4D46A

Crystal structure of e. coli fabi in complex with nad and 5-bromo-2-(4-chloro-2-hydroxyphenoxy)benzonitrile
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
238
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Ordered Water Channel in Staphylococcus Aureus Fabi: Unraveling the Mechanism of Substrate Recognition and Reduction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 83
structure length 238
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d46A00
3S2FA 2PLAA 1U8FO 3NAQA 3RAJA 1UH5A 3S55A 1U3TA 2PKQO 2BELA 4F45A 1ZW1A 3HN2A 2XXBA 3N74A 3NDRA 5G0UA 2WD7A 2D3TA 4J3FA 1DC5A 1KEWA 3A9WA 4IGFA 2ZJ0A 3OIFA 2J3KA 3HN7A 1CIVA 2Y1GA 3AOEA 1D7OA 1RM4A 3OMLA 1HLPA 2BRUA 2AEMA 3EHEA 3C7DB 3D4NA 4ALNA 3I5MA 1PR3A 5C5IA 3CUKA 1PJBA 2EW2A 2NACA 2FPIA 1YL5A 1ULSA 3JQAD 1XDWA 4IBOA 1UXIA 4DREA 4IY1A 5T5QA 3CXRA 4E31A 3ETEA 3DFZA 2E37A 1F8GA 3MWEB 3MEQA 1KBZA 1H5QA 2AG5A 4J1TA 4OJNA 4RPLA 4FC7A 4H15A 2XF8A 3ZDFA 2BH9A 2ZYGA 1DLIA 2W90A 1SO8A 3MWDB 5I9LA 2PH3A 2OHXA 4LN1A 2ZB3A 2FMUA 2I76A 5JC1A 4JBHA 5TNXA 4XCVA 3F46A 4GX5A 3HG7A 4NPCA 5IZCC 2O50A 3DWFA 4PZDA 5F21A 4B3JA 2Y1CA 1N8KA 4B4OA 1UUFA 2Q2QA 4L73A 2GN6A 1DRVA 3JD3A 3OIGA 4CLRB 1JKJA 4G5HA 4J0EA 1FXSA 2O2YA 3TNLA 1GUZA 1GYRA 4MOWA 3KLPX 1ZSYA 3DTTA 2RHRA 3WQQA 4BQRA 4RDHA 3JQAB 1MX3A 1U8XX 2YHIB 3FTPA 2NU9A 3BMOA 3V5NA 3OEYA 5JMPA 4EDFA 4U6SA 3TZQA 3DC2A 4W7HA 4KP7A 1NVTA 4LCJA 4DXHA 2JFGA 5IAAA 2CD9A 2JAHA 1T4DA 3AI1A 1MG5A 1X0VA 2DTDA 2VWGA 3RUEA 2IZ0A 2DTXA 2HU2A 3L77A 3JQGA 1A9ZA 4BNMA 5CEFA 5HS4A 3GNTA 2HK8A 2J5RA 3C7AA 1YE3A 2PZJA 1TT5B 2NTNA 4YVFA 1PL8A 3E6AA 1HDXA 1T2CA 4CM3A 1ML3A 1GEGA 1BHSA 2YV3A 1GQYA 4UUMA 1ONOA 3GGPA 3F3SA 4L9RA 1F14A 4NI5A 4NK5A 1EMDA 1XSEA 1E3IA 1DEHA 2ZATA 4GAEA 4LGVA 3ZWNA 5K9ZA 3LC1O 1KY4A 2I67A 4O1MA 1KC1A 4QQRA 4U7WA 4A73A 1WPQA 1QYCA 4YAIA 1I3MA 4MO2A 5CHEA 1PQWA 1LC0A 1QMGA 2P68A 2PZMA 3GFGA 3DB2A 3RASA 2OORA 1TI7A 3D7LA 3KM0A 3W8FA 1ISHA 5FWNA 1CDOA 1DSSG 1LDMA 2WEKA 3CZMA 1I8TA 2NTJA 4MP3A 3VDQA 1WZEA 4BNZA 2WTBA 4MJLA 2HAEA 5IZ4A 3DAPA 3EAGA 5L4SA 3ONFA 4MKZA 3PWKA 3WWYA 4B79A 4M87A 4ALKA 1IE3A 3DDNA 3RFTA 1H6DA 1V9LA 2P9GA 3EZYA 1GAEO 1BTOA 3PI7A 2FZWA 1E6WA 1A71A 5T67A 1I3KA 3U4HA 4BO5A 2RCYA 2BI7A 1UDBA 2OBNA 3GRKA 3OJLA 4ND5A 4II2A 4W82A 3WLFA 3I6IA 1Q7GA 4GI2A 1C1DB 2X0JA 1P1JA 2PR2A 1V3UA 1QORA 3VPGA 2EEZA 3WOHA 4CLXA 2BFAA 1A7KA 1FDTA 5H82A 1PEDA 3TL3A 2R00C 3KYBA 4XIJA 1I10A 3HDQA 2EWMA 3WMXA 1MA0A 3WR5A 4F46A 2NTVA 4WLEA 4J4BA 3BMOB 4EUHA 1Y8RB 1PIWA 4DLAA 5JYDA 1MC4A 2RBEA 1K3TA 4E21A 4MKRA 1EE9A 4NK4A 1R4NA 1VL0A 2HRZA 5GZ1A 2HRBA 4BMSA 2BD0A 2O7QA 3NEPX 4WJZA 1PJQA 4XKJA 4BKQA 4YAGA 3PWSA 5KVQA 2C82A 2FY8A 3GRPA 3ANNA 4BNHA 3AUAA 4L8VA 5TLSA 2EHDA 3K9QO 3ZNOA 4MIEA 4WCDA 1GV0A 4LVCA 4CMHA 5TS3A 3PHJA 1D1SA 1XA0A 2J6IA 3C85A 3GVHA 2E49A 4YAKA 1VL8A 3ITDA 4ITUA 4PCVA 4JXKA 1EVZA 2X58A 2ZCVA 4I5FA 1T2DA 2W2KA 4XQGA 4AJNA 3ICCA 3BXXA 2WM3A 5F1PA 1WDLA 3VKUA 4CUJA 3KYCA 4WLOA 2VN8A 1AN9A 5ILOA 2GNAA 5ENDA 3OQ6A 4RVHA 3H5NA 4RZIA 2JCYA 1LEHA 4TMFA 3E9NA 4P4LA 4BO9A 3H5RA 3CKYA 3MJCA 1H94A 2IEBA 3INRA 1QSGA 1KVUA 1F8FA 4TKLA 3K6JA 2VYVA 5L7TA 1B16A 3VH1A 2WDZA 3HDJA 1R37A 3PRJA 1C1DA 4JX8A 1GQQA 2EERA 3NX4A 4NJMB 1SB9A 3BMQB 4PRLA 1R15A 1E0DA 1L7EA 2HDHA 4Z9FA 1G6KA 4OSOA 2AQKA 2NVBA 3JQDA 3K31A 3KZVA 3OA0A 2Z5LA 4RGBA 5A3VA 4QSMA 4IQ8A 4AICA 1XIVA 4TQGA 4UAGA 1EZ4A 4G65A 4BQPA 2C29D 3BMNB 4TVOA 4D0SA 4EJ6A 1I2BA 5JO9A 4TROA 3H65A 3V8BA 5FYDA 4CMIA 3WYEA 3WNVA 1DHTA 5EJ2A 2QZ9A 4PLGA 3W6UA 3O9ZA 1HSZA 2A35A 3R3SA 3R3JA 4BNVA 3LK7A 3WQSB 2DU8A 2Y1EA 4O0LA 1J49A 3CEAA 1S6YA 5TSDA 1GR0A 4AJ1A 4RO0A 4XZ3A 5CDGA 3AFMA 4NHEA 3EY4A 3HJAA 4P22A 5BNFA 1A7AA 4UVIA 1G1AA 3JQ8B 1BVRA 2NQTA 3RD5A 3H7AA 4II3A 1E3JA 3PPIA 4L4RA 4CJXA 3SX2A 1IY8A 3D5TA 4CMBA 4J4HA 1PSDA 1W6UA 4W4TA 1BDBA 5L7WA 3H3JA 3PFFA 3TOZA 1AHIA 2VYNA 3G1UA 3RJ9A 1WZIA 2X9VA 1ADFA 3LT2A 3UCEA 3SXPA 2PD6A 3D3EA 5C7IO 1C14A 1E7YA 5ER6A 3RSHA 3VH2A 3M2PA 1QG6A 3KBOA 4CQMA 1SB8A 2YY7A 4GSLA 4OQYA 2GYYA 5JFOA 4C7JA 4B8ZA 2VRCD 2H1SA 3U5TA 2G82A 4AJIA 1W4ZA 2GASA 3DQPA 3HDHA 4XR4A 4IGEA 1E77A 1SMKA 1O5IA 4WKGA 4CL3A 1J5PA 3P5SA 3RC2A 4QO7A 4E5KA 4R51A 1PS8A 3ZN2A 4I9UA 4BL5A 2PA3A 3ZV4A 1DIHA 4YTEA 4AJEA 1I24A 1YBMA 3GFBA 4E0BA 4BKPA 4AJPA 3KTDA 2BMAA 2JHFA 1T2FA 3JD0A 1CERA 2HJSA 1EBUA 4NU5A 3ZHZA 4C4OA 1NX6A 2NVWA 1MUUA 4HWKA 3EK2A 1ZXLA 1O6ZA 1SNYA 1O9BA 3E5RA 1YDEA 4GGOA 5DDIP 3CZRA 3GDOA 2H6EA 4CMCA 5IFLA 2NNLD 4WUVA 7MDHA 2YQ5A 3RROA 3NUGA 4GQAA 1E1NA 1P77A 4WEOA 1NQAO 1HSOA 1B8PA 5JYEA 2EJVA 4PLVA 2X9NA 2UUPA 5KVSA 3PJGA 1NTOA 2YQ4A 2X6TA 3DAGA 1Q7BA 3LT4A 4CM9A 1AGNA 1PGQA 2O48X 1DPGA 4HX5A 1NFQA 5TF4A 3Q2KA 5KVCA 2ET6A 2PY6A 4E2XA 4DQXA 3P2YA 1PZHA 4OAQA 1UAGA 1ZMOA 1P45A 1BSVA 5HWSA 4KQXA 3RWBA 1LDBA 1ZSNA 1OBFO 5F5LA 3IP1A 2EGHA 3NTRA 3V1YA 3RKUA 1FK8A 5KNLA 3I83A 5JNLA 2HMVA 4DWVA 3QWBA 1CETA 2PFGA 3QW2A 4CM5A 4JCOA 3PEFA 4XQEA 3LLSA 3ZWVA 2C2YA 1V6AA 3JQCA 4L4SA 2AQ8A 3ZCXA 1H9BA 3QA9A 1DIRA 1U3UA 1F06A 1ZVMA 2FSVA 3B1FA 3FCOA 3GEMA 4J1NA 