4D48A

Crystal structure of glucose-1-phosphate uridylyltransferase galu from erwinia amylovora.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
294
structure length
284
Chain Sequence
NSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLVTHSSKNSIENHFDTSFELEAMLERQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVMCAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIRRFDETGHSQIMVEPVADVTAYGVVDCQGAQLNPGDSAPMVGVVEKPKADQAPSNLAVVGRYVLSADIWPLLAKTPIQLTDSIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLESAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
publication title Glucose-1-phosphate uridylyltransferase from Erwinia amylovora: Activity, structure and substrate specificity.
pubmed doi rcsb
source organism Erwinia amylovora
molecule tags Transferase
total genus 78
structure length 284
sequence length 294
chains with identical sequence B
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4d48A00
1H7FA 2XWNA 1JVGA 3SXCA 1R7YA 4HOCA 2V0KA 2VS3A 1H4CA 4ECMA 1G93A 2NXVA 1FZWA 1H7GA 3DK5A 2Z86A 2AM4A 4ARWA 5CMIA 2APCA 3QVBA 4KRVA 4M28A 4B5BA 3V0NA 4KNXA 4B2XA 1I52A 1ON6A 5I1FA 1VZUA 2RITA 1JYLA 2E3DA 3D5NA 4Y6NA 2WEEA 1ZJ1A 1LZ7A 4HO2A 5FU8A 1XZ6A 4FRBA 3SXBA 3ZF8A 4HO9A 2JCOA 1W77A 1ZIZA 4AYJA 2A8WA 2VSIA 2D7IA 2Y7AA 4NAKA 2AECA 4Y7UA 1QWJA 2ZU7A 1EZIA 1ON8A 1ZCUA 4EE4A 2YCMA 5C1GA 3USQA 2XWLA 1VH1A 2VXMA 2RIXA 1GA8A 4IRPA 1ZJ3A 2V0IA 4Y63A 2P72A 1JVDA 4EEMA 3HL3A 2BO7A 1FXOA 2RJ0A 1LZJA 4HG6A 5C48A 5C49A 2X5SA 5DDVA 1ZJ2A 1ZHJA 4CVHA 4DDZA 5C4DA 1ZJOA 1IIMA 1LZ0A 1KWSA 2RIYA 5L6SA 2GGOA 5AJNA 4CJ8A 2P73A 4B42A 1W55A 2RIZA 4Y62A 5FU0A 4LW3A 1IINA 3V0QA 5L6VA 3I0LA 2RJ4A 3E26A 1WSZA 4Y7FA 3OKRA 5BXCA 1LL2A 1TZFA 1R7VA 2O1HA 4FCUA 2Y4JA 1VGTA 1WT1A 2JCJA 1MC3A 4D11A 2RJ7A 1SS9A 4E1KA 1WT2A 4GBPA 2QGIA 4G3SA 