4D3ZA

The structure of inactive prolegumain from chinese hamster, trigonal space group.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
406
structure length
389
Chain Sequence
AGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHSTSSPISLPPVTRLDLTPSPEVPLTILKRGQIQRLLDARHVIEKSVHKIVSLLAGFGETAERLLSERAVLMAHDCYQEAVTHFRTHCFNWHSPTYEYALRHLYVLANLCEKPYPIDRIKMAMDKVCLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROLEGUMAIN
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
total genus 145
structure length 389
sequence length 406
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4d3zA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3zA01
2CNNA 3P45A 1RHRA 3EDQA 2P2CA 3GJRA 1K86A 3QNWA 4FGUA 1I4EB 4NOKA 4NBNA 4JR0A 2C2MA 1NW9B 4IEFB 2QLFA 4I1PA 4QULA 1K88A 4ZVQA 2FUNB 1RWPA 4JJEA 2H48A 5IAEA 1NMEA 3DEKA 5IBRA 2H5JA 3V6MA 4AW9A 1RWOA 1RHQA 2CDRA 4FXOA 3R5KA 2HBYA 4NOMA 3H0EA 4ZVRA 4NOJA 5I9BA 5IAGA 5IASA 4ZVUA 5IARA 4QTXA 3V3KA 1GQFA 1BMQA 4N7JA 2HBQA 4DCJA 3R6LA 4HQRA 3P4UA 5IAJA 1QDUA 3D6FA 4AWAA 4DCPA 4JJ8A 2CJYA 4JR1A 3H11B 4EJFA 1NMSA 4HQ0A 3S8EA 1NMQA 1PYOA 3PD1A 2J32A 2HBZA 3DEIA 4HVAA 4QU5A 5LU9A 2DKOA 3NR2A 4JQYA 3SIPA 5JFTA 2CJXA 3BIJA 3ITNA 2AR9A 4IYRA 3R7BA 5IAKA 3S70A 3DEJA 4JQZA 4ZVPA 4ZVTA 1F9EA 4LSZA 4QUGA 2FP3A 2QL5A 2J31A 3EDRA 3K7EA 1QX3A 4JJ7A 3NKFA 2J30A 4QU0A 2H4WA 3PCXA 1RHMA 3V55A 4N7MA 3IBCA 5IC6A 1RE1A 1SC1A 4M9RA 4EHHA 2FQQA 1KMCA 1SC3A 4JR2A 3KJQA 1SHJA 1F1JA 4QUDA 1I3OA 3V4LA 1I51A 4D3ZA 5IBCA 2Y0BA 1SHLA 3SIRA 1CVRA 3PD0A 3D6MA 4QUBA 4EHNA 1RWKA 2H5IA 3GJQA 5LUBA 2WDPA 1ICEA 4D3YA 2XYGA 3DEHA 4NBKA 4QUIA 3UOAB 1JXQA 2H65A 5H0IA 4PRZA 4QU9A 1RHKA 1RWNA 3KJFA 1M72A 2HBRA 5IBPA 4EHKA 5K20A 2CNLA 3KJNA 3R7NA 3H13A 1RWXA 4EHLA 2C1EA 2XYPA 3GJTA 2QL9A 1RHJA 4N6GA 4FDLA 5LU8A 3OD5A 3UO8B 3D6HA 2H51A 1SC4A 2XYHA 3R6GA 1RWVA 4JB8A 1RHUA 4PRYA 4QU8A 4NOLA 1IBCA 1PAUA 4N5DA 4AWBA 4QTYA 5IANA 3NS7A 5IC4A 1I4OA 2XZDA 4PS1A 4QUAA 3R5JA 4NBLA 3R7SA 2H4YA 2K7ZA 4ZVOA 2CNOA 2QL7A 2QLBA 1RWMA 2Y1LA 1GFWA 4I1RA 4EHDA 3H11A 3H1PA 4DCOA 4N6NA 4D3XA 4EHAA 4QUEA 3RJMA 2C2OA 2NN3C 3IBFA 3GJSA 2CNKA 5IABA 4QUJA 2QLJA 5I9TA 4PS0A 4FEAA 3V6LA 1CP3A 5LUAA 2J33A 4EHFA 4ZVSA 4QUHA 2C2ZA 2XZTA 3E4CA 4N6OA 2C2KA 1QTNA 3V4OA 1RWWA 2H54A
chains in the Genus database with same CATH superfamily
2QTVB 1P7CA 3VPBA 4YECA 3FNIA 3P20A 5JD5A 3DBRB 5CR9A 2OBNA 4CG2A 2I6UA 3G79A 4J7UA 4O1HA 3SVZA 2PRIA 2Q8PA 1VIDA 3W2HA 2GFHA 1OV4A 2FEKA 2X9GA 3M9LA 2J5BA 2HWUA 5KAPA 3WISA 5JDIA 2I03A 1U3CA 4DLSA 5I7SA 1WUYA 3F1KA 2GF2A 4NYIR 4P5EA 3BCHA 3I8OA 3UNXA 3VISA 1N57A 2AQ8A 4OHXA 4I81A 5FV7A 4C3OB 1HFEL 1YS4A 4ZT3A 3AF6A 1T4GA 2I65A 4F3CA 3KYIB 2VPPA 4JUIA 4B81A 1GQRA 3FTCA 4ER3A 1ZQ1A 5JY6A 3LBIA 1T36B 2W8BA 2O2GA 3UBMA 3VVBA 3PJEA 2JI8A 3B20A 3I5AA 4DEYA 5EGNA 1P4GA 1FFDA 2VAMA 3UMFA 4BGIA 2W2MA 1MC1A 2XWPA 1W4AA 3Q8MA 5IEBA 5C9HA 1GPJA 5A04A 4HF7A 1CUZA 1OFIA 1P2VA 1PWZA 1UZAA 4B76A 5TS2A 3Q98A 1WMEA 3T7KA 2Y8EA 1UBGA 1W1IA 5DYNA 1ZLYA 1RKVA 3P4XA 3DLTA 3SDZA 1EGVB 4ME6A 5H5JA 1BYIA 2P9ZA 2MYPA 4NQRA 3RVSA 1RJ9A 4DLXA 5C8ZA 2YNMA 3VNRA 1THMA 4KWEA 3WR5A 4E30A 1Z7GA 4IXTA 3Q11A 4UBIA 5ALVA 4Z86A 2O0KA 3PGMA 5GONF 4HGRA 5WRFA 3O84A 3PNPA 1FFAA 1SEPA 1YVDA 4F9EA 4N3NA 5JG7A 4EG6A 2HA3A 4WWHA 3TGWA 3ZPXA 4M8IA 5EIEA 2FWNA 1NP6A 2G67A 3BUSA 2Z83A 2RAVA 3LG2A 4KLCA 4X1KA 1KDOA 2G9RA 4MW1A 1HOTA 1JI0A 2VP6A 2OGSA 1F2DA 1K9SA 1JF8A 2JS7A 2B1RA 1IOZA 3HQ4O 4IIJF 3UOAB 5HOEA 4WNIA 2F8TA 3R9XB 2FQXA 5JFOA 3UQZA 2WK1A 1L5RA 1H4TA 2XJ4A 3H8WA 3MGCA 3MT0A 4YMSA 3DB1A 5AK6A 2M9MA 1QS0B 2W4MA 3A2MA 4UATA 5JZMA 1XR3A 4EI2A 3IP5A 4F6RA 5JMTA 3F6YA 4PX3A 5MHTA 2F4QA 3UMBA 3PYLA 3WRYA 2AQHA 4TYNA 1TK9A 4YRSA 5FNZA 1OXBB 4UHCA 2PL1A 2Q6IA 4L28A 1IPEA 3NHRA 1P2TA 1Z2DA 4D92A 1FYFA 3AKYA 3EH2A 3K0KA 4CLRB 1QKJA 4BQQA 2AD1A 1P81A 1XRPA 1SC4A 1DHRA 3CPJB 4OP1A 3VR3A 1VPTA 3Q0EA 1ZUIA 1QIKA 2Q9UA 1BWRA 1BYUA 2AEFA 2R6R1 2X6RA 3H65A 3F6SA 3OM0A 4IOKA 4B4VA 5IPFA 3TFWA 4C7OA 1T3SA 3T9EA 1I2BA 1MDFA 2G63A 3Q2OA 2FMUA 4HGPA 4FD2A 4RCYA 4NBLA 4W8GA 4B7CA 2LKCA 3KYDA 3FIJA 3MWLA 3N2GB 2G1UA 1BOFA 1FZQA 2IQIA 2QMZA 1H94A 3C6KA 3OC0A 4DMHA 4E51A 1WBDA 4Z3DA 1WZIA 3IIMA 1GJRA 4KO8A 3STHA 3JATB 5IM4F 1V8FA 3JQAB 3HK2A 3QBDA 2Y93A 5ENZA 3HLTA 5C32A 4WY2A 3ISJA 3O8QA 2XXBA 3B1VA 1MC8A 3WP0A 4WAUA 4KBYA 1VMEA 4H4DA 3QLJA 2FYTA 1HEUA 2O8FB 1X1CA 3EQ9A 3WQQA 5JECA 3L8DA 4B43A 4FFWA 2WF8A 3GMTA 4G5SA 4KFCA 4ID9A 4C5CA 3AIKA 4DV5B 4WDQA 1RRJA 4IO1A 5CLFA 4P22A 2Y1DA 3A9CA 3HS3A 1HQYE 2IYWA 3BGVA 3WL8A 3FGPA 1JQLB 1BKYA 1ZP6A 2BFEA 5TEWA 4QQFA 2HKIA 1QWSA 4D9JA 1ND5A 1CJKC 2X8WA 1F0KA 2B3TA 3S1AA 1G7CA 3DDUA 2PMDA 2C4TA 4PQYA 4YMUA 3PR1A 1LFDB 1G55A 1R0YA 1LBTA 2WG0A 3IBSA 4WOKA 5EJMA 4AJHA 4DSUA 5JC1A 1JUDA 2R7KA 2WTXA 1Z45A 1E7RA 1EB8A 1YBHA 2FWPA 2PFSA 3L05A 2ZRCA 4M1EA 3C3BA 4WW0A 2ORWA 1E4OA 4CDNA 1ZNQO 3JS5A 4OJNA 2GZSA 3PNOA 1XDSA 3ANNA 3G0IA 1Y3BE 2O6LA 3L01A 5C8VA 2P40A 4EJSB 2YRXA 4LWPA 3BFVA 2V1XA 5MGBA 3RNLA 3JYQA 3NR2A 2HHHB 2IOQA 2YS6A 2W8ZA 4U8HA 3FPEA 5E6SB 5K0CA 1WP4A 3ICEA 1UEJA 