4ZQHA 4A26A 5G4LA 1UR5A 2I66A 1FDSA 1UXGA 2E48A 3CH6A 1ZKMA 3FF4A 3GUCA 2VNSA 4KZPA 4W6ZA 4C7KA 3AI2A 3GMDA 4BOYA 2Q45A 4D7AA 4BNYA 4LSMA 3IP3A 4YDRA 3B1KA 5JY1A 3ON5A 5KOIA 5EQDA 2R6JA 4G2NA 4XWYA 2QQ5A 3LF2A 4FR5A 2OFPA 1E7RA 4LSWA 3DHYA 4R5HA 4ZJUA 3GZNB 4HBGA 1LDGA 5KJ1A 3KYDA 4J1QA 4AJHA 5KJCA 3BTSA 4XYLA 3N7UA 5THQA 4Q3EA 4RF5A 3ETDA 2BHLA 1U9JA 3RVDA 3T4XA 5C7LO 3EGOA 1EQ2A 1SAYA 4IINA 1UAYA 1Q2XA 1IL0A 4M89A 4XB1A 2X7HA 3FR8A 4CUKA 5IN4A 1YBAA 1S7CA 6LDHA 2Y66A 4JROA 3TWOA 3I1JA 4PFJA 4YJFA 1O8CA 4Y9DA 4RPGA 3BA1A 2EKPA 4N7RA 4KDFA 5B4TA 3L0DA 3ORFA 2O3TA 3PQFA 1DHRA 5B4VA 4JP2A 1XU7A 4WGGA 4Z6KA 1U2GA 1N9GB 4PG7A 3JQFA 3UF0A 4EEXA 2X22A 1J0XO 4DVJA 2RHCA 2NU7A 4CM4A 2XXJA 4IJKA 2JAPA 3GK3A 3BTOA 4HADA 4E2YA 1VM6A 2GUGA 1BRMA 4MVJE 1PU2A 5JCJA 4Z9YA 3NJ4A 4Y8VA 2FZEA 5TT1A 4HFJA 4OMUA 3HNPA 1SZJG 1VL6A 4CV1A 1Y8QA 3MJ4A 1DJNA 2RAFA 3G17A 1E1KA 3TJRA 3WYCA 3A28A 5FF9A 3GPDG 3JQ9A 5EPOA 5AXBA 3ADPA 3DBRB 2DPHA 1NNUA 5EQFA 5I7EA 4FPXA 3I9MA 4JP3A 5LCXA 1NAHA 3QVOA 1HDYA 2VHVA 4IDGA 4OM8A 4D3DA 1EUZA 3M1AA 2Z1MA 1XR3A 3OQBA 3TQHA 4DQVA 5A5EA 1I3NA 4UULA 4BB5A 2VHWA 4R1UA 4ZU3A 1UZLA 3ENKA 2CMDA 3OJOA 1ISGA 1PJ4A 3LVFO 2JD0A 4OXYA 4E32A 4RPJA 4AG3A 2HMTA 4PLZA 4ZN6A 3INTA 3JQBC 1LRLA 2C7GA 4AFNA 4YYZA 3L9WA 2DQ4A 4CM9D 4PG6A 1SBYA 1R0SA 3ROPA 4A0SA 3ROKA 4FFOA 1MV8A 1NWCA 1ZCJA 3G49A 2Y1FA 2XOXA 1XU9A 4A10A 2VWQA 4FN4A 1SCUA 4FJ0A 4TWRA 4J1SA 4ND2A 2GZ1A 3DL2A 3KVOA 4RVGA 3GUYA 1DC6A 3SLKA 3GNQA 4L0QA 5F3RA 1JLLA 3L4BA 1LQTA 2DFVA 2ZB8A 3DZHA 3WG9A 4B3IA 3GGGA 2AQHA 1LXCA 5DP1A 3R0IA 3ZW9A 1YONA 3CSDA 4EI2A 1ADGA 8LDHA 3QVXA 1I32A 1ZNQO 3HADA 2QZZA 3HSKA 5CAEA 1PTJA 5A03A 2I3GA 1VLLA 2VUTA 4UUOA 4WOKA 4XA8A 4XIYA 1F12A 2JHGA 4CLRA 1AUPA 4RVSA 3WNQA 3OQ1A 1X14A 4L74A 4CQLA 5LDHA 1R0KA 4L4XA 1GY8A 2WE8A 3M1LA 1XG5A 2YHIA 4LMRA 3MJEA 3PTZA 4HNGA 3DBRA 3K30A 1U3WA 1C0LA 2DVMA 1YB4A 1X13A 1PL6A 2D8AA 3PHGA 3IJPA 4GMGA 1P3DA 1CF2O 3AW9A 2B4RO 3DBVO 3KOUA 3ZI0A 3OJFA 3OBBA 1YKFA 1BVUA 4NJMA 2X86A 2YW9A 2YJZA 3C1OA 1NQTA 4JJGA 2X0NA 1E3WA 2Y0DA 3IC5A 3I4CA 5DP2A 3VZSA 3VVBA 3L9XA 3VZPA 2HK9A 2BFMA 2JD2A 1YGYA 2OBYA 1NR7A 5AXCA 4URFA 4R9RA 4BIIA 4K1LA 4E2ZA 4YT5A 1EVJA 1VJTA 4E5NA 1MB4A 5JO0A 3L07A 2QRJA 3VH4A 3X2FA 4BMNA 3GDFA 3VH3A 3WJAA 3DMTA 1U1IA 1H6CA 1M76A 1I0ZA 4TSKA 3FNEA 4KUHA 1NASA 3WFIA 1O95A 3EYWA 3GQVA 3GZNA 4OL9A 2PK3A 2C59A 5G4KA 5A02A 2IEDA 3W1VA 2IYPA 3LQFA 3UAGA 1BWSA 1VKOA 3QVWA 5JDCC 5FI5A 3QV1A 1P9LA 1RWBA 1I36A 1TT5A 5JBIA 3WB9A 4JJIA 1X7DA 3GOHA 4A5OA 3GA0A 4TVBA 1JKFA 3I23A 4B4UA 4KUEA 2C07A 1E1LA 4TRJA 1B3RA 3ZGYA 4DBVO 3E1KA 4ZVVA 1H6BA 3I9JA 1PGJA 1V35A 3NGLA 3PZRA 4R68A 4WCFA 3U09A 4M54A 2DPGA 4BNNA 4RLHA 2QRKA 5I8WA 5JW6A 3JYLA 1M6HA 1Q0QA 4FGSA 1HYHA 1P1KA 4YT4A 4QX6A 3LU1A 1DFIA 1P1HA 3E5MA 4UVDA 5GZ6A 2JD1A 3PYLA 3ZWBA 1I2ZA 1MFPA 4IIUA 3F4BA 3NJ8A 4UVGA 4Z0HO 3NRCA 2A92A 3F6YA 1QYWA 4GVLA 1UXHA 2D1YA 5ENVA 4I8XA 4YJHB 4AJ4A 1JQBA 4OOFA 3GEGA 4RQTA 4XQ9A 5L45A 3MOGA 2YDYA 4S3MA 1PJ3A 4RORA 3JQGB 4CM8A 2AA3A 5L7YA 2J3JA 2FPPA 4R01A 1HE4A 4NH4A 1WXDA 5JCXA 4KDEA 4KUGA 1DC4A 2VWHA 4WLFA 3L6DA 1KVQA 1DB3A 4R1SA 3ADOA 3GVXA 4YA6A 5IDXA 1YO6A 1N7HA 2X5OA 3DEYX 5ILGA 4Q3CA 1Y8RA 6ADHA 4E5PA 2QHXA 2ZTVA 3QVSA 2CFCA 2I65A 4J2OA 2IRWA 3IL2A 2DTEA 1GL3A 4F6LA 1LC3A 1X1TA 3Q9UA 1PWXA 3DHNA 3NDJA 3DOOA 4RJTA 1GCOA 2NLOA 4WE3A 3UOGA 1C1XA 1V8BA 2PGJA 3D3WB 1TT7A 4L75A 4ZA2A 4CL8A 1E1MA 4ALIA 3COSA 5DN9A 2FR8A 4IZIA 5JAZA 4QO8A 4IS3A 5I9NA 2VT3A 4BKUA 3RI3A 3RFXA 4BO1A 5G4KB 4J9UE 4J16A 3HQ4O 2NWQA 1E6UA 2UVDA 2QX7A 1VJ1A 2XPCA 3BHIA 3A1NA 3HE3A 4IPTA 3OICA 3TZ6A 2BGKA 4HFRA 1IOLA 3NTQA 1MXFA 4IJWA 2FR1A 1FDVA 5CPFA 1TEHA 4IZHA 1RJWA 4MP6A 3ETGA 3HHPA 1NFFA 3WS7A 1EFKA 3TDKA 5IG2A 4BNFA 2OOSA 3NYWA 4DLBA 5L95A 4I5DA 1H2HA 3D1LA 3FI9A 2R2GA 2ZYDA 5KWEA 4XQCA 1J4AA 1U2DA 4OKNA 2CF6A 4G81A 1N7GA 3IMFA 4Z3KA 3OJ0A 3AM5A 5JS6A 1UJMA 3L6OO 3F1LA 4YEDA 3ZNNA 3ICPA 2GRAA 3OA2A 4J91A 2QYSA 4CUZA 1H6AA 3IIEA 2O2SA 4R3NA 3H4VA 4NFYA 4WNCA 1E7SA 3CE6A 3AY6A 3CMCO 4TKMA 8ADHA 2H63A 3DXFA 5EL0A 3FPLA 4R3WA 4U0JA 1HDOA 3JQEA 4YBZA 1Z75A 3QVTA 4NBVA 2PD4A 3W4IA 5JDIC 1VE9A 5G0SA 4ROSA 1GTMA 3PYXA 1QYDA 4R9SA 3ZW8A 3SBOA 2HQ1A 3ZZNA 1FDUA 3VKVA 1ID1A 2Y0CA 3LT1A 1ADCA 1K89A 1ZJZA 4UUNA 4NR0A 5HBRA 1QXSA 1QKIA 2PTGA 3ULKA 4PLHA 3I9OA 1P1IA 4E6PA 1BW9B 2AW5A 1PX0A 3BHMA 1Q7CA 1ZIDA 2TMGA 4ZQEA 4QECA 4WNIA 1VSVA 4PLFA 4CM6A 2ZB4A 4YR9A 1RPNA 3QQPA 5L51A 2JCXA 4YRAA 2CDCA 2NVUB 1E3WB 1BW9A 2BLLA 3VPXA 1XWFA 1EDZA 1NPDA 2YHUA 2NV6A 1UP7A 5ITWA 1FDWA 3TPCA 5A5FA 4BGEA 1K0UA 4CMGA 3MJTA 1EK6A 1YWGO 4CR7A 4JNKA 3WBFA 1U5CA 3C1TA 2VHZA 2Y67A 1P0CA 1PJ2A 1ENZA 5L40A 3S2GA 3KEOA 3JTMA 4JN6B 4JJFA 5GMOA 2EW8A 3OJEA 4J90A 3F1KA 4EUFA 2ZYAA 3I9KA 3JYNA 5JDIA 2P9EA 5A9RA 4P38A 4Z3DA 4WECA 1CQIA 4YJGA 1PS0A 1HYEA 2RH8A 3PDJA 4QFDA 4YB8A 2POQX 1I01A 2DBVO 2O3RA 2EXXA 2GN9A 3C3XA 3O4RA 1YL7A 2I9PA 3DMTC 5ICSA 5C7OO 2VCYA 2W4QA 5CFZA 3Q9NA 2E82A 2H9IA 3D3WA 5B12A 2B5VA 5CDSA 3IS3A 2UUOA 1IYZA 3UUWA 1KEPA 1NAIA 4MP8A 1O0SA 2W2LD 4FS3A 3KSDO 2VOEA 