3F1YA 2VSHA 1H7QA 1QGQA 3U2XA 1ZCTA 4K6RA 5C3DA 3V0OA 1PZTA 2BO6A 2YQCA 2WVLA 4HO3A 4FRHA 4Y7TA 4D11C 1OMXA 5C1HA 4KPXA 4P00A 1FWYA 1H5TA 4BQHA 3DUVA 4D0ZA 4Y9XA 3V0MA 3IOHA 2I5EA 3D98A 1TVYA 5C3AA 1FXJA 1EYRA 1R81A 3I0DA 3BCVA 3JTJA 4JD0A 3TZTA 4JISA 1GQCA 4EEOA 2AGDA 1O7OA 1V83A 1GX4A 4R7PA 4ASJA 3POLA 5CQOA 1HV9A 1S4OA 3I0HA 1FGXA 3R2WA 3OH1A 1R7UA 2V0HA 3V0PA 1S4PA 1VPAA 3I0CA 2FYDB 4KXOA 4KC2A 2GGQA 1LZIA 3T7MA 4P02A 4Y64A 2Y6PA 2JCKA 1O7QA 1G3LA 2OI5A 3OAMA 2I5KA 3RSBA 4KT7A 2AM3A 3R3IA 4G87A 1H5RB 1VGWA 3KIAA 3OH4A 1R7TA 2YQJA 2WAWA 2VS5A 4NAIA 5CMJA 1G1LA 4FRPA 1G9RA 4FRQA 3CU0A 2VS4A 5CMFX 1H3MA 1V84A 2E8BA 4LW6A 5EIYA 4FQWA 4FRAA 4KC4A 2RJ6A 2ICYA 2YQSA 4EE5A 5AJPA 5CQPA 4CJBA 1JV3A 2YC3A 3U0YA 3Q4SA 4M4KA 4Y7GA 1ZJPA 3LW6A 3SXAA 3I0KA 4J18A 1INJA 1ZI4A 2P6WA 5AJOA 3I0FA 3OGZA 4B4MA 1NHEB 1NMMB 2QH5A 3OH2A 1W57A 2FFVA 1H5TB 4KC1A 2VFZA 1WT0A 4B2WA 1H5RA 3N9WA 1FRWA 3U2UA 2RJ5A 3V90A 4AAWA 2AE7A 3U2VA 5FV9A 4IRQA 2D0JA 3ST8A 5C38A 5IFYA 1VZTA 1R82A 3GUEA 3SX5A 3E25A 3SX8A 3U2TA 5EJZA 3I0EA 2VXLA 1QG8A 2RJ8A 3CKJA 3V8YA 1O23B 1H5SB 1MP3A 4HO6A 1FO9A 4L41C 3K8EA 1R80A 3U2WA 4BMAA 2JCLA 3CKVA 3FOQA 4KNRA 1ZI5A 2WVMA 2FYBA 2X65A 4G3PA 2OEFA 3OC9A 5IDTA 5J49A 4D48A 2Y4MA 3V0LA 1NF5B 1WVCA 4CJCA 3O3PA 2V0LA 1TW1A 1ZCYA 3BRKX 2ICXA 3RMVA 2Y4KA 4FRLA 2ZU9A 1TW5A 2I7BA 2VD4A 3I0GA 2XMEA 1K4VA 1LL0A 1ZDGA 5CQNX 1GX0A 1YROB 2UX8A 1FR9A 4M2AA 2Q4JA 1O0RA 4XWIA 2QKXA 1GWWA 4UEGA 3JUKA 1LVWA 4FREA 5EJ1A 2FFUA 4MYBA 1OQMB 5C4CA 1VGZA 1VZXA 1H5SA 3PKPA 5FUHA 3IOIA 2XWMA 3Q80A 2AESA 1H4DA 1HM8A 4FROA 3SXGA 4HCQA 4NANA 4EEAA 5C8RA 1FOAA 3PKQA 1XHBA 1H7EA 2X5ZA 1V82A 2BO8A 3IOJA 5C4BA 3D8VA 2X60A 1H5SC 3FWWA 1WT3A 2OEGA 2A8UA 2OI7A 2PGYA 2WGZA 2PA4A 5C1LA 2FYAA 3F1CA 1YP2A 1H7LA 1H7HA 4MNDA 1FO8A 4EEGA 1LL3A 3I0IX 4Y6UA 2W0VA 3V91A 