3WDSA 2JLCA 2ZULA 2WWIA 1GL7A 1NMYA 2JIZA 1VPDA 1GQOA 3VH2A 3I23A 5KX5B 1WETA 1EP1B 1QRAA 1ESMA 4A6PA 4HEA1 2FMTA 4EECA 3Q3VA 5HOQA 1FYFA 1JR6A 3G13A 4FN4A 3F78A 3WMWA 5D85A 4PINA 3FJOA 4JP8A 4LJ4A 5A5VA 2ZRJA 2O8VA 5TPWA 3IQXA 1L5GB 2ECFA 3BBPA 1FBNA 5TQJA 3NJRA 3M5PA 2QE6A 3OZSA 1RJEA 4J4HA 2YQ4A 3Q0TA 4TSFD 2GF0A 5KVQA 3CZMA 2HPAA 2HDNB 1H2RS 5JD4A 3ZDBA 2LP4Y 3NWJA 5IK2D 2WVAA 2X8AA 5E9WA 1KVRA 1Q1BA 2TMGA 4FLEA 4K03A 1RIIA 1Z7EA 2PIAA 3HLKA 1UPUA 4OVKA 3W6PA 1JIXA 3FYUA 2O8DA 4J0FA 4BN0A 4N82A 4X60A 2PUCA 2ID9A 2CWDA 1GRCA 4I5FA 2WM3A 5B7GA 4NV3A 1Q21A 3TDNA 4C20A 3M4NA 3W8DA 1J8YF 1DAOA 2YFHA 3GB9A 3O31A 4F3EA 2QVXX 2ROQA 2VTKA 1D2MA 1II8B 1NA5A 3AF5A 2Q3BA 4GC5A 2EWVA 1KC1A 5CXQA 3G5TA 2C07A 3GD5A 4CLHA 3TIFA 1ZDMA 4EHFA 4B5LA 4ZEMA 3O47A 1IPHA 1GCUA 3WWPA 1Z7WA 3F74A 4CMKA 4QBKA 2W2MA 2LD4A 3WRXC 5LMUB 4NI5A 4BQSA 1G2QA 1QFZA 3BQ9A 4MA4A 4H3TA 1LSOA 2G9RA 2QD4A 4AUMA 3WQBA 4BNXA 5AW1A 5CLLA 2GVNA 2HWWA 2R6DA 3LU1A 2PMDA 1V5WA 3LKDA 3NAQA 4HEA6 1P7ZA 3LNTA 4Q16A 1Z9BA 1DIHA 3K1AB 2EQBA 2Q3MA 1G17A 3BCSA 2ZUSA 3IAM1 1IHDA 4IY1A 4FMCF 4GP7A 3T38A 1XD2B 1ETUA 2NX2A 4BMDA 2J5QA 1R6VA 3VZBA 5K05A 3ORRA 3AJDA 2VF8A 3T7TA 1D2EA 1HGXA 2XYQA 3ETNA 3PUJA 3QV1A 5FFNA 2JCVA 5L6LB 3FVWA 5JD5A 1W5BA 4IW3B 4JZKA 1PWYE 4DILA 1CV2A 5KTRA 2B34A 3IEVA 1OFVA 2AR7A 3THOA 3BH6A 1Q74A 3H1GA 3C4VA 3R5SA 4OHYA 4QYIB 5F5XA 4ZVOA 1U1DA 2A86A 1GPYA 3B7WA 4WT7A 5HHTA 3SF0A 3F97A 3HJUA 4FHFA 1B2LA 1WCIA 3ESBA 3IDSA 2XUZA 1FFAA 3OF5A 5F76A 3F6BX 5L3ZA 4EVIA 1OASA 4C04A 1S6YA 1OXSC 2BI7A 3IAS6 4O6VA 1MP0A 1X0VA 2JKZA 1DX6A 3SYKA 3V7NA 3D43A 4WUTA 5E2BA 4O59O 1QDUA 3UG6A 4NC9A 1K8XB 3VYWA 1TAGA 3ZHTA 1ZGZA 4PLTA 4V0MA 1PTKA 3AFGA 1KQOA 4FQ7A 1IM8A 2WJ3A 1QQ5A 4HWKA 3HB1A 3DTVA 3FE2A 4X45A 5JI2E 1YA8A 1U5AA 3PEYA 3K53A 2AB0A 2GKSA 3B38A 1DB3A 4GRAA 4H7JA 4HTAA 3P9CA 2GN1A 1GPKA 2FSVA 5E8RA 1K66A 1RPNA 2N1BA 1OIVA 1J2TA 2AOVA 2VDPB 4NF2A 4Q82A 2W22A 4ZCQA 4B6SA 1KYYA 4B3MB 2R00A 1PIWA 1PS9A 4JYCA 1RC1A 4ZDWA 4TV8A 3IAM6 4IDHA 5FPYA 5JU6A 2O0HA 1CWUA 2Z8YA 1EFLA 1TPZA 3P0EA 2B8WA 3SJRA 2AF3C 1RAGA 2PT7A 3EXAA 4LAFA 3K92A 2VYQA 3RARA 