4D46A

Crystal structure of e. coli fabi in complex with nad and 5-bromo-2-(4-chloro-2-hydroxyphenoxy)benzonitrile
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
256
structure length
238
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Ordered Water Channel in Staphylococcus Aureus Fabi: Unraveling the Mechanism of Substrate Recognition and Reduction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 83
structure length 238
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d46A00
2OHXA 1X7GA 3CUKA 2IZ1A 3ZHZA 4NU6A 3ZWWA 2E49A 5TQVA 4F45A 4OH1A 1OAAA 3WNVA 4DVJA 3S8MA 4JN6B 3V2GA 3G79A 2C07A 4FFPA 4I9UA 1DFIA 5I9LA 4IQ8A 1OC2A 3C1AA 1CDOA 4ALJA 1UZMA 2CDCA 1KVQA 2JKVA 1O89A 2YFHA 4LK3A 4BNFA 4M89A 3OQ1A 4FC7A 3CMCO 4Z3DA 4BO1A 4DMLA 1NNUA 1YS4A 4DIBA 2AHRA 4IDCA 4Q3CA 1O9BA 3CINA 3OIDA 5IDWA 3QRWA 2QX7A 3PFWO 3KO8A 2VUSA 4E2YA 4PLVA 4Q3NA 5JAIA 1U7TA 3ONEA 1NFQA 3KYCA 4J3FA 3AY3A 1P1RA 4YTEA 4W7IA 3I9KA 2AE2A 2YQ5A 2EG9A 3IUSA 1NVGA 4RVSA 3GLQA 2X0RA 3PPIA 3AK4A 2Q4EA 1ZBQA 1M76A 3D4OA 1Y1PA 3SLGA 5HS6A 5T64A 7MDHA 1B16A 1T1RA 4WLNA 3UUWA 4CQMA 2UVDA 3LC7O 2P68A 3DZIA 3E18A 3HDYA 4O5OA 1I10A 4MKRA 3IKVA 4O59O 4ZJUA 3IDSA 1LBEA 1B8VA 2CDBA 1WXDA 4YRAA 4DPLA 3SXPA 5DF1A 2EWMA 5ENVA 2ZTMA 4G81A 4KWHA 2Q4BA 4A2CA 1P0FA 5ENDA 3KETA 4XYMA 4BO2A 1EMDA 5T6BA 1MB4A 2CSUA 2G5CA 3RSHA 1PL8A 1BW9A 1P77A 1P45A 2NV6A 2O7QA 1E3SA 3HE3A 5JO0A 4OIMA 4DQXA 1VJ0A 4XQGA 5JAZA 1EK5A 1I2BA 1J4AA 1R66A 3JQ6A 2GSDA 1CERA 5DBFA 1NASA 3P7MA 1QLJA 1H6CA 5JMPA 1MV8A 4KZPA 1KVUA 1YBVA 2XAAA 3HDJA 4E21A 2BFOA 3WGOA 2CVOA 4RQUA 4M86A 1EDOA 1M66A 3B20A 4ZQEA 5KKAA 1H9BA 3PLRA 2ZB8A 3LLVA 3VH4A 1H93A 1YL5A 1C3VA 1L1FA 3NT4A 4PGFA 6LDHA 2VZ8A 1R4MB 2HCTA 1I30A 4YT4A 3OIGA 1U5CA 3DB2A 3KB6A 5TF4A 2WEKA 4B4VA 1H6AA 3Q2IA 5GMOA 1Q2XA 2B4RO 2GASA 1PWZA 3FNFA 3KHUA 4DA9A 4XWYA 3OJFA 5K0ZA 3SX2A 3B1FA 3WMWA 3ON5A 1T1SA 3MJSA 4P4GA 1SNYA 3EAGA 3EHEA 5C7OO 2GLXA 5G0SA 2O3RA 4YXFA 2EKQA 2BGKA 1GYPA 2VTDA 3ADOA 1PGNA 4U0JA 1WP4A 3NJ4A 1I3KA 2FOIA 3V2HA 1HSOA 3GNQA 1PGPA 4RORA 3AU9A 3ZWXA 3VZRA 2PFGA 4DRYA 4TSKA 4YQZA 2VNSA 4IJWA 3PWKA 4XYGA 2PLAA 4N7RA 3WYBA 4B79A 4TZKA 2QQ5A 4BKOA 4OYRA 1GCUA 2LDBA 3I23A 2WSBA 4HBGA 1NQOA 4IBOA 3WJ7A 4OOEA 4XGIA 1ORRA 1LDGA 4QEDA 3FTNA 2YHUA 1X14A 3ITDA 4RLSA 3WNQA 3CZMA 3ZWVA 3B1KA 3R1IA 5KVQA 2O50A 3IC5A 3Q6IA 4G5HA 4IMRA 4CM4B 1G0OA 2D2IA 5BQFA 1QMGA 2BFPA 2JCVA 1DB3A 2AG8A 2X5OA 2ZCUA 4KWIA 4NHEA 3TQHA 4PG8A 1KEVA 2GERA 4OSPA 3OBBA 1EZ4A 1JU9A 4Z9YA 2E4AA 1FDVA 3INGA 3JYLA 2JFHA 2O48X 4JJFA 4E2XA 1CRWG 1GV1A 3PFFA 3QIVA 2AXQA 2GF2A 4D3FA 3ZWMA 3GDOA 4IDGA 2C29D 2HK8A 2P2SA 3VTFA 3I52A 2D3TA 3SJUA 4XYBA 1VRWA 5TIIA 3ZNOA 1R4MA 2UAGA 4L9RA 3RWBA 2B83A 3IP1A 1NR1A 2WD7A 1DSSG 1QV7A 3WWYA 4ZA2A 1L7EA 3ZWOA 4GLLA 5HRUA 1ZEMA 2G1UA 3GPDG 4U6QA 4XDZA 3UKOA 1ZSYA 2PKRA 3GOHA 4EUEA 2EJWA 3JD4A 4JP3A 3WBFA 3I4CA 4XIJA 2IYOA 5ICMA 4J1SA 4BV9A 1I2ZA 4ND1A 1XLTA 1BTOA 2BH9A 3QVTA 4CV0A 3EDMA 3BAZA 3OEWA 3BMQB 2DFDA 2GYYA 4TRRA 2BFAA 5JC8A 1TT5B 4DIFA 4RCVA 4ID9A 3S2GA 4YT2A 2G76A 3GAZA 5ES3A 1TT7A 3GVHA 4XYLA 1U7HA 4D46A 4MKZA 1NFFA 5L7WA 4K9DA 3VZPA 1ZK1A 1R6DA 4J1NA 4XR4A 3D3WA 3B70A 1JA9A 1LSOA 2DBRA 5DN9A 5THQA 1PTJA 1ISFA 1I3MA 2IZZA 2AQHA 2O4CA 3H3JA 1JKJA 1HDGO 2SCUA 3I9MA 3KEOA 3U49A 3JD3A 4XJSA 4A27A 4PLPA 3IOYA 1QKIA 3W4KA 3DOCA 1NPTO 3ADPA 4YT5A 4MVJD 2C54A 2PTGA 3JQBA 1HLDA 4B4UA 3ZW9A 4CMEC 3RKUA 1LQTA 4JCOA 3P19A 2CMDA 2H5LA 1PEDA 4RPLA 1HT0A 2BGLA 2WE8A 4WCFB 3PQFA 2I99A 2NU7A 1VI2A 5L4LA 2O4UX 1NHWA 3GEGA 3BTOA 5LCXA 5U4QA 2Z1MA 3ANMA 3HNPA 1U2GA 2W90A 4UVHA 4U5QA 4IQGA 1PJLA 5EJ2A 1M2WA 2B0JA 3OF2A 1FDTA 4GVLA 5EL0A 2JD2A 4H16A 1N9GA 3LSYA 2EP5A 4FJ2A 1PQWA 2G82A 1UR5A 1UXJA 1ZMTA 2IYPA 1C1DA 1EUDA 2EKPA 3PJDA 3U09A 4BNUA 5I8WA 2Q2WA 1MXFA 2DKNA 3H5NA 1IULA 4BNVA 2C20A 3V1UA 1V8BA 5DNAA 3C7AA 2ZJ0A 3INRA 1LC0A 4B3JA 4BB5A 4EGFA 4JIGA 1EK6A 1TVEA 2B36A 3JYNA 4Q9NA 5LDGA 3GVIA 2QYSA 1Y5RA 4OXYA 2RH4A 4IIUA 4RF3A 1YKFA 4JNKA 5KJEA 1QR6A 3F9IA 2IDZA 4CR6A 4E2WA 3JQ9A 5KVVA 3GZNB 4XRGA 2P5YA 4I5GA 3NTOA 1QG6A 3O03A 3HWRA 3OA2A 4OO3A 4R1NA 2ZB7A 1YRLA 5FI3A 5BT9A 1HWYA 1J6UA 1E1MA 2Y1FA 1T26A 5DCUA 1LDYA 5BSGA 1MA0A 2HKIA 3WFIA 1GUFA 4OM8A 3GUYA 3LT0A 2I76A 1NM5A 1YJ8A 1YOVA 2EGHA 2B35A 2OMEA 3AY7A 3IJPA 4KP7A 4LVCA 4NFYA 5T8KA 4ALKA 4CM3A 3V1TC 5DP2A 4CR8A 4J2OA 3KBOA 2I5PO 5IZCC 3JQFA 4IINA 5IG2A 4ZGWA 1ISHA 3ENKA 3GR6A 3BHMA 3OQ6A 3NRCA 1Z45A 1C1XA 2FPIA 4QTZA 3VKUA 3C7DB 2Z95A 1B3RA 2UUOA 1PGQA 4LGVA 4XKJA 2GN9A 4ALNA 1FDSA 4EEXA 2IE0A 4MO2A 1VSUA 4Z3KA 1ZZEA 2VWQA 1KEUA 4PIVA 1T4DA 1OFGA 1WPQA 2HLPA 3SC4A 2W2KB 1XHLA 5EPOA 3MJVA 1HDZA 2UV8A 1X0XA 1ENPA 1K6XA 3I9LA 4WLOA 5HA5A 1C1XB 1UDBA 3AWDA 2NUAA 1V6AA 2WYVA 1D1SA 3AI2A 2C0CA 3L4SO 2FWMX 2Y0EA 1YXMA 3OJ0A 2QW8A 4E32A 4I9HA 4EZBA 3OECA 3VTZA 2C5EA 3H9GA 5F1KA 2JJYA 3ZV6A 5IXYA 1DFHA 2GZ3A 2X86A 2EJVA 4P4NA 3TFQA 1ISGA 4M55A 4WLUA 1E92A 5TS3A 2C82A 4A73A 5B1YA 1IZ0A 2YDYA 4AL4A 4K6CA 5G4KA 1T2DA 1KC3A 4QSMA 4MVJA 1LDNA 3RUIA 3RFTA 4WOJA 1LSSA 2VQ3A 3PHGA 