1PJSA 4YQZA 2O3SA 2GDZA 4YQYA 1M2WA 3PWZA 1PWZA 5EMHA 1F0YA 3DAFA 4BO6A 1SOVA 1JN0A 1HDRA 5COAA 2PGDA 4B7UA 1WDKA 1T4BA 4J6FA 3VOSA 4FSHA 2FRDA 4Q9NA 1ARZA 2D0IA 3FHLA 4X54A 2P4HX 1P74A 1EBFA 2O4CA 4LISA 2WD8A 3KHUA 3DTYA 3E03A 3LYLA 1HTBA 3QRWA 4MINA 3VZRA 3UH1A 3WYBA 3DONA 2C5AA 5EN4A 2YDXA 4GX2A 4PVDA 3ZNPA 4D43A 1EE2A 4I9HA 1ENYA 4AJKA 3DOJA 1A4UA 4NJOA 3JD2A 3STHA 2AHRA 3L4SO 4WPGA 5DNAA 4OIMA 5EIOA 4ID9A 4RQUA 5IDQA 1H93A 5MDHA 1ADBA 2D59A 2A9FA 4CMEC 1TLTA 1E7MA 1ZXBA 2IZ1A 1E7QA 3P19A 2G17A 3U0BA 3BYZA 2P5UA 2IXAA 4BNXA 1A27A 4BNGA 2QW8A 2OP0A 3EUWA 5FFFA 3A14A 4FD3A 1IB6A 2EIHA 1U4OA 1NHWA 2P2SA 5TX7A 2CY0A 1NXQA 1Y5RA 2D5CA 3UN1A 2Y1DA 3WLEA 4BNKA 1XGKA 1PZFA 3PHLA 1OOEA 4ILKA 3GDGA 3TOXA 5C3MA 3LC2O 3FD8A 4HKTA 3QWFA 4K26A 9LDTA 4XB2A 1PGNA 2WD7B 4YJFB 5L4LA 3PJEA 3GAFA 1YVEI 2CSUA 4M1QA 4FQ8A 3KETA 4YJHA 1NWHA 4OQZA 5AOVA 5DT9A 5IJZA 2VWPA 3AI3A 5A3JA 4WOJA 1BXGB 5DOVA 5COQA 2Y05A 5T8KA 1GFSA 4YPOA 5T8KC 4IMRA 3RC1A 2B4QA 3MZ0A 2VNAA 4GMFA 3B6ZA 4YJDA 1R16A 3GEDA 1NBOA 2V7PA 1P1FA 4CMAA 1HDGO 2F1KA 4JIGA 4IDCA 3MJVA 5TJHA 1ENPA 4W7IA 1W73A 4IDFA 5EESA 1KVRA 2ILTA 1WW8A 4QEDA 2HMSA 2EJWA 1PQPA 1OAAA 4WCFC 2OGUA 5A9TA 4GBJA 1A72A 3PYMA 3DR3A 4NG5A 1HEUA 3RBVA 3HUDA 5BQFA 3LF1A 4DPKA 3NT5A 2D4AA 2W8ZA 4BGVA 1LSUA 1GYPA 1K6XA 4XGIA 1T2EA 4D45A 3FBGA 3GNSA 1KEVA 3E82A 2QRLA 3VPHA 5DCUA 1P31A 1K5HA 4BO8A 2PGLA 3ONDA 1HF3A 1ZO8A 1YQXA 1YB1A 1ZZEA 4QT0A 5IDYA 1CYDA 2EP7A 4DYDA 3H9QA 5B37A 1YQGA 4I08A 3RJ5A 4RV9A 2OZPA 4B8WA 5CP8A 1IZ9A 3DHEA 2I99A 1Y6JA 4BV8A 3DBHA 3DBLA 3NKLA 4IIVA 2OUIA 4BB6A 4IDBA 4N5NA 1DXYA 2AE2A 4HFMA 3ZHXA 1Y5MA 4RVFA 4DMMA 2BGMA 3TFQA 4BVAA 2W98A 4FIZA 3FNGA 4ALLA 5IF3A 5LC1A 1Q1NA 1ZH8A 2GZ3A 3GC6A 2V6FA 5HS6A 2YV1A 1BMDA 1X1EA 2HMUA 3VPSA 4IXTA 4E30A 2OL4A 3PFWO 4R4JA 1DDOA 5F1OA 2OP1A 4RCVA 4NU6A 4M55A 1GQ2A 2CUKA 4UEKA 1ISIA 4CV3A 1Q0HA 3ENNA 3RC9A 1K2WA 1LNQA 4ZQGA 5U1PA 4LVUA 1T1RA 2XAAA 2O3QA 5BNIA 4R41A 2AG8A 3ST7A 2O23A 3PQEA 4IDEA 3H9GA 2ZTMA 2X23A 4BNLA 4R16A 4A27A 1DJQA 5G0VA 4L76A 3TZKA 2Q46A 3NT2A 5ITVA 4HV4A 1NM5A 4DQUA 1MC5A 1ZMTA 4CPDA 2FHSA 2Y93A 1PS9A 4J2HA 4B4WA 4Y67A 1WWKA 2Q2VA 1M6WA 1YJ8A 3V2HA 4IMPA 2X4GA 4OYRA 4JK3A 4RF4A 3ASUA 1ULUA 5DCWA 3EZLA 3H2ZA 5IN5A 2O7SA 2VZ8A 1WAMA 4RVDA 3F4LA 2VUUA 4PLCA 3QLJA 3VZQA 3ITKA 3JYQA 4YT2A 2VZ9A 3D0OA 4ZQBA 2BGLA 3DZIA 2AEJA 3ZU2A 4PLYA 5COBA 2DFDA 1JTVA 2Q50A 4LK3A 4HP8A 4J7UA 5G2OA 1KC3A 3HFSA 1B15A 3Q0EA 3ZV3A 1N5DA 3DZBA 3PP8A 5I8ZA 5AYVA 5KJEA 1DIBA 4CLOA 3WJ7A 2CDAA 3H8VA 3ZHBA 1T1SA 5H83A 3UCFA 5DOZA 4EUEA 2GLXA 1ZBQA 1GCUA 2HSDA 4F3YA 5KTKA 1LX6A 2VYND 3WTBA 1V0JA 3BZUA 1GPDG 1NFRA 4ZQFA 2IODA 1KS9A 3MJSA 4IS2A 3GPIA 3QP9A 1LQUA 2R00A 3IOYA 4OXKA 3K5PA 3UXYA 2PV7A 2HK7A 1HE5A 1OMOA 3BHJA 5TIIA 5HM8A 1H2BA 2HMWA 2I6TA 2C7VA 1O89A 3WFJA 4D3FA 1T25A 4FCCA 2CDBA 3PJDA 1D4FA 3G79A 1V3VA 2VRCA 4N18A 1A5ZA 2EF1A 3EVTA 4XJSA 4AJOA 4A03A 1DRWA 3H3FA 1KOLA 4DPMA 2IE0A 2DAPA 3Q1LA 5DBGA 4A7PA 3KXDA 2LDXA 4DYVA 5BSFA 3IUSA 5TQVA 2Z95A 1LA2A 3OIDA 4BO7A 2JKVA 2D5AA 1EUDA 3GZ4A 5A06A 3U3XA 1ISMA 3GVCA 3RUIA 1GUFA 1P1RA 5JC8A 2DBQA 2EGGA 2PZKA 1E3EA 4ZRNA 5T64A 3ZU5A 3TFOA 1GZ3A 3SVTA 1H0KA 2ZQZA 4KQWA 3U62A 3GGOA 1DFHA 3QJ5A 3FWZA 4MVJG 3WIDA 1AXGA 1LJ8A 3ROQA 5BT9A 3B1JA 4KOAA 3RUDA 2JJYA 2PKRA 3O26A 4WLUA 2YV2A 4OXNA 1B8VA 1PZEA 1YDWA 3I9NA 4RF3A 4NBUA 1Q0LA 5A04A 3RC7A 4ZRMA 2G1UA 1QYXA 2CVQA 1P33A 3PIIA 4XD2A 1C0KA 4INAA 4IJVA 3K8ZA 3PIDA 1XQ6A 1IULA 3AWDA 5MGBA 3SJUA 1N2SA 4EEZA 1LU9A 1CWUA 1R4MA 1UXJA 1SEPA 4OOEA 4M8SA 5G0TA 2I5PO 2B0JA 2BKAA 3D4PA 5KKAA 4YRDA 3WICA 3JQ8A 4CM1A 1IPFA 2PD3A 4M86A 5TGDA 4IM7A 2RIRA 4BNJA 2JFHA 3PVZA 2Q4EA 3K92A 4RLSA 1G0OA 2UAGA 4MVJA 4B7CA 1P0FA 4IJUA 2EKLA 1ZSVA 4F6CA 1GUYA 7ADHA 4CR8A 2X0RA 1A4IA 3QWAA 1Y8QB 1E5QA 2TMDA 3GHHA 3JYPA 4YCAA 4TZKA 2W2LA 3PLRA 3B70A 3E8XA 3U4CA 3QIVA 4RZHA 1GV1A 1NPYA 1WP4A 3GR6A 4EJMA 3CPSA 4RDIA 3HB5X 2WYVA 4HNHA 4YT8A 3ABIA 1YOVA 3G3EA 4MVJP 3O8QB 4YACA 4R5MA 3ZV5A 1ENOA 1GADO 1VSUA 4Y6PA 4JGBA 2J8ZA 5KKCA 1R6DA 1K6IA 1YOVB 3QSGA 5ICMA 3C7CB 1ZJYA 3ZNQA 2VT2A 1UDCA 1TB4A 4DIFA 4QUKA 5BSEA 2NM0A 4MIOA 3UHAA 4YRBA 2G5CA 3VDRA 2X1HA 2SCUA 3ONEA 1EUCA 2HLPA 3CTMA 1DO8A 1ONNA 3W6ZA 1LLCA 2Y0EA 3KO8A 4P4NA 3WGHA 3VHRA 3UW3A 5T6BA 3RCBA 1KETA 5BSHA 3OECA 1TVEA 3CIFA 3FBTA 1DBVO 4U6QA 1R4MB 2J5QA 1M66A 3L4BC 3OEWA 1U3VA 5A4DA 1I2CA 5CPBA 5GZ3A 2C5EA 4RVUA 4YXFA 4RF2A 1UZMA 2FN7A 4GVXA 3WXBA 3E9MA 2V65A 3OSUA 4MVJH 3UICA 3FNHA 4FBGA 2VTDA 5JSFA 3FN4A 3E9QA 3KSZO 3H6KA 3KV3O 3PHIA 4FOOA 1XKQA 3HZZA 3I6QA 3JV7A 4NNJA 3RBZA 2F00A 4CQMB 1OFGA 2A94A 4N54A 5TT0A 1KEUA 2DUWA 5JCJD 2CVOA 4EW6A 3RKRA 1B8UA 5HRUA 2AQIA 4KTTE 3L6EA 1LDEA 1WMBA 1YBVA 4BHTA 4NBRA 3ZWAA 5LDGA 1B2LA 1N92A 4FFRA 1WNTA 3ZWXA 1NPTO 3ANMA 2B4TO 3CMMA 1Z73A 4CMJA 4JQCA 1BGVA 1NP3A 4E13A 1NVMB 4P8RA 1QR6A 1ZEJA 2ZTUA 4D46A 3EC7A 1BXKA 3AU8A 3ZV6A 3WGIA 3W4KA 3OP4A 4QTZA 3DZFA 1C1XB 4MKXA 3O8QA 4PZEA 3WGTA 4CQMD 1Z82A 4QXMA 3ZU3A 1XEAA 3Q3CA 3KEQA 1R4NB 1ZK4A 2V6BA 2YFHA 1ZFNA 2BFPA 5JY6A 5U4QA 1UXKA 1Y9AA 