5H7XA 2WUDA 1U2PA 5FA5A 4ZFNA 1UXIA 5BUCA 1KIMA 1JAZA 3H5NA 1VGRA 3DL0A 4I50A 1IRXA 3FZQA 1NFQA 1HTBA 1MV5A 5HF6A 1S1MA 1W5SA 3ENVA 3G6WA 5AHOA 1X7ZB 3ZBQA 1H2FA 1QIEA 1L5ZA 2B37A 2QSZA 3N6RA 1EK1A 1B42A 3RVBA 4JI0B 3A3NA 1FS5A 2WNSA 2QPAA 3A9SA 3LQKA 3O83A 3AR4A 4F93B 3F8TA 1IG3A 2ERXA 2IHZA 1TFUA 2EVWX 2GTHA 3UAWA 4BNYA 1LB1B 3GIDA 1Y48E 2IYSA 2B7CA 1BS1A 5H3LA 3A32A 4LISA 1UJ5A 1PJ8A 2YWCA 3TL2A 3AEKB 2YVLA 4QO8A 1KWKA 3EZ6A 1MJHA 4PO9A 4P36A 1NTRA 4PR0A 1P31A 1N0HA 4JL6A 1ZEMA 1G21E 1CQXA 4XVQA 1PEYA 4R9NA 1XFDA 4HWGA 4MKHA 1CF4A 4CE6A 4LOJA 3DZKA 1I7SB 5D3QA 5GPBA 4AJJA 4LRWA 2C4KA 3E3MA 4XDYA 1VPVA 1EFPB 2OOSA 3C16C 5GOTA 3ZWDA 4RSRA 5I01A 5JU6A 5JLJA 1JTEA 4I3HA 1ZIDA 3I58A 4RVCA 4N76A 4YBRA 1ZAYA 4DIKA 1FLDA 4GFDA 4PYIA 3D8SA 1RAEA 1BRMA 2R2GA 2QL7A 2IOYA 4RFSB 3DAGA 3UJCA 3ZXYA 1NXXA 5L4LA 1Y7IA 1C4WA 4DAOA 5HNKA 8OHMA 3TBFA 5G4KA 4I55A 5JRDS 4TT3A 5EPEA 1DAMA 1AS0A 3S28A 4MQ5A 2G0AA 4BFCA 1UXJA 4M60A 1V71A 4HDQB 1W48A 1NSFA 2G06A 1TE2A 2XDWA 5I7WA 1QTRA 5KQGA 3ZN2A 4PAOA 1GRQA 3L8YA 1H4SA 4UQPA 1GKKA 4KODA 1T6NA 3OECA 1RXVA 1ESDA 4R40A 4HX5A 1MEJA 5TPZA 3V80A 3EVTA 1UDWA 2WVGA 3ABSB 3NPMA 3CZ9A 2QI9C 4K6CA 5IK2A 2AL7A 1XE3A 2IE0A 1G8SA 3N0VA 1RC8A 4Y2HA 3OPQA 3KD3A 3X1XA 4CIAA 4P58A 1MUUA 5FNVA 5AIBA 1GGKA 1VKJA 3EZ9A 4AQYB 4CR7A 3PWZA 4XPZA 1JFFA 1W30A 2JA1A 1XMQB 3OA2A 4NICA 5T4EA 2B2NA 4P6VF 4AECA 5JMOA 3SOZA 1QTQA 1NASA 2OVFA 1DV1A 1TD1A 3O8DA 1Y5IA 5E9JA 4ZCLA 5LOVB 3IKTA 1OFTA 2Q8QA 3RUCA 1GHTA 4C76A 4MGKR 1MB9A 5BQ5A 4LUCA 3PEVA 3OKPA 4DCJA 1BJKA 1BQ3A 2YV4A 1QH0A 2OHGA 2VCEA 1V1MB 1SB8A 2F1IA 1VI6A 3ND7A 5FL3A 3RKSA 4HWSA 3PDJA 4J2HA 2DFTA 3IVGA 5FWYA 4IHKA 1UBJS 2Z98A 2TYSB 1A7AA 1PS8A 1F1BA 3BIWA 3H84A 4QSMA 4Z1MD 1A1SA 2DFPA 2PL5A 4MPTA 4YRBA 2VTBB 1SAYA 1UJNA 4MS1A 3M81A 1E2FA 3FUUA 3SVTA 3COJA 4CNQA 1E3LA 1N0VC 3RU9A 5KJ1A 3EDRA 3OZSA 4CMKA 4CEIB 2R85A 1YAHA 2REXB 3I4CA 1XZGA 3K5WA 3M6AA 2XVZA 1PJQA 1XU4A 3CWQA 4QU0A 1KDVA 1M2GA 1NHWA 4YV7A 3S4YA 3WGIA 4MKZA 4UVEA 5KDLA 4EENA 5BSWA 5ALUA 1GILA 1SU6A 1Y1QA 4QKQA 4BLOA 3RFVA 2F8MA 4B6JA 4BE7B 4XB1A 5CG1A 2BAGA 4P8RA 5DI3A 3GQBB 5HCNA 4C14A 4D3ZA 1EX7A 2E5FA 1PR5A 4ITVA 3OIWA 3ESBA 1AB6A 5COAA 2XUZA 3WRXA 4E70A 2AG0A 5T41A 1N9ZA 2AXNA 4CR6A 3OO0A 3WMGA 2IITA 4OQNA 4HEA1 5C37A 1TKRA 1YD7A 1ZPDA 5K20A 2X4IA 1EP2B 4WCFC 1HPLA 3D43A 1C2YA 1RQRA 2REOA 1E9FA 1AA6A 1GV0A 1VIAA 1KP3A 1IAQA 1TU3A 1O5TA 1CWUA 3FHLA 1YIOA 2ZB4A 3R5FA 3MWDA 4N7BA 5B58T 1QB8A 3L02A 2ZRQA 2D0IA 2XYVA 3GJ6A 2CFSA 3ROMA 4ZOLA 4IHJF 4J0CA 4UNRA 3PENA 3TAXA 3V7FA 3L6BA 4IIFA 1RWQA 4ZQIA 2BV3A 3KEMA 2M6LA 3DVAA 4MMXB 3BTSA 4EFKA 1V26A 1QM5A 1QRTA 2UXBB 3FTQA 2ZT7A 2IT1A 4M1KA 4Y2JA 3NANA 3NGLA 1NW8A 3MCUA 2ZE8A 1K8RA 2PXAA 3WHKA 3LXUX 4MHSA 3WLSA 1TTHA 1MVOA 2BF4A 3D4PA 3QXGA 3E1SA 3D7KA 3I8SA 1AKWA 1Z15A 4K46A 1ORIA 2FQWA 1PTJC 3E8MA 3UCXA 3T3MB 4JEIA 4KI7A 3JQ8A 3HWX1 1WLYA 4KVFA 3GNLA 4RC9A 4NCNA 3UQYS 4DHEA 4YRMA 4FEYA 1YQWA 2Q1YA 4O4LF 5G4LA 3HWRA 2R84A 1JYFA 3EVNA 1URPA 3A4LA 3TOSA 1RJWA 1XTTA 4PZYA 3FWPA 3MJEA 1QQ5A 2ZUUA 1J8FA 4N0QA 3SJUA 3R74A 3U5TA 4B6SA 4FLFA 3J7AC 2YXBA 1EUCB 3I05A 3K5IA 1LBEA 2B4RO 4TTIA 4WKOA 3IURA 2VA8A 3M70A 4F86A 3F71A 3U1BA 4H7DA 1FW8A 4F8YA 1TIKA 5DASA 3ZTYA 1YDWA 2QZPA 2WYOA 1KVTA 2DWPA 5KYXA 4FE7A 4EW3A 4AJEA 4CCYA 4NOJA 2JLWA 4HDNA 2PYDA 1W76A 3EEYA 2VEOA 1E7WA 1R3DA 1T8YA 2IKSA 3WVNA 5HFJA 1RQNA 2W9XA 1YB5A 3G2KA 4FFBA 4TXHA 4H16A 4B4DA 5JAOA 2PJRA 1PNOA 3CRNA 4JP8A 4BFYA 1ZM3A 2XMDA 3DL4A 3T9DA 5BMVB 4BVJA 4EOGA 5CFZA 1YOVB 2PAFA 5IXSA 2PWBA 2F2TA 4PYKA 1E0KA 4RIGA 4OJTA 2WE8A 3A31A 3HABA 5I9SA 3KXPA 3TLZA 2B8JA 5B4UA 3SM3A 3RV4A 4Z0NA 1LRKA 3DXFA 1G6OA 3HKEB 3PX3A 1PVVA 2QD5A 3ACBA 4I08A 1OBVA 1V43A 4MV6A 4DIBA 9MHTA 1IVNA 1QCCA 3V4ZA 1DO8A 4CWAA 4BLSA 5HVNA 4JMPA 3LUPA 4D7AA 4LEIA 2NTJA 3ED5A 2J4CA 2PL9A 2YNMD 3FYHA 4KDFA 3UJ8A 3WK4A 1G7SA 6ADHA 1FQOA 3T12A 4OAPA 2Q6KA 3FVRA 1IE3A 1HURA 3W6UA 2AFIB 2XXAA 1L4GA 5CCXA 1QP4A 3F3SA 2XUGA 2ZJ3A 3THWB 1IVYA 2X1LA 3DR3A 1GQQA 1ZLXA 3L3BA 4QYIA 3GRPA 4MICA 3VHRA 4ES6A 1GEEA 1QIIA 3BQ9A 1XZFA 1SXIA 4W1PA 1RZRA 1YQUA 1NC1A 1W8IA 2CNBA 2V6BA 1Y5LA 3ZR4B 4DMMA 2F9MA 2Y2VA 2R4TA 1WZUA 3AXSA 4R01A 3BGWA 4ZDJA 2CV1A 3PI7A 1OOEA 2H51A 3G3EA 4OHRA 2BMDA 1RIFA 3UB2A 1Y1WA 2QX4A 1GY8A 3C48A 3L8HA 2C99A 3NT5A 4UUNA 1KEWA 1AY0A 4BASA 3COVA 4FFVA 3FLBA 4UBKA 1DB3A 1MR3F 2WI8A 4M8LA 3FDZB 2V1UA 3CIFA 3SQWA 2XZDA 4PX2A 3NH6A 3C70A 2VT7A 3AJRA 3H8SA 3TIGA 3UJHA 3R0ZA 4A5OA 5IFLA 3OFND 4BLWA 3KT3A 5F33A 5TSDA 2F3RA 3WXBA 3ZQJA 2QJRA 3U4IA 3RADC 2WHYA 3TR5A 2XQFA 3C1UA 4MRPA 4P4UA 2NP7A 3ELBA 5ENDA 3G9UA 3KOUA 3EQ2A 3L93A 2A0YA 2WWIA 2VCYA 4OQEA 4UPVA 4O4HA 1HMYA 2IYZA 1G2IA 4C4ZA 4PNEA 2VYQA 3L9WA 2HMVA 3H9BA 4INPA 3T1OA 3OKFA 2PD3A 3IH5A 1PL0A 3O74A 4CKEB 5GINE 2EKLA 4LVUA 3NM4A 3MUNA 1P5RA 4LY0A 1SUWA 3AERA 4GEKA 2IS1A 2DHRA 3AF0A 4G6ZA 2P2CA 3ZDQA 3GIWA 3WKCA 3ZI7A 3HEMA 3ZIDA 4HUTA 4YGXB 4TLCA 2X5JO 4NY1A 1KR2A 1UP6A 4RD0A 3SQLA 4E21A 1XC7A 2HT1A 1IB6A 1UBTS 1YE3A 4MYUA 3QYAA 1QRAA 1FS4A 3FCYA 3L7OA 4G4SO 4GPEA 4KR0A 1O5OA 2VKQA 3STXA 