2W8ZA 4MPDA 1GQ2A 3UGKA 4RVHA 3CE6A 2ZYAA 1HRDA 3AFNA 4JX8A 4JBIA 3RBZA 3TN7A 4CM8A 5A03A 3FNHA 4BQRA 1PJ3A 2D0IA 2WYWA 4HX5A 2VOJA 3GA0A 4NK4A 1NQ5A 2UUPA 4P38A 1VJ1A 1WMBA 2DPHA 1LDMA 1LJ8A 1OMOA 3OHSX 3A28A 1JAXA 1S7CA 1A7AA 3E6AA 1ZVMA 1PJQA 3SC6A 5LC1A 3W6UA 2HK7A 3WGHA 1EBUA 4YPOA 3B6ZA 5G0TA 1ADBA 3GEDA 3WJAA 4KUGA 4U8GA 1PIWA 1Q7GA 1UZLA 3UCXA 2NU6A 2ZB3A 2YQ4A 2O7SA 1JQBA 4JP2A 5IFLA 1D4FA 3Q9UA 2BD0A 2W2KA 2ZATA 4UEOA 1SO8A 4WKGA 1RPNA 2QG4A 3QV1A 3HZZA 1JWBB 5L45A 5ER9A 3EVTA 1ZK3A 5TT1A 5HS4A 5IZ4A 1RM0A 3KV3O 5TRTA 1N7GA 3BTVA 3DMTC 4XRRA 5CEEA 4R51A 2OP0A 4J16A 1E3JA 1UXIA 4WOKA 4IDEA 1Z74A 5TGDA 3O38A 2D5CA 4J0EA 4XIYA 2X7HA 4ESOA 4J0FA 4XQCA 4B7UA 4J49A 4MVJF 3I83A 3CMMA 1ZJYA 3NYWA 5F5LA 1E7SA 3ONDA 4CUJA 5L9AA 4XB2A 1L7DA 1T2EA 2XOXA 3ETEA 1CIVA 1M6WA 2AW5A 4XQEA 1OZAA 3RASA 2B4TO 1V9LA 1SZJG 3BMNB 1LEHA 3P2OA 1UP4A 5A3JA 5JMWA 4YAEA 1E7RA 2P9EA 1TT5A 1CETA 1AGNA 5JDCA 1M75A 4BNNA 2EIHA 1WW8A 5I8ZA 2AQ8A 3C1OA 4I8XA 2VHZA 4GGOA 4L74A 3FSRA 5KVSA 5EINA 3FHLA 3LK7A 4KQXA 1B3BA 1PGJA 4CM9D 1KYQA 4D0SA 2YFQA 3GEMA 2I65A 4A0SA 3GFGA 3L9WA 3F1LA 1XDWA 3D5QA 3KSUA 3Q3CA 1VPDA 4FBGA 3QA9A 2JFFA 4BO8A 3FF4A 1A72A 1XWFA 1YQXA 3UN1A 4YJFB 2OZPA 3DEYX 1MC4A 2HDHA 3JQAA 3OH8A 4HKTA 3WTCA 4AJHA 3WB9A 5KCZA 2PR2A 3OM9A 3LT2A 5DP1A 1N2SA 5KJFA 3HJAA 3NDRA 2OO5A 1AHHA 3V1YA 1BDMA 2CY0A 5EMHA 1NYTA 3O9ZA 4YJFA 1SMKA 5TSDA 5U1PA 4GMGA 4RVDA 2GN8A 3LU1A 1GCOA 4OGWA 3FNEA 1X7DA 4MVJI 2I3GA 4AJ2A 4LRSB 3GGGA 4BO9A 1BMDA 1TLTA 3FI9A 2YZ7A 4GWGA 3RVDA 4CQMB 5FWNA 3IAHA 4J4HA 2C2YA 3WQQA 3U9LA 1PZHA 5L40A 1RM3A 2CUKA 4TKMA 4YB8A 1C1DB 1E1KA 4ZQGA 3WSWA 4YR9A 3KLPX 1WDLA 2HJSA 5JLAA 1C0IA 1ZK2A 3PJGA 1ID1A 1K2WA 3WTBA 1W73A 3SBOA 5L4NA 1EVYA 4D44A 4CMEA 3RJ5A 5MDHA 4J43A 1R37A 3B1JA 3D3EA 1OOEA 4KUEA 2CF6A 1ZCJA 2C59A 4LRTB 2VTEA 1KERA 3QQPA 4MDHA 1LDBA 4ND2A 1WNTA 4P4LA 2AQIA 2PZLA 4IGFA 5AXCA 1VE9A 1PJCA 2DTDA 2PD4A 4UREA 3DTTA 3QHAA 3GZNA 3TZKA 4KTVE 4K28A 3UVEA 4CL3A 4L76A 1NXQA 3C3XA 5G0VA 4FJ1A 3ZH2A 3OMLA 5CFZA 3HN7A 4FW8A 4CJXA 4AJOA 4R1SA 5KOIA 2YHIB 1A4IA 3EZLA 4CQLB 4BGUA 2HUNA 4M1QA 4FFOA 1UAGA 2DC1A 2UYYA 3ANNA 1IUKA 5B12A 1J49A 1ZJZA 3GF4A 3VPHA 3ZU4A 1G0NA 4AJPA 4NG5A 1I36A 4B7CA 5CEFA 1H5QA 1I32A 1VL8A 2ZTLA 4RF4A 4YAKA 1H6BA 5HBRA 2FSSA 1DAOA 3F6YA 2NADA 1LSUA 1DLIA 2VWGA 5CDTA 5ER6A 1SPXA 4BNXA 4I1IA 4MIYA 3ZWAA 1WZIA 1H0KA 3H5AA 4TQGA 5JDCC 2NLOA 3DFZA 3W1VA 3ZN2A 3ZNPA 1SEVA 4E12A 5ILOA 3GVPA 4EUHA 4RPHA 4BO4A 4CV2A 1OC4A 4WJZA 2GUGA 5T57A 3UAGA 1MG0A 4BOYA 1K6JA 4XA8A 4N18A 4RO0A 1H2HA 2J3JA 4UUPA 2X9VA 7ADHA 5IJZA 1DJNA 4B3IA 4A03A 3AI3A 3OQBA 1QP8A 3HSKA 2PH5A 2DUUA 2Q50A 4JJGA 4BGVA 5F21A 1IY8A 1XYGA 1ZXLA 5JDIA 2CVZA 4J91A 1EFLA 1EQ2A 1N5DA 3U4IA 5AXAA 1ZFNA 1KOLA 2GNAA 3D64A 1ONOA 3FNGA 5EESA 4CM8B 3ZWNA 5T8KC 1PJSA 3D4PA 2Z5LA 3F46A 4MOWA 2Q49A 1W4ZA 3AUUA 3GVCA 3LYLA 3F1KA 4Y8VA 4EJMA 3VZQA 4GBJA 2Y1EA 4CODB 4CQLA 1F17A 1B7GO 1RKXA 3QWFA 4YAJA 3DHYA 1Q0HA 4E31A 1GPDG 3MJCA 3RBVA 3WQSB 2Y66A 3GMSA 3NDIA 1F06A 3QVWA 1AUPA 5JCJD 3KYDB 4EBFA 3H4VA 4ZQBA 2X6TA 1E1NA 4CMJA 4HFNA 3M2TA 1AXGA 2PKQO 2F00A 4CMHA 2O23A 2ZIZA 1XG5A 4GL4A 5A4DA 2JFGA 3I1JA 1O5IA 4RDIA 1WVGA 3WIDA 1T24A 4QECA 1GQQA 2RBEA 1V35A 3RUCA 3C7CB 3RUAA 5KVCA 3T7CA 3KYDA 3TL2A 3E8XA 3STHA 2DBQA 1HE3A 4DLBA 2OOSA 3PHJA 5I7FA 3QE3A 3T4XA 1KEWA 1XA0A 4MVJE 3S2EA 4ZRNA 1QYDA 2J6IA 4N54A 3L6DA 1IOLA 2AEMA 3D3WB 4UULA 2EW2A 4WLVA 4BIIA 1TA4A 3A9WA 1U3TA 5IZCA 4Q3BA 3M2PA 5DBGA 1IB6A 1W8DA 4BHTA 1UUFA 1YGYA 3PK0A 2H9IA 2JAPA 3QWHA 2R6JA 1SBYA 3BZUA 5TT0A 5L53A 2J5KA 1ISIA 4TRMA 1ZSVA 3JD2A 4O1MA 4DBZA 5JY6A 4XZ3A 3ZNNA 3D5TA 3VH1A 1ENZA 3LC2O 5EERA 4CV3A 3KXDA 2VZ9A 4ZN6A 3WGZA 1F8GA 4GQAA 1IHYA 2HMTA 3INTA 2C2XA 1B26A 1ADCA 2NTJA 1NQTA 3ZNQA 3HFSA 4IJVA 4PCVA 4BB6A 1YH3A 2I67A 2NQTA 3ZV5A 5DOZA 1A9YA 3TRIA 3LQFA 1P1FA 1B15A 3FPCA 3HHPA 4AJ4A 3I4FA 4RLHA 3I9JA 3PDJA 2D8AA 2LDXA 1BXGA 1CJCA 1UH5A 3ZW8A 3TFOA 3K92A 2HRZA 4H15A 1Y8RA 3ZU2A 1P1KA 1EUCA 5A5FA 1RWBA 1FMCA 3UXYA 3JSAA 1QXSA 2WMDA 3RI3A 2H6EA 1VLLA 5DZSA 4HV4A 4LISA 1B14A 3JD0A 4DBVO 2IODA 2WE7A 2R00C 1SCUA 5COBA 5BSHA 3AJRA 4QO7A 5KNLA 1LUAA 4II3A 3KTDA 1YONA 4BKUA 3FWNA 5LDHA 4E5NA 4BNKA 1BVUA 3W8FA 3FWZA 3ONFA 1NBOA 4XR9A 1A9ZA 2A94A 4D3DA 5JC1A 3D0OA 3C8MA 4NJOA 2Q1SA 4IY1A 1E7QA 1V3UA 1Y6JA 3DC2A 2Y0CA 1EUZA 3X2FA 1KVSA 4EI2A 2AEFA 3GGPA 4RZHA 1FK8A 4M8SA 2DTXA 3ZI0A 5A02A 1PX0A 3WS7A 1NR7A 3ZWBA 5L51A 1DRUA 1JKFA 1N9GB 1UP6A 2QIOA 2W2LD 3M1LA 3ZCXA 3UH1A 4JGBA 3QVOA 4EITA 2Y99A 3GRPA 1YL6A 4QT0A 1LDEA 3DOOA 2J3IA 1BXZA 2VHWA 2VUUA 4IS2A 1H94A 2AA3A 2J3HA 5JPIA 5G2OA 1WMAA 2R00A 1PS0A 4Z0TA 5C3MA 1E1LA 5JDIC 3WWZA 1GL3A 1I24A 2NACA 3PZBA 4NDNE 2B69A 2DUWA 3MOIA 3LC1O 4EJ0A 4GWKA 4BNGA 1CEQA 3WXBA 5H81A 4W4TA 4NQZA 2D59A 4H3VA 3PDUA 3WX0A 4NH4A 3NAQA 3RROA 5A9TA 4R1UA 1LTHR 2V6FA 1E6UA 3F47A 3EVNA 3GDGA 4BNLA 3X2EA 3AU8A 3CXRA 4IXWA 4ND4A 4B7XA 4TVOA 2EP7A 3UHAA 1E6EA 3F4LA 3JQAD 2NM0A 2XXJA 2OFPA 1MC5A 3ZWPA 1DIHA 4GSKA 2VZ0A 4OMUA 4R4JA 3O26A 1XCBA 2VNAA 2PGLA 3AOEA 4B8ZA 1FJHA 1GADO 