1HM9A 4DE7A 4NALA 3SX7A 1MP5A 1HM0A 1INIA 3ZLLA 4B4GA 3EE5A 4AYLA 2YQHA 2OI6A 2YESA 1HJLA 1FGGA 2YC5A 3ZGGA 4ASYA 2FY7A 1ZJ0A 3RMWA 1NWGB 5CQLX 1NKHB 3CKOA 5C47A 1R7XA 1VGUA 3OH3A 1G95A 1JYKA 2W0WA 3PNNA 2ZU8A 3U0XA 1G0RA 2XMHA 4HO8A 5FTVA 4HO4A 2O1FA 1NQIB 5IDSA 2PX7A 4KQLA 2BO4A 1JV1A 1YP3A 3K8DA 1OMZA 1S4NA 1QGSA 5DDTA 5C4FA 1VICA 4KPZA 3Q7UA 2CU2A 1YP4A 4ZDQA 1PZYB 1HJJA 1GQ9A 5FYEA 4EVWA 4FCEA 5C3BA 1GWVA 2V0JA 3OH0A 4D0TA 3SXDA 4M2BA 1FR8A 1G2VA 4FRDA 1G23A 2DPWA 1VM8A 4FRMA 1ZI3A 1H4EA 1E5KA 1MP4A 5CQMX 4C2SA 3T7OA 3CKNA 2D7RA 3CGXA 2Z87A 2AH9A 2WE9A 5FTSA 3TQDA 4G3QA 3USRA 1G97A 4AC3A 1H7TA 1ZDFA 2RJ1A 3SXEA 2O1GA 3DJ4A 4DECA 1H5SD 4B4BA 3SX3A 1ZCVA 2WVKA 5HS2A 4EE3A 4HO5A 2MZBA 1VH3A 1FG5N 2PGVA 3CKQA 3I0JA 1Z90A 5CMGX 3V8ZA 4YS8A 2Y4LA 4HO0A 3T7NA 1G8OA 5C4EA 5CMHA 3SPTA 3ZLKA 2FYCB 2AM5A 2RJ9A 3ZGFA 3NGWA 4Y7VA 5JQQA 5C36A 4B3UA 3JUJA 1ZI1A
chains in the Genus database with same CATH superfamily
1H7FA 2XWNA 1JVGA 3SXCA 1R7YA 4HOCA 2V0KA 2VS3A 1H4CA 4ECMA 1G93A 2NXVA 1FZWA 1H7GA 3DK5A 2Z86A 2AM4A 4ARWA 5CMIA 2APCA 3QVBA 4KRVA 4M28A 4B5BA 3V0NA 4KNXA 4B2XA 1I52A 1ON6A 5I1FA 1VZUA 2RITA 1JYLA 2E3DA 3D5NA 4Y6NA 2WEEA 1ZJ1A 1LZ7A 4HO2A 5FU8A 1XZ6A 4FRBA 3SXBA 3ZF8A 4HO9A 2JCOA 1W77A 1ZIZA 4AYJA 2A8WA 2VSIA 2D7IA 2Y7AA 4NAKA 2AECA 4Y7UA 1QWJA 2ZU7A 1EZIA 1ON8A 1ZCUA 4EE4A 2YCMA 5C1GA 3USQA 2XWLA 1VH1A 2VXMA 2RIXA 1GA8A 4IRPA 1ZJ3A 2V0IA 4Y63A 2P72A 1JVDA 4EEMA 3HL3A 2BO7A 1FXOA 2RJ0A 1LZJA 4HG6A 5C48A 5C49A 2X5SA 5DDVA 1ZJ2A 1ZHJA 4CVHA 4DDZA 5C4DA 1ZJOA 1IIMA 1LZ0A 1KWSA 2RIYA 5L6SA 2GGOA 5AJNA 4CJ8A 2P73A 4B42A 1W55A 2RIZA 4Y62A 5FU0A 4LW3A 1IINA 3V0QA 5L6VA 3I0LA 2RJ4A 3E26A 1WSZA 4Y7FA 3OKRA 5BXCA 1LL2A 1TZFA 1R7VA 2O1HA 4FCUA 2Y4JA 1VGTA 1WT1A 2JCJA 1MC3A 4D11A 2RJ7A 1SS9A 4FIYA 4E1KA 1WT2A 4GBPA 2QGIA 4G3SA 3F1YA 