1IZ0A 4O59O 4J43A 4ND4A 1Z45A 1PGPA 1ZK0A 1BG6A 3K2BA 5JLAA 2Z1NA 4GSKA 1EEHA 1KY5A 2QYTA 3GT0A 3V1TC 4AJJA 2UV8A 4B3HA 2VRBA 2FR0A 1JWAB 4PGFA 1YB5A 2FP4A 5F1KA 4YAEA 3IDSA 4S1VA 3PK0A 4Q39A 5DULA 4BMVA 3GG2A 3IKTA 2GR9A 5KCZA 3BTVA 2GSDA 3ZWOA 3PHHA 1RM3A 2NSDA 1T2AA 4NQZA 4WK6A 3X2EA 4QFCA 4A2CA 4BUCA 1Y9EA 3E18A 4CLOB 1UP6A 3WDSA 2VZ0A 2CZCA 3I52A 4OHUA 3WMWA 4CM7A 5FI3A 4BNTA 5B1YA 1LI4A 4GH5A 1I30A 4YWJA 4OKIA 1MG0A 1B3BA 3TRIA 3AY3A 3JQBA 3OF2A 4NBWA 3ZWMA 4XRRA 1KVTA 4TRMA 4MVJM 3HB4X 5IXYA 1SPXA 3JQ7A 3G1TA 4OO3A 5U9CA 3WGGA 2GGSA 3O03A 3SLGA 3FPCA 4PVCA 4Z9XA 1KERA 4FDAA 5JPIA 1GEEA 4JLWA 3K73O 3HWRA 4H7PA 4Y98A 1JVBA 4OH1A 4ALMA 1MP0A 4PG4A 1NHGA 3UCXA 1LSJA 2A4KA 1SOWA 2H5LA 3LLVA 4IQGA 1LDYA 2GN8A 4EITA 1Z7EA 4AVYA 1FJHA 1L1FA 1W0CA 3D5QA 2HKIA 4LRSB 1YXMA 4BKRA 4W99A 4J7XA 4I9NA 1PJTA 4IQ0A 2VHXA 3Q6IA 1VPDA 1RM0A 3KRTA 1OC4A 1IPEA 3U9LA 3DO5A 4IXWA 3U4IA 3G0OA 3RUCA 3VTFA 4UEOA 5DBIA 4PG5A 3M2TA 1HT0A 3KB6A 4XDZA 4XGNA 2ZJ1A 3UVEA 4DIBA 1G0NA 2FSSA 1HLDA 3T4EA 3I4FA 4DLLA 5CEEA 1B0AA 2ZKLA 3AOEC 4FC6A 3AUSA 9LDBA 3JQ9C 1VJ0A 1GD1O 3RIHA 4BO4A 2VUSA 4CR6A 5JAMA 4DBZA 1ZEMA 2D2IA 2IZZA 3GVIA 3AK4A 3JSAA 5K6AC 2PNFA 4DRYA 5I7FA 1JKIA 2BFOA 2WWRA 3GLQA 4U0KA 4TRRA 5HA5A 3RFVA 3K96A 2DUUA 4DGSA 1D1TA 4HFNA 4MVJI 4YJGB 3T7CA 4NMHA 4I1IA 2RH4A 2VQ3A 4PZCA 1PL7A 2DBZA 4U8GA 3JCZA 4E2WA 1J6UA 2YUTA 2DM6A 4XR9A 4O63O 4ZD6A 5KIAA 2AXQA 1LDNA 1P44A 4CM4B 2OXIA 1BXZA 1CEQA 2Q1WA 3IAHA 3NGXA 2BF7A 3QHAA 1MLDA 2J3HA 4FW8A 1TXGA 4EBFA 3TL2A 1VKNA 2Q1UA 1ZUD1 1CJCA 1N1GA 3A4VA 3HFGA 1ONPA 4XYMA 3AOGA 4GWKA 5H81A 4E3ZA 1U4SA 2CF5A 2UYYA 4NDNE 4FGWA 1ZK3A 2Q1SA 4WCFB 3BAZA 1OI7A 2JCVA 4DMLA 1QLJA 3VC7A 3W8DA 2EV9A 2B83A 2LDBA 4MPDA 3TZHA 1AHHA 5TRTA 4Z0PA 1IHXA 4Q3AA 5BSGA 1QLHA 4D79A 4ONEA 4FFPA 1JW9B 3DZGA 3P2OA 1I5RA 3M6IA 1E3LA 1YL6A 3DBHB 1XYGA 3UGKA 3LC7O 4Q3DA 4GPD1 1JU9A 1ZK1A 1XHLA 3ASVA 1GYQA 1DC3A 3H2SA 4ZGWA 2GERA 2WYWA 3BMCA 1DRUA 4FFMA 5KJ6A 2GCGA 4BNIA 1M75A 1JA9A 5A9SB 4N5LA 5AXAA 1W8DA 3ZH2A 1VRWA 4TRNA 1N9GA 1A9YA 2Q1TA 3QWIA 2Q4BA 4LW8A 5DF1A 1PGOA 4BO2A 5J23A 3GG9A 4FOSA 2WE7A 5FEUA 3LT0A 2YFQA 1DAOA 2CVZA 1JWBB 3WGQA 3MCVA 3V2GA 1LLUA 2EKQA 3WBBA 3LDHA 4EYEA 3T7EA 3KUXA 1B26A 4M49A 3S8MA 3H9EO 1T26A 1QRRA 4W9NC 2Q49A 1AE1A 4ALJA 2Y68A 4GGPA 4XYBA 1HZJA 3NDIA 4AL4A 2DLDA 2HO5A 5TC4A 3DBLB 4RPHA 1U5AA 5L53A 1D8AA 1H9AA 3DOCA 1B7GO 5L4NA 1HETA 2B69A 3PGJA 4H16A 3C8MA 1LUAA 2UDPA 2W2KB 3KSUA 1HDZA 3OHSX 3PQDA 3H5AA 4H3VA 1E7WA 4Z0TA 1Z6ZA 1LRJA 1LRKA 5ES3A 2NADA 3PLNA 1R66A 5GY7A 3GAZA 2PKQP 1NVGA 4PLTA 4EZBA 1HE3A 3FSRA 3CINA 4DL9A 3C1AA 5DCYA 3F47A 4GLOA 1JVSA 1NQOA 1QP8A 1EDOA 3GY0A 5L9AA 1NQ5A 1YJQA 3V2UA 3AU9A 1N1EA 2C2XA 5I7VA 1M67A 3AUTA 1ORRA 2GO1A 3ZU4A 1VC2A 2GF2A 4GKVA 2ZK7A 4GLLA 1PZGA 4K6CA 4ND1A 4E5YA 3DMYA 3VPFA 1Y1PA 2O4UX 4TZTA 4B7XA 3C24A 5AXDA 1NYTA 3OM9A 4PIVA 3UKOA 3BIOA 3NTOA 1HE2A 3ANLA 4MVJD 3OETA 1BXGA 1LSOA 4E4YA 4NZ9A 1DFGA 2FOIA 1HKUA 3FRJA 3JQAA 4AJLA 4BV9A 4CMEA 3FWNA 1YRLA 2J3IA 3GVPA 3ZWWA 2B36A 2AMFA 4U5QA 3WGOA 3JQFC 5DBFA 4NFHA 4Q3BA 4UEJA 5C37A 1HWYA 3GN2A 3F9IA 1X7HA 3IQDB 4GX0A 5CG2A 3QY9A 5T57A 1BDMA 1JAYA 1EVYA 1PQUA 2VYVD 3RU7A 3U4DA 4DIOA 1MGOA 4W9NA 5BNTA 4PLPA 3MTJA 3VAZA 4N5MA 4FJ1A 1U28A 1PR9A 1DOHA 3ZHYA 1GU7A 1K6JA 3FR7A 4FFLA 4XDYA 1FMCA 1QV6A 4BNUA 4CLHA 4NBTA 5EERA 2EG9A 4FB5A 4CQLB 1DIGA 4KWIA 1UZNA 2HJRA 4J9VA 3OH8A 1LTHR 4CV2A 1KYQA 5DZSA 4BS9A 1B14A 1E5LA 1PJLA 1E92A 3A06A 3AM4A 2NU6A 5JXWA 4WLVA 3GH3A 3LSYA 3QE3A 4JBGA 4EJ0A 3E48A 3QWHA 4J0FA 5A05A 1GPJA 5TJ9A 4WASA 4UVHA 2GN4A 1LSSA 3KYDB 2CNBA 1E6EA 1KVSA 2FWMX 5THKA 4NFSA 4R54A 2P9CA 1OC2A 3S2EA 3JYOA 5I7SA 4DUPA 4DPLA 4GL4A 3RUHA 4XRGA 4D42A 3Q11A 2OMEA 4KWHA 1U7HA 3DZJA 4EGFA 2Q2WA 2WMDA 1C0IA 2QIOA 3JQ7B 1R0LA 1RYDA 4R1TA 3INGA 4P4GA 3WGYA 4D0RA 5AQ1A 1F17A 1GZ6A 1DAPA 4PRKA 4XYGA 3BMQA 4PLWA 1HZZA 2HCTA 3RQSA 2E4AA 5JAQA 3S1LA 4K9DA 4E12A 2NVUA 4UUPA 3V1UA 3WX0A 2PWZA 5CEJA 3I3OA 2DT5A 3AY7A 4RL6A 4XEHA 4DA9A 4YAJA 1LLQA 3AJRA 3LZ6A 4FJ2A 1XQ1A 3MTGA 3SEFA 1EFLA 1MFZA 5F5NA 1YQDA 4UREA 4DTIA 3SC6A 5IXSA 2Y99A 1WDMA 3PDUA 4XJTA 5L3ZA 1EQUA 2O3JA 3SJ7A 3K2EA 4CMIB 3TF5A 3RBXA 3NV9A 3GF4A 4OGWA 2X5JO 1SEVA 1L7DA 2NUAA 2P5YA 1KIFA 2BI8A 3WSVA 3DZKA 4D3SA 2P91A 1YH3A 2HUNA 3TSCA 1ISJA 3I9LA 3JQ6A 2IDZA 4JBIA 2B37A 4ND3A 1C0PA 3RUFA 4CLDA 2O3UA 4ZICA 3JD4A 1HL3A 2YZ7A 4XGKA 5JAIA 5HTOA 3Q2IA 1UDAA 5A1TA 1CQJA 2AEFA 4DC1A 2Q3EA 4DC0A 1UP4A 3GN1A 2PH5A 3IUPA 2V6GA 1MXHA 2V6MA 4I5GA 1JAXA 4BO0A 4CM8B 4J49A 2ZCUA 1GZ4A 2B5WA 1DLJA 3P7MA 4CMKA 3ZWYA 1DIAA 3BMNA 1X15A 4CV0A 2FPGA 2DBRA 1NR1A 2GPTA 4PN3A 5JE8A 1T24A 3WIEA 2DKNA 5CDUA 1CRWG 3RU9A 2IXBA 4KMSA 5K6AA 3EDMA 3F5SA 3KYCB 1D3AA 4Y6SA 1HDCA 4AJ2A 3EMKA 5B4UA 4FFNA 1XELA 4Q3NA 4J7CA 2G76A 2Y1OA 3SC4A 1RKXA 4WLNA 3PGXA 4MVJF 5JDCA 4BGUA 3HDYA 3ZWCA 2X8LA 3EW7A 4MDHA 4CLEA 2VHYA 2C20A 3WGZA 1EK5A 4CODB 4BNWA 1V3TA 2C54A 5I9MA 3RUAA 1OZAA 3WWZA 4K28A 1LLDA 5ER9A 5AVOA 3W8EA 1RM5A 3OFSA 3ROMA 1Y81A 1I3LA 4HY3A 1C3VA 1X7GA 4LCEA 4BO3A 3WQRA 1X0XA 4GX1A 