3S55A 2RAFA 4MJLA 4PLYA 5H83A 5ADHA 5C7LO 3WGIA 1Z6ZA 3RC7A 1ADGA 3AUSA 4XX0A 1U3WA 2JL1A 2P5UA 1E5LA 4BO5A 4AJIA 4DXHA 3RBXA 1E3LA 5AQ1A 2GPTA 1V3VA 4F6CA 4PLCA 3WR5A 1ONNA 4FSHA 5JSFA 4Y6RA 4Z6KA 2GGSA 2QRKA 4I5DA 3DOJA 1YO6A 2YY7A 4Q3EA 3BHJA 2E6UX 1JWAB 3I6QA 3LZ6A 2OXIA 1E3WB 1E7MA 1KC1A 1YL7A 4YJGA 3RD5A 1U9JA 3GPIA 2O3QA 4G65A 4JROA 4L4RA 2FR0A 3KM0A 4R1TA 4OQYA 1MP0A 1PZFA 2OORA 3U3XA 5A5EA 4OQZA 1EBFA 5FYDA 3EGOA 5B37A 1M67A 3UCFA 5ITVA 4BMSA 4PRKA 3BTUA 4Q39A 4G2NA 1EVJA 1A71A 4DLLA 3BYZA 4R54A 4UVDA 2YDXA 3H7AA 4WLEA 5DT9A 3RC9A 2HRBA 3VH2A 4IPTA 4DTIA 1QLHA 1XEAA 4PVDA 1ZH8A 3TZQA 4IDDA 3TZCA 4D45A 4BGEA 3ASUA 5I7SA 2IEDA 1R4NB 4A5OA 3PWZA 3RUHA 1PSDA 1YQDA 4FOOA 3K5PA 2FHSA 1Q0QA 3SJ7A 3WYEA 3WDSA 3EY4A 2P9GA 5B4TA 1NPYA 3KYBA 1U8XX 5L95A 2CF5A 1KEPA 2W98A 4OXKA 3WOHA 5GZ1A 1GDHA 2Q1WA 3W8EA 3JYPA 5I7VA 2VT3A 2ZB4A 2O3TA 1GQYA 4M49A 4AJEA 4BNIA 3HUDA 1CF2O 4HY3A 5JY1A 4Y98A 1SC6A 2GDZA 4W9NC 3WICA 1JVBA 2HO5A 1Q0LA 3PGXA 1N7HA 5AVOA 2G0TA 1YVEI 2I6TA 3H9JA 3G3EA 2GRAA 1XU7A 1JKIA 3E9QA 1GEEA 3BMNA 3CH6A 3H3FA 3PWSA 5CP8A 3LF1A 2YUTA 4P8RA 1DFGA 4IDBA 1DPGA 4J4TA 1RM4A 1KIFA 5CDSA 2DVMA 2FPGA 3I9NA 3EYWA 5TJHA 2FRDA 1VM6A 1DIGA 3PIDA 2X22A 3UW3A 4LMPA 1CYDA 2DLDA 4ZHSA 2YYYA 3GNSA 1LA2A 2J8ZA 1Z73A 3K73O 4RQTA 1Y9AA 3QW2A 2VYND 4CLHA 3K6JA 2X5JO 1TB4A 2PV7A 5HTOA 3C1TA 5G4LA 2UDPA 4YAGA 1QV6A 1CQJA 4YACA 1KY5A 5G0UA 2O3SA 2FSVA 1IYZA 4FFNA 4YRDA 4KTTE 1HE2A 3PGJA 3U4HA 1Q7BA 3DHEA 5IN4A 2HMUA 5JYEA 4PZCA 1D3AA 1GY8A 3OP4A 4WLFA 1HXHA 4AG3A 3NT5A 4YEDA 3VC7A 2PY6A 3H9UA 1ML3A 3L4BC 4WGGA 4Y6PA 4DLAA 3AI1A 2Q2QA 1W6UA 3DL2A 1I3LA 2A4KA 4PG4A 4DYVA 4FQ8A 5CG1A 1PS8A 1P0CA 2DAPA 3DHNA 4BMVA 4I5EA 5JYDA 3AOGA 4B4OA 3ZU5A 2ZCVA 2CVQA 2VWPA 1HKUA 3CKYA 3S1LA 3MZ0A 1BRMA 4CR7A 1D8AA 3FD8A 4L0QA 1R15A 4YJHB 1C0KA 2JCXA 2PK3A 4E4YA 3LF2A 3H9EO 1HYEA 2EEZA 3CZRA 4GMFA 4E3ZA 2BI8A 3EW7A 5EQFA 2GZ1A 1D1TA 3JQCA 4WK6A 1R0SA 2XPCA 1WDKA 3K8ZA 1DDOA 1U4OA 1ULUA 2O2SA 4BKPA 3ZHBA 1ADFA 2PKQP 4GX1A 4Q3AA 4YT8A 4PVCA 4NPCA 4R3WA 5L3ZA 5EQDA 1OI7A 3BHIA 2OGUA 3BTSA 1UDCA 2PGDA 1E5QA 4E5MA 4H7PA 4RF5A 4RGBA 1PJBA 4GKVA 1ULSA 3I6IA 4OSOA 3VOSA 3VVBA 4E5YA 1YDWA 4X54A 4D79A 3MJTA 3QVSA 3HADA 4WEOA 3BMOB 3JQGB 4CLOA 3JCZA 1B8PA 3DXFA 2ZYGA 2I66A 1A5ZA 1XQ1A 4HP8A 1XIVA 1ZK4A 3W4IA 1EVZA 4HWKA 4C7JA 5H82A 2P4HX 3DMTA 2D5AA 3TZHA 3COSA 1ZK0A 2BRUA 3MOGA 3FBTA 4NI5A 4PG6A 4J2HA 5CDYA 3E5RA 5F1PA 3WIEA 4BNZA 5TC4A 4XB1A 4D43A 1E6WA 1P3DA 4IJKA 2PH3A 2GR9A 2X8LA 4MP3A 3K30A 3HG7A 3ICPA 3PP8A 1HF3A 4FIZA 4NFSA 1LRJA 3A4VA 4TRJA 4RV9A 4F6LA 2HAEA 2ZQZA 1I2CA 5I9MA 1EDZA 1V0JA 3GNTA 4NIMA 1HTBA 2A35A 5L7YA 1VKOA 2NTNA 5L7TA 1KS9A 3I3OA 3AUAA 2QRJA 3L77A 2JD1A 3KZVA 4JK3A 2IEBA 3W6ZA 3PJFA 4EEZA 5FI5A 4HADA 4URFA 4L8VA 4PZEA 4Z9FA 3RUEA 3ENNA 4IS3A 3KRTA 3OA0A 5AOVA 3U4CA 2ZTUA 2EW8A 4EUFA 5HM8A 2QRLA 2NVWA 3VDQA 1EVIA 5A9SA 4WECA 1LU9A 1PQUA 2NVBA 2POQX 1DC3A 2ZTVA 3VPGA 5JS6A 3WG9A 3AUTA 1DLJA 2IXBA 5GY7A 3OJOA 4R3NA 5CPFA 4NBRA 3N7UA 4TVBA 1YB4A 2EV9A 2VRCD 4UVIA 5C5IA 1YWGO 4BVAA 3R0IA 1F8FA 4JQCA 3VDRA 1K3TA 1LC3A 3DR3A 2I3AA 3DO5A 1AE1A 3PXXA 4PFJA 4PRLA 1YBAA 3HB4X 4MVJP 1GYRA 3WFJA 1PR3A 1H6DA 3NJ8A 4TROA 5JW6A 3QSGA 1UAYA 4YCAA 5ILGA 2Y1OA 4OKIA 1NWCA 2ZKLA 1GUZA 3OIFA 4BNTA 1GZ4A 2HSDA 4IQ0A 3ZU3A 1PJTA 3V8BA 5BSFA 2OL4A 3PZRA 5ICSA 1PGOA 3JQBC 1ZEJA 4DIOA 3DZBA 3KEQA 4HFJA 1UDAA 2VRCA 2ZJ1A 4NBVA 5A04A 5IDQA 1WZEA 2XF8A 2CDAA 1MFPA 5CPBA 2O3JA 4OXNA 3PHHA 4RDHA 4YVFA 3G0OA 4LW8A 2DTEA 3GY0A 3ST7A 3ANLA 4INAA 1ZSNA 3DZFA 4NBUA 5AXDA 4CM4A 2BKAA 5CG2A 4WE3A 2CD9A 5JFOA 5THKA 1O0SA 1DIAA 3PYMA 5DBIA 2G17A 1BVRA 1WWKA 1P74A 4R41A 4UUOA 5IAAA 1R16A 4JXKA 3KSDO 2PZMA 5BR7A 4RZIA 2X5KO 3TNLA 2OBNA 4ONEA 3WQRA 3D4NA 1Y81A 1P44A 3FN4A 3JYQA 4ALLA 2PZJA 4HFRA 1CWUA 4WCFC 4WNCA 1SB9A 4AFNA 1EQUA 1HEUA 4HFMA 4PG7A 5G4KB 4PN3A 2HJRA 4ILKA 2WD7B 1JDJA 3CEAA 4YBZA 3DBLA 1HZZA 2EERA 4CMIB 1ISJA 5TLSA 3H8VA 4B8WA 4E13A 1I5RA 3FBGA 1HLPA 3H6KA 4ALMA 4KDFA 4YJHA 2VOEA 1U2DA 1C0LA 3RU7A 2E82A 3FR8A 4YYZA 2A92A 4XGKA 1RM5A 2GCGA 4GAEA 2R2GA 5IF3A 3NGXA 4CLEA 3ITKA 1DRVA 5JAMA 1TI7A 1IPFA 3CTMA 2Y05A 5CHEA 2W2LA 4F46A 3A14A 3DZHA 1E7YA 2EKLA 2V6BA 3AM5A 4YA6A 3JTMA 4II2A 1SB8A 4DPMA 3E03A 3GHHA 4HNHA 4CUKA 1QYXA 3MWDB 1LSJA 4J90A 3JQDA 4OHUA 3ZDFA 4CLDA 4XYEA 4DUPA 2WWRA 4UEKA 1NP3A 3OETA 3PHIA 4LVUA 4K26A 1DIRA 1O95A 1JW9B 2ET6A 3R6DA 4LSMA 2O2YA 2RHRA 3LLSA 3OSUA 5EIOA 2D1YA 1LNQA 3ZGYA 4BS9A 3BA1A 3DWFA 1GZ3A 1HDYA 3GN1A 4J9VA 1KVRA 3HB5X 1LLCA 4FD3A 2H63A 3RFXA 2J5QA 3U5TA 2RH8A 2BELA 4BV8A 3QJ5A 3UOGA 5IXSA 2X0NA 4FFLA 3WGYA 4NBTA 1EE9A 2CFCA 1K89A 4Q3DA 1ZIDA 3RC2A 1PZEA 3TDKA 3W8DA 1G1AA 4PLGA 4CL8A 4FN4A 4CMBA 5F5NA 3N74A 3EUWA 1X13A 2Y1GA 1J0XO 3NV9A 3HN2A 4U0KA 3PIIA 2O3UA 5A3VA 2JAHA 3K31A 1U4SA 3Q9NA 3DAPA 2X4GA 3KVOA 1GTMA 2P9CA 1BWSA 4FFRA 4BNJA 4AJKA 3DBLB 4DPKA 2FN7A 2HMVA 4NJMB 4CPDA 4WCDA 5L4SA 1J5PA 3RU9A 1YDEA 5F3RA 2EF1A 5K6AC 1DC4A 1GYQA 3UICA 2FMUA 3L6OO 4LN1A 4J7UA 4J7XA 4MVJM 4QFDA 3RKRA 5A06A 3PYLA 2X9NA 4D42A 2XXBA 3E5MA 4GLOA 