4BNWA 4RD1A 2GNPA 2RGUA 3SNKA 3PK0A 1P1FA 3LQFA 4NATA 1PR4A 1GCGA 1MQ8B 3FWZA 4H3SA 1E9VA 4QOEA 3PIIA 3OT1A 3IPLA 1V8ZA 3KC2A 3EB9A 4HQRA 4DV6B 4LQLA 3VTZA 4AFNA 2O4UX 2QW1A 3WFZA 1U8XX 1WUTA 3GMSA 4QYWA 5HE8A 1CY8A 2FXVA 4Z7JA 1KWGA 5KU1A 4NJMA 4G1UC 3RU2A 3WV5A 3ZHYA 2GN1A 4KQEA 1A9RA 1M3SA 1OZ0A 4YCCA 2AOVA 5KUTA 2BL4A 3FPJA 1W25A 4GKBA 4PEVA 4TUYA 5IAKA 2B5WA 2QNIA 2C04A 4HWOA 1ZRMA 3GP5A 4QNMA 3VPFA 2FN8A 5ADWA 1XAIA 2KPOA 2H1VA 4NCJA 1OBCA 2M1XA 1FDSA 1GNTA 2PN1A 3H83A 3MMNA 3A4TA 2COUA 4P08A 2J0QA 3DBHA 3PQ8A 1O87A 2HFJA 3TB6A 4K9NA 1VP9A 4LRQA 4TYQA 2CCKA 4EHJA 2NU7B 4YC7A 1KAOA 3CZQA 4RLFA 4D98A 3ZJTA 5CVDA 4YHHB 2BRUC 3PR3A 3HTXA 1TEXA 4ZV4A 4R7ZA 1XK6A 4I5GA 2V03A 2DTEA 1CZLA 2I3DA 3GCDA 1R9MA 3O8BA 3QELB 16PKA 4C2TA 3JZAA 4HDKA 2H8KA 3GI1A 1YWGO 4Q7MB 4BQOA 4E4YA 2WDZA 4FD3A 1U8YA 2Q3CA 3UPTA 1VGQA 2XNCA 3SS9X 1OF1A 3DLAA 1VIYA 2GM9A 1T24A 4I1OA 4XTRA 3X1JA 2POCA 2YIJA 3DOUA 3VHQA 1UMBA 3W3AA 4KDRA 1JPJA 3SF8B 1UT6A 2Q1SA 2B4TO 2ZBDA 3CRW1 2DQKA 4M22A 1NR1A 4N5HX 5FORA 3RS8A 3NLLA 4D4GA 2G1JA 4PYJA 5AR1A 4R8LA 4B85A 2BM8A 1SD5A 3PC6A 3E27A 1ZK1A 1XNJA 4H7KA 4PRYA 2HSEA 1FXWF 2H18A 1M8PA 4HDRB 1PVDA 3U1TA 2RIRA 1WB9A 5J58A 1EAYA 2AOWA 2RAPA 2X4LA 3Q7EA 1DAKA 3V7YA 1E9EA 1EAMA 3SFVA 5BN3B 1M6VA 2PYIA 3PFHA 3QVLA 1M1NB 2UDPA 5ALWA 5JAIA 1C0LA 5I5EA 1EX1A 1FDUA 2AMLA 3SX4A 3GD5A 2H3EA 5EWJB 3SE0A 5KTRA 5LWQA 4AKHA 2E4AA 1I50A 1FLNA 3CJTA 1IU9A 1MJGA 3D7NA 3E5MA 5DF1A 1U65A 2KYRA 2P5UA 4KXFB 5FI1B 2YN4A 4IZ6A 4BB0A 2IJGX 1RM5A 3FZEA 5BWOA 4QM7A 4WINA 2C8KA 4GOLD 4IJQA 4KR6A 1RXUA 3D9QX 2CXPA 2JLBA 2CWDA 4Y9RA 4JVLA 1JDVA 3X0DA 2A1UB 4HPWA 2ZVQX 1E5VA 4P98A 4PZ0A 5ESWA 3S6JA 1DBSA 4DPKA 1QHIA 4WA7A 4JWKA 3IDOA 4K3UA 2IH4A 3WZMA 2PCLA 3DAOA 4O5AA 3NH9A 5KU7A 3OOHA 1JFVA 3CH5A 1RP7A 4I3GA 4JYMA 4Z3KA 3RS3A 1IQRA 1EE9A 1KH1A 3OURA 4ZQGA 4LYHA 1GUDA 2GETA 2XXJA 4LQ4A 5CGZA 5E6UB 2XTZA 3GJ0A 1E6WA 3KOOA 1YH3A 3HO6A 1LLUA 4TS4A 5KX5B 4E2FA 3FLEA 4OMUA 2IZ0A 5CK4A 4NJEA 4Y18A 2WQ7A 4MW5A 3KAPA 1Q19A 1I33A 2ZVDA 5IW8A 4B6GA 1E1DA 2YQ4A 5DNEA 3TF5A 2RKOA 2QRMA 5CQGA 3C85A 1XKQA 5AJYA 4Z5XA 3MTDA 1O96B 4KWIA 5COQA 3HJFA 3THXB 3K5OA 4HJXA 2OZPA 1FF9A 2OM2A 3ZKWB 4NARA 4XB6B 2CL5A 4D74A 1L4MA 3UY4A 2JGIA 1HYQA 4R68A 1I4TD 4HWPA 4Q9LA 4ZVTA 3IQXA 4DANA 1V48A 1N36B 1OPRA 3MRTA 2X7JA 2PDAA 3FVWA 1JEYB 1V7CA 2YN0A 1QHSA 1B3RA 2X9VA 3LQYA 4LDAA 4EABA 1SBQA 2X5KO 2OY0A 4JC5A 2I7CA 4E94A 1KTIA 2EZ4A 2XKJE 3TEMA 4L0DA 4UDXX 1V47A 3GUHA 1FB5A 2QUJA 3WLIA 3VKHA 3GAFA 3OEHD 1C9YA 3EGXA 3RC9A 3WK8A 3N7UA 1CR4A 2ZPTX 4C0KA 1B7GO 1H8HA 2WAYA 2I8CA 2XQKA 2IBTA 3PUZA 3OPYI 1DIBA 1PFQA 4RWZA 1R5BA 3UH1A 2FVXA 4MGHA 4YRQA 1M75A 4MQLA 2YASA 1QGZA 3SN6A 2WJ3A 4L22A 1X94A 1EIZA 1GGVA 4PRZA 3HN7A 5DV9A 5PNTA 4RZUA 2FEMA 1UOPA 3SHWA 4EEXA 5CA0B 1M83A 1COZA 1TU0A 4BL5A 1I2AA 2O1WA 1IUNA 4XD2A 1YK1A 4RADA 1DBQA 1ZSVA 1WXGA 2Y68A 4QT0A 5ES3A 3CH7A 3HM9A 4JYZA 3RVRA 3V4FA 1DQSA 1YI1A 2NO0A 3E9YA 2B4KA 4L5CA 2FZKA 3K6SA 3F2VA 5EZSA 1Z4MA 3LI2A 3BIXA 1R27A 3OKCA 1G6HA 3I2KA 3PSHA 4MUKA 1N6LA 3QITA 2PR7A 3UM9A 2ZSUA 4P83A 5FB3A 3L06A 4NOLA 3H7AA 1JXMA 1OGIA 3HFSA 1RYYA 3NTOA 4PIVA 3WB0A 4AN4A 4JBHA 4G4GA 3ZY4A 3FFXA 3GLQA 2A3NA 4E5DA 4H4EA 3K35A 1KZ7B 1N2CA 4N9WA 2Y1LA 2BFWA 4ZC8A 4EHDA 4YLYA 5DZSA 4P4TA 4KSBA 3AETA 4HXFB 1R88A 4GVXA 3K71B 1O6ZA 1X39A 4KVZA 4KQIA 3R7FA 4EI9A 1T3LA 1U3GA 1GAEO 1RI3A 2OUIA 5BXQC 4OH1A 2ONCA 4FEAA 3LQ4A 4KFTA 2H07A 4ALNA 2PNFA 4CU2A 5KNDD 1CUAA 1Y6QA 4KZPA 2CHGA 4OQMA 3TSCA 3IBTA 1P1RA 2C9MA 3JVUA 5CJPA 3INRA 2COEA 3QFSA 4K9QA 4X3CA 1S9DA 4XWTA 4YPFA 2ZBRA 4RIIA 1TQ6A 4KE6A 1U94A 4IUYA 1CKEA 4H0NA 4LMAA 3JVIA 3P32A 1A8UA 3T7AA 3GFVA 3O1JC 1G64A 2R92A 3A9RA 4NBNA 3UZUA 3NEPX 1L5NA 1PG0A 1VJRA 2I4LA 3AJ9A 2IQ5A 5CYPA 4B2YA 4BX3A 4IV8A 1UJ4A 3IC5A 3TPZA 4D9HA 4GZ6A 3ROFA 4ZI7A 3VOSA 4GUAA 4EQ6A 5F51A 2Y1GA 2AKYA 4IMPA 2CNDA 4TV8B 1KOGA 4ZCQA 1QYIA 4IH4A 1P6UA 3GWGA 1JG2A 1JYEA 1E1RD 1JJIA 2D00A 3PKJA 3CWZA 4TN5A 2I66A 3OJOA 3A3KA 5CB8A 4JKYA 3TMKA 5LOVF 4R2IA 3KLBA 4BMSA 3AOGA 1ESMA 1NUUA 3AGPA 4E22A 3ZI0A 3QFRA 3VJRA 3BHMA 4MPRA 2GTPA 5TS3A 1E1YA 1MT3A 3GNQA 3L5KA 3PRYA 1YIAA 3LNCA 3WIEA 1D5WA 1R0WA 3FYUA 1V8DA 2HF7A 3FKQA 1F2UA 2CKMA 3DUWA 4O2AF 5DTIA 4G8BA 2FDXA 2OCKA 1H2HA 3ME5A 4MITA 2QAGA 3NKFA 4QBGB 1LVGA 1WXDA 2BWJA 2I6SA 3LC7O 3MWYW 4JSTA 3NHBA 4U5XA 3REQB 4AY5A 3SEAA 3VPHA 2R65A 1JIUA 2WU4A 3TMYA 3VI3B 2CHFA 3KV1A 5C51B 2I4NA 3D5TA 4HDSA 2E9SA 3JZDA 4GZMA 2HK6A 4IKEA 4GX5A 2AOUB 4MVJA 1PZEA 3UJAA 3N2KA 5J2UA 2HA4A 8GPBA 1E1CA 1COWA 1DWOA 3FXAA 3V2IA 1TM5E 1PHRA 4O63O 4H59A 5K3CA 4WX2B 4D9CA 4RJTA 5ITZA 1RAFA 4XE5A 5G0WA 1XZJA 3ANMA 4KNWA 3W2FA 3KR0A 3UTCA 3BX1A 4PSVA 1G0NA 2OXRA 3FPGA 2CF6A 2RK3A 1AMOA 3SJZA 3HUTA 3LPLA 2I29A 1Q92A 4HAZA 4HFJA 3RSHA 1BQEA 5AKHA 3AG5A 1EH5A 4KIWA 5A62A 5P21A 2MYTA 2OO7A 1X1BA 3DAHA 1RM3A 2HYDA 3OJ0A 3PT9A 1YHNA 3DKRA 3T3IA 1TM4E 3WWYA 4AKTA 2ZUVA 3DV0A 4HAUA 4N03A 3H1BA 1ISIA 2CDBA 1F9AA 1Z75A 2XSZA 2FG6C 1MEEA 4MUYA 4YALA 1RLIA 1PX0A 3C14C 2FN3A 3ICVA 5BN4A 4NVRA 2J1LA 3LRTA 3PSAA 3DV2A 4FU0A 2VBIA 1NVWQ 5I4BA 