2VSHA 1H7QA 1QGQA 3U2XA 1ZCTA 4K6RA 5C3DA 3V0OA 1PZTA 2BO6A 2YQCA 2WVLA 4HO3A 4FRHA 4Y7TA 4D11C 1OMXA 2J0BA 5C1HA 4KPXA 4P00A 1FWYA 1H5TA 4BQHA 3DUVA 4FIXA 4D0ZA 4Y9XA 3V0MA 3IOHA 2I5EA 2C0NA 3D98A 1TVYA 5C3AA 1FXJA 1EYRA 1R81A 3I0DA 3BCVA 3JTJA 4JD0A 3TZTA 4JISA 1GQCA 4EEOA 2AGDA 1O7OA 1V83A 1GX4A 4R7PA 4ASJA 3POLA 5CQOA 1HV9A 1S4OA 3I0HA 1FGXA 3R2WA 3OH1A 1R7UA 2V0HA 3V0PA 1S4PA 1VPAA 3I0CA 2FYDB 4KXOA 4KC2A 2GGQA 1LZIA 3T7MA 4P02A 4Y64A 2Y6PA 2JCKA 1O7QA 1G3LA 2OI5A 3OAMA 2I5KA 3RSBA 4KT7A 2AM3A 3R3IA 4G87A 1H5RB 1VGWA 3KIAA 3OH4A 1R7TA 2YQJA 2WAWA 2VS5A 4NAIA 5CMJA 1G1LA 4FRPA 1G9RA 4MIXA 4FRQA 3CU0A 2VS4A 5CMFX 1H3MA 1V84A 2E8BA 2VK9A 4LW6A 5EIYA 4FQWA 4FRAA 4KC4A 2RJ6A 2ICYA 2YQSA 4EE5A 5AJPA 5CQPA 4CJBA 1JV3A 2YC3A 3U0YA 3Q4SA 4M4KA 4Y7GA 1ZJPA 3LW6A 3SXAA 3I0KA 4J18A 1INJA 1ZI4A 2P6WA 5AJOA 3I0FA 3OGZA 4B4MA 1NHEB 1NMMB 2QH5A 3OH2A 1W57A 2FFVA 1H5TB 4KC1A 2VFZA 1WT0A 4B2WA 1H5RA 3N9WA 1FRWA 3U2UA 2RJ5A 3V90A 4AAWA 2AE7A 3U2VA 2J0AA 5FV9A 4IRQA 2D0JA 5D91A 3ST8A 5C38A 5IFYA 1VZTA 1R82A 3GUEA 3SX5A 3E25A 3SX8A 3U2TA 5EJZA 3I0EA 2VXLA 1QG8A 2RJ8A 3CKJA 3V8YA 1O23B 1H5SB 1MP3A 4HO6A 1FO9A 4L41C 3K8EA 1R80A 3U2WA 4BMAA 2JCLA 3CKVA 3FOQA 4KNRA 1ZI5A 2WVMA 2FYBA 2X65A 4G3PA 2OEFA 3OC9A 5IDTA 5J49A 4D48A 2Y4MA 3V0LA 1NF5B 1WVCA 4CJCA 3O3PA 2V0LA 1TW1A 1ZCYA 3BRKX 2ICXA 3RMVA 2Y4KA 4FRLA 2ZU9A 1TW5A 2I7BA 2VD4A 4O6NA 3I0GA 2XMEA 1K4VA 1LL0A 1ZDGA 5CQNX 1GX0A 1YROB 2UX8A 1FR9A 4M2AA 2Q4JA 1O0RA 4XWIA 2QKXA 1GWWA 4UEGA 3JUKA 1LVWA 4FREA 5EJ1A 2FFUA 4MYBA 1OQMB 5C4CA 1VGZA 1VZXA 1H5SA 3PKPA 5FUHA 3IOIA 2XWMA 3Q80A 2AESA 1H4DA 1HM8A 4FROA 3SXGA 4HCQA 4NANA 4EEAA 5C8RA 1FOAA 3PKQA 1XHBA 1H7EA 2X5ZA 1V82A 2BO8A 3IOJA 5C4BA 3D8VA 2X60A 1H5SC 3FWWA 1WT3A 2OEGA 2A8UA 2OI7A 2PGYA 2WGZA 2PA4A 5C1LA 2FYAA 3F1CA 1YP2A 1H7LA 1H7HA 4MNDA 