1Y8RB 4E5KA 3JQGA 1YBMA 3KLMX 3O8QA 4NK5A 1X0VA 3ZHXA 5CDGA 2NVUA 1UJMA 3DAFA 5CDUA 4MP8A 3VH3A 5FF9A 1IL0A 5IDYA 4FJ0A 4ROSA 1GFSA 5J23A 5CEJA 5JNLA 5BNIA 2YV2A 3L0DA 3F5SA 3AW9A 1EEHA 3RAJA 3S2IA 1ZO8A 1I3NA 3GRKA 1O8CA 3JQFC 3NKLA 3ZHYA 1EE2A 3MWEB 1GZ6A 1LLUA 5JBIA 2NU8A 3DDNA 3QLJA 3O8QB 3BMCB 4MKXA 4FC6A 4XJTA 3WBBA 3G17A 1NFRA 4L75A 1AN9A 5MGBA 3WYCA 4A7PA 4EYEA 3OJLA 1HDOA 1X1EA 2OP1A 4TKLA 2RCYA 2VHYA 3NEPX 4WASA 1O6ZA 1KVTA 1PJ4A 2VCYA 5JE8A 4A26A 1W0CA 4IM7A 3U62A 3SLKA 1JN0A 3GZ4A 4QQRA 1NAIA 4GX0A 4Y6SA 5TNXA 1H2BA 1NHGA 4YAIA 4J1QA 2C7VA 3TL3A 2YJZA 2YW9A 4IZHA 4FPXA 2DBVO 4ZICA 2QHXA 2GD1O 3WMXA 5KIAA 3G1UA 4YRBA 3Q11A 2W4QA 4IDFA 4ZQFA 5TJ9A 5DULA 2QYTA 1PJ2A 2Q46A 5FEUA 2DU8A 1DC6A 3RUFA 3F3SA 3IL2A 3LT4A 4QUKA 3IIEA 4DWVA 5I9NA 3DTYA 2QZ9A 4ALIA 3PTZA 3H5RA 4YJGB 1K6IA 4ND5A 2HK9A 1LQUA 4XD2A 5COQA 2Q1UA 1GEGA 2AG5A 1QORA 3IQDB 5A1TA 2Q45A 2JHFA 4FGSA 1P1HA 4YJDA 3ZV4A 3VAZA 2FY8A 1Z82A 4CQMD 1T25A 1U3VA 2EXXA 2JCYA 3ULKA 3IKTA 2GN6A 1N8KA 1ONPA 3PJEA 4MP6A 4M87A 4GVXA 2BF7A 2VHVA 4RVFA 1K5HA 3RQSA 2YV1A 4WNIA 4FDAA 4BGIA 4L4SA 3TWOA 1VC2A 3IMFA 4S1VA 3GFBA 2VRBA 4FCCA 1B8UA 1WLYA 5CAEA 4BO6A 5T5QA 3QVXA 4F3YA 2VYVD 1LX6A 4D7AA 1ZXBA 2YHIA 3ABIA 4OAQA 2NTVA 4CMIA 3PQEA 4BO3A 1R0KA 2B5WA 4CM5A 3AM4A 2A9FA 3UF0A 4TWRA 3JD1A 2Q3EA 3MJ4A 4OL9A 4DC0A 1DO8A 3C85A 3NUGA 1BDBA 1QYWA 4IXTA 3RJ9A 1HE4A 1NVMB 1WAMA 3DONA 4O0LA 1BG6A 3LVFO 5BSEA 1A27A 4KDEA 3WGQA 4FOSA 3IJRA 2J3KA 2PD6A 4J1TA 2DFVA 2BLLA 2I9PA 3G1TA 1E3WA 2PGJA 2C7GA 4N5LA 4AJLA 1GAEO 2NU9A 5K9ZA 1MG5A 1PR9A 5F1OA 2H1SA 1DAPA 3DBRA 4RF2A 2VYVA 2BGMA 2JD0A 3HDHA 5JCXA 2Y0DA 4IGEA 4C4OA 3KOUA 4Z0PA 4R9SA 3EC7A 4QFCA 1DOHA 1R0LA 3FPLA 4J4BA 4W82A 1VJTA 3FR7A 2ILTA 1TXGA 5KJ1A 4IDAA 1NTOA 4MIEA 3JQ8B 4J6FA 4PLHA 3DBRB 4I5FA 1R4NA 3IUPA 1MFZA 3I5MA 1ENOA 3P5SA 3FCOA 1PZGA 4NFHA 1HDCA 4RPGA 5AXBA 3ROMA 2JHGA 3U0BA 1ZMOA 4LCEA 4YWJA 1ISMA 2V65A 4OOFA 1XELA 1ARZA 3JV7A 4XCVA 4DREA 3Q1LA 3EK2A 3EMKA 4IIVA 4KUHA 4NBWA 3PQDA 4KOAA 4UVGA 1KY4A 3GC6A 1GR0A 1UZNA 3DBHB 3ORFA 2AQKA 2RIRA 5K6AA 1B2LA 2BHLA 1TEHA 1NAHA 4E6PA 3LT1A 4RJTA 1T2CA 3VPSA 4MVJG 1EFKA 2PD3A 2PWZA 4FS3A 1DHTA 1R12A 4RPKA 2VWHA 2VT2A 5C7IO 1WDMA 2NWQA 2WJPA 3PEFA 3P2YA 4J7CA 4NR0A 1GUYA 4GPD1 4P22A 1Y8QA 1I01A 4ZD6A 4Z0HO 2PZKA 1Z7BA 4OKNA 2NSDA 4RL6A 3GG9A 1DEHA 3PVZA 4BO0A 4HUJA 1P1JA 1FXSA 3ROKA 1DXYA 3RFVA 4D3SA 3DFUA 3GQVA 5IN5A 4LCJA 3DZJA 1HDRA 2HU2A 6ADHA 4BKRA 2TMGA 1Y8QB 4GKBA 1MUUA 3JQAB 4O6VA 3GK3A 3C24A 4E30A 3TOZA 1GPJA 4KMSA 1UXKA 4EDFA 4N5NA 4IZIA 4O63O 4E33A 4AJ1A 2ZK7A 3NT2A 3KSZO 3BMOA 3AM3A 4CLOB 1MX3A 1QYVA 3BMCA 1KBZA 3NDJA 4DGSA 4ZU3A 3ICCA 2PNFA 1HSZA 4XQ9A 5I7EA 5U9CA 3D7LA 2VN8A 4IUYA 1U1IA 4CMKA 2VYNA 4Y67A 4B4WA 4R5MA 5DOVA 4BMNA 1IPEA 1DRWA 1HE5A 1BXKA 1C0PA 4CMAA 2BFMA 3WLEA 1HZJA 1X15A 1QRRA 1BW9B 4E5PA 4NZ9A 3FRJA 2FZWA 4PLWA 3RUDA 3ROPA 3TSCA 1DJQA 3VPFA 2WYUA 2FPPA 2HMWA 2Q2VA 4PLZA 1PS9A 3R3SA 2FP4A 2Q99A 1DHRA 1LRKA 3DBHA 3Q0EA 4FGWA 4I08A 4OJNA 3S2FA 3GT0A 3HQ4O 3IS3A 5A9RA 4QX6A 1KETA 3MTJA 5HWSA 4GH5A 3NGLA 2NVUB 3BMQA 3BIOA 2X0JA 1E7WA 1B0AA 4JBHA 4PZDA 1NQAO 4A10A 3A1NA 4CLXA 1BSVA 1RJWA 1SOWA 4R9RA 1GU7A 1XSEA 2BI7A 2FZEA 1F0YA 1P1IA 4JBGA 3SEFA 3PYXA 1BXGB 1VKNA 2HMSA 5KJCA 3L6EA 2QZZA 3PLNA 3QWBA 4K1LA 1LXCA 1QSGA 1MLDA 3GG2A 1XR3A 2GO1A 2VUTA 3TPCA 4D0RA 1UXHA 5A9SB 1K0UA 4DYDA 5DDIP 2GN4A 1RYDA 1AHIA 1E3IA 2WTBA 4DMMA 3PI7A 1GD1O 4YQYA 2X1HA 4CM6A 1PWXA 1C14A 5T67A 5JO9A 3GGOA 4QXMA 1YJQA 4C7KA 1SEPA 1HL3A 5JCJA 5IDXA 3G49A 4U7WA 3WGTA 1G6KA 3NTRA 1OBFO 1D7OA 5A05A 1PU2A 1XU9A 1CQIA 3KYCB 3PRJA 3QY9A 2V6GA 5BNTA 3V5NA 2WM3A 1NX6A 3L07A 5KJ6A 1DIBA 5G0WA 3CSDA 3ZV3A 4L4XA 2DM6A 2F1KA 4BO7A 1M6HA 4FB5A 3VPXA 1JTVA 4UUNA 3U4DA 1SOVA 5JAQA 1P33A 3L9XA 4IJUA 3GUCA 3SVTA 4J9UE 1T4BA 2BMAA 3W4JA 3JQ9C 4ITUA 1IHXA 3K96A 2CZCA 3Q2KA 3M6IA 3HFGA 1ZW1A 1NVTA 5FFFA 3VKVA 2Y93A 2OBYA 3DMYA 3H65A 1V3TA 3MCVA 4IMPA 4R16A 4TRNA 4UEJA 3CPSA 3JQEA 3OEYA 1JVSA 1I33A 4EJ6A 2Y68A 3H9QA 1I0ZA 1LLDA 3T4EA 2EHDA 4NMHA 3VHRA 3GAFA 4AJJA 3CIFA 3K2BA 1E0DA 3KUXA 3K2EA 1JAYA 1U3UA 3V2UA 2CNBA 2WDZA 4XEHA 3TF5A 4BNWA 4E0BA 4LMRA 2B37A 4PG5A 3RIHA 4DQVA 4CM7A 3DAGA 4WUVA 4NJMA 4GX5A 1FDUA 1RYEA 4XDYA 3R3JA 1IZ9A 1LLQA 2DPGA 4D41A 3O4RA 1LRLA 4HXYA 3WLFA 2TMDA 4HNGA 4W7HA 1N1GA 3OFSA 4FFMA 1BHSA 4W99A 5BNFA 4LSWA 4GI2A 4WEQA 3I9OA 5KTKA 1YOVB 3GVXA 4FR5A 1E77A 2IRWA 3WSVA 5GZ3A 3L4BA 1A7KA 1VL0A 4CLRB 2IZ0A 4QO8A 1IE3A 3WGGA 2B4QA 1PL6A 4DC1A 4MIOA 1I8TA 4MVJH 2Y1DA 4EW6A 9LDTA 1HDXA 4BUCA 2X23A 4E2ZA 4MINA 4N5MA 4GGPA 1YE3A 4W6ZA 4ZVVA 1NPDA 3JQ7A 1P9LA 3TOXA 4R01A 4CLRA 2EGGA 1H9AA 3A06A 3ETGA 3IP3A 1S6YA 3QP9A 1O94A 4Z9XA 3E9NA 5KWEA 3RC1A 4BL5A 3FTPA 2NQ8A 2AEJA 4AVYA 4BNHA 2ZYDA 4ND3A 4CV1A 3K9QO 1ENYA 2Q1TA 3E1KA 3GHYA 4XGNA 2V6MA 1N1EA 2FR1A 4CMGA 2Y67A 4R68A 3JQ7B 3LDHA 3DQPA 5KKCA 3ZWCA 9LDBA 1U28A 2IXAA 3GDFA 1A4UA 1F14A 1GV0A 3ZZNA 3M1AA 2OUIA 5B4VA 2B5VA 3MJEA 3H2ZA 4BKQA 4PLFA 2VHXA 2AMFA 4WCFA 2X9GA 4DL9A 4W9NA 3AY6A 4Y9DA 4BNYA 3ETDA 3VZSA 4UAGA 1DC5A 4M54A 