1XCBA 1SC6A 2J5KA 4GKBA 1EVIA 4BGIA 4IUYA 3AUUA 1YS4A 3DFUA 4E33A 3NT4A 2NU8A 3KLMX 2I3AA 4J4TA 4MIYA 1IUKA 2IYOA 1RYEA 1Y7TA 2ZIZA 4HXYA 4NIMA 4RPKA 3FNFA 1HRDA 1ZK2A 3IKVA 5IDWA 2ZB7A 1ISFA 3R1IA 3PJFA 5CG1A 2VOJA 4R1NA 3FTNA 2E6UX 4LMPA 1HYGA 4XX0A 4UVEA 4ESOA 1FF9A 2JL1A 1QV7A 3U49A 2EP5A 1WVGA 1Z7BA 2PZLA 3D4OA 4IDDA 3ZWPA 1E3SA 3H9UA 4OSPA 5KVVA 2WSBA 3PXXA 2AE1A 5JMWA 3N58A 1VI2A 4R69A 3TZCA 2VTEA 4ZHSA 3D64A 4GWGA 1LBEA 2JFFA 3VTZA 2X5KO 4D44A 5K0ZA 3H9JA 5KJFA 3JD1A 2DC1A 3BTUA 2B35A 3AM3A 1IHYA 3PZBA 1JDJA 1XLTA 5CDTA 1I33A 2GZ2A 1WLYA 3BMCB 4XYEA 4LRTB 1TA4A 5BR7A 1R12A 1QYVA 1WMAA 4WEQA 4O5OA 3MOIA 2Q99A 5A9SA 1O94A 4Y6RA 4IDAA 3GHYA 4B4VA 4O6VA 2P4QA 3GMSA 5IZCA 3F5QA 5G0WA 2NQ8A 2YYYA 2X9GA 2QG4A 4E5MA 4PG8A 1U7TA 4BKOA 2OO5A 3TN7A 2ZQYA 4D41A 5ADHA 3O38A 3UFXA 3VVCA 2X0IA 1GDHA 2C0CA 2GD1O 4I5EA 3EVNA 1HXHA 3WTCA 4KTVE 3B20A 1Z74A 3WSWA 3IJRA 3AFNA 5EINA 2G0TA 1AXEA 4HUJA 2WJPA 5CDYA 2ZTLA 4K6FA 3S2IA 3R6DA 2WYUA 1PJCA 3W4JA
chains in the Genus database with same CATH superfamily
4P92A 2QD2A 2PLAA 3S2FA 3PT9A 3C48A 3C41J 2P75A 2FX2A 4TV8A 3V1NA 1SHLA 2NO4A 1U02A 4M99A 4R1OA 4X6UA 3V8RA 4F45A 5LN1A 5G0UA 1T3GA 1Y4SA 4TLMB 4ZCIA 3A9WA 3QF4A 4MGZR 2W43A 4YCSA 2AWNA 5DB4A 1CIVA 1X7WA 2R96A 5BRJA 2ZWAA 3BCSA 1RM4A 2GRJA 4U2BA 2BRUA 3TTWA 3OX1A 4KNVA 4LMAA 3TECE 3D4NA 3MUFA 5REQA 4ALNA 4DJAA 3AIMA 3FVQA 2Q3MA 1IN1A 2EL7A 4LDJA 3TLKA 1PJBA 5A4MS 4B3RB 2E1RA 2VHEA 1EKXA 2DFKB 4Y6LA 4JUCA 1YL5A 4JI3B 4O4IF 2OHGA 3T35A 4UHJA 1NP7A 3I45A 4PQYA 3UV7A 1POXA 4JH0A 1E2PA 1I7PA 5FQNA 4E31A 1UXOA 3QMPA 2HYDA 1MABB 1NRIA 3ETEA 1U0NA 4RK1A 4DUGA 1F8GA 4IFEA 4K9RA 4J1TA 5PNTA 1YMUA 2AG5A 3H11A 2ZVQX 1OYOA 3QW4B 4FC7A 4IVPA 3OM1A 2XF8A 1SU7A 3C3KA 3P0HA 4F91B 3H84A 1SH7A 5K99A 2BH9A 4DLKA 4TMKA 2BZ1A 4D6YA 3LXXA 2VTBB 5I9LA 5EIAA 2OHXA 2QLMA 3ZW7A 5JLJA 5JC1A 1QGOA 3PQ2A 3HO1A 4EPYA 3OLQA 4V02A 3DEAA 1ZVJA 4DJFC 1UJNA 3F46A 4GX5A 3JZAA 3LHIA 3HG7A 3SYMA 3GJ5A 3MGBA 5F21A 3ZS9A 4L3OA 1CP2A 4U7PB 4UCWA 2FPMA 3BGSA 1GGFA 2J48A 1P7PA 3N2ZB 4L73A 4EO9A 1DRVA 3JD3A 4OLJA 4ZIRA 1JKJA 4J0EA 2DQZA 1Q1BA 1GAWA 1SELA 5YASA 2O0KA 2ZRMA 3CNOA 3TEFA 4MOWA 1FP2A 1TGYA 1ZSYA 3DTTA 5EJMA 3BJRA 5C8YB 4YMGA 4JYMA 5FBLB 2FZKA 4RDHA 4TWJA 4XM1A 1DZ3A 3WGUA 3T5PA 3TVYA 1YBFA 4NYIQ 3QBJA 1GKUB 3S2SA 3FKJA 1DKOA 3AFIA 1U8XX 2A88A 4KQFA 5AHWA 3FTPA 4C0LA 4RTSA 3BMOA 1WEHA 1T8TA 4MO9A 2JIQA 4UPEA 2CE2X 5LIPA 1RQGA 5EY5B 1GFWA 3DC2A 4NYMR 4EKEA 5B55A 2B6HA 4D9IA 4UFOA 1NSYA 3D9QX 4DXHA 4EMTA 3WAJA 2Q2OA 1EPUA 2JAHA 3HKBA 4EQZA 3AI1A 1MG5A 3A6HA 1X0VA 3TUZC 1I7NA 5LJIA 1DKQA 1J8VA 3CLUC 3EG9A 1F4PA 2HK8A 3C7AA 5AO9A 1XPJA 4MR9A 2H2AA 1U65A 1Q1AA 2PZJA 2QPTA 4XW2A 5EUCA 4IRUB 1FFHA 1JNYA 1YZYA 2DRIA 2C4KA 3FSJX 1ZJWA 1X94A 4UUMA 1T8RA 1ONOA 4JBLA 3P9ZA 5G1NA 3THOA 1BCRB 2PBZA 3JW8A 4NI5A 5K3AA 1N6OA 4EP1A 2GQ0A 4NK5A 4DEYA 5JATA 3JZDA 1DEHA 4GAEA 4K6HA 5K9ZA 2HJVA 1L5ZA 2VKTA 3D8UA 2WOOA 4A73A 1QYCA 4TQAA 5IDVA 4OREX 4XSHA 1LC0A 3V80A 3GFGA 5K0FA 4MJ7A 3RG2A 3V8MA 2OORA 4K9MA 3PTLA 2ZT5A 3NHMA 1UJ4A 3RTGA 1CDOA 5FWNA 4X1KB 4DLUA 3RDPA 1US8B 2Z2YA 5HQ3A 1SVUA 1QUFA 4GD3Q 5IT0A 3U61B 1VHJA 2NTJA 3LBHA 3FVRA 3W8RA 1OHHD 4BNZA 5IZ4A 1ZA2A 2VNHA 4CKWB 4ZXFA 3ONFA 3WWYA 1USVA 4ACBA 2YXLA 3QFTA 3TPFA 1PQYA 1UL1X 4HEA6 1V9LA 2XQKA 1TO6A 1GAEO 3PI7A 2REXB 4JBXA 4CRWB 2AHOA 3TSAA 4DLXA 1XHFA 3NHKA 3PD7A 2BI7A 4W82A 2PPLA 3T9AA 3ZVMA 3GLKA 4FSXA 2BV3A 4DT1A 1NNLA 2R8EA 3G7NA 3EFEA 1C1DB 1UBRS 1DWPA 1P1JA 1JZSA 1QCYA 3W3AD 2RGBA 1V3UA 3AVUA 1QORA 2R4QA 3KE8A 3NBZC 2BFAA 1H2EA 3EJWA 3L41A 1VHDA 1EJ2A 4KL8S 3K3PA 2Q6VA 4EPRA 1X80A 1Z6PA 4F7WA 1MA0A 5DYGA 5EE9A 3FDXA 5KQRA 1JAHA 3A1EA 4J4BA 1QIEA 3B12A 2XJ9A 1KJNA 1OXBB 3Q6MA 5JRZA 2EZ8A 3CRVA 3NCHA 3AF3A 3DP7A 2RBEA 1K3TA 1XNJA 2PNJA 3RNLA 1RYNA 3KZCA 4QASA 1R4NA 1YCFA 2FDCA 4S05A 3N39C 2Y2VA 3PSHA 3BKXA 5IVPA 1S2NA 4U7FA 1AQJA 5J40A 2E0IA 1GG2A 4QE3A 5LNK6 4JUAA 3RFUA 4XKJA 1CUSA 4ZCMA 4BKQA 4CF7A 4RXMA 1M54A 3EEBA 5KVQA 1E2FA 1YULA 3GRPA 3ANNA 4LDPA 2IIBA 4DC9A 4AZSA 3FNRA 2QSJA 5TLSA 4CIVA 2EHDA 3COWA 1GTL1 3K9QO 3KCNA 1ODCA 4WCDA 5IMSA 2WIDA 4KK4A 3DDHA 1CTQA 2X2PA 3LBNA 1D1SA 1H05A 1KIAA 4IOMA 2J6IA 5J2UB 3GVHA 2CLHB 2HPAA 5CVTA 4YAKA 3UAWA 3EDYA 1F2TA 2Z3ZA 4PCVA 1GGKA 4XQGA 2Q4DA 3AKYA 1T2DA 4L8FA 4KLNA 5CMLA 4Z86A 1E3DA 4LSGA 3VNRA 1A9QA 2F64A 4AJNA 2OCKA 5KO2A 4BXOB 2IKSA 4CL2A 4I1SA 3L0SA 2O0LA 5AWFC 3P9SA 1WDLA 3TZLA 1F6BA 4XUDA 4CUJA 1S9DA 3ZCTA 1AN9A 5ENDA 4C4YA 2PUFA 3OQ6A 3KAKA 2RHJA 1N1DA 2P4SA 3KTFA 4NBSA 2JCYA 1OW3B 2HA7A 5CTAA 3OUTA 4A91A 3B7WA 3D3QA 1RI4A 4P4LA 4OGGA 1U8AA 4W8GA 1Y1SA 3BRWD 3CKYA 3UAZA 2AG6A 2PT9A 5H68A 1M0TA 1KVUA 1F8FA 4TKLA 1R1DA 4OK6A 1P4RA 3OCYA 3MJHA 2DULA 3FPFA 3PG5A 4OU4A 7MDHA 5L7TA 3EA4A 1PLLA 2W6NA 3OOEA 4AMGA 2WDZA 2XLBA 3HDJA 5HBGA 1FU4A 1C1DA 1OV4A 1Z6TA 2VJAA 4JX8A 3NX4A 4MRPA 3EQZA 4NJMB 1SB9A 1Y9DA 4PRLA 1R15A 1ULTA 1E0DA 5AJVB 2QR5A 4YJ2B 3PUYA 1L7EA 4RSRA 5H7XA 4DJ5X 3V4FA 3IHWA 3WHPA 1BRTA 2LXNA 2NVBA 3OA0A 2YVUA 1Y63A 2XTNA 4N5IX 2GYUA 4V0ME 5J63A 3GP8A 5AIAA 