1FO8A 4EEGA 1LL3A 3I0IX 4Y6UA 2W0VA 3V91A 1HM9A 4DE7A 4NALA 3SX7A 1MP5A 1HM0A 1INIA 3ZLLA 4B4GA 3EE5A 4AYLA 2YQHA 2OI6A 2YESA 1HJLA 1FGGA 2YC5A 4Q7CA 3ZGGA 4ASYA 2FY7A 1ZJ0A 3RMWA 1NWGB 5CQLX 1NKHB 3CKOA 5C47A 1R7XA 1VGUA 3OH3A 1G95A 1JYKA 2W0WA 3PNNA 2ZU8A 3U0XA 1G0RA 2XMHA 4HO8A 5FTVA 4HO4A 2O1FA 1NQIB 5IDSA 2PX7A 4KQLA 2BO4A 1JV1A 1YP3A 3K8DA 1OMZA 1S4NA 1QGSA 5DDTA 5C4FA 1VICA 4KPZA 3Q7UA 2CU2A 1YP4A 4ZDQA 1PZYB 1HJJA 1GQ9A 5FYEA 4EVWA 4FCEA 5C3BA 1GWVA 2V0JA 3OH0A 4D0TA 3SXDA 4M2BA 1FR8A 1G2VA 4FRDA 1G23A 5D92A 2DPWA 1VM8A 4FRMA 1ZI3A 1H4EA 1E5KA 1MP4A 5CQMX 4C2SA 3T7OA 3CKNA 2D7RA 3CGXA 2Z87A 2AH9A 2WE9A 5FTSA 3TQDA 4G3QA 3USRA 1G97A 4AC3A 1H7TA 1ZDFA 2RJ1A 3SXEA 2O1GA 3DJ4A 4DECA 1H5SD 4B4BA 3SX3A 1ZCVA 2WVKA 5HS2A 4EE3A 4HO5A 2MZBA 1VH3A 1FG5N 2PGVA 3CKQA 3I0JA 1Z90A 5CMGX 3V8ZA 4YS8A 2Y4LA 4HO0A 4O6MA 3T7NA 1G8OA 5C4EA 5CMHA 3SPTA 3ZLKA 2FYCB 2AM5A 2RJ9A 3ZGFA 3NGWA 4Y7VA 5JQQA 5C36A 4B3UA 3JUJA 1ZI1A
chains in the Genus database with same CATH topology
1H7FA 2XWNA 1JVGA 3SXCA 1R7YA 4HOCA 2V0KA 2VS3A 1H4CA 4ECMA 1G93A 2NXVA 1FZWA 1H7GA 3DK5A 2Z86A 2AM4A 4ARWA 5CMIA 2APCA 3QVBA 4KRVA 4M28A 4B5BA 3V0NA 4KNXA 4B2XA 1I52A 1ON6A 5I1FA 1VZUA 2RITA 1JYLA 2E3DA 3D5NA 4Y6NA 2WEEA 1ZJ1A 1LZ7A 4HO2A 5FU8A 1XZ6A 4FRBA 3SXBA 3ZF8A 4HO9A 2JCOA 1W77A 1ZIZA 4AYJA 2A8WA 2VSIA 2D7IA 2Y7AA 4NAKA 2AECA 4Y7UA 1QWJA 2ZU7A 1EZIA 1ON8A 1ZCUA 4EE4A 2YCMA 5C1GA 3USQA 2XWLA 1VH1A 2VXMA 2RIXA 1GA8A 4IRPA 1ZJ3A 2V0IA 4Y63A 2P72A 1JVDA 4EEMA 3HL3A 2BO7A 1FXOA 2RJ0A 1LZJA 4HG6A 5C48A 5C49A 2X5SA 5DDVA 1ZJ2A 1ZHJA 4CVHA 4DDZA 5C4DA 1ZJOA 1IIMA 1LZ0A 1KWSA 2RIYA 5L6SA 2GGOA 5AJNA 4CJ8A 2P73A 4B42A 1W55A 2RIZA 4Y62A 5FU0A 4LW3A 1IINA 3V0QA 5L6VA 3I0LA 2RJ4A 3E26A 1WSZA 4Y7FA 3OKRA 5BXCA 1LL2A 1TZFA 1R7VA 2O1HA 4FCUA 2Y4JA 1VGTA 1WT1A 2JCJA 1MC3A 