5EN4A 1X7HA 1E3EA 1Q1NA 2X0IA 3UCEA 3NX4A 2P4QA 4AJNA 5B4UA 1Y9EA 1SAYA 3N58A 2Y1CA 4PLTA 4UVEA 3ASVA 1Z75A 8ADHA 4NNJA 4CM1A 3NTQA 4CM9A 1PQPA 3D1LA 4RPJA 3TJRA 2PA3A 2WD8A 3E48A 1ZKMA 1Y5MA 3OJEA 4ZRMA 1U5AA 4U6SA 3GH3A 1ZUD1 3E9MA 2D4AA 2X58A 3JYOA 4TZTA 4RVGA 4R5HA 2NNLD 1BGVA 2YV3A 8LDHA 1LI4A 2P91A 4K6FA 4JLWA 2E48A 1YQGA 1UP7A 4UUMA 1U8FO 3BXXA 3GMDA 3QWAA 4GSLA 3TZ6A 3GN2A 3MTGA 3T7EA 1T2FA 3DZGA 3VVCA 1Q7CA 1HETA 3EZYA 3PHLA 3UFXA 4CMCA 2DBZA 3MEQA 2E37A 1ZNQO 2GZ2A 3RCBA 3E82A 5AYVA 4GX2A 5ITWA 1VL6A 3HDQA 4BNMA 1T2AA 1MGOA 5C37A 4DQUA 3DBVO 1NWHA 1QYCA 3QWIA 4WPGA 4KQWA 2ZQYA 2J5RA 3F5QA 4TMFA 2RHCA 4YDRA 3OICA 1HYHA 5JXWA 4RVUA 2DT5A 1X1TA 1FF9A 4AICA 3F4BA 5COAA 5GZ6A 1XQ6A 1Y7TA 2FR8A 3ZWYA 1DBVO 2DQ4A 2Z1NA 4L73A 4R69A 5TX7A 3AOEC 2AE1A 1AXEA 1FDWA 1F12A 1P31A 2V7PA 3DZKA 1YB1A 4NU5A 1XKQA 5DCYA 4ZQHA 3JQ8A 1JLLA 4I9NA 4JJIA 1PL7A 3ROQA 3AFMA 1VSVA 1Z7EA 5DCWA 4S3MA 2C5AA 3H2SA 1HYGA 4B3HA 4BQPA 1MXHA 1UXGA 1N92A 2HQ1A 4CUZA 1XGKA 1YB5A
chains in the Genus database with same CATH superfamily
2OHXA 3ZHZA 4NU6A 4ZZ1A 4DCCA 1QQ7A 3BCUA 4DA0A 3ZWWA 4MV4A 3HUFA 4R7ZA 5TQVA 4F45A 4NWIA 4WDQA 5YASA 3WNVA 5I4CA 5ICEA 1XNQB 2R47A 3S8MA 2SICE 1Z62A 3E9ZA 2C8VA 2PX5A 4KR2A 5J2UF 1GCIA 1XK7A 2ILVA 2IPNA 3AHJA 4WW0A 3HY3A 2A9RA 5C8YB 2NN3C 1O6FA 2O8VA 3BM5A 3FTQA 1C30B 3FF1A 2CDCA 5L51A 2JKVA 2YFHA 2B8EA 2I1QA 2PVCA 2XCQA 1ABBA 5LL6P 5PNTA 1KXJA 3C6BA 4IMJB 1YS4A 4DIBA 4E1AA 5IFLA 3TRJA 3KE9A 3A9SA 3KO8A 4GP6A 1UBEA 3HJBA 4Q9HA 4BRSA 1HOXA 1QZTA 2A5YB 4Q3NA 2NU8B 3OPYI 1NFQA 1N5KA 2J59A 2BSXA 2Z8XA 4YTEA 5A3RA 4DDWA 1GQFA 1DX4A 1AJEA 2AE2A 2YQ5A 3AEUB 1YRBA 1IM8A 1QHHA 2X0RA 4D97A 3PPIA 3AK4A 5B36A 1D0VA 4FGJA 4GYKA 1LPPA 4R1LA 1XQWA 4PY2A 4Y9TA 4WLNA 4P08A 2WWYA 3D3JA 1KDPA 2GPSA 4N8EA 1OAOC 3VZBA 3A7DA 5TVKA 2WY2D 1N34B 4KCGA 2IEYA 1Q0SA 1T5LA 3TQFA 4QXPA 2Z6AA 2BWJA 3IKVA 4O59O 4F5ZA 2EDCA 3VHLB 1G8AA 1CV2A 1HMPA 1KO1A 3D7RA 5DF1A 3W9BA 3X1YA 4IHJF 4CG2A 4X94A 5ENVA 3I62A 2EZTA 1YC2A 2ZTMA 2NNWB 3CVOA 4YRKA 2ZT8A 3K4QA 3E53A 3KETA 4G85A 4I8DA 4P9NA 3H99A 1MB4A 2G5CA 3RSHA 1NW8A 1P77A 2Q3DA 1SHZA 2WHXA 1E3SA 3HE3A 4EJSC 4ENSA 3RE1A 1CQPA 4E14A 4XQGA 1EK5A 2VTBB 3JQ6A 1A8QA 1KSGA 1DG9A 3H2GA 3A3OA 3UPUA 1C4OA 2BUAA 2Q5IA 4Q7MB 5DNDA 5JMPA 1JSXA 1CUVA 4KZPA 1GHTA 3EWAA 4QOGA 3VR4D 4D8TA 1VKHA 3NRBA 1JPJA 2XIQA 1W47A 4RQUA 5KWVA 1QO0D 5KKAA 3V1NA 3OM0A 1KZ6A 3NKFA 3NRJA 4G84A 3R44A 4PYQA 4V39A 1L1FA 3KZKA 1R4MB 3PQ8A 4KIJA 4PNHA 4D57A 4L6CA 5LQDA 4M8LA 3QLTA 5LNK1 2KB0A 1RXVA 2V7VA 4QAQA 1OKKA 2JA1A 2WEKA 4PWYA 4CEIA 1BMQA 1ORDA 2XVXA 4FU0A 1Q2XA 4F71A 3V2UA 3KHUA 2AXPA 1AK9A 3OJFA 1BQEA 4IHJA 1KR5A 4XW2A 4XWYA 3UWMA 3WMWA 5K0ZA 3THYA 1XCMA 4Q47A 2O06A 2QRMA 4P4GA 1GPBA 1SNYA 1QCCA 3EAGA 4HUQB 4E51A 3ESQA 1TAHA 4DOMA 5SY4A 1PYGA 5KUTA 4EFMA 3F6RA 2UYCA 1HI9A 2WABA 2B78A 1EAYA 5A62A 1Z2NX 2WAMA 3WXMA 3PF9A 2VTDA 4U0JA 3NJ4A 4RIEA 2FOIA 2EKBA 2E2WA 3LI2A 4OFZA 3W6NA 1O5OA 3COYA 4OH7A 2YWEA 3AP3A 3AZQA 4Z4HA 4DV0B 3KJXA 3OO0A 4ZEVA 4WIAA 1JHUA 1EG7A 3VZRA 3LZCA 4N9QA 4MWZA 3VYWA 1EWTA 1CB0A 1Y1LA 1CUIA 2QTBA 2IU6A 3TD9A 5AUPB 4PFSA 3P0FA 4OHCA 4OYRA 3SZMA 2WSBA 1NQOA 2Q5JA 5D5HA 3D8TA 5FHRA 4XGIA 1DXHA 2X13A 5DHUA 4QEDA 1LK7A 2MYNA 4L16A 2YHUA 3TGPA 4BUJA 1XMIA 1X14A 3BORA 4M0FA 1P5ZB 2IOYA 3ECSA 3ZWVA 1O0BA 3PA8A 2P4SA 3R1IA 5IMBA 2O50A 2WUDA 3IC5A 1KQOA 3K1YA 2XVAA 2NZUG 1G0OA 1M2OB 2W6CX 2FUKA 3Q72A 4G4GA 4GOJA 1P0QA 2BFPA 1Q7EA 2XE6A 3GJ6A 4TL9A 1CTQA 1VCIA 1WR8A 1TLFA 2AG8A 2ZCUA 4H7EA 4NHEA 3B38A 4ZXFA 1ZN7A 1U1DA 4MUAA 4I19A 2GERA 2Y3IA 4OSPA 3AG6A 2X4IA 1JU9A 4Z9YA 2E4AA 4JS0A 5EE9A 2JFHA 1R0ZA 1GA6A 1VKRA 1SIWA 2ZJOA 3LUCA 1CRWG 1GKLA 1PDOA 3QE0A 2AXQA 3QIVA 3V46A 5A5VA 2GZRA 2Z3ZA 3GIDA 3EXFA 3GDOA 1TYCA 3AQ4A 1U3FA 1L5OA 2QSUA 2I80A 2P2SA 1ZDMA 1GPYA 1P7WA 2LCQA 2ZIFA 3DT6A 3VTFA 2VCHA 2QUZA 4XYBA 2YS6A 5IC5A 3RWBA 1G8FA 1K27A 1W5AA 4GP7A 4F4DA 2I78A 1PG5A 3WNDA 4DWJA 2M6LA 3MIIA 2NYAA 2B8TA 4OX9B 2VDWB 4K6HA 3AERB 3BPSA 3AGPA 3D6UA 4LPSA 4QELA 3IPYA 3D7NA 1TD9A 2OVFA 2XR1A 5IC6A 1T1GA 4ZIRA 5CB6A 3NAGA 2ZBDA 4UE2A 2IIBA 5AVXA 4P58A 3UKOA 1SC4A 2LWIA 2PKRA 1Y3HA 1FPMA 1XJ0A 3R3ZA 3GRAA 4YJ3A 3ZQKA 5ICMA 1M0SA 4HAWA 1I2ZA 1NIJA 1XYVA 4M53A 4N82A 2ZRHA 3OEWA 3BMQB 4DIKA 1UBCA 3HL0A 3PT5A 1JP7A 2PKCA 4N49A 3R74A 3QKTA 4RCVA 4G0PA 4DIFA 1G3MA 4GZ6A 3KWJA 3LY7A 4D5EA 1DJOA 5ES3A 4G5RA 4XYLA 1EM8A 5TB5A 2KX7A 4PV7A 3MAGA 2QZSA 3QI7A 4NCKA 3ZTYA 3DKRA 3VR3D 2V98A 3LIPA 3O4VA 4K9DA 5JEDA 4RZQA 4BLTA 2IHVA 2QL7A 1R4ZA 4FN5A 5DYGA 3D3WA 2XYGA 1JA9A 2W6IA 3WK8A 5THQA 3QLVA 1ISFA 3DXXA 3KEOA 1VA4A 3H3JA 1JKJA 3BJMA 2FQWA 3I9MA 4X1IA 4YALA 3JD3A 1QGUB 4EHNA 5IM4F 3E2IA 1QIGA 3IOYA 4LE1A 2OBFA 4ZAXA 2IKQA 2PMDA 3O3CA 4RHUA 1YVPA 5B2ZA 3HUEA 4G2TA 4MVJD 4M83A 3TW4A 1E79D 3ES9A 2GXUA 2PTGA 1V95A 3TTSA 4Y2HA 3B60A 4B4UA 3C39A 1Z6YA 3ZW9A 1LS1A 4CMEC 5A5DA 1NR5A 3AF4A 4JCOA 4PPGA 5ILQA 1P19A 1PDWA 2C4MA 2H5LA 3NU1A 4JFAA 2BGGA 1NC3A 1PEDA 3K16A 2AR7A 4G36A 3DD5A 4KAAA 3L4JA 3VNBA 1U2DC 2PZAA 4N3BA 5CDFA 2I6XA 3CRRA 4FNMA 5LCXA 4RK6A 