3RWBA 5H83A 2JFNA 5CXSA 4NWIA 4DQDA 1RZRD 1IFXA 4DZTA 1QO0A 4X95A 1XPUA 4FB5A 4V3CA 1C1XA 4DMFA 4W63A 5JWRA 1ZXXA 3R7SA 4HPXB 1K92A 4MI9A 1KI3A 1QXSA 3CH4B 4IX1A 2PHZA 3NHLA 4B3TB 3HA5A 2FEPA 1ZVKA 4GI2A 4TX1A 1XBTA 4TMWA 2A5DA 4U2FA 2VAXA 5K4GA 3PTZA 3QXXA 4U4AA 1E2IA 4TWZA 4GQAA 3WLKX 4KOAA 4HADA 1Y8CA 2AFHE 1X8KA 1XA3A 2R11A 1SCAA 5E95A 1T26A 4MLPA 3VR4A 1U1FA 1AO0A 1UBSB 3DDWA 5HKKD 1JVNA 4MULA 5ALLA 1U7WA 4OMFG 1Q83A 5CVEA 3ERCA 1QHEA 4L6CA 4HFMA 2FR8C 1DC8A 2VTDA 4Q9DA 4W1SA 4ZYVA 3V2UA 1NNEA 3AUUA 4FIDA 1E66A 1PS0A 3PEUA 4BP1A 3BD8A 3H5IA 1BXZA 3WAGA 1RCTE 4CEJB 4TL6A 4CM6A 5JYBA 4PWYA 1OASA 4FIZA 3KZ1E 4KGDA 5CVUA 2E4UA 2DPGA 1WSDA 4BNJA 3FRHA 4MP3A 3DTYA 4TROA 4I5FA 5JNVA 1N6KA 2NXJA 5AKLA 3Q72A 3AVYA 1T8RA 5GONA 3HCWA 1X77A 2EAUA 1ETUA 1WXIA 5CT8A 2VHYA 1NQOA 1R66A 1RWOA 2RJOA 1ORVA 2M6SA 2O2EA 4OXXA 4IRUB 2OORA 3KSZO 4UNPA 2Q9BA 2JEZA 5TARA 2GTIA 5JCJA 3C3MA 2ECQA 2DCMA 1QZXA 3IP7A 2OZLB 5J2TB 1F6WA 1KJQA 3IQHX 2F00A 4NCKA 5C53B 1RSZA 3W2TA 1GTJ1 3I76A 5DXAA 1UFRA 4IIJA 4MDEA 5EHNA 2WQZA 1NH3A 3IDFA 4LN1A 3VU9B 4BO1A 1SG6A 2XPCA 2Y05A 3BSFA 4K28A 4XCQA 5B5SA 5AVQA 5K6AA 3R4VA 1W0JA 4LBVA 2O8DA 1MDBA 2XB8A 1KARA 3AKCA 3E05A 5G0SA 2GFIA 2HH9A 4KFUA 3BXPA 3C7AA 3BSWA 1JA9A 3CO5A 5T64A 4E5VA 1YA6A 1P3DA 5LQUA 1MNQA 3TRHA 4B31A 5BMVF 3T1TA 2J3LA 2NUTA 1RM4A 4MMYB 5JNSA 5JMPA 2RGRA 1Z3CA 3HYNA 5E1OA 1P7PA 1QLWA 1GTMA 2CZGA 4J9VA 5KINB 2V7QD 1J7JA 4A92A 4G09A 5HP4A 1QFXA 4FYHA 2IX3A 1CRWG 1MRSA 1BKSB 1WL8A 2AE1A 1DIRA 5JSKA 3TDKA 2AFVA 4DA7A 4LE2A 2GEFA 1SOUA 5HM8A 3DEHA 4YUZA 4UTVA 4KXMA 3CMMA 3SXJA 1Z5NA 5DGHA 4NKRA 1H65A 3GFGA 1ZIPA 4I2NA 5IM4A 4OUDB 1P0FA 2CD7A 1YNND 2X0IA 2YJ4A 3F47A 2LCFA 4LZWA 1SBCA 3QSYA 3QLVC 1D2HA 2NX2A 2DQYA 3R5TA 1Z6ZA 2I3GA 1EQAA 3KVRA 1NG1A 1RXSA 2XUKA 1DX9A 2JJ8A 3IV6A 2VQDA 1G20E 3OMWA 5FI5A 1I10A 1ZICA 1GU1A 2PZJA 1S2OA 3DOCA 3ACCA 4NZOA 2H1SA 3E18A 5IU6A 2W58A 1YGYA 4AWBA 4BXOB 1R0XA 4H1VA 4K2HA 2NVXA 3KLPX 4AICA 4MH0R 4P80A 1H93A 4NBTA 4ZHSA 3GUYA 2HUNA 3MJDA 1VCOA 2DPLA 1H5NA 3OQHA 5HUJA 4QVIA 4PLTA 1Z3IX 3DVQX 1PD1A 3E0QA 5FOWA 5FWAA 4ZYWA 1FDIA 2PMCA 1RACA 5HA5A 1C14A 2XW6A 2CJWB 4HRYA 3FZYA 4I1YA 1XSEA 2YWBA 1DZIA 4PG6A 4E07A 4D6YA 5JD6A 3P9CA 4K9KA 1OJ7A 1NVUQ 1TEVA 1XQWA 2JKYA 4A6XA 3PQCA 2GN0A 3OHSX 4ZVSA 2PUWA 4O5OA 4RTPA 4OU5A 5ABPA 5D7BA 1G9TA 1P8JA 4PLWA 3NX4A 3GQVA 2X15A 4MVXA 5GIPE 3AWDA 3H3FA 2XBUA 1EK0A 5AXAA 4YRZA 4M9UA 2XRZA 2C98A 3AT1A 4BO3A 2GK3A 1SVNA 1NNI1 1YACA 3GRCA 3DQPA 4BC0A 3ZLBA 1V16A 3AMVA 5CM2Z 3GEIA 5CNKA 2ERCA 3WNBA 4EGSA 4Q9HA 4R7GA 3GFFA 3WMWA 5FUQA 4ER0A 2XAUA 1IN8A 3JYNA 4G5XA 5G3YA 1KI8A 2PBZA 3SBXA 2FQ1A 5JCXA 2IELA 4X0EA 2WSSA 2ODEA 3G0HA 1IRIA 3RW9A 4RK0A 3TUZC 2YDXA 1ZOIA 4NABA 2IYQA 4EF5A 3V42A 2WIJA 4P3XA 2QE6A 3A26A 3MTQA 4RY8A 1SU4A 5B6IA 3RE1A 3W0LB 2BKLA 4AX8A 2A30A 7MHTA 3WWEA 4RACA 4ZIRB 2YWJA 4ZVNA 3FOFC 1FP2A 3BREA 1B2RA 4WESB 1PV4A 4D0GA 1U28A 4R8RA 1PW7A 4A91A 1W44A 3B48A 2DBRA 3GEDA 4B8WA 3A1EA 2CSUA 2JW5A 2OBFA 1GT91 1Q91A 3A6GA 1PGOA 3F1LA 5AHWA 5IJ0B 3SPXA 4H3TA 3QBTA 2ILTA 1SKUA 4DSNA 4QC2A 4XWKA 2DRIA 2I4OA 3GUZA 3KJQA 1PJBA 2G7ZA 1S3SA 2QR5A 3HDTA 4AG3A 2QF7A 1KJJA 1SPBS 5AKEA 5LP6B 2QQ0A 3NGMA 3MINB 5EOVA 5IHXA 3VO9A 5GTDA 2NAFA 2QXYA 1GZSA 4BU0A 1SPXA 2QVBA 3U48A 5CEJA 4WNAB 3UMJA 2D5AA 3LUGA 5EESA 3QNMA 2WSBA 3P2KA 1XNGA 1H8HD 1MABB 2CNLA 2JCGA 2XGMA 1NOKA 4ZK6A 1DXOA 1DIGA 1V1RA 2Y2UA 4G3XA 2VH5R 3WYFA 1EG7A 2RC5A 3IHWA 4R83A 1O89A 3L6EA 3KSBC 3PFWO 1E0SA 2X0EA 3DCNA 5REQA 2NVWA 2XLCA 3JAKA 4O2RA 3TW4A 5BURA 3FI9A 4KVAA 2C95A 1ZVMA 4I2VA 4OI0A 5TGZA 4L6AA 4LJYA 4MUHA 2BH2A 3A58B 1U90A 2MT9A 2YWDA 4RPJA 4LSMA 4G5YA 4BV3A 1NGSA 1NDHA 2GESA 1LCIA 4W6ZA 1T9DA 3IPCA 1HX7A 1Z06A 2DX7A 2ZJFA 2JBAA 2XMRA 4K8OA 2J3JA 1UOQA 2VBGA 2G9ZA 1BVRA 2GS9A 4WEOA 1XWWA 2CVOA 4O4JB 2YWRA 3W1EA 2BZ1A 4I1RA 4OMDA 4RABA 5DO9A 1J2YA 3WAKA 1FW6A 2NZ2A 1D2CA 5G1PA 3VAAA 4NMWA 4D8TA 2G9QA 3K20A 1KORA 1JKXA 2DUNA 2ODPA 1P5JA 2VHJA 2HU2A 4Y9TA 3CLHA 5KTSA 2HF2A 1C0IA 3CZ4A 3KFVA 3VBEA 4ED9A 1O9HA 4OLHA 1GDDA 4PNZA 1GUAA 1DT3A 2IUSA 4JT8A 4R2HA 4V24A 5ED0A 5FI0B 4F9TA 1XDZA 3HJRA 1G20A 4X24A 5BW5A 1E0DA 3P0IA 3Q3VA 1P2GA 2QN9A 4HQ0A 4C4AA 2QRVB 2HL6A 2NUPB 1I0LA 1IHXA 3S55A 1H9CA 1NDQA 2PFGA 3DMDA 4Q5GA 4BWGA 4L85A 1SCDA 5H3HA 1NIJA 4LSWA 3HZRA 2QBYB 5EMNA 1XWIA 3X2EA 1EVIA 2Z56A 3Q7RA 2DZDA 3WQRA 5A5VA 3BMOA 3MS7A 2ZZKA 1XRLA 4GYKA 4M83A 2CDAA 2FQYA 1Z22A 2F48A 2CT8A 1M2WA 4HRXA 5SV2A 2GH1A 1VQ1A 2Q4OA 2BEVB 4ZQHA 3ORHA 4UEOA 3CZCA 4DUGD 1XMVA 2JASA 2WUWE 1J2TA 1H1TA 1QKIA 2BCGY 4WOCA 1T5LA 5CDGA 4FHCA 4Y2QA 1JQKA 1I1NA 1G9XA 2X77A 2OTCA 3L7YA 2VUMA 5KX5F 3KKEA 3CRZA 1G4AE 4S24A 1UM9B 4ZQEA 1U7DA 2AB0A 3M3DA 5CAEA 2C5EA 5HHTA 2NVUA 1WULS 4MVCA 1P2FA 1UDAA 1XKLA 2I22A 5JASA 2OO5A 3LBHA 3CVWA 2CHUA 3PA6A 4PY2A 3OG9A 4DLVA 2JLAA 2KHZA 3HJAA 4NNPA 1EZZA 4DWOA 2VPIA 3T3HA 3GCZA 4MHOA 3KAKA 1KO7A 1XHFA 3HKCA 2DPHA 3CY6A 2LWIA 1ODFA 2X8LA 3WLRA 3I28A 1NRWA 4JR2A 1QWOA 3KXDA 2CNWD 4N54A 1ADBA 4D4HA 6YASA 4F3RA 2Q4RA 1H0HA 2YFYA 2VA9A 3G2IA 3FSEA 4OYRA 2X2OA 2QRNA 2VKTA 3IUMA 