1M0WA 1XIVA 4REOA 3NBQA 2O14A 4ZU6X 4A36A 3UANA 4L6AA 1KIMA 1D2MA 1I2BA 2R7AA 5JO9A 4TROA 1PFUA 4GOKA 4BBAA 3V8BA 4RZSA 4F4UA 1QE5A 3QPUA 3A6DA 2A35A 4BTLA 1AK1A 1GGVA 2JGJA 3R3JA 4GPBA 2Z6UA 4BNVA 2GCOA 2JA2A 1JQDA 2Q27A 4IFBA 2BFDB 3QOWA 4OHRA 4OI4A 4C1NA 2P3QA 2Y1EA 1IUOA 3F74A 1AV6A 5TPZA 4EVSA 4HLDA 1WP9A 3OZSA 4A8TA 1GR0A 4XZ3A 1K8YB 3AFMA 4NHEA 4NMMA 4NYMQ 4PBSA 3RIMA 4DFDA 2XDAA 3OE7D 1E6CA 3SFZA 2WJ3A 3MF4A 3U48A 5BNFA 4KLAA 4HAYA 4EGAA 2HPVA 4YV2A 4G5FA 2H11A 2IU0A 4KGXA 4JMLA 4RACA 2WTAA 2AV6A 4NC9A 1N77A 1IHOA 4NYIR 2QMOA 3H7AA 1MDBA 2RGAA 3GRFA 1YRYE 4RFSB 5A2GA 5AESA 1EK0A 2IHZA 3WAKA 1XCPA 3M81A 3MLBA 3PPIA 2ZPTX 4I81A 4CJXA 3SX2A 1IY8A 3CJRA 1WCWA 3D5TA 2OG1A 3TLYA 4LF5B 2JRLA 4IZ6A 3OJCA 3QZUA 5CYOA 1WXXA 5CFLA 1RSZA 2PH7A 3LP6A 2QQEA 1AHIA 1AQNA 4CIXA 2V1XA 3FA2A 3HYLA 4HPJB 2XZLA 2X9VA 1ADFA 3LT2A 4XAQA 3IDZA 2GA9A 1IM2A 2PD6A 3OAAD 1C14A 1E7YA 3GBVA 3RSHA 3QU5A 3VH2A 4PPNA 4AO6A 2GJ9A 3HU5A 4EFDA 1E2MA 4Q00A 4GSLA 4OQYA 2WMYA 1K8RA 1OLOA 2UVPB 2BGTA 4YECA 3SYRA 4LKRA 3I04M 4AJIA 3DQPA 3NHRA 3HDHA 4KKXB 4KLRA 4AG5A 5D8DA 1MX9A 5DYYA 3ECSA 3R5TA 3VU0A 3U6BA 2AR7A 3BQMB 1P4HA 3B2EA 4OXQA 4L5YA 4CF5A 1KTIA 2J0SA 4QO7A 3A1WA 3WNDA 1TECE 4BZPA 4E5KA 2HB6A 2PA3A 4EM6A 1DIHA 1SD2A 2HUPA 3HCDA 3DMPA 4YTEA 1FUIA 2ZUVA 3ZCRA 1JKXA 1SD1A 3RJZA 4N0QA 1NBAA 1E94E 2XB8A 3TBKA 1PNRA 2IP1A 2YY6A 2JHFA 3OT1B 1T2FA 2VDQB 4XDHA 5HF8A 1ATIA 4K6MA 4D9EA 2H59A 4LOKA 4E07A 1N2HA 1G5HA 2WUGA 3D6AA 2ZGVA 4D26A 4TUYB 2OYCA 4JVNA 1SCQA 4OQMA 2C58A 4AKIA 1C9NA 1ZLXA 1JHZA 4B82A 1RXIA 1MO3A 1N0WA 1O6ZA 1SNYA 1YDEA 1ZXLA 2P9HA 3E5RA 4P84A 2H6EA 4G89A 4JLDA 5AH0A 5K0NA 5TS2A 3MGGA 4CMCA 2W8BA 5KSYA 3EIEA 4ZYUA 4C0KA 1QG0A 3R5XA 3RROA 1QBKC 1TO2E 1E1NA 3U39A 1P77A 1ODSA 1TJYA 2FW6A 2IYWA 1L7XA 3LFUA 2C04A 1HSOA 5CX4A 1PR1A 1TRHA 2QRNA 1K08A 2F7SA 2JIZD 2X9NA 3MCUA 2WOJA 5KVSA 4P86A 1Z6AA 2NUTA 3L8CA 1Q7BA 2B9EA 5D6OA 1TU0A 5ELMA 2PUAA 1DCKA 3TYXA 2DH5A 1DPGA 4ARAA 4ZJYA 2JEOA 4I8IA 5JASA 1IVNA 2QWXA 1CY1A 1SKMA 3EULA 3KXPA 3NYIA 4OAQA 1RHMA 1MMFB 3NDPA 1P45A 1PFYA 1SY7A 2D2VA 5KYWB 1Z8NA 4RD4A 2EGHA 3O4VA 3ID6C 5KNLA 4B0PA 2HMVA 2ZRKA 4B4DA 3QWBA 3TSWA 4CM5A 2A78A 3WKAA 2GRUA 4V0SA 3TR6A 3ZWVA 3VR5H 1JR4A 1U9IA 1V6AA 3BZWA 4RWZA 3JQCA 4L4SA 3BIXA 3QVUA 3ZQKA 2D62A 4JB2A 3BE6A 2BEVA 1ZHFA 1MHTA 4INZA 4A26A 1KEZA 4YUXA 2RHHA 2Y3IA 1UR5A 3IILA 3IR5A 5BR4A 2VVTA 4KXUA 1U04A 1MTOA 4GZ3A 2PSJA 5DGHA 3IXQA 5H70A 4YXWD 2BHNA 1ZKMA 1ZJJA 4M76B 5EE1A 3DMRA 3COZA 3GUCA 3RABA 1MAHA 1HTWA 1R6TA 2C3MA 3PGKA 4W6ZA 3OKCA 3OZUA 4D7AA 1IBSA 1C50A 4MS4B 2WPDA 1RR6A 3AIIA 3K70D 2GFQA 5KOIA 1WSDA 3FMPB 1KSFX 4D9HA 3LK6A 4HC4A 3THWB 1KJQA 1D09A 2PGAA 2YFYA 4FR5A 3OM0A 1NU6A 2J0UB 4YR7A 4LSWA 3DZCA 3EQ9A 3N1UA 5CLFA 4HBGA 5MGNA 1O9GA 3OZEA 2ZJZA 1OX5A 1IN5A 3SQNA 3EQ8A 3LC0A 1JDZA 5T64A 2RGRA 5AVKA 3T4XA 4FFBA 3IBGA 4K86A 5BYAA 1UC5B 4OK3A 4LC9A 1N1MA 4J6EA 4M6WB 4IINA 3WP1B 1UAYA 5IVIA 3HYCA 1V37A 2X7HA 3A36A 1VG0B 4PZ0A 5ELXA 2C4MA 5ETJA 5IN4A 4L95C 3KHTA 3G2QA 5FOUA 3V3TA 6LDHA 4JROA 3L7DA 1O87A 3N8KA 5I9TA 2OSVA 3TWOA 1V5EA 3VNVA 4ZJZA 4B17A 2HSEA 1FTQA 2XZPA 2YC2C 4KDFA 1T0JB 3ESZA 2J3DA 2E89A 1PZXA 2O3TA 2AFHE 2QX9A 2ZIUB 2DJIA 3QFHA 2JGLA 4JP2A 3AW8A 2XEDA 4H1HA 4BBJA 3E8MA 2G67A 4L5BA 1YR7A 4BV3A 4ZIRB 1L5HB 3BB4A 3NOVA 3WB1A 4PG7A 5KYWA 3IERA 2B3DA 1Z4LA 2HQBA 5JPDA 3TLAA 3EMDA 1Y5NA 3LXMA 4RS4A 2O2IA 2ORWA 3JARB 3AIKA 3X44A 5BW5A 4C4RA 4MVJE 1NMQA 2FFBA 5JCJA 4LTDA 4F6RA 2H3EA 2OBFA 4JU9A 4ZDJA 4Y8VA 2FZEA 3OIWA 2CHGA 1UKEA 1WU7A 5JH7B 1CJKC 1JLKA 5KDLA 5HJ2A 1VQ1A 4M1WA 3G2HA 5F51A 2RAFA 3ZIAA 5BV1A 3HU3A 3SXJA 1QO0A 3UJHA 2JF0A 4X1YB 1TUBA 2EP8A 4GUAA 1CK4A 5CLHA 4D2IA 1J8DA 3H8JA 4TXNA 4Q9JA 5B7GA 2PAFA 4V2UA 3C0KA 2JIRA 1NAHA 4IDGA 3SSNA 4D3DA 3K0KA 5IHPA 1NYRA 4RSHA 1M3SA 3IUYA 4J8PA 4N5HX 1J5EB 1XR3A 4PX3A 4LJ4A 3DEFA 3OX4A 1EX6A 2N47A 3WIOA 1XBTA 2WB4A 3G02A 4G4SP 2W2PA 5DSTA 1L7NA 1M2OA 1T9AA 4R1UA 4MMXB 4PN7A 3ENKA 4XGRA 1UM9A 1PWYE 3ZEAA 1NLYA 1WCYA 3DF7A 3ICWA 1X2BA 5C1OA 3LX4A 1FPMA 1JZQA 1L7OA 4PLZA 4QU5A 4XSVA 5AQEA 5D01A 4ZN6A 4LF6B 1N78A 2CNNA 1HT3A 1PAUA 1XEFA 4AFNA 4HVCA 2XEXA 1NC3A 2EBHX 4CM9D 4X7MA 4HDMA 3I09A 3P9CA 3KKQA 4PG6A 3OX2A 2DCUA 1R0SA 4O29A 3ROPA 4KX3A 2PUDA 1JF8A 3U1BA 3D7KA 4NCBA 1UT8A 2HHJA 2RGYA 4DNFA 1NWCA 1ZCJA 4W5NA 1G291 2OE2A 2UVPA 2Y1FA 3EZ2A 4FYVA 1QF9A 2J9FA 2B8TA 2GJSA 1GTSA 3EPHA 1RNLA 4A10A 5BQ3A 3FSEA 4TXMA 5KPJA 3GPCA 3PC8C 2FWPA 4LHYA 4TWRA 1KI2A 2OKGA 2VJQA 4J1SA 3VR0A 4EFMA 1H5NA 1DCMA 3E3NA 3OTGA 4HWGA 3GUYA 1T2UA 4PNZA 1HKHA 1RAGA 1SCJA 4G5GA 4RVGA 5LUAA 3WL5A 5F3RA 2GAOA 2GBIA 3L4BA 5IUJC 1QE0A 3DZHA 1YIOA 3OTOB 5B3JC 2HCBA 2G5GX 1E4EB 3PTAA 3E2PA 2IV7A 3CT6A 2C9DA 1ND6A 1RHRA 3F6EX 4C4ZA 5GQSA 4ERXA 4JL6A 5EP2A 3QVXA 4Q1AA 4BCDA 1E8MA 1N57A 1I32A 4JGGA 4X66B 1ZNQO 4IIBA 4CKEA 1OH6A 3W5BA 1M74A 1PTJC 2ID9A 2QZZA 2G08A 1PTJA 5IYZB 5A03A 1UPCA 1AA9A 1JSXA 1A88A 1P73A 2I3GA 2VUTA 2Z2ZA 4ZOEA 1F12A 1LI5A 1IVYA 3VC2A 3W9BA 4RVSA 3WNQA 1U2PA 4K2HA 4NH0A 1XG5A 2G9VA 1QWOA 2YHIA 3DE0X 1QTQA 4HNGA 