4TROA 3VAAA 4B2IA 1A5ZA 4EP1A 4HB3A 1R6AA 3QA9A 3GAAA 2OFWA 1SBZA 2Y93A 4EMBA 3HS3A 3GUUA 3N0VA 1YH3A 1P9WA 2IGTA 3HV2A 2Z9DA 4J0DA 3P96A 4Q19A 1E69A 4LNUA 1P2GA 5TPWB 2A9RA 3T12A 1ORIA 1YNND 3GVPA 4OIFA 1P0PA 5EE5B 2CF5A 2VHTA 3BRWA 1X80A 2ZE7A 3MRXA 1G9SA 4IEIA 4MVJF 1H5QA 5DTMA 4E46A 4YV7A 3QYFA 4LWOA 1E2EA 1XNHA 2F9LA 4JL8A 4Y1RA 1ZIDA 3ND7A 3EBOA 4I3FA 4RKYA 2VP6A 5KQSA 3VKFA 2PBLA 3C14C 3LUDA 4KU4A 2O0LA 4US2R 3INGA 4CKBA 5EPEA 3FYUB 1MABA 2O8DB 1FW6A 4CT4B 4OSOA 3E2PA 2WFZA 4LHYA 3GC6A 1UR5A 4LHVA 5GV8A 1JIVA 4L4SA 2XHZA 4YQEA 2QUKA 1U65A 4PTLA 2HO5A 1GZHB 4EG4A 2GEKA 4QJ3A 2Z1NA 1QYDA 4E31A 1LTQA 1VKZA 2YW2A 2O9JA 4EUSA 2PGAA 4GPIB 2AMVA 4PHHA 1A35A 4JJGA 3TBHA 1I3LA 1LZKA 4BBAA 1MB3A 1S2DA 4KSBA 2BH9A 4Y3UA 3ZOZA 1KKMA 2P6PA 3WKBA 4C7JA 9GPBA 2YC2C 4RL4A 1SQFA 4GI1A 2O3UA 1F60A 4C4YA 1EB8A 3DLBA 2XZDA 5BMVF 2ZSDA 4KX5A 4MMZB 2ZUBA 4P3XA 2GO1A 2Q5FA 1KE1A 4HYQA 2C5HA 2PZGA 3OY7A 3NPAA 3IP8A 5TGTA 1RHRA 1QH8A 4LN1A 1AQUA 1L1QA 4N7JA 2QZJA 2VZ9A 5EKXA 2FJPA 4BKPA 3H5NA 1KQ3A 2ZYGA 2JLSA 4JITA 2H5LA 4A91A 2QZ9A 5F4ZA 1EQUA 4PYKA 4Q3NA 3RTBA 2IEAA 1VE3A 3NT2A 2H5JA 2I6QA 1BRTA 1ZX1A 3SI7A 2KQUA 3UKJA 1K27A 3PEEA 5JD6A 3QLEA 2Y71A 3VAZA 4TZKA 4TS3A 2WU4A 3M3HA 1WCIB 5DHQA 4DG9A 4ZIRA 5A4JA 5IAOA 3VHQA 4F92B 4IV0A 2C9MA 1GPAA 3O2NA 4PAOA 1LBHA 4WKBA 3RYFA 1HRKA 4FCCA 1CU1A 3P5BA 3N9IA 4WXPA 2YY7A 3KQSA 4QNRA 4JSRA 4P4TA 3LUJA 4GZ5A 1AM4D 1LC0A 4UHDA 3VDRA 4F8EA 5L4LA 4RIFA 3VR6H 3ISTA 3O03A 4RPCA 1XTTA 1D8TA 4D9EA 1I80A 1WB5A 4TYWA 2VATA 4G1FA 8AT1A 3WMXA 4NNPA 5HIJA 3PGKA 5J63A 3DTVB 3U7QA 1F6DA 1SXJD 1CIVA 2OUIA 2QMQA 2QTCA 1VA5A 4E5SA 2R97A 3A28A 1BIFA 1OGYA 1XCJA 2O1EA 5FB3A 5JZSA 4UCFA 5CDFA 4WBNF 3I0NA 2H1HA 3AC0A 3RNOA 1KJ9A 4GXTA 2QYSA 1W1WA 2A0FA 4HN4B 4PC3A 3W1VA 3EGCA 4YIHA 3NEPX 1T6YA 2J5KA 2PS1A 1HE5A 1SIBE 2RC5A 3QLUC 4MV8A 2O2CA 2JI6A 1DC8A 3M6VA 4N6GA 4TV8B 5A3QA 5CDTA 2BGGA 1SZDA 3MT7A 2EBWA 1Z5ZA 3RS5A 1KARA 5EINA 1ZC4A 1SU6A 2C2KA 3O84A 1GCOA 3IB3A 5KNBH 1NP6A 3IDQA 2VBIA 2ZTVA 3EA0A 4B7XA 1GTL1 3IIEA 2VRCA 4CLOA 3IAFA 2WIBA 3EDYA 4D8WA 4Z5XA 4LNUB 1R5NA 2UDPA 2UVQA 1YVRA 3MJTA 1EBFA