1FVHA 2IYFA 4YRGA 3GVCA 4OP3A 1SMKA 4O2AA 4YIHA 2AI3A 1LSJA 3FHCB 5CYGA 1W36B 1XDGA 1Y3FE 3G2OA 4Q47A 4MVJD 4UTPA 4FINA 2ORED 3BTUA 1YR8A 3N39C 3TVTA 4M4SA 4R81A 2VHTA 2JLVA 2CMFA 2AVNA 2TRSB 4BFZA 4IDDA 1J9ZA 3IIJA 2YV1A 4AZ3B 3ABRB 5I4CA 1X7GA 3R7NA 1OLSA 2A6ED 2PKXA 3DD5A 3VTFA 3DE7X 3K8OE 4O4LA 4RVSA 1FYEA 2GYWA 1LLQA 1ND6A 1U2SA 2BTOA 2OSVA 2R8XA 3D2CA 3I9MA 3IXMA 1IOWA 1P2DA 1U6IA 1ZI6A 2R79A 4KMSA 4X1IB 3DEFA 5BNTA 5ALDA 2HV8A 3D8HA 3MWEA 4D9GA 4WN9B 2HIHA 3C7CB 3HMKA 4P5PA 2VF7A 1ZEJA 3BKXA 3H9JA 4UC0A 4C3VA 3DBLB 2GLTA 4JOSA 4OKIA 4XOUA 2VDQB 4Q7LA 2XSZD 1YB6A 4Z99A 1NN1A 2ZUBA 3TH5A 2R5NA 5F1YA 5K0LA 4D8WA 3KZOA 1TJ5A 3KWMA 2C8JA 3JD3A 3W6ZA 4KQ2A 3IV7A 4IDFA 2EKZA 4R41A 4LZZA 5JDIC 1CULC 3WDSA 1VG0B 3NO4A 1QO0D 1BXGA 4TVSA 4KQ1A 1QHHA 2DLDA 3UXMA 4OBBA 1UIRA 1EXVA 1RQ2A 2OD7A 3OSUA 3RO7A 1R0ZA 4QECA 4TLDA 5J5CA 5FLYA 1TT5A 4DM7A 2EYUA 2LRHA 1Q12A 4B2IA 2RCYA 3QWFA 4RX1A 1JIKA 1ZYUA 4RKYA 2PUBA 2WU0A 4PAMA 4Z7OB 3BICA 2UYOA 1GSOA 2G0NA 4FXPA 1CT9A 3GJ8A 3SVLA 4BNHA 3AP3A 1JB1A 2WOJA 4UM9B 2QM8A 3L6DA 3UC9A 4TZ6A 3RHSA 4HNQA 3AM1A 2IP4A 5F52A 3UEOA 1GUYA 2BT4A 3KJHA 4NP6A 4CEHB 3NETA 3PC7A 3QQ5A 3WIOA 4RIFA 4BMCA 2BC9A 1DDOA 3PFKA 1SG0A 1AOXA 4KLNA 2YY6A 5K0EA 4LNHA 5AI4A 3KL2A 2YNMC 4DDUA 3BE5A 4AW9A 5IWAB 3AVUA 3TIIA 1ACMA 3E22A 1APBA 2R86A 4E7OA 1QNLA 1HETA 5GADl 5BQXA 1KETA 2B4QA 4JODA 2JDIA 1D9ZA 2OG2A 3MVEA 4JJ8A 1KA9H 1E3QA 1XXHB 4TTTS 5F4BA 3GDHA 5ELLA 4LCJA 1JDUA 1QU3A 1Q1BA 2QNBA 5DCYA 3Q1LA 1T6YA 1D6JA 1EG2A 4N9QA 1Z9BA 4XYEA 3SK0A 3PFCA 4R1SA 3T38A 4UBLA 1JQEA 2DR3A 5KOHB 4REMA 4EI7A 4HGOA 1ATIA 4MB0A 1JEQB 2MSCB 3AKEA 2HLDA 4RKWA 3WRYC 4Q4DA 4DR4B 5BYKA 2GBGA 4CCSA 4EL5A 2GJ9A 1L5FA 2BIFA 1RE1A 4LE0A 4LY6A 2FPPB 2QGZA 3RSZA 4EUEA 3EGVA 5IJ9A 4AZTA 3OX2A 4TWRA 1TLTA 1N5IA 2HB6A 5KSZA 1MJGM 3P9QA 3OZUA 1ZYRD 4YJHA 3V2HA 1QRUA 1NBME 2JFHA 3DW3X 3FDJA 3HJGA 3ASYA 1VZ3A 2OD9A 4QOGA 1E7MA 2H0QA 2QTAA 7GPBA 4JI3B 2CZCA 3E6AA 3F78A 1QE0A 2PMEA 1X70A 4XX0A 2ZB7A 1JDJA 2MDTA 4YT2A 4BY9E 2YRFA 1M72A 1M9NA 3K0AB 1OA1A 2ZIGA 3OCZA 4GYYA 4OF4A 1ORTA 1O03A 3V8EA 1JPUA 1QQ7A 1C0KA 4F21A 2HCTA 1EBBA 4A8JB 3E5HA 3K96A 1X7YA 1DTEA 1DX4A 3LLVA 1K1EA 3C3KA 4J94A 5CX1A 5IKEA 1D7OA 2E1RA 2LTAA 1DSSG 1I9CA 2VH1A 1W0KA 2IZ7A 3BE6A 4JMLA 2ZJ5A 1UQUA 4XWGA 2QZ9A 4G5RA 4MO9A 2CVQA 3ND5A 1LH0A 1G98A 2A59A 2IHBA 2OHFA 2ASEA 3BHIA 3A3OA 3JALA 2P6NA 3FPLA 5DX1A 4D6XA 4BEWA 5IG2A 4MA5A 3ZLUA 3DTVB 2OBMA 4EY3A 4HD8A 3CX4A 1ZM2A 1VLZA 1OTXA 3G9QA 4MV1A 2IIVA 4MKXA 3DBRA 5TX7A 4CTKA 4GO1A 4BLQA 1UKZA 1UMKA 5JAUA 2A0UA 2IYOA 1A9ZA 3O8LA 3GZNB 4D3XA 2OECA 3CYFA 3AL3A 1JIXA 3I23A 4CUZA 3RVMA 1K2VN 5FD8A 1CE8B 2H1WA 3E9NA 4LGVA 4A6PA 2DGDA 2AG5A 2AS0A 2ADFA 1HTWA 1WMBA 5DCLA 4EPVA 1JMVA 4XW2A 5DM70 3M1AA 3UWKA 2J33A 3HJCA 1DRWA 2QUHA 1JNYA 1WPGA 3L0OA 4X61A 3CN9A 4KN8A 4Y0VA 4BWVA 1BGVA 1FRQA 4H7IA 4KIUA 1GCUA 3E3OA 5DXJA 2G70A 2I6GA 4BJ3A 3OZRA 4CLOB 1PG5A 2BMVA 3LF1A 1E63A 2GN9A 4XB2A 1Y6ZA 3FMOB 4MLDA 3ZCTA 2CK3A 4GX2A 1Z0DA 4ZALA 1OYVA 2FMXA 2BF7A 3B12A 4TTQA 1VCHA 4KIFA 1P5FA 1PV1A 1RWPA 3URKA 4I0WB 2XUDA 1WU8A 2HQSA 2UZIR 1SD1A 1XALA 1YDGA 5BSKA 4LFCB 3WRWA 3OU7A 4D0LB 4F2DA 1UC4B 5JHGB 4OI1A 1W47A 3NP9A 4RZXA 3DUFB 3DMGA 1YR2A 1CJUC 4L57A 3OJCA 1P1KA 3A0UA 4EVIA 5CB6A 5JXIA 3P4UA 4EMBA 1BDBA 2XCLA 3CNEA 1EVYA 4PZEA 1R0CA 2ZTLA 5BQPA 3BT7A 2Y1EA 3RKUA 4C4RA 1N7GA 3F3KA 2H9AA 1VP3A 4ACBA 2D4HA 2EXXA 3AX6A 5JY1A 2XUFA 5J2TF 3LGSA 3W90A 1YFZA 4GP6A 3SYMA 1OZFA 1VSBA 4ZKDA 1SFOA 2C78A 4FC7A 1GR1A 3FNBA 4FZ5A 3V7NA 1JLLB 2Q50A 2RH9B 1V5WA 5CH8A 1N78A 1QS0A 2KJQA 4P2BA 3HH8A 3IJEB 5B4TA 1TD9A 3PNYA 4YR7A 4BNDB 2W6MA 3LCCA 4FBMA 6CHYA 1L7QA 4QPNA 10MHA 1X74A 2GR9A 4BTEA 2NTNA 4BP9A 5D51S 3EULA 2WY2D 1FXWA 4MCIA 1Z7WA 4EGJA 4LJ8A 1WG8A 4N8EA 1OAOA 2BCEA 4TKMA 3KDPA 1Z6AA 2PRJA 4J29A 4UM5A 3FSJX 3EW9A 3IERA 4AP5A 2JVIA 3P2OA 1MJNA 3LH5A 4BUJA 1OTYA 4BX9A 5JQWA 4QTUB 2R93A 1USKA 4GAEA 4WH0A 3GEBA 3TCXB 2G72A 1T4CA 1AK2A 1XG5A 1BS9A 3M6UA 2CHVA 3U4HA 5KTKA 1U6KA 2A5JA 3HCNA 4IQ0A 4B83A 1BXKA 3N2GA 3MSXA 5LBTA 3A9WA 4C0XA 1EVJA 3BRQA 2YMMA 2Q28A 1TYBE 3ECCA 4FQ5A 4UM7A 3DL7A 5FULA 3NAMA 3JATA 1TA0A 1TM2A 3U0BA 4EGCB 3JQAA 4G67A 5FTMA 4H1HA 2BPOA 3K31A 2VF4X 3PZBA 3UANA 4Y2PA 1D2AA 1Z4OA 2JAWA 2ZSJA 3IT2A 4DXHA 3KEQA 5CDYA 2UYCA 1I6VD 3C3EA 3CKYA 4RTRA 4RPGA 3EEOA 2DMRA 1L7NA 1KFJB 4WT7A 4XTCS 1VJGA 2BEUB 4G8DA 1NBMA 3RC7A 1XZQA 1CQIA 1J4AA 2GD2A 4Y2TA 1SCQA 1QDLB 2P9TA 5ILGA 4M6WB 1GPAA 2A4MA 2ZUEA 1XJ5A 2W4IA 4FHEA 4X54A 3EG9A 3U7EB 2R8PA 3KRTA 3AEZA 1QK5A 2QYHA 1I4LD 3N2EA 4EI8A 3HI4A 2F3SA 4KGXA 2MSEB 4P82A 1Y37A 2QTRA 4TWAA 3JZFA 5GMOA 4AKSA 4Z2AA 1E3JA 1I3NA 5C8XA 5JJLA 4QDZA 3RJMA 4C6HA 2QDXA 3AIOA 2E6KA 3CIOA 3B6IA 4PYNA 3ZNNA 3VRHA 3BRCA 3B1WA 4BFWA 1TRHA 3M2PA 1HDGO 1MENA 2YWGA 4HNSA 2B30A 3L77A 5HRUA 4Z0HO 4K6MA 4OGKA 1E6KA 4ZU3A 4ZCTA 3ZVNA 2KMLA 4UZSA 5JDCA 5M2QA 2XIQA 3MJVA 4G1FA 3WOVA 4MVJM 4EJSA 5JVDA 3O5AA 4EO9A 4YWJA 1X0XA 2VT6A 4MIEA 1ZCBA 3INGA 3NUQA 5CIQA 4CKCB 4DR5B 1PT5A 3KQQA 1DU4A 2UZ3A 2VN8A 3FOBA 5E6SA 4CLXA 1SXQA 4PBRA 2FZWA 1VB3A 4MYCA 4Y6GB 