2MYPA 4G6ZA 3K30A 5JEEA 4RH0A 1A8QA 2D8AA 5LIRA 1PL6A 3CLTC 3ZI0A 4D8YA 1P3DA 3DBVO 4UDOA 3UJBA 3RS8A 4PSKA 5M2QA 1FJGB 2GXSA 3OJFA 1JLHA 2FMKA 1CUGA 3G9ZA 2YMLA 1JL3A 3OBBA 3BD8A 5TMEA 3ZIDA 4MEAA 4C88A 1IQPA 3L1UA 4F84A 4RXTA 3C1OA 2QTRA 5DIFA 4BIMA 1IJKA 2X0NA 1E3WA 1GCIA 4LWOA 4IFTA 4EX7A 1KZ9A 1R8SA 3I4CA 4DV1B 1X7ZA 3EVZA 3LVBA 3H1EA 3E4DA 2HK9A 4F0JA 2BFMA 2I4LA 4I1PA 2FUG1 4WX2B 2JD2A 2GYWA 4JOCA 4UNQA 1KO1A 2OBYA 3W90A 1GIAA 1TM4E 5BN3B 3EZXA 5AXCA 4URFA 1WCV1 2O2JA 4R9RA 4K1LA 1X8JA 4MS1B 1EVJA 2QPAA 2VSNA 5ALHA 1PV1A 1QMPA 1QV9A 2P6PA 2H4XA 1KWKA 1AK9A 2I8CA 2O1WA 2UYQA 5LMCA 1TD1A 4PQFA 1SHJA 2E55A 2QL5A 2YXBA 1WUTA 1T29A 2HNBA 3WJAA 2GHRA 3STUA 3DZ8A 1I0ZA 2MYTA 3AVTA 2VAXA 3FNEA 2ESRA 4KUHA 4MA4A 2JS7A 4J0GA 5BVGB 4XIIA 2K6GA 3GZNA 2GM4A 1DL5A 2GJAA 2PIDA 3DM5A 4G5RA 4QLOA 3PEVA 3S5JA 2I03A 3H16A 3KG2A 4MJ3A 4TUYF 5H3HA 3TMKA 2ZSUA 3D6TB 5SY9A 4IUCS 2AI3A 2FPUA 3QVWA 1E9EA 2I62A 1UPTA 2PWYA 2WV7A 4ZYZA 1G21B 1MGPA 2NO7A 3S6JA 4ZZIA 2C5BA 3GA0A 3P2KA 3FDZB 4TYMA 4NCAA 1JKFA 2W6IA 4YASA 1QK4A 4MI9A 1KP3A 1RCUA 3CVWA 1RCTE 1ISPA 3I39X 1DOAA 4GF5A 2JZCA 2P2LA 2RSLA 3TTTA 4HLCA 3ZDBA 2I2XB 3U09A 1G8JA 4M1ZA 3GLIA 4M54A 2DPGA 1KQFA 5A4AA 3JYLA 1Q0QA 1NUSA 3NHSA 1EP1B 1CZOA 5FBQB 2WZBA 3O8DA 1KTVA 5LA6B 7ABPA 2OCPA 1TZBA 4N12A 3S99A 2QSYA 1DFIA 3O2JA 4XX1A 3AETA 2QQGA 5AW8A 2XKKA 1I2ZA 1W0JD 1OR8A 2B1RA 3F4BA 1R9GA 2VK4A 3A7DA 5IULC 4H7DA 4GRAA 1M72A 2A92A 3RO7A 2JFNA 4GVLA 1E5TA 1FP1D 3IALA 1AS0A 1WVMA 4JYBA 4YO8A 4WXEA 4YJHB 1T8PA 2WSLA 4Z99A 3KQLA 4DV2B 2VPIA 2E3JA 1ZINA 3GEGA 1GTJ1 2AK2A 2Z6VA 3W6PA 3MOGA 2YDYA 3W3ZB 1AX9A 3C3PA 5JWHA 3STXA 4DCGA 4URVR 1WO8A 3SXUA 3C5CA 3EPKA 1Q0SA 2I0FA 1T10A 2YL2A 3A3NA 2FG5A 4OQPA 3SS9X 4NH4A 2Z6QA 1II8A 1W5AA 3EZ6A 3GLFA 1GG5A 1NMXA 1OXSC 4RH1A 1XDDA 4HB3A 5KMGA 5JALA 1NLFA 4IV0A 4R1SA 5BPFA 1QOPB 4B6PA 4UXHA 1WU8A 3RSZA 1FFEA 2TRSB 3CCFA 5IDXA 1EWYA 1KI3A 1YO6A 3F90A 2X5OA 4RHEA 4WACA 1PT6A 5ILGA 4AULA 5IK2A 3N0TA 3PKZA 4ZVOA 3P2IA 1L5VA 2ZTVA 3K0FA 2I65A 3PU6A 4J2OA 4ECEA 3U44B 5HRCA 2AVDA 3V4VB 4DRXA 4XVUA 1N2BA 4HWOA 2BY4A 3OZWA 2B4AA 4PO9A 1KP2A 3INNA 4R7TA 4ZQCB 2UXDB 4F9TA 2O8NA 1GCOA 2NLOA 4WE3A 3UOGA 4BC1A 3WV5A 4Q4CA 4MUIA 1JLMA 1V8BA 3RHZA 2PGJA 1GGNA 1UIRA 4ZA2A 1P5HA 1HGXA 1SWVA 4XIGS 1ZIPA 3EVFA 4KK3A 1EXNA 2LUOA 2FFHA 3D31A 4BFLA 4E08A 4QJIA 5JAZA 4EG6A 2GYVA 2GFHA 4ZCPA 4PAQA 2X0KA 4KN8A 4M9SA 1YS7A 2ZYSA 3RFXA 3ABOB 3PR2B 4C08A 1W0KA 3GARA 1OI3A 4D6XA 2GZMA 3KR9A 4UQLA 2QX7A 3KPJA 1VJ1A 2H57A 1BXRB 2A9OA 3HE3A 3OICA 4FB4A 3DE6X 4FNAA 4HFRA 3WISA 2DERA 1RJDA 1ZNZA 1AMOA 1R6BX 3NTQA 1JS1X 4ZVTA 3B1YA 1G41A 3C4JA 1HLFA 1HG1A 1TEHA 5KQPA 1RJWA 5K3OA 3ETGA 1ULBA 3HUUA 3HB9A 1N4DA 4ZC8A 3COJA 4DKJA 1XMVA 1KYXA 5F76A 1MD9A 3KLNA 4NATA 1KORA 3IOCA 4B9AA 4GT1A 4MVYA 4CDNA 5KYXA 4QKQA 3FCYA 1UJBA 2NU8B 3C6ZA 4J29A 1BH2A 4DXAA 4A0QA 4PZ9A 1UPUA 2RAUA 2B92A 2PQ0A 3OU7A 1U2DA 2ZBUA 1X39A 2WNSA 4MWDA 4PHTA 3VMFA 5AVYA 3IRVA 2KMLA 2BGUA 3GRZA 3HKEB 2EQBA 4WADA 4L9AA 3ESXA 2BFCA 1UBNA 3QUTA 4I1OA 4Y9TA 5D51S 1TTTA 3L6OO 2IWHA 3UMSA 1W35A 3ICPA 2GRAA 4QNMA 3R77A 4J91A 4ZKDA 3IIEA 1V2GA 1WEKA 2O2SA 2OK8A 4FZ3A 4JJ7A 4R3NA 1FX0B 3X1YA 3QQ5A 4TSFA 1E7SA 3BGIA 3CE6A 3PPYA 4NCJA 2ZBEA 3C1UA 4W1SA 4WZAA 4EJSC 1WQ3A 1UPFA 4G85A 3DXFA 1K4KA 4KE9A 1X9HA 3D1JA 4QYIA 4R3WA 3RWMB 1FYXA 4XIFA 5IANA 1HDOA 2PMWB 4D82A 1JJVA 3QVTA 5TARA 3SX0A 5I7HA 1JR3E 1LFAA 3UNXA 3OCVA 5JDIC 1YR2A 3KQUA 4ROSA 3C7TA 3F7OA 3PYXA 4I4TA 1Q22A 1RRVA 1XLVA 4ZAZA 3ZW8A 5KQMA 1SU4A 1O4VA 3LUAA 1FDUA 1OT3A 3DVLA 1GZHB 4RABA 3UIEA 3VKVA 2YFKA 1OWNA 1ZJZA 3Q41A 1M73E 3H7IA 2C8VA 3OF5A 4CDMA 4D0NA 1NKVA 1QXSA 1QKIA 2PTGA 3KQPA 1C7FA 3F6RA 1ZUWA 3I9OA 4E6PA 1C9YA 4WK2B 1VHQA 3O9MA 1Q7CA 5HJ7A 5DX1A 4CM6A 4YR9A 2UUAB 4PLFA 2PJRA 2ZB4A 4PYMA 1VCMA 1NUAA 4KPUB 5L51A 4DNQA 4YRAA 4XDGA 3P52A 5BYJA 4TTPA 1E3WB 1PFWA 2GZDA 3UWSA 1P80A 4MK4A 3VPXA 1XWFA 3THYA 3ROXA 3SP1A 3PFCA 4KMOA 5FNVA 4YMTA 3TPCA 5A5FA 1BVYF 4HNTA 3K32A 2WUVA 1P1CA 1GT91 2DWCA 3C6QA 4TLEA 3MJTA 3K9NA 1S2OA 1EK6A 1YWGO 2EZ4A 5TPWA 1ZM9A 2VQ6A 4UMVA 5GM1A 4X60A 1CUEA 1EVLA 1RHJA 1UBHS 1Z2NX 2LIVA 3E8SA 4U9HS 4AF7A 1XQXA 1P0CA 1PJ2A 2E87A 2PM8A 2GZHA 1LI7A 5JI2E 2VHQA 1PEYA 3KEOA 4JN6B 2DLNA 1S2IA 3OPXA 5B1EA 5J47A 5KU1A 2YWCA 4EUFA 1CY6A 2ZYAA 5IVHA 3I9KA 3JYNA 5CYFA 1M1UA 4ZI7A 1JYFA 5A9RA 4GDFA 2BWJA 4M8IA 1YUNA 5FA8A 1J0DA 1L7QA 2BBTA 3PXBA 4MKIA 1ZLYA 2HA4A 3ZZTA 3QE9Y 2OB1A 4JVSB 1K6EA 3H2IA 1U9YA 1E2EA 2EXXA 5H1YA 2I9PA 5C7OO 2O2GA 4PYOA 3H87A 5DYTA 2H9IA 5B12A 2C7RA 2KB0A 3QXXA 1IUPA 2NZYA 2UUOA 3UUWA 4MP8A 3KTOA 2FSGA 2W70A 1KAEA 1O0SA 2GAJA 1AM4D 2QGNA 2W2LD 2ZBPA 3E2MA 1PJSA 4MAAA 4YQZA 1BVHA 4LRXA 4MRMB 3WP0A 2Z9BA 1DRKA 4FX5A 4ZOLB 4HQNA 3CBQA 4RNDB 4D3XA 1CIPA 1TZJA 2IHJA 3O8NA 4MUJA 1PWZA 5HFNA 4GS5A 3RIEA 1YRWA 1V41E 1Z6GA 5E3JA 1XWWA 3DAFA 1QH1A 4QVKA 4BO6A 1HG0A 4G07A 2NYUA 2AUNA 4YRRA 1OB5A 1CHDA 4GOJA 3K0AB 4RTNA 1SQ5A 4RK4A 1K6MA 3W79A 4B7UA 2R84A 3Q72A 4FSHA 4Q9NA 3ADKA 3VKHA 1H2ZA 4W1PA 3AVYA 5JMOA 2D0IA 1CUYA 1KI7A 1VMIA 2P4HX 5HVNA 