4D11A 2RJ7A 1SS9A 4FIYA 4E1KA 1WT2A 4GBPA 2QGIA 4G3SA 3F1YA 2VSHA 1H7QA 1QGQA 3U2XA 1ZCTA 4K6RA 5C3DA 3V0OA 1PZTA 2BO6A 2YQCA 2WVLA 4HO3A 4FRHA 4Y7TA 4D11C 1OMXA 2J0BA 5C1HA 4KPXA 4P00A 1FWYA 1H5TA 4BQHA 3DUVA 4FIXA 4D0ZA 4Y9XA 3V0MA 3IOHA 2I5EA 2C0NA 3D98A 1TVYA 5C3AA 1FXJA 1EYRA 1R81A 3I0DA 3BCVA 3JTJA 4JD0A 3TZTA 4JISA 1GQCA 4EEOA 2AGDA 1O7OA 1V83A 1GX4A 4R7PA 4ASJA 3POLA 5CQOA 1HV9A 1S4OA 3I0HA 1FGXA 3R2WA 3OH1A 1R7UA 2V0HA 3V0PA 1S4PA 1VPAA 3I0CA 2FYDB 4KXOA 4KC2A 2GGQA 1LZIA 3T7MA 4P02A 4Y64A 2Y6PA 2JCKA 1O7QA 1G3LA 2OI5A 3OAMA 2I5KA 3RSBA 4KT7A 2AM3A 3R3IA 4G87A 1H5RB 1VGWA 3KIAA 3OH4A 1R7TA 2YQJA 2WAWA 2VS5A 4NAIA 5CMJA 1G1LA 4FRPA 1G9RA 4MIXA 4FRQA 3CU0A 2VS4A 5CMFX 1H3MA 1V84A 2E8BA 2VK9A 4LW6A 5EIYA 4FQWA 4FRAA 4KC4A 2RJ6A 2ICYA 2YQSA 4EE5A 5AJPA 5CQPA 4CJBA 1JV3A 2YC3A 3U0YA 3Q4SA 4M4KA 4Y7GA 1ZJPA 3LW6A 3SXAA 3I0KA 4J18A 1INJA 1ZI4A 2P6WA 5AJOA 3I0FA 3OGZA 4B4MA 1NHEB 1NMMB 2QH5A 3OH2A 1W57A 2FFVA 1H5TB 4KC1A 2VFZA 1WT0A 4B2WA 1H5RA 3N9WA 1FRWA 3U2UA 2RJ5A 3V90A 4AAWA 2AE7A 3U2VA 2J0AA 5FV9A 4IRQA 2D0JA 5D91A 3ST8A 5C38A 5IFYA 1VZTA 1R82A 3GUEA 3SX5A 3E25A 3SX8A 3U2TA 5EJZA 3I0EA 2VXLA 1QG8A 2RJ8A 3CKJA 3V8YA 1O23B 1H5SB 1MP3A 4HO6A 1FO9A 4L41C 3K8EA 1R80A 3U2WA 4BMAA 2JCLA 3CKVA 3FOQA 4KNRA 1ZI5A 2WVMA 2FYBA 2X65A 4G3PA 2OEFA 3OC9A 5IDTA 5J49A 4D48A 2Y4MA 3V0LA 1NF5B 1WVCA 4CJCA 3O3PA 2V0LA 1TW1A 1ZCYA 3BRKX 2ICXA 3RMVA 2Y4KA 4FRLA 2ZU9A 1TW5A 2I7BA 2VD4A 4O6NA 3I0GA 2XMEA 1K4VA 1LL0A 1ZDGA 5CQNX 1GX0A 1YROB 2UX8A 1FR9A 4M2AA 2Q4JA 1O0RA 4XWIA 2QKXA 1GWWA 4UEGA 3JUKA 1LVWA 4FREA 5EJ1A 2FFUA 4MYBA 1OQMB 5C4CA 1VGZA 1VZXA 1H5SA 3PKPA 5FUHA 3IOIA 2XWMA 3Q80A 2AESA 1H4DA 1HM8A 4FROA 3SXGA 4HCQA 4NANA 4EEAA 5C8RA 1FOAA 3PKQA 1XHBA 1H7EA 2X5ZA 1V82A 2BO8A 3IOJA 5C4BA 3D8VA 2X60A 1H5SC 3FWWA 1WT3A 2OEGA 2A8UA 2OI7A 