1FX0B 4NBUA 5JUWA 2VAPA 2BDUA 3ER9A 2FTKE 4UXIA 4I1UA 3T0FA 1OWLA 1XZLA 3JWEA 3CLVA 4RKRA 4O4IB 2NGRA 4QVKA 1JHVA 5G2OA 2ECKA 3GTJA 2LP4Y 5EIBC 2PE5A 1YGPA 2JA6A 3WRXC 3PRHA 4ASUA 4TKVA 4ZN6A 3D0KA 3HYSA 2P9GA 3BE8A 5AVKA 4QLOA 3RRFA 2WG1A 5KWJA 5FHRA 4ZDKA 4HTFA 4ZCIA 3G7NA 2JLZA 1IN6A 1WU7A 4QWMA 2QQFA 3NYWA 4L3WA 4GICA 2ZI6A 3OUTA 2RGEA 4B3DA 2QJWA 4JBWA 3EIFA 2XJ9A 5J47A 5HDBB 3BMCB 5K3AA 1EHIA 3AEKA 5K3DA 2P35A 3UYLA 3ACDA 4MKIA 4IFIA 2WBLC 1ZMXA 5K2OA 1EHYA 2WABA 2RDMA 2EF0A 1G59A 1YL5A 1YVEI 3EXEA 3HCEA 3FGNA 3DMHA 1R6XA 2WIDA 3UV7A 4OJMX 4A8TA 1BROA 4BOYA 3HPRA 4W8OA 1NY6A 4KN6A 3P2EA 5LPNA 3B5JA 1SY7A 1E69A 4YP7A 5SICE 4N5IX 2WDPA 2HF8A 2ZI7A 2CFRA 3O21A 4OHWA 1PLKA 4HK4A 1B8NA 4J6FA 2QTTA 2N0SA 1H6CA 4UBMA 2BHNA 2DPMA 1ULAA 5E9QA 3AR6A 5LP6F 3B1FA 1RW4A 3SX0A 1NF3A 4GMGA 4DW8A 2G7MC 3ZHQA 4BEBA 4J3NA 3B52X 2CXTA 2ATVA 4BZQA 2XMQA 1RYDA 3AZOA 1K3TA 3SR4A 3CPHA 1AS2A 5E2AA 3MRSA 3N7TA 4QHSA 4JK3A 1GSIA 4UQOA 3TJZA 3WLPA 2FKAA 3T34A 3A2KA 3HCFA 4XPIB 5AUOB 1Z37A 2Z8ZA 1MQAA 1B23P 2CSXA 2RHOA 1XZIA 2PT9A 1UDCA 5EE9A 2AJDA 3O47A 1DTWB 3SE7A 5CW1A 4CJXA 3QXCA 1MG5A 5COBA 2GHIA 4O59O 4D8XA 4NCHA 3NAQA 3G8CA 4PM4A 2NP6A 2WT9A 3ISTA 3N58A 1NBOA 3GJZA 2W2VA 3TINA 4DFDA 3UT5B 3WGKA 3KUCA 5LKAA 2QTWB 3NOOA 2C4MA 2WD7B 3E2IA 4H3VA 1RI2A 2PMWB 6PFKA 3AL0C 2XTAA 4URVR 2BGTA 4UARA 3ZNOA 5K9ZA 4PYOA 2WJ6A 4O4JF 3UAVA 4ABYA 5KNDH 3ZOKA 2EG9A 5LOVA 1Z6XA 1UBHS 5DGXA 2OA0A 2I3BA 3F67A 5JOQA 3IHTA 5HEKA 4QAJA 4YJGB 2WHXA 4P4LA 5DN6D 1C50A 4ZV9A 1XTJA 1BSVA 2VRBA 3Q7QA 1V1MA 4K9MA 3WNVA 4EB3A 4G85A 5BT8A 3WIBA 1HXHA 1Z2OX 4MRMB 1VRCA 1NUQA 3CPSA 2LCQA 1T1JA 3E23A 4L8IA 1U2QA 1F2TB 3L0CA 3PG5A 3QE3A 2AFIE 2JLRA 3LBNA 3DTNA 3OE7A 3QMWA 1ZK4A 4IKOA 4ENTA 4UEWA 2QN1A 4XGRA 2D2IA 1TJNA 4H0CA 3X44A 2IXFA 1I6LA 5EMHA 1O57A 4CEIA 5F1PA 2EKQA 1FOEB 2G71A 2ZJOA 1Z73A 5HF8A 4CM1A 1U0SY 3D3WA 4GWKA 4OYHA 5EC8A 1OWOA 2WM9B 5CBPB 4RZ2A 4DTIA 3ROPA 2ZREA 4ND5A 2AG8A 4ZICA 2XNKA 4K6OA 5C52B 2PXHA 1L6RA 2ACVA 3GQBA 4JR1A 2ZGVA 4ZYZA 4B3FX 3A7DA 1TGOA 721PA 3ID6C 4H3KB 2BMAA 2FW6A 4KQ6A 1WP9A 1KYVA 2EQ5A 3ITNA 3REOA 4C4PA 4URXR 1KQFA 4URZR 5LQNA 1SUPA 2AF3C 1ZAKA 3QXHA 4NR0A 2JDID 1BA2A 3QPCA 1QYRA 2YYZA 4EYEA 4GMXA 1UC8A 2I0FA 2V7UA 3THYA 4ARCA 5E38A 3E2MA 2OV8A 2VPXA 1USGA 4QIWA 1R6AA 1VIVA 3G9TA 1RHMA 3KTDA 2HSWA 3GN1A 1L7BA 3IV9A 2GD0A 4JYCA 5CVJA 4BO6A 3U6KA 1Y8AA 4BE4A 2WV9A 3K3PA 2ZPUA 4Q18A 1MC4A 1HBJA 1MQ9A 1T2FA 1T8SA 3NAZA 1GAQA 4EJMA 4LXQA 1CUUA 3TKLA 2J3MA 2XCIA 5I4IA 5DHFA 3LT2A 4TXLA 3F74A 3MF4A 1WD7A 2HLDD 4JOCA 4NH4A 1E5TA 2P9BA 4GPIB 3TX2A 4WXPA 1GPNA 3E61A 1NQUA 1GZ6A 4WASA 3ICCA 3Q3HA 1AURA 1DCKA 3U13A 2BR4A 5C4IA 1CB7A 4H7FA 2PVPA 9ABPA 3VKUA 2A67A 2JJ2A 4J0KA 3RRYA 1Q0QA 1UCFA 3FPHA 2NZXA 4IIBA 2G6BA 2OUKA 3HYRA 4L4ZA 3U17A 3PFGA 5P8WA 2RI0A 1GNVA 2G4LA 1I1HA 3K9QO 2CLCX 4OBEA 1TLLA 1VKZA 4ZAWA 1DKNA 4BFSA 1G16A 5T6BA 3RUIA 1HH4A 1AKYA 2OHJA 3DE6X 1WEKA 4IFEA 4Q01A 3QBVA 4X64B 2BM1A 3UMSA 3IUYA 3PR2B 2DR2A 1EWTA 4EAAA 5KVCA 1NM5A 1PZHA 2BR5A 1JQDA 1JFSA 1AUPA 3Q5DA 5DRYA 4JNCA 3OH8A 4KLZA 2C7RA 3FOZA 3DZCA 2ZCJA 3I1IA 3STVA 1QVWA 2XD4A 4DXDA 2NZUG 3NJ4A 5CD1A 1TA4A 2ZM5A 4HGZA 4PFJA 3K72B 3HU1A 3OI7A 1TWHA 2RBGA 2EWWA 4ILEA 4XYGA 1QIGA 4I14A 1IQUA 2GNAA 5TQ0B 3DKPA 4JEMA 1P9LA 4CV3A 1ZN8A 2A88A 2XNSA 4V0QA 5AOVA 1NZDA 3K0FB 1ESNA 1DLIA 4EAQA 1GCOA 4RSMA 3RS7A 1IHOA 3C24A 3MCVA 4GKAA 4FI3F 1HDEA 3AUTA 1RFGE 2VTKA 3AEYA 4BVFA 2Z5LA 3FUCA 4YONB 1HNWB 1FRNA 4BV9A 1G5HA 3ZE2B 2Q3JA 2FPRA 4N6OA 2A33A 3WNCA 5BSGA 4DLLA 4F11A 4D81A 3QFFA 3AB3A 4NZPA 4DA6A 3THOA 4MRSA 3OF2A 3ZE6A 3D6AA 2KE5A 4D5EA 1JR3A 1RJDA 1QQAA 2F1RA 1BU5A 3GDOA 3ZU6A 3GFOA 3AVXA 2TMGA 1GLVA 4KB4A 3ASZA 4B8ZA 3G8DA 5BMVA 1X92A 2X19A 3IO5A 3VVCA 1HDZA 3VX3A 3DT6A 4Q05A 1DCMA 1JYSA 4HVCA 1CD5A 1M8JA 3AFOA 4W1QA 2QP9X 4PQEA 2I2XB 2YXEA 1ZD4A 2HBYA 4PC6A 4IP9A 1Z29A 3JR7A 3UGQA 1EA7A 3SIXA 1F6DA 4LFBB 3CW9A 3HKEA 5FO1A 1TFRA 3PGLA 5EKSA 2JF0A 4RXMA 4AG6A 1MB4A 3GPCA 5KTTA 1V5EA 2OK7A 2AUMA 3SEQA 1XD8A 1XA0A 1T8IA 1E3WA 1BE6A 1N2IA 5TQ2B 2B4AA 3DU5A 2I76A 4JI4B 4IG9A 3A10A 3ADKA 1YVUA 2Z6VA 5LMZA 4Q4AB 4HLQB 2AR9A 4FW8A 1UWVA 4MLCA 1X7WB 1QOPB 3EAGA 1UFKA 2XNDA 2Z4SA 2AFIA 4DL9A 3RIXA 2GLXA 4WCVA 1B14A 2FWAA 1I2CA 1YQTA 2FPOA 1E9BA 1JLSA 2HZBA 2X0NA 2H1CA 3CV3A 3JRWA 3THWA 3R3WA 4FDVA 4CFYA 1UZNA 2O1SA 2VC2B 4E0BA 2DU8A 1OR8A 5BXYA 2VQ3A 5AKKA 2GKOA 5JBIA 5DOZA 3UN1A 4PCAA 1UMCB 1VFPA 4NF2A 4RHYA 1DRUA 4YXFA 1DG3A 5DRTA 4BRWA 4LOHA 3ZD6A 3ITKA 4IJMA 1F2VA 3K0SA 5KKNB 3AOEA 3NNSA 3NTUA 4LCEA 3W2IA 1SZPA 4YFVA 3TSAA 1UBEA 1U0BB 4NRDA 3KKMA 3NPAA 1OX4B 1A4RA 2OAP1 1DP4A 3BFPA 3FDZA 3ZCQA 1FC0A 2IHKA 2QUAA 4OYLA 4AJOA 4C6RA 2PUFA 4ZWNA 3NTVA 3EBLA 3G5UA 3MGKA 4YRKA 5CA0F 3ILYA 5HKOA 1PJ3A 2G9VA 1K4TA 3EUFA 1KNQA 1N7IA 2CJPA 3F6EX 2HADA 3INNA 4MLZA 5DX0A 2CF5A 4ZHQB 5B64A 5HK8A 1ATZA 3A70A 4DV0B 4B45A 5EIXA 1C3EA 1R6VA 4DLWA 2FAXA 4G1MB 4Q3OA 1D8TA 4S0XA 5JCPA 1C8LA 1DJQA 1K7FB 1NF2A 1QFZA 1SZJG 2WF9A 5HIAA 1PWEA 3WA6A 3BL8A 3HU2A 5ALOA 1QIDA 3MOSA 4ZCSA 1XELA 1GZ7A 4PO1A 2G8NA 4RD4A 1CEEA 4OHVA 2G77B 