1ZUNB 5CM2Z 1TAGA 1A2OA 1UJCA 4I3GA 4BVBA 3QITA 2RARA 4AS3A 2UYGA 1MRZA 3OAAA 1PJAA 3UO8B 2W90A 4DDKA 4U5QA 1KZ7B 4YMHA 1M2WA 3Q5GA 3LSYA 4YMVA 2FMIA 1RAAA 5EJFA 2EP5A 2NUAB 4FJ2A 1P5JA 1ZMTA 1CJUC 5DWVA 5DT2A 1XC7A 1QIJA 1PW5A 4PQGA 1ILEA 4G56A 4EKDA 1MXFA 4H1TA 1I2MA 2F43A 4G9EA 2R97A 3K70D 2AI3A 4ZCMA 5H8WA 2WM9B 2WPDD 3C7AA 1M5TA 2HA3A 2GLUA 1GGKA 3REGA 3SDSA 2ZFUA 4EGFA 1L9XA 2DHDA 2F3QA 2JASA 3MD9A 4KQ6A 4MI6A 4TXJA 1KWKA 1VG0B 5LDGA 3MGGA 1XMJA 2QMZA 1CEXA 3G9ZA 4QICA 3WGVA 4EHDA 3KB2A 1YVDA 4RF3A 1SCBA 2SECE 2FWJA 3FWYA 4MX8A 3F9IA 1JTFA 4DIDA 3U19A 2AN9A 2IDZA 4LE0A 1ORIA 3L7AA 3JQ9A 4PNPA 1H1DA 1NRXA 2ATCA 3MSCA 1QG6A 3NTOA 4FHFA 4F4UA 4R1NA 1YIDA 2E1PA 3HVIA 4QXAA 2P3LA 5FI3A 3A10A 1E1MA 2HJVA 5TQ2A 4JLVA 4R1OA 2Z3WA 5DCUA 2HKIA 2XEDA 2YYZA 1RE0A 2R96A 3VHXB 5FBQB 3CJQA 4OM8A 3SLRA 5EWMB 1X8JA 3NYQA 1XZLA 3GJZA 1NRJB 2PRJA 1X7ZB 3HHEA 3IUYA 4IMIB 4LVCA 2OMEA 3ILSA 4IOKA 1XJQA 1Q95A 2VH1A 4N8SA 2IUUA 1DIOB 3HJCA 4UXJA 2RJ3A 3LBYA 5TEWA 5DP2A 4MQUA 5C0OE 3QBTA 3V33A 4MQEA 2QVZX 5DYTA 1E0KA 4IINA 4MVWA 5IZCC 1HZZC 3KU1A 4IILA 4ZGWA 2QVBA 2YRXA 2PG3A 3BHMA 3HU3A 4N9WA 3AR8A 3NRCA 4V24A 5ARCA 3UXHA 4DA7A 3OCWA 4XVCA 1Z45A 1AKUA 1C1XA 1NBWB 3USZA 2G83A 4KMRA 3DE6X 1ZAYA 2DULA 1N5MA 2Z95A 1B3RA 3CUWA 3S5JA 1S8AA 3TGWA 1AS0A 4M6WB 1ULBA 3UV3A 2REXB 4YMSA 3EXHB 3IOCA 1FDSA 4NMMA 2IE0A 3CUSA 2QJTA 4LG1A 4R98A 4Z3KA 1IIRA 1ZZEA 2H1CA 2X7XA 1T4DA 1JG6A 2PZGA 3OZWA 4XTRA 1LV7A 3MJVA 2AJBA 4J76A 1HDZA 3VPCA 1X0XA 4I66A 4IOMA 3KZOA 1TQ6A 1Y4ZA 1UDBA 3Q41A 2WYVA 2VTVA 1E2FA 2C0CA 1DP4A 4JU8A 1YXMA 1W1IA 4HWRA 2AMJA 4K03A 4O2LA 4Y0VA 4D25A 4PZYA 3VTZA 5LLTA 2C5EA 1KOFA 3AR6A 3EVZA 2Q4RA 3BWXA 3H9GA 1O7JA 2JJYA 4P98A 4WSOA 4BECA 1ZA1A 1MAHA 1JIIA 2X86A 3D81A 2EJVA 1US8A 2IW3A 3VOBA 4IIHA 4ZO4A 3BXPA 3S1SA 1E92A 1SRQA 2C82A 4KXYA 1COWD 5TS3A 3NDPA 1XNJA 5T41A 4EJFA 3MLBA 4QSMA 5F9HA 3W3AD 1L5RA 3QUTA 3RFTA 4TTVA 2VQ3A 6REQB 4DQLA 4EM6A 1N6LA 2I4RA 2RGYA 4X24A 1TVCA 1JVNA 4OBXA 4UUAA 4AG5A 3G2KA 4RVHA 2JAUA 2P67A 3CZ9A 3GRFA 3NW9A 1Q11A 4G1CA 1HRDA 3UWPA 3QHQA 1QGED 4FP9A 1MHTA 3TN7A 1VCNA 3UHJA 1E3DA 1ZGCA 2II6A 2XVYA 2YR0A 5A03A 1S3IA 2IU4A 2QF7A 4KFCA 2QGFA 1PJ3A 1RAFA 2WYWA 3RRNA 1XXHE 2JIZD 3C0KA 3ABOB 2UUPA 1VGVA 2D0OB 5KSYA 1VJ1A 4KG7A 3OQVA 1IVNA 1TTTA 2GHTA 1R1DA 5AI8A 5E3HA 4UZFA 3P2EA 3ZZTA 2R7AA 5T4BA 3A28A 1YI0A 2ZZNA 4X5OA 1WZ2A 1WPXA 1RW4A 2BP7B 2G28A 1YS1X 5IF9A 4YRMA 2JFWA 2JARA 4H7KA 4UM7A 5CXUA 4Z7JA 4G0XA 1XZGA 2X5NA 2OCAA 2ZRNA 2RI0A 3NHAA 2O14A 2WJ6A 2WU8A 2XNSA 4TS9A 5K0JA 4QHYA 5EWJA 2EJCA 3JRXA 2A78A 4L5YA 1JQBA 2B61A 3COWA 4MS3B 3TAUA 4I4CA 3Q9UA 2QN6A 3VRHA 1JMYA 5HR5A 1QZZA 1RWQA 2W2KA 4HNTA 3PI6A 1RPNA 1OH6A 3FROA 5ER9A 3D0RA 2KHZA 2WJ3A 1PFVA 1T9GR 3EVTA 4IIDA 5HS4A 3MMPA 5TT1A 4IF4A 3W05A 4ZO7A 4NEGA 4O8CA 1G8YA 4U2KA 3FPGA 1WIWA 3E3MA 3L8ZA 1XA3A 5TRTA 1N3LA 5CB0A 3BTVA 2YXLA 3MRSA 4G63A 2OESA 3RVQA 3X43A 4J16A 4F93B 1EGVB 5MFPA 4F8EA 1O96B 1W0KA 3NZEA 4FQ5A 5SZIA 1UXIA 1CBUA 3H5LA 4TN1A 5TGDA 2XUHA 1SG0A 3O38A 4A92A 5ADVA 2C1ZA 3W5VA 4CT4B 2QVXX 2AI1A 4RL4A 1R9MA 1JXQA 4X8OA 1E6LA 3IVMA 1KFEB 5TMBA 4CKBB 3NQ41 3IFSA 4HAIA 4MVJF 1P9OA 4OLBA 4F3RA 5FUXA 3ELWA 1ZJYA 3NYWA 4C6TA 1E7SA 3QU9A 4AS2A 1KGSA 4B6RA 2FDRA 3E9RA 2WFLB 2P9YA 5KVAA 1XRSB 1G9XA 1CIVA 5LWQA 1T5HX 4LYGA 4Y2VA 4UZEA 2B4TO 1ULZA 3HNRA 4QQNA 4C3ZA 4OHFA 3HSYA 2X41A 1ZVQA 5CLGA 3UMGA 3W04A 3O21A 3B5JA 1OA0A 5J63A 5AIAA 1ELOA 3X1WA 3RT9A 5JMWA 4TUYF 1E7RA 3KTAB 1TT5A 3HDVA 1CUUA 5DISB 4W5RA 5JDCA 4X63A 3P0IA 4DW8A 1R6VA 2VJLA 4KX3A 1AMNA 4I8XA 1BE6A 4DG9A 2QE7D 3FHLA 4KQXA 4UDOA 2B6HA 4TV9A 1R8YA 1PGJA 3QXJA 5EINA 1L5FA 4OPMA 1DKPA 4C6RA 3E05A 1KY2A 4MKFA 4YRZA 3BWEA 4A0SA 2IL1A 4ZDWA 1XDWA 2D1QA 4BC1A 4YROA 4GD3Q 1VPDA 3SSNA 2Q0XA 1QP0A 3FF4A 4PPQA 4YJFB 2OZPA 4UKDA 2HDHA 1PNOA 3S4YA 4ROTA 3WTCA 3B1WA 2IYNA 4ML3A 4AJHA 4E5SA 3MPUA 1Y48E 1JG3A 3OT1A 5K8TA 1WLSA 3G0DA 2PR2A 3KD3A 4NAHA 4RADA 4ZJPA 1EINA 4K46A 5DP1A 5I4BA 1N2SA 1UBJS 3FJOA 1SWWA 3RK1A 2G1PA 1BXRA 4CCSA 3V1YA 5DYIA 1RJ9B 4E08A 4MUFA 5EMHA 1SOMA 3WHKA 1J2YA 4HWOA 3C16C 4TLAA 2AFHE 2C2BA 1JSRA 3JAMA 1PP4A 4YJFA 5TSDA 5U1PA 3UM9A 4FMBB 1S2LA 3LU1A 2GEKA 1GCOA 3EF3A 5EJGA 3FNEA 3IILA 5GVSA 1AQIA 5GV7A 5E8RA 1JJVA 4EATA 1BMDA 3ELDA 4GWGA 3RVDA 3V8NA 3K70B 1BX0A 3OZIA 2VKTA 4J4HA 3ACBA 4DZTA 4GPBA 3SKVA 2XTAA 5L40A 3KR1A 2CUKA 4NU0A 3AKCA 1C1DB 1E1KA 4YB8A 1E1DA 3INYA 3KLPX 4ZVRA 4KV9A 3TVDA 1D1QA 3AB7A 1WDLA 3HP4A 2VPYA 3M4NA 2AUNA 5JWHA 5KYUB 1GQRA 1JIJA 1MIOB 4TWIA 4NZYA 5AVUA 4JBLA 1TCCA 2P0EA 4UU0A 1P8JA 2NV2B 1NVKA 4CMEA 2WYIA 1W35A 1WXIA 3AV0B 4LJ9A 3FNBA 5D51S 2ROQA 5K8VA 3HU2A 3K9LA 4FYJA 4LRTB 1YRYE 4HVTA 2F9MA 1N2ZA 2ADOA 2R8BA 3QQPA 2PS0A 2RK4A 4ZXPA 2J45A 2IJGX 4KR6A 1B74A 4MDHA 3NJRA 1WNTA 2GBGA 1C30A 1YMVA 2AQIA 4P4LA 2LVBA 4ZOEA 3J81A 1PJCA 2PD4A 4N76A 1SR8A 1UWKA 2VKQA 4UREA 3IBGA 3OPNA 1N8SA 4PTLA 4QUIA 4FYYA 4W9MC 3AF6A 4JUCA 1KU6A 2GSWA 2JIZA 3AXTA 4KGZA 2O2XA 2VK1A 3GBPA 4OLFA 2GFHA 3UVEA 4CL3A 5G0VA 3SHFA 3TDNA 3GLKA 5DWDA 4FJ1A 3ZH2A 2ZU0C 4ZTUB 3QH4A 