2PGYA 2WGZA 2PA4A 5C1LA 2FYAA 3F1CA 1YP2A 1H7LA 1H7HA 4MNDA 1FO8A 4EEGA 1LL3A 3I0IX 4Y6UA 2W0VA 3V91A 1HM9A 4DE7A 4NALA 3SX7A 1MP5A 1HM0A 1INIA 3ZLLA 4B4GA 3EE5A 4AYLA 2YQHA 2OI6A 2YESA 1HJLA 1FGGA 2YC5A 4Q7CA 3ZGGA 4ASYA 2FY7A 1ZJ0A 3RMWA 1NWGB 5CQLX 1NKHB 3CKOA 5C47A 1R7XA 1VGUA 3OH3A 1G95A 1JYKA 2W0WA 3PNNA 2ZU8A 3U0XA 1G0RA 2XMHA 4HO8A 5FTVA 4HO4A 2O1FA 1NQIB 5IDSA 2PX7A 4KQLA 2BO4A 1JV1A 1YP3A 3K8DA 1OMZA 1S4NA 1QGSA 5DDTA 5C4FA 1VICA 4KPZA 3Q7UA 2CU2A 1YP4A 4ZDQA 1PZYB 1HJJA 1GQ9A 5FYEA 4EVWA 4FCEA 5C3BA 1GWVA 2V0JA 3OH0A 4D0TA 3SXDA 4M2BA 1FR8A 1G2VA 4FRDA 1G23A 5D92A 2DPWA 1VM8A 4FRMA 1ZI3A 1H4EA 1E5KA 1MP4A 5CQMX 4C2SA 3T7OA 3CKNA 2D7RA 3CGXA 2Z87A 2AH9A 2WE9A 5FTSA 3TQDA 4G3QA 3USRA 1G97A 4AC3A 1H7TA 1ZDFA 2RJ1A 3SXEA 2O1GA 3DJ4A 4DECA 1H5SD 4B4BA 3SX3A 1ZCVA 2WVKA 5HS2A 4EE3A 4HO5A 2MZBA 1VH3A 1FG5N 2PGVA 3CKQA 3I0JA 1Z90A 5CMGX 3V8ZA 4YS8A 2Y4LA 4HO0A 4O6MA 3T7NA 1G8OA 5C4EA 5CMHA 3SPTA 3ZLKA 2FYCB 2AM5A 2RJ9A 3ZGFA 3NGWA 4Y7VA 5JQQA 5C36A 4B3UA 3JUJA 1ZI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7F A;  2XWN A;  1JVG A;  3SXC A;  1R7Y A;  4HOC A;  2V0K A;  2VS3 A;  1H4C A;  4ECM A;  1G93 A;  2NXV A;  1FZW A;  1H7G A;  3DK5 A;  2Z86 A;  2AM4 A;  4ARW A;  5CMI A;  2APC A;  3QVB A;  4KRV A;  4M28 A;  4B5B A;  3V0N A;  4KNX A;  4B2X A;  1I52 A;  1ON6 A;  5I1F A;  1VZU A;  2RIT A;  1JYL A;  2E3D A;  3D5N A;  4Y6N A;  2WEE A;  1ZJ1 A;  1LZ7 A;  4HO2 A;  5FU8 A;  1XZ6 A;  4FRB A;  3SXB A;  3ZF8 A;  4HO9 A;  2JCO A;  1W77 A;  1ZIZ A;  4AYJ A;  2A8W A;  2VSI A;  2D7I A;  2Y7A A;  4NAK A;  2AEC A;  4Y7U A;  1QWJ A;  2ZU7 A;  1EZI A;  1ON8 A;  1ZCU A;  4EE4 A;  2YCM A;  5C1G A;  3USQ A;  2XWL A;  1VH1 A;  2VXM A;  2RIX A;  1GA8 A;  4IRP A;  1ZJ3 A;  2V0I A;  4Y63 A;  2P72 A;  1JVD A;  4EEM A;  3HL3 A;  2BO7 A;  