5FPQA 4KQ9A 2WD8A 3I2IA 3DTYA 1LD3A 1H2RS 1PEAA 3LKZA 3QRWA 2ZZNA 3FGOA 3EDQA 1YDFA 3WZ2A 5J4HA 4JEIA 3DKRA 2FWNA 3ND8A 1DAHA 2YDXA 3WKCA 4CF3A 2YH2A 3EWNA 3OTIA 1XTBA 4DL9A 2GD2A 2GM5A 4CI9A 4RV4A 5JPCA 1D2HA 4HAXA 5DNAA 4DMKA 4QQFA 4XFKA 1IFXA 4RQUA 1TQ8A 2E4YA 4KPUA 1N5OX 4CMEC 3GRYA 4I3GA 4OGFA 1ZXBA 1ODKA 4UHHA 2IZ1A 1E6LA 1ONSA 2BW0A 4H4CA 1GGJA 2NVOA 1FYVA 3N0VA 1P2FA 2XODA 2ZS8A 4HVTA 5AVTA 4DLPA 4G1EB 1K3UB 2D8MA 2ID4A 3HCPA 3NNNA 2IPMA 4FCVA 4QPJC 2FW9A 2OP0A 4P7JA 5KWIA 3PL1A 4H3KB 3EGVA 1T5TA 3A05A 2EIHA 2Q5HA 5AW2A 2WUWE 3H86A 4AZ3A 3E70C 3IOBA 2CMKA 3KVNA 1TKAA 2CY0A 4PC3A 5AI6A 5TX7A 2V8BA 4WAUA 5LR6A 4CEIA 2HPHA 3NBXX 2Y1DA 2ECPA 4BNKA 5JAUA 1VECA 2EBWA 3PHLA 1SUSA 3CRMA 1OIVA 3AM1A 1U8TA 1OGJA 3FI0A 4WOBA 3TOXA 3B82A 5JVDA 4HKTA 1DEAA 2ZJ6A 1TO1E 4YJFB 2J0VA 3GAFA 1YVEI 4M1QA 4ER6A 1J0CA 4FQ8A 4ZOLA 2JJ1A 4OG2A 1NWHA 4R98A 1N34B 1KAOA 2H00A 2C77A 1NBME 5AOVA 3W5UA 5JU6A 2VWPA 1QHGA 5A4JA 1Z7WA 1J2JA 1GFSA 3WL6A 4IMRA 2B4QA 5EFOA 3T1OA 3HBAA 2VDRB 3B6ZA 4GR5A 3V8VA 1R16A 1G20A 3WJ2A 5FUXA 4CMAA 2EFJA 1KBOA 1M2NA 3GZTB 3MJVA 1ENPA 1K63A 4MJXA 3OHPA 1W73A 5EESA 1O57A 3TMAA 3SNHA 3ORYA 1GAQA 3PDIB 4QEDA 2Q28A 2QRVA 4M0KA 4KODA 1N3IA 1SPBS 3WIVA 1FB5A 3PYMA 3B52X 3DR3A 3BG5A 1U3FA 1OFUA 1HEUA 3LWZA 5BQFA 3LF1A 3FUCA 2POCA 4IO0A 2VSYA 4F4CA 3NT5A 4Y2QA 2VDUE 1LSUA 1GYPA 2C4TA 2W2TA 3GA7A 3ZI4A 1U2QA 3MMZA 1CEXA 4D45A 5K4GA 3P94A 5EKUA 3FZGA 1Q12A 3ZDAA 4EHKA 1SXJB 4KWCA 2W6CX 1MOZA 3GJTA 4R3UC 1P31A 5EJ4A 4BO8A 2EVWX 3KPUA 3Q5EA 2PGLA 1VIVA 1ESZA 4S24A 4XWKA 2CJPA 4HO1X 1FUEA 4I50B 1U7ZA 1HF3A 3ZQ4A 1ZZEA 5JHHB 1ZITA 2OC4A 1QHHB 4R9NA 2ZAOA 3V34A 4L4ZA 4OUKX 4U2KA 2E18A 2GXQA 2J6BA 4R8SA 5B37A 4DYDA 3GAAA 4Y7DA 5CIWA 5CP8A 3NEAA 1KK2A 2H1IA 4LA4A 4UHCA 1H2YA 4FYYA 3D43A 2ZQ5A 4C01A 5J4YA 5HFJA 4HNSA 4F5ZA 3ZHXA 2O0HA 4NBNA 2WQ6A 1Y5MA 4Y2YA 2OQRA 3TFQA 621PA 3QEBZ 5KTSA 2XVAA 4R2MA 5FA5A 1V2HE 2YBDA 1H5UA 4DADA 1Q1NA 2QX8A 5IJ0A 2QU7A 2O8BB 2A1TS 3O4GA 2GZSA 2KBEA 1Q83A 1ZESA 1E0KA 2CFSA 4KRYA 3IJEB 4R2HA 2O59A 5F1OA 4LQ4A 1KXZA 2WA2A 3AT1A 4AK9A 4IH1A 4ZGBA 2MT9A 4UEKA 2JGDA 4R2JA 4XOIA 3TDMA 1Q0HA 3B2QA 4XD7D 3IVAA 4ENUA 1NW4A 5KSWB 1K2WA 2UYCA 1MCZA 1JXMA 4C0QC 5DW3A 3ET5A 1OXMA 1MABA 4LVUA 4E51A 4BNDB 5JNSA 3DGFC 2WILA 2F4VB 3H9GA 2IIVA 2ZTMA 4UMFA 3UXEA 4URZR 3Q8WA 2W2NA 4BNLA 5KMGB 5D3MA 5FWXA 1DJQA 2XW6A 2H08A 3H2YA 2X4LA 4JVMA 2DPXA 4UKDA 2EQ5A 2Q46A 2X1MA 1G8FA 5ITVA 4L72A 4OATA 1NBMD 2FHSA 3BB3A 3E9ZA 1Z13A 2YRXA 3DWIA 4Y67A 3N8GA 2DBYA 4N03A 3IESA 4BZZA 3QTTA 2Q0SA 4Q1EA 4MQEA 3V2HA 4OYRA 2I7CA 1O95D 1YDGA 1ULUA 2RH5A 5AW3A 3P45A 2XNDA 4PFKA 5AUQA 3OZBA 1QU3A 1YZUA 3R3WA 3MWJA 1GNTA 5EFZA 2P2DA 3A3KA 3KL4A 2G0NA 3TX2A 6PFKA 1OWMA 4TXHA 3EGXB 3OP1A 2VZ9A 1ITZA 5CK4A 2BGLA 2YC4C 1XZHA 3D6NB 3S5UA 4MVCA 3ZU2A 5BW6B 2DFDA 2H8GA 2VF7A 4R0NA 1JTVA 1W1IA 2PRJA 4QTXA 3CH4B 2IHBA 2G9UA 1IUNA 3HFSA 2COKA 4HGQA 3K5WA 5DHAA 3ZV3A 1N5DA 3DZBA 3PP8A 2JLRA 5I8ZA 4YIKA 5GOZA 4OV6B 3LPCA 3ZXUB 3ZY6A 3WYGA 2MJLA 4UDYX 5TQ0A 1XZNA 2ZRLA 5EZYF 4I4LA 1T1SA 2QLJA 3UCFA 4A23A 1RRPA 5HKOA 2I78A 3FIJA 3FYSA 3GJYA 4KXWA 4Q03A 1WB5A 4QYMA 2Q2NA 1GCUA 4YCBA 1Z56C 4TMVA 4F3YA 4IRXA 4D80A 5JZ9A 2DMRA 4OQQA 3H6HA 3TQIA 1F3LA 2BM1A 3WTBA 4CIAA 4HRXA 4JA2A 2YWHA 3DYBA 1N3LA 1KS9A 2MDTA 1WHSA 2BMWA 3C14C 3JVDA 4R8KA 3QP9A 2X6QA 2E5LB 4UCFA 1HE5A 4R84A 3MJFA 3KU4A 4IIEA 2IYRA 3OQIA 4WY2A 2NG1A 2P62A 1XNHA 3HLYA 2RD2A 3HRHA 2AFIE 2C7VA 3OJWA 1T25A 2C7BA 2CDBA 3HWWA 4X7BA 5L3RA 3Q88A 4K40A 2PFKA 3PJDA 4R9UC 3TI9A 5JROA 3QU4A 3ZD8A 4ZDIA 2VRCA 3KAQA 1UBKS 1IRIA 3EVTA 3BZBA 2J0UA 1QHNA 1DRWA 1XKLA 4S1NA 2XCQA 3FGPA 2DR3A 3Q1LA 2HTFA 1YFJA 3KXDA 5HMMA 3BXZA 5BSFA 1QP7A 3LWNA 4D9GA 3O1HB 1Q19A 4WBXC 1A5BB 1TLFA 3K1AB 2JKVA 1R5OA 2IUTA 4B6OA 1EUDA 2WU1A 5A06A 2HJ9A 3T6KA 4CI0B 3PT5A 4BMXA 1ISMA 3GVCA 1L5MA 4DWJA 1PZMA 2PZKA 3ROFA 3TB4A 1COWD 1ZGHA 2VAWA 4CE6A 1HH4A 2HWUA 2Y76A 1MRZA 3GFSA 3WIDA 4BRSA 3UY4A 2FUG6 2H4HA 2JJYA 4WUTA 3RUDA 2BBSA 4OVKA 5J4VA 3D4BA 3O26A 2PV0A 4P83A 1K5PA 3P96A 1B8VA 3I9NA 4UEWA 4V3BA 4NBUA 1Q0LA 4MW9A 2HF7A 3FAKA 3J7TA 5AOBA 5HF9A 4DSAA 3RC7A 2PZGA 3TXXA 4ZRMA 3X1WA 3L7CA 1QYXA 1W6RA 1JHAA 1E8DA 4ZVUA 4Q34A 4DNXA 4NOMA 3PPWA 1T3SA 2QI9C 4I5IA 1CDZA 4QWMA 3PIDA 1XQ6A 2QJWA 3AWDA 1RYFA 1MAVA 4YRMA 2ZROA 5JBNA 4EEZA 3U7HB 4M8KA 5E7JA 3RQIA 4I19A 2YN2A 3NVKI 1CWUA 4ANFA 1R4MA 1PHPA 2C98A 4N65A 6AT1A 2IITA 2JGIA 5G0TA 3TOCA 4WZBA 3N2YA 3LY5A 3BD9A 5AR1A 4TV9F 4CQNA 1OTXA 2J07A 1CV2A 3H1BA 5DTMA 4PE5B 3K16A 4CM1A 4HDKA 1IPFA 4M86A 4Q1DA 4QDKA 4JVLA 4NX2A 2XZTA 4LYFA 5TGDA 1WRBA 2M98A 1WF6A 4AY2A 3O1IC 3PVZA 5CT8A 1JSLA 5AT1A 4MVJA 3OQIB 1BEUB 1DJPA 3E84A 3AXTA 4WY5A 5FEMA 2MR6A 2GUWA 4FOTA 3QGMA 4BQSA 4CR8A 3WA6A 3NP9A 3KJFA 3AERA 4L1KA 4MB0A 3SSMA 1E5QA 2ZETA 3ILYA 1LPPA 4D8TA 3KKOA 3IPCA 5J5VA 3ZD9A 4KN5A 2XNCA 4ZPXA 2N1MA 5A0VA 4PZLA 4X64B 10MHA 4KIGA 1NPYA 1WP4A 3ZXIA 3ADDA 2V4UA 1R0RE 2WYVA 2Z5VA 2X7JA 3ABIA 3TLXA 4EAAA 2QVCA 2B99A 1S01A 3QHQA 3B9BA 5EWLB 4R5MA 4YC7A 1IEXA 2VSFA 3AHFA 3GLRA 4JQYA 4E3WA 1S7GA