1A9XB 1EVEA 4NOMA 1QE0A 4PZLA 4PONA 4AJOA 5KOIA 3M3DA 1WMEA 3PQ2A 4LV8B 4MUNA 3L8HA 4YREA 2XUFA 3UPDA 1UAGA 2UYYA 3ANNA 5B12A 3T52A 1S8FA 2OQVA 1J49A 4AMVA 3GF4A 2OBXA 3ZU4A 1Q0ZA 3G2LA 3RWMB 1P3Y1 4AZ0A 5CEFA 1FLNA 1I36A 3BRWD 2Y4NA 4YAKA 5HKKD 5JH7B 4IICA 1H6BA 3I4LA 5CA0F 1II9A 3W2HA 4HNUA 2EYUA 4FE3A 1L9KA 4QBGB 3LQ2A 5DGTA 3R23A 5DMHA 4MA5A 3RH0A 2FPOA 5ALLA 4F06A 2D7DA 3DCNA 4B48A 1DZIA 5CDTA 4OYYA 1WY5A 2YS7A 3RIXA 1XMOB 2KJQA 4BUZA 2H3EA 4KX5A 4WXRA 3RIEA 4QUEA 1H0KA 3DW3X 5LMUB 4G67A 3DFZA 2QRZA 4OJYA 4N1AA 1UXOA 2FGJA 2FU5C 4CIYA 1E5XA 5ILOA 2KW5A 3RHSA 3WK4A 4LHSA 4EUHA 4GEKA 4BAUA 2H1IA 4MV9A 4DR1B 1UKZA 1G38A 4B6QA 4Z1OA 4WJZA 2L2QA 1OXXK 4NOKA 4EHLA 2GUGA 1K0FA 3P8ZA 3WIVA 2JAWA 2QG9A 4UM9D 1I6WA 1K6JA 1L8OA 4XA8A 2XHEA 4RTKA 4PCLA 4RO0A 1A9SA 4UUPA 2X9VA 2ZT5A 2AUMA 3PKZA 3Q98A 2PT9A 3C5VA 4E15A 2W6NA 1EGHA 4WN3A 3BCHA 4OXIA 1IQRA 2RGWA 4F6RB 3ZVNA 3TYXA 1OFUX 1PZXA 4EGQA 3H16A 4QQKA 1JYEA 1ZD5A 3SKYA 2PBFA 4JJGA 3AF0A 4PM4A 3FGZA 5F21A 1K97A 4LVOA 1O95D 3DB1A 1MJFA 2PO5A 1EFLA 1N5DA 1IN6A 3NBQA 1KOLA 4EB6A 2QW1A 1CJMA 1ZCZA 2GNAA 3D64A 4BFWA 1RFGE 1CIJA 2ZSAA 4ESEA 1ONOA 4C4XA 2ZRJA 3HU5A 3RU3A 5K05A 1Z15A 2DHCA 1W8IA 1NF8A 1PJSA 2R60A 1SVSA 3UAVA 4LI3X 1BCSA 2VUHB 4YYEA 5KNCA 2Q49A 4MITA 4R2JA 3GVCA 2PPLA 3LYLA 5JEEA 3HEBA 3LM8A 3IDFA 3R09A 2XNKA 3G0IA 4W8HA 4FYMA 1JEEA 4K40A 3RVPA 4RSGA 5CD9A 1PJRA 2HHCA 3VZQA 2XMPA 2R1TB 3C6QA 4RVOA 4E1VA 2DQZA 3OSZA 1MO4A 3LQ4A 1XXLA 4TX1A 2M6KA 3GROA 1B7GO 3TW0A 4X1KB 3EZFA 2HTEA 3IVGA 1NY6A 3LWNA 3UGJA 2J5BA 5CNMA 4PZZA 1GPDG 3KFXA 2JIBA 4WXMA 4E31A 3MJCA 1NUPA 3FMPB 2DH6A 1G17A 2OAEA 3GMSA 1YJAA 2J0UA 3NDIA 1F06A 3L7CA 3QVWA 4HNRA 4MUKA 1UJ4A 4HZUB 5J9FA 5FI0B 3KYDB 5T4HA 1K7XB 2GRUA 4FEEA 3CEPB 4RY2A 4YCCA 3U13A 1A8HA 1NXWA 1VI5A 4FMCF 4HFNA 4CMJA 2Z5GA 4U39A 1TMYA 5JG7A 1XNRB 2O23A 4ZGBA 4D4HA 3FNRA 3NNDA 3PR3A 4F97A 5A4DA 1FBNA 2WAAA 3FCEA 2JFGA 1P2TA 2J0QA 3I1JA 3VSEA 4RDIA 4YUYA 5EJ6A 1Q3KA 3MJHA 1WE2A 1G2QA 1XX6A 3AKDA 1WUJS 1W6RA 1FSSA 3HLKA 5KNCD 1BKYA 5DHSA 1P17A 2YXBA 3CEJA 3KSRA 3IIJA 4PSAA 3SMVA 5KVCA 3EWNA 1OFHA 2VDLB 1XRQA 3E8XA 3D8RA 4RCYA 2WQZA 4FB4A 2OOSA 5I7FA 1DV1A 3T4XA 1KEWA 1XA0A 3DYVA 4MVJE 5LJIA 1MORA 2VAMA 1YA4A 3RNLA 2J6IA 3QUBA 3V00A 3X2EA 4R40A 1DX9A 1NJ2A 2EW2A 2GBFA 3AC0A 3DTVD 4MRPA 3QELA 1CR6A 1U3TA 1UKVY 2NO5A 3IPAA 421PA 5IT0A 1RVV1 3GT3A 1IB6A 2QPAA 5KYYA 2F59A 1J33A 4BHTA 1D6SA 4TKUA 3MVEA 1TYZA 4AKHA 3R2JA 1KR2A 3GEEA 5IYZB 1XQ9A 1USWA 5EHQA 2M32A 2R6JA 3UKDA 1DOAA 3F90A 1KZHA 3BZUA 2VA8A 2DG2A 4PYMA 1M5UA 1ISIA 4JELA 4NCBA 4O1MA 3JD2A 3WY9A 3GI1A 4DBZA 4LJ6A 5JY6A 3RTBA 1F1JA 2WB2A 3CX8A 3MTDA 5DIZA 3MCTA 3RYFA 1N6PA 4JLDA 4DMHA 3GLSA 5B3JA 1J5XA 2ZE8A 2XUOA 2XZLA 4F38A 3AFIA 1URPA 3LW8A 1GGJA 4CV3A 2ZJ6A 2I1VB 2HQOA 9ABPA 1F8GA 3QG5A 3RAEC 4F2HA 4GQAA 3RFUA 2C5SA 4DABA 2H7XA 3FMIA 3AHGA 4X0EA 4X3PA 3M3HA 2Y71A 5CD1A 5GJVC 3HFSA 2X2EA 1YH3A 2AF3C 2I67A 2VF4X 1QLWA 3ZV5A 3G89A 5DOZA 3CZCA 3DJYA 3L7NA 3TRIA 2CXOA 3TVTA 2Q3HA 3GLTA 4AJ4A 3PNSA 4CT5A 3R7BA 2VRWA 2BBWA 3B2EA 3I9JA 2C78A 3ICOA 3RW9A 5IVIA 1UH5A 4TMZA 3GDWA 8GPBA 3AHHA 2V0GA 5KNDA 1PWYE 4W1SA 3ZU2A 3NVMB 1VDMA 4DEVA 1JRLA 4C0KA 2IS1A 1R3DA 4MR9B 1FMCA 1XEXB 5TV2A 3UXYA 1KRXA 3H6GA 1X38A 5SY6A 3RVJA 3NFRA 1LCIA 3ZHQA 2WMDA 3K0SA 3G2JA 1DWQA 2D54A 1YCHA 5EAIA 1J39A 2FTKE 3RTDA 1OQAA 2VDPB 3JD0A 5AUQA 2IODA 4YP7A 2QY9A 3ZXIA 4DBVO 2H51A 5COBA 4CTJA 1QGUA 3AJRA 4QO7A 2JGJA 3C8UA 4ZCLA 2Q3MA 4BKUA 2TECE 1R6AA 2ALJA 2N0SA 2QR5A 4L9SA 3H2IA 4PAGA 4E5NA 2PYIA 4BNKA 1H2WA 3OTQA 4ITVA 1AZWA 5L6MB 3KPVA 4PZ0A 4BZXA 1L1EA 221PA 4YRCA 3NBYC 4MXDA 3ZDQA 2GILA 2V7QA 3KJQA 3QI2A 1BFKA 3C8MA 2NPIA 3RVNA 1TTPB 4LBVA 2LKCA 4W5NA 1WXQA 3IBFA 3I28A 4C0LA 3X2FA 1EESA 1RHQA 2C0PA 4R1MA 1KEEA 4QDKA 4RZHA 2O2JA 3GPLA 1SELA 1TEVA 4DEYA 5A02A 4LF8B 1B6TA 1NR7A 1ATIA 2FWPA 5IM5A 1GO2A 2WT9A 3PQ7A 4LY0A 5DRTA 3EIXA 3ZCXA 3UH1A 3TTYA 3L84A 1OIXA 3A3NA 3O8NA 4BFXA 5AK4A 4QT0A 1WKBA 1UIMA 1XK6A 3A32A 2IIPA 4TLBA 3AETB 4DCNA 2IYUA 2VUUA 1RNLA 3D0QA 3QZUA 5JPIA 2GNOA 3BFJA 4CF6A 4Q4HA 4IDPA 4Z0TA 5JDIC 4LECA 3WWZA 3U9TA 1WP9A 1YAHA 1GL3A 2NACA 2W43A 3E7DA 1T8SA 5HQJA 3EVAA 3DKPA 4ZC8A 4EJ0A 3IB3A 1CEQA 2XB8A 1K6MA 1NN0A 2H59A 3GT7A 3SZUA 5EXPA 4W4TA 4Z53A 1IJBA 3IRVA 1MQSA 3EC1A 1P5HA 4B32A 5JAPA 2XVZA 3X1KA 4HJXA 1DTEA 3GFFA 3QFRA 4K87A 3EEOA 1JQ5A 1LTHR 1E6UA 4P3YA 3JS5A 2GK3A 4Q19A 3CPHA 3I2JA 5A7FA 3CXRA 3L79A 5B1IA 4IRUB 1MA3A 2JJ2A 3KJNA 1T9HA 1TNDA 1T36A 3N1UA 3UHAA 3EZXA 3F4LA 3OPMA 4A0RA 2UUAB 1SZCA 2WA2A 4JL8A 4GSKA 4R4JA 3EE6A 2GWHA 3CGWA 1XCBA 4AI6A 2VNAA 3V8BA 4G6ZA 1TTHA 3ANYB 5F52A 3REFA 4YNBA 3S55A 4YRIA 4AWBA 3CH7A 1AKYA 4L0MA 1Z4IA 1Z3IX 4L2IB 1K4MA 1F3OA 5LYJB 2JKZA 4S0ZA 3JARB 1J8QA 2YJ3A 4R3UC 3KDAA 4L85A 1V6SA 4RESA 2JL1A 2OECA 1E5LA 4BO5A 5KWIA 4WESB 4P54A 3RBXA 1NUUA 3G7SA 1GL7A 3WYNA 4PLCA 1PLLA 4IUDS 3UAOA 3GQBA 1OWPA 4LOKA 4FSHA 5GTDA 4Y6RA 1RRFA 2FOLA 3NTXA 4UZSA 5FNVF 2GGSA 2QRKA 4DG5A 3EQ6A 3DOJA 1YO6A 2C8LA 3E61A 2QTTA 3AKYA 5BO5A 4BWVA 2Z04A 3BHJA 3DOFA 2O1SA 1B43A 4HGNA 