1RFLA 2UUCB 1YXMA 1H1LB 5C5DA 2XQJA 4HQKA 3OP1A 3HXPA 5SZHB 3VKFA 4F85A 1YB7A 3FN4A 1OB5A 4NSNA 4M37A 3TBKA 3GYBA 3TSWA 5K5EA 2O7NA 4FYDA 1UJ2A 3WL7A 2OCAA 4D25A 2O2ZA 3Q85A 2F17A 2OXTA 4DMLA 1OKKA 5JQGB 4DUYB 1NBMD 2BFMA 4LHVA 1I7LA 1KBZA 2JFFA 2C2OA 3S99A 4AO7A 3BXOA 3GJSA 4UTZA 2ST1A 3OUUA 3R24A 1VC2A 5HCIA 3L0IB 3WYCA 4E08A 4J0DA 3KT8A 3Q0IA 1XHEA 1J49A 1GAJA 3SZUA 3V6LA 3ZUPA 4AYXA 3MUOA 4DM3A 1A2OA 3C8UA 1YKSA 3PPIA 1HR0B 3VNBA 1K4MA 4DXAA 4EYSA 2DE0X 2BGWA 4LJLA 2WG2A 3FWHA 3REGA 4B09A 1ANKA 1Z0IA 2H1OA 1N5OX 1R9TA 2VRWA 5DHRA 5DM60 4JBLA 3E5RA 1LK0A 2OHVA 1JEAA 3N28A 3NASA 4AKEA 3QEKA 1R15A 5SY6A 4DQVA 2JZCA 3UIEA 4CKYA 1ZD2P 3PWKA 5FV4A 1GP2A 1Z2PX 1LPAB 3PNKA 2PTGA 2VYFA 2JI9A 2A9VA 4XD7A 4YI5A 4ALLA 2A7XA 3B8HA 1AN0A 1TQHA 3K1TA 4HDCA 4FFDA 3OX1A 4GSKA 3OAAA 2I7DA 4ALIA 1ZFNA 1SC7A 2EFGA 4JP2A 5B6PA 3MAJA 2J3QA 3CLRC 3DJFA 2AN9A 3DMFA 5ALJA 1E1LA 5E9WA 2PG3A 3H2GA 3UAZA 4AQ7A 5DCUA 1OUMA 2NTEA 1V25A 1UXHA 2EZ8A 4UVHA 2GAIA 1EHCA 2VAVA 3FNGA 5IBQA 1ZM4A 2X9NA 5GOZA 2DLCX 3QELA 1ISRA 3C43A 1K7CA 1ZJZA 4Q1DA 4B7ZA 1W2WB 4ASUD 3W7AA 1U7XA 1YMQA 4YR9A 3JWHA 1SG9A 3DD1A 2DH6A 2FPKA 3OE1A 4KAXA 2H11A 1SEVA 4NDZA 2GKGA 2QPTA 3N9IA 5IVPA 3GLHB 3V55A 2EFHB 1OI2A 2GJAA 8ADHA 2ZYVX 3ETEA 3EZXA 1XWFA 4IY1A 3J80A 1JE0A 1GA6A 1KYXA 3SF8A 4OXIA 2ZUTA 1K6EA 3ETHA 1OI7A 2G08A 2GSWA 3DLHA 2GFQA 2Q5FA 4CT5A 3QPBA 3OCVA 5ERGB 4G4JA 3IAUA 3FX2A 4W7SA 1NA5A 3ODPA 4IM7A 2O2YA 5LP1A 5LQMA 4HNAB 3UWMA 1JLHA 3ZDCA 4V02A 4ZZ3A 4YUVA 2RKBA 3BJIC 3KPVA 3IX7A 2PGLA 3TL3A 3ZWKA 4FT4A 3VJLA 5BN3A 1Q3KA 1U4SA 2DYKA 4J4TA 4K05A 4R0NA 2FB9A 1MX9A 2P2ZA 2WYWA 1WF6A 4NL4H 1N25A 3T3OA 4UM8B 3HJHA 5EWJA 3UK2A 1O95D 4N6GA 2JC3A 3LGAA 4NEQA 3ZE7A 4QBTA 1WHTB 3TZBA 3KALA 5EN4A 5K8LA 3I42A 2II6A 5JWOA 1Y5MA 2R6FA 4EPRA 4XQ9A 2ISQA 2B2CA 5J4YA 2A1UA 3DSRA 3QH4A 4GXNA 1Y3HA 3RJ9A 5JSZB 4RL4A 3P9XA 5JAZA 4QUAA 3QLUA 4ZYXA 2VP3A 3E9CA 4OL9A 1Z28A 4V1CI 4A7PA 1OLUB 1LW7A 4QDJA 1JFLA 1PIWA 4HYTA 1JZQA 4LF9B 2R6DA 5KKAA 2ZJYA 2WJHA 1PQYA 1UT5A 5F7XA 4DLUA 1ZD9A 4FQ7A 1UKYA 4BLUA 4CN9A 5KX5A 3CS3A 4GF5A 2D3TA 1NDUA 3D6TB 1H8EA 2QUKA 5DYTA 1RYEA 2NVOA 3UMRA 4ZDWA 3L18A 2Q3DA 1NULA 4OHMA 4ZAYA 5L40A 3N8HA 3ROXA 3VGJA 2XT6A 3FR7A 4MWZA 1TWFA 3PDIB 3D3KA 2WFMA 2WTBA 1YRHA 3C3CA 5A4DA 2NVYA 2GZ3A 1SUIA 3RLIA 1RXWA 3RVOA 1O96A 2PS9A 3H4TA 2XMSA 3T3GA 1TKBA 1UAYA 3THXA 1ZJWA 1SHKA 3CT4A 3ZKWA 3VPXA 3NHZA 4KU4A 2WZDA 5FBZA 3QVKA 4P7KA 1OWMA 5EXDA 2V3CC 1T9BA 3ANXA 2QAGC 1LXCA 1HLDA 1TU4A 2H2AA 2CLOB 4LOAA 4M89A 3S3TA 5HQ3A 1JEYA 3GJYA 1XL1A 4MNTA 4QEDA 3M82A 3FTEA 2ZRLA 1Z36A 4R9UC 1BCRB 2UUAB 3VOTA 4OOFA 4L50A 4DQUA 4PRLA 1JQ5A 1YFKA 4DNQA 4N3CA 2I7XA 3NNDA 2NXCA 2ZIZA 3SG0A 3ONEA 3DCIA 4OM8A 1C9EA 5AQ1A 1R0LA 3ZU5A 1GUZA 3ZS8A 1N0UA 1A9YA 1PEAA 4HMQA 4AI6A 4QPCA 1IY8A 5FYQA 2VSYA 2Z3VA 3NP7A 2MSNA 1RNLA 2B9EA 3T7JA 2ETXA 3GUCA 3FKSA 1R9GA 4MV5A 4GX1A 4JJ7A 1UXGA 1PDVA 1I2MA 1ZBQA 2C9ZA 3T1HB 5CA0A 1J8YF 3UOGA 2CB9A 2LE0A 3AONB 3GLKA 3SBDA 4LOLA 3CGGA 3CW8X 3TTSA 1Y98A 1J33A 3E84A 3C5VA 3GDWA 1RQXA 1C3JA 4JNKA 4NZNA 4TWIA 5G40A 4R0MA 1ABBA 2AG6A 3EQ6A 3L07A 4UMEA 3JARB 2XZOA 4KXQA 1V96A 4MX8A 1KKLA 3N05A 3DV9A 4C4YA 2YVKA 3DDOA 2XAAA 1TCCA 2H1IA 3A1DA 1Y7TA 2RAFA 4EGAA 4TQGA 4E5YA 2IDKA 1BIFA 4A10A 2CY0A 1Z8NA 2VF8A 1AVTA 5FBHA 5FFFA 3DF7A 4MVJH 1E2HA 2VSNA 5EXPA 3VDXA 1GPBA 3LBYA 2ILVA 5DBGA 1WPQA 3WQHA 2CE7A 2BZ0A 3O3OB 1PGJA 1DBRA 2A5YB 1OAKA 4GOOD 1HO3A 1J0DA 2HU7A 3W9YA 2HD4A 4TS1A 4XQEA 1EBFA 1DWUA 3QEJA 4JL5A 2C4VA 1SHZA 2OMKA 2A9FA 2YFHA 3LDFA 3NOVA 4V0NA 4CGYA 4DC0A 1FFGA 2P4QA 5A5GA 4BNIA 1MW9X 1OIXA 3SZRA 3JTMA 5JAMA 1EK5A 3MPUA 4CF7A 2L18A 4BN4A 1JEEA 2UVPB 3G2JA 4EIWA 1JVBA 4TLBA 5DT2A 3BTOA 3IPXA 2Q1WA 1NQWA 4ZZ0A 2PH1A 3E48A 4BTVA 4GMKA 5CHYA 821PA 3A05A 1FMLA 1ZONA 2KS6A 3LQ1A 4WNCA 3TOCA 3KBOA 3I3SR 4YT8A 1YA4A 2QRPA 1N6PA 2NYAA 2QLBA 3GEEA 3ANYB 3PEFA 1OWNA 5B1IA 3NHSA 3K0HA 2PH7A 1GVHA 2Q9CA 3TD9A 2JATA 2FUEA 5JSBB 1E0JA 3JVEA 3KKPA 4GZ5A 1K3UB 4LVOA 1MX1A 4MQMA 2GBFA 1D2MA 3TLXA 2D6FA 2QR3A 3GRKA 4DC1A 2OORC 4MQFA 1LX7A 4J0HA 1J21A 1CP3A 2WAMA 4YAEA 2ZRGA 1NW5A 5C7LO 1RCUA 3GY0A 5DHTA 3HDGA 3WNDA 4Q3BA 1BEEA 4ZJZA 1KDRA 5B1YA 2VSOA 4Y0NA 3RT9A 5AOBA 1E3SA 2OAEA 2QOEA 3CUTA 3STUA 1FQJA 3ZJUA 2O3JA 2ZKIA 3JQEA 2J6BA 4EMTA 1ZHFA 4PG8A 5C1DA 1DKQA 1I4EB 1L7OA 2Y4OA 3FNFA 5K6AC 3GLGB 1HWYA 1Z6TA 1E79A 4E7PA 3U4QB 2OCDA 3AFHA 4P0PB 2JGKA 1RBYA 1QMPA 1UK9A 3YASA 5JANA 4PIPA 2FN9A 1SUDA 2PV7A 1YF3A 4JHXA 3REQA 2OAQ1 3KZVA 1Y1RA 1JHXA 2EQAA 1PWXA 1B41A 3DGEC 4GOKA 3RB8A 1I30A 4LNUB 5BORA 1C8VB 3AHDA 3HWSA 3OUZA 3P5SA 2IHJA 1ZRNA 3H11B 3ROZA 4ETMA 4ZI3A 5J3JA 3LPCA 3NUGA 2IWHA 1WABA 4YCSA 2MINB 4GL4A 4OAOA 1T5OA 3I9LA 5CDTA 1QMGA 1B93A 1UZMA 3ELWA 1H3NA 4CNBA 1K5PA 1Y4UA 2NYVA 1CY0A 2XVAA 3OZXA 3PNSA 4LE1A 5F5LA 4JXZA 3GB9A 1NP7A 3KTAB 4AZ0B 4EZIA 4F4IA 3QKUA 1MP0A 3U44B 4RVNA 3HHEA 3C8HA 2WUGA 4CM7A 3T5AA 1QFMA 1M10A 2OK8A 3IUBA 4FHZA 4RSHA 1VPEA 3OVMA 1J70A 1NXQA 1XEWY 3MXTA 3QTBA 4N3BA 1KMCA 3CGWA 1VPWA 3DE2X 1UT8A 4JT2A 1CUGA 4MUBA 1ADFA 1NT2A 1U02A 5T6MA 4Y6RA 2YZGA 3ABOB 