3J80A 4MHSA 3LZ6A 4Q4DA 1FX0A 2M98A 3PLAE 3OOYA 5CVDA 4UNQA 1E98A 3RD5A 3GPIA 4JROA 5I9IA 1U0JA 4TM8A 1A9RA 4I3FA 2J08A 5A4KA 4GR4A 2XD4A 3U3XA 2E0IA 1JEJA 3ESZA 1YULA 3LSTA 1J9ZA 3UCFA 3ACDA 1I7LA 4BMSA 1XXHA 3QKWA 2ZI3A 1ACMA 2P9TA 1F38A 1USKA 1HQYE 3DEFA 1QNLA 3E7WA 4OL0A 4AURA 1JG4A 1DKNA 2YDXA 1HDIA 2QD4A 4G0MA 1Z6QA 4IPTA 5FBRB 2IK8A 4G09A 1P4JA 2OKCA 3S7ZA 1AN0A 3K20A 4PCUA 1SUWA 3L6BA 3QFFA 4PVDA 2PUGA 2BFFB 2RKWA 4HMQA 3TZCA 1ETUA 4BGEA 1TUEA 3D6AA 1UMBA 3MILA 5CCEA 5I7SA 2D7JA 2IEDA 2B7CA 4FT2A 3HB1A 4OAPA 3RUHA 1BHJA 3K70C 1CUFA 1YQDA 4JLMA 1JAIA 1ZM7A 3TIGA 4AO6A 3SJ7A 5E7QA 4C7BA 1G9TA 2PX8A 5BW4A 1ULAA 2AMVA 3WDSA 2JRCA 3EY4A 3W8NA 1UBFA 4UE6A 4F5EA 3CUUA 2CB0A 3G8YA 5L95A 2W98A 1T15A 3GCZA 2D1TA 5ESWA 5EE1A 3WOHA 5EE3A 5CDHA 3HK2A 5GZ1A 1QM5A 2J31A 1YR7A 2OPHA 2BSAA 3UHFA 1DAGA 2UZAA 3KQUA 2OUKA 3NB0A 3QJYA 2VT3A 2ZB4A 3LQQA 5JNWA 3STXA 4AJEA 4XVHA 5JY1A 1GTJ1 4HNQA 5JTTA 4PTZA 4HDRA 2BKLA 2YIJA 4W9NC 2ANCA 2R79A 2ZS8A 3GGSA 3AI7A 5H80A 3RVOA 3VDXA 1ZH0A 1HA3A 4H0NA 3BQNB 1U9CA 2DE0X 3G8CA 5AM0A 1Z35A 2I6TA 3M6VA 4WHMA 1BIFA 2KE5A 1ANKA 3L0PA 3H9JA 3R5SA 4KN6A 5C32A 1X8XA 4QYWA 4YUAA 1YS6A 2PMCA 1JKIA 4DV3B 4B7ZA 2VJAA 3BMNA 2QOEA 1XD9A 2YUTA 3HWX1 4UMVA 5AJUA 4ZU1X 5JH7A 2AFHB 1DFGA 4JUFA 1J24A 4ZAZA 1B4DA 2W9XA 2DVMA 1RQ7A 2FPGA 1U9IC 1M72A 3F67A 4C2AA 1FLAA 2CGEA 2Q6VA 2RI6A 4E22A 4LMPA 4OLHA 5JFGA 2DLDA 3O73A 5FI1B 4C06A 2WKRA 1LA2A 1LPNA 4QOJA 1Z73A 4RQTA 1Y9AA 1XF9A 4TMYA 5BUQA 1L0BA 3DHVA 1U0EA 2R1UA 2HMAA 2W8BB 1FP2A 2VEOA 3C1TA 3C3AA 3OJWA 1L7NA 2YRFA 4YAGA 1SVUA 1CQJA 1HG1A 3N3AC 4RU1A 4YACA 2O3SA 5G0UA 3MWJA 2FSVA 4GI5A 3T5BA 2C7OA 3BF7A 4PYJA 3IPRA 4ARAA 1BCRB 1X7YA 2BL4A 1GLVA 4TWBA 1D2MA 2Z4RA 3GCWA 2VYCA 4FYHA 3T7KA 3PNPA 3U4HA 3DHEA 4DIUA 5BV1A 1MR3F 4YMLA 2QQEA 4HJRA 4OI2A 4JIMA 3OPXA 4I6EA 2G1JA 1D3AA 1GY8A 2NUBA 2WD9A 3PEEA 4MULA 4Q15A 2Z4SA 3G5MA 3IEMA 2IDJA 2C2OA 2PY6A 2ZUCA 2WSSD 5JXIA 3L4BC 4Y6PA 4ZVPA 3MCAA 2VK2A 3NUQA 5TPZD 3AI1A 5DGCA 4ZDKA 2Z9BA 3ND6A 4F9TA 3FUXA 2A4KA 4YUXA 1F6WA 3CHYA 1UMCA 4XWOA 1G20A 1ORTA 1HTTA 1TKRA 1GGFA 2HPVA 1KJWA 3BQMB 3DHNA 4LSZA 4DXAA 1LWNA 3CZ5A 4CU5A 3NCTA 3IO3A 1Z6PA 3NWOA 3L0OA 4UBMA 2KBFA 1HKUA 1GAWA 1H1LA 1IY1A 1TC1A 3CKYA 4CR7A 4L0QA 2PK3A 4E4YA 1N5LA 3E8MA 1HYEA 3CZRA 4JQZA 1AHNA 3EIOA 4HLDA 4EY4A 2BI8A 3A37A 4ARVA 1YIOA 4WK6A 4HC4A 1R0SA 2P4EA 1WDKA 2XPCA 3DM5A 4ARZB 4HB3A 1DDOA 5C8YA 2XDQA 1O0CA 1PJ8A 3G02A 4OIFA 4LJSA 3RGWS 2HA6A 3T7TA 5EQDA 3HCWA 3TE7A 3I2IA 1UDCA 1U0NA 2O8NA 3WDLA 2BTQB 3CRZA 4ER3A 1Y3IA 1WULS 5J2TB 3EGEA 4OSOA 1QO0A 3N0VA 4Z3OA 2CWDA 4QRDA 1AUOA 2FFJA 4EYKA 5EZYF 3QVSA 2WSSA 1CY2A 5KTRA 2RB4A 4M1WA 5DVZA 3P4UA 3UWDA 3SF8A 1AUXA 1XVUA 1ZHHA 3I42A 2DKFA 3PNKA 3SBDA 2IP4A 3IDOA 4DR7B 1SUEA 3K0KA 1A5ZA 4IKPA 4BIMA 1KL7A 2JA2A 2X5XA 1YZYA 1M6VB 4HWKA 1WA5A 4EO7A 1Z4KA 4OXQA 3DMTA 2QB5A 4NICA 5ITZB 2B4AA 3L0CA 5AJHA 3C2QA 2ZIXB 3CXUA 4B43A 4J0GA 4NI5A 3E9YA 4PG6A 5AHXA 3VBEA 5FOQA 4J2HA 4KO1S 3IKJA 3QOXA 4A8TA 5TC4A 4EFDA 2JI8A 2P5TB 3AVPA 1TTQB 2GJSA 4FDLA 1JALA 2B7LA 3S68A 1QO7A 3WMFA 1L4BA 3CVYA 2I9KA 4JENA 1W1UA 3C97A 3IBSA 2CE7A 3TUJC 1NXSA 4K6MA 5J43A 3HG7A 1JEAA 3A27A 2PTHA 4QYIB 1MZPA 2FV8A 4FIZA 1TZ2A 2MYUA 5BVGA 5LXTA 2ZSUA 4OQEA 2YWGA 1Z13A 5KQPA 2HAEA 2P6MA 2ZQZA 5B5SA 3VC3A 3TEFA 3IO5A 4DLXA 5F4ZA 2C83A 3GNTA 1WB6A 1ZL2A 2Z6UA 3OAAD 4HQ6A 1GG8A 2OAQ1 4EPTA 3PJRA 1HTBA 2VAVA 3H2YA 5L7YA 1C3XA 5B55A 3NBKA 5KEIA 2H06A 3R75A 5L7TA 3QIAA 3I3OA 3R6LA 1AD2A 2GN0A 2NZJA 5IUKC 5HJ7A 1WCWA 3HCNA 4BQNA 1OTHA 1ZC3A 2WJHA 1YS7A 1JDBC 1NT4A 1XRPA 2AYYA 2IEBA 2RGGA 2VQSA 2YTZA 1GUBA 3IHKA 3K0AA 3HZRA 3M5WA 1H3FA 1CHNA 3DMRA 4EEZA 1BDIA 4HAUA 4URFA 3W7AA 4PZEA 3RUEA 3PNOA 4IS3A 1ECCA 1JQ3A 4F84A 4GNRA 1II8B 4WZAA 4EUFA 2HFJA 2ZVJA 2NVWA 5JQGA 2AOUB 2JZCA 3GIWA 4CKEA 1Z5NA 2POQX 3KTFA 1DC3A 2WJWA 3BSYA 3PTLA 2QZPA 2VYFA 3QVKA 3VPGA 1E1RD 3WGNA 5JS6A 5KU1A 2ZKIA 2VSXA 3KUCA 2DRIA 2DHQA 3CURA 4NBRA 3M0EA 3ZXXA 4BMDA 2DBYA 5C5IA 1BEUB 1YWGO 1G4AE 3AF5A 4ABTA 1Z63A 4NNPA 4D3XA 2GLTA 4EG3A 1F8FA 4TN5A 4RDXA 1KI2A 1TM1E 4ZVMA 2QP4A 3MBOA 4KAJA 4CLDA 1ODLA 4TLDA 5KTMA 1E2LA 3FCAA 2HA5A 4Q7EA 5CXXA 1H2XA 4R2WA 3WFJA 4YRRA 5JW6A 3HVHA 4ZYXA 1HPLA 4DG8A 5LJLA 2FZCA 1B0PA 3GFOA 1Z39A 1XTQA 3IEUA 5AWFC 2QR2A 2CCJA 1NWCA 2ZKLA 4RDCA 3TR0A 4DA8A 5K01A 2FUEA 4V1CI 1KJZA 3JWEA 4HDMA 3ORYA 4TSRA 4X6UA 1Y1QA 1EP3B 3H13A 4PX5A 5BSFA 4LDQA 4BZWA 3B2NA 2OL4A 2JJMA 4UU8A 4EUKA 1AB5A 3ZY2A 3KQHA 3P4XA 4JR0A 2YCLA 1U3DA 4QOHA 3GLGE 1TA0A 1I51A 1M1YE 2ARKA 5L3SB 1UDAA 2VRCA 4ZOAA 1TD1A 3GEHA 1PX2A 1ZPDA 2K2QB 2CDAA 5C1BA 1MFPA 3F8WA 2WKQA 2I03A 3MUNA 4FBLA 4AZWA 1TQ4A 1X9GA 4RDHA 3PGLA 3G0OA 4LW8A 4YVFA 3TIVA 3T3OA 1OH5A 2W70A 1IHPA 1NKSA 1U81A 2NXWA 4MLPA 1MAAA 1VE1A 1J1IA 2BFWA 1ULHA 2GARA 3DZFA 4KR9A 4CM4A 1PR1A 3O82A 4OB8A 3T5MA 2J85A 2BKAA 5CG2A 5CX1B 5JFOA 2BM1A 5THKA 1O0SA 4XWWA 3PC6A 1CQJB 1C9KA 2DX7A 4BX9A 4CE6A 2V59A 3I6ZA 3SDZA 3ZY6A 2X14A 1FEZA 1R0XA 4R41A 1BCRA 1X7YB 1W2WB 5C7OO 4ZEWA 5CXQA 2VEDA 4WXHA 4Y1RA 2HDNB 1SCKA 3ZLVA 2GEJA 2ZR0A 2R1ZA