5MF6A 3HVHA 1PL7A 4PX5A 2DECA 1LPNA 4QGHA 1VL0A 3GA7A 1DEHA 1JH9A 5FJJA 1LGYA 2ZYSA 4W1RA 4PLYA 3G1WA 2E18A 3IDZA 4HYYA 3I0ZA 4J9UE 4RKQA 1C7FA 3ELYA 3I6QA 3EVDA 3HL4A 4E5UA 1XRSB 3HXLA 5C1IA 1IXKA 4Y6QA 2PRZA 5FRDA 3J81k 3H5LA 4N18A 1VI2A 2VXYA 1UC9A 1DJLA 1CUEA 1EK8A 1IHYA 1U0HC 3H13A 3CR8A 3D3JA 1UM8A 3EUWA 4ZPXA 1E7SA 1ONOA 1ZJ6A 1VHLA 4EITA 4KL8S 2WWHA 2XA1A 4E1BA 4L4RA 1Z6YA 1ZM7A 2YUTA 5EZ5A 2EL9A 1KVUA 5TV2A 4D02A 5FLXA 3RSCA 3S81A 1X7XB 4JJ4A 4UFOA 5ALQA 1BHO1 5JZBA 2WT8A 3DE5X 4DKXA 2HXGA 3EIXA 1ZKDA 3D7SA 1GG5A 4CEJA 3S1LA 4POOA 2P6PA 3CSSA 5F5XA 3DNMA 4HPJB 3VO1A 4V38A 4QRDA 5DU2A 1SNYA 3VOBA 3VR5A 4F45A 3CISA 2P4EA 3RODA 1IEQA 5MFZA 1Q0SA 5K1ZA 3SX2A 3U7IA 1ZO8A 2OWDA 2FV8A 4TYYA 2O8BB 2ZU0C 5C4GB 4IWNA 3VYSB 1X2EA 1E6CA 3EIOA 3L4BA 2D13A 2AJTA 2CMKA 3QPDA 3R3YA 1Z26A 4PS0A 4RMNA 3FMVA 3L1JA 5E3IA 3ZHZA 1P9OA 2QMYA 2G5GX 1AZTA 1VJTA 5AVSA 3ZYZA 4RZSA 5J2TA 1OKKD 3OZ7A 3E4CA 4MWEA 4TMYA 4XZ3A 5H68A 1U3WA 3DM9B 3V4OA 3GJ7A 2DKNA 1DARA 3NBXX 4JVOA 4N49A 5BSFA 2RD2A 1M34A 3GTMA 1Q84A 4QQ8A 1GDTA 2ZRJA 4JHLA 3VU9A 1Y82A 4F2PA 5DGTA 1E2MA 2M6RA 3P2YA 1PZFA 2Y0PA 5L95A 1E8NA 3ENZA 4LYDA 4RF3A 1ZOPA 1IUPA 1U28C 2PZAA 3OEYA 1TKCA 4IILA 1LDNA 1WTAA 5IAEA 3RASA 3ZNQA 3CE6A 3FYSA 2H5JA 3VUEA 4GR9A 4M53A 5U4QA 1QSGA 2CCGA 2EOAA 4QWWA 4B6OA 4EP1A 1ZGZA 2EC5A 2RB5A 4H17A 4DB4A 2P2YA 1BX3A 1B0PA 3PU6A 4NMLA 4II7A 3GDFA 1HGXA 1CJSA 3ZU4A 3JY6A 1YDFA 5DBFA 3R3XA 3IEPA 3JW8A 4OVKA 4EHIA 4KPYA 4A2CA 3TG2A 2PJZA 2WWWA 2V7WA 5AK3A 1JHOA 3VSDA 1KSFX 5BV8A 2ZIUB 4MJ7A 1V95A 1GTZA 1NUAA 3RG8A 3U3JA 2P6OA 2PEZA 2FEAA 4QOFA 1NQXA 2XDYA 3WTBA 1RWBA 1E8MA 1A31A 1K7XB 4H3HB 4HAIA 4O2LA 4OQFA 4OUDA 3ORRA 4PR3A 4JLPA 4WK0B 3RUHA 4MXDA 2A68D 2VHCA 4TRJA 3NBZC 1J0EA 1OVMA 1GU0A 3G17A 3PE4A 5JAPA 2MHCA 3WLEA 1XZDA 2AKEA 1TCUA 2FQQA 1JEJA 1DUSA 1GN8A 1Z8FA 3OLWA 2SKEA 5CURA 4EATA 1Z5ZA 1J0XO 4A0FA 3QEOA 1ST2A 2PEYA 3W5CA 4JT4A 2Q5CA 3IXQA 2TS1A 2E87A 3HFGA 4NK4A 5HIKA 3X1ZA 5J1TB 1JG6A 3GGPA 2DBZA 2RMKA 3S8MA 2FEOA 4ZO8A 1EP3B 4KO4S 4ESHA 5EP3A 2XADA 3NDRA 4W5HA 3GARA 2CLIB 4RGYA 5J4HA 1T8WA 1TPZA 1VXRA 2IZ1A 4UEJA 2L17A 3VHLB 3ZCSA 4GHWA 1ZHOA 3OC6A 4H7JA 4M0DA 1NW6A 5I7FA 4WL0A 5DIFA 5LZ4A 1N1MA 3BVPA 4MWSA 1U2ZA 4H18A 4AVYA 5JW6A 2A1TR 2C3PA 1O6BA 2CJWA 3K9HA 1NI3A 2XOKA 3K6JA 4EYQA 5F1OA 4IUBS 2VJKA 4D8VA 1Z2AA 4S1NA 1L5KA 1YRYE 4HNUA 4GP9A 3ONDA 1LLCA 4ZHQF 2Z9CA 4ZARA 5LKRA 4UPDA 3KD2A 1MOZA 5D85A 2ZDGA 3P9SA 1J0BA 4QU8A 4XM0A 4G2TA 1CRZA 1DAGA 2O8CB 3IIEA 3OZWA 1E1MA 1U3TA 4Q3NA 3RSFA 1JJBA 3N6VA 4K9LA 4A2WA 2MMCA 1KEZA 4QFDA 1RJEA 4I46A 3TE7A 1A8PA 2UZ0A 5ALKA 5KHLB 1L7EA 4FILA 3FCEA 3EASA 3IJPA 1KK0A 4GPD1 4DT1B 5HUHA 5KQSA 4AS1A 5AVJA 3EODA 2REQB 5DBEX 5ICSA 1E89A 1G21B 2ZW9A 2W0SA 1FSFA 1VE1A 3JU3A 3GMIA 1YZNA 4R2KA 1ZNZA 2G5PA 3RQSA 2CXUA 4I4CA 2DFVA 1RZ3A 4DWJA 2H2FA 2ZIXB 5AW2A 1W9MA 1SQSA 3IQFA 5JQGF 3EZLA 1Q7RA 1S89A 4WKGA 5LUAA 1AMUA 5F23A 4HATA 4NYMQ 1PV2A 4X8MA 3WIVA 5C81A 5DHSA 1JBEA 2NPIA 1K9VF 1QOQB 4TL8A 4CKBB 3ZXUB 3U39A 4US2R 1PR6A 1YASA 3A6FA 1B74A 2BD0A 3UJ7A 5C3MA 4IKPA 3B5IA 5TVGA 5ADVA 4M0PA 1H8ED 3OWXA 3EPHA 4ZIRA 1DJMA 5L7TA 2OO5C 2PIAA 2UUBB 1X0VA 2AMYA 1I0IA 1RCFA 2ASVA 4M9ZA 2FDRA 5BVGB 3OQ6A 3HEAA 4RESA 5KNBD 4G4IA 1CUWA 1O7JA 1ZH2A 3DEAA 4YAWA 5H8WA 3WGMA 5JZVA 1L5WA 2OZKA 4M2LA 5U4XA 2ZB2A 1U2GA 1NQVA 1QRSA 1QAMA 3MAGA 4BCCA 4OFXA 1X7DA 5SYNA 3DXZA 4YNBA 4B3MB 2C20A 2DQZA 3L79A 3RYIB 2LBPA 4PGAA 3WBBA 4Q9IA 3A9TA 4ECEA 5F98A 2OP0A 1V5FA 1PFGA 5LP6A 2I7VA 2PX5A 1NC3A 1PNTA 1VA4A 3MINA 1KHTA 2Q27A 4UULA 5E4JA 5B3AA 1T5IA 3FTNA 5TF4A 1D6NA 2FHSA 2Z8YA 2WIKA 4KN5A 4UU7A 4WNAA 1U98A 1XZHA 4BBPA 4EG3A 5FL7A 4G0MA 2G25A 1DC5A 4KO3S 4EYGA 5K8IA 1MABA 1S9HA 1PQWA 2C3YA 3KTOA 4XFDA 2YIVX 2FR0A 4I5DA 3Q4GA 1E62A 2GO1A 4FC6A 5JFGA 1TVEA 2JVJA 3RF7A 5NULA 1IIBA 2Q5OA 4IBOA 2E85A 3AR9A 4AC9A 3WVOA 4EEKA 2IEZA 2H2WA 2IVFA 1HF3A 3FKSD 2Y0BA 4GZLA 4IIUA 4A2QA 3L8FA 1W7AA 1TADA 3DC7A 3CJRA 3GPLA 2GZDA 5FUYA 3KOZA 3FOWA 4C7VA 4DSTA 1FVOA 4KSYA 5GZ6A 1XEAA 3S27A 1Q0ZA 3LQ2A 2PGIA 4M1YA 4QDOA 4R1NA 5LSAA 4CQJA 2EX1A 1TKAA 2R6GA 3KJFA 3HRHA 3LY9A 3JTEA 4Z9FA 1USVA 1CF2O 3F3YA 4O4JA 1P1HA 3ZC3A 4L9RA 3TPCA 4ZT7A 5CW2A 1W85B 2GAAA 1MHTA 5JMWA 1RQPA 1REQB 3ESZA 4P93A 1O6CA 5EUMA 1C7EA 1NVVQ 2EX4A 2VJBA 1P0QA 4BPRA 4IRMA 4JI2B 1MORA 2QMUA 3HY6A 5EZQA 4ZTUB 5GVSA 3KKQA 2BEKA 2ADMA 3ZGYA 1XXHE 4IWYA 4Q19A 2W4QA 1OLXB 1D3AA 3P0FA 1GTRA 1EWYA 1VHDA 2N3ZA 3B9QA 3G59A 5KWIA 3ROGA 4FYWA 3ZLVA 1DOAA 2GJKA 3ZEIA 3HNOA 1PT6A 1QGAA 2GASA 5CXQA 2EG5A 3MYYA 4B7UA 2IH5A 1UEIA 2RFLA 1YRLA 3FFWA 3FUVA 4CKXA 3O4HA 1N4AA 3VC3A 5IT5A 3I62A 3G2HA 2VJOA 4U2BA 2JHAA 2WMNB 1CY2A 2IPAB 3ESXA 3FNRA 3UK1A 4B9AA 1Z35A 1A8IA 3Q15C 1FNBA 3A1NA 2HA5A 4CM8B 2FVYA 2WHPB 4YXWA 1YZQA 1J1UA 5DNYB 1UWCA 2GD6A 3PUHA 4HSGA 1MF7A 5TJHA 1I94B 2J3DA 1EFAA 1R8SA 5ERYA 4OLBA 1LU9A 2C5BA 1VA5A 2ES4A 1Q0RA 1T5SA 1Z88A 1LWOA 2IUFA 4R05A 4V0SA 2ZG6A 1IJBA 4IDGA 3E58A 4I9UA 4KQFA 4X6UA 1UM9A 1NPYA 2XDQA 2DUUA 5EZ6B 4C2AA 1N33B 3K9GA 1R4MA 2DT5A 3GL9A 4GGPA 4Q1FA 4NV1A 3I5YA 5F2NA 5GJBA 3QEBZ 3WGJA 3B13B