1FXO A;  2RJ0 A;  1LZJ A;  4HG6 A;  5C48 A;  5C49 A;  2X5S A;  5DDV A;  1ZJ2 A;  1ZHJ A;  4CVH A;  4DDZ A;  5C4D A;  1ZJO A;  1IIM A;  1LZ0 A;  1KWS A;  2RIY A;  5L6S A;  2GGO A;  5AJN A;  4CJ8 A;  2P73 A;  4B42 A;  1W55 A;  2RIZ A;  4Y62 A;  5FU0 A;  4LW3 A;  1IIN A;  3V0Q A;  5L6V A;  3I0L A;  2RJ4 A;  3E26 A;  1WSZ A;  4Y7F A;  3OKR A;  5BXC A;  1LL2 A;  1TZF A;  1R7V A;  2O1H A;  4FCU A;  2Y4J A;  1VGT A;  1WT1 A;  2JCJ A;  1MC3 A;  4D11 A;  2RJ7 A;  1SS9 A;  4E1K A;  1WT2 A;  4GBP A;  2QGI A;  4G3S A;  3F1Y A;  2VSH A;  1H7Q A;  1QGQ A;  3U2X A;  1ZCT A;  4K6R A;  5C3D A;  3V0O A;  1PZT A;  2BO6 A;  2YQC A;  2WVL A;  4HO3 A;  4FRH A;  4Y7T A;  4D11 C;  1OMX A;  5C1H A;  4KPX A;  4P00 A;  1FWY A;  1H5T A;  4BQH A;  3DUV A;  4D0Z A;  4Y9X A;  3V0M A;  3IOH A;  2I5E A;  3D98 A;  1TVY A;  5C3A A;  1FXJ A;  1EYR A;  1R81 A;  3I0D A;  3BCV A;  3JTJ A;  4JD0 A;  3TZT A;  4JIS A;  1GQC A;  4EEO A;  2AGD A;  1O7O A;  1V83 A;  1GX4 A;  4R7P A;  4ASJ A;  3POL A;  5CQO A;  1HV9 A;  1S4O A;  3I0H A;  1FGX A;  3R2W A;  3OH1 A;  1R7U A;  2V0H A;  3V0P A;  1S4P A;  1VPA A;  3I0C A;  2FYD B;  4KXO A;  4KC2 A;  2GGQ A;  1LZI A;  3T7M A;  4P02 A;  4Y64 A;  2Y6P A;  2JCK A;  1O7Q A;  1G3L A;  2OI5 A;  3OAM A;  2I5K A;  3RSB A;  4KT7 A;  2AM3 A;  3R3I A;  4G87 A;  1H5R B;  1VGW A;  3KIA A;  3OH4 A;  1R7T A;  2YQJ A;  2WAW A;  2VS5 A;  4NAI A;  5CMJ A;  1G1L A;  4FRP A;  1G9R A;  4FRQ A;  3CU0 A;  2VS4 A;  5CMF X;  1H3M A;  1V84 A;  2E8B A;  4LW6 A;  5EIY A;  4FQW A;  4FRA A;  4KC4 A;  2RJ6 A;  2ICY A;  2YQS A;  4EE5 A;  5AJP A;  5CQP A;  4CJB A;  1JV3 A;  2YC3 A;  3U0Y A;  3Q4S A;  4M4K A;  4Y7G A;  1ZJP A;  3LW6 A;  3SXA A;  3I0K A;  4J18 A;  1INJ A;  1ZI4 A;  2P6W A;  5AJO A;  3I0F A;  3OGZ A;  4B4M A;  1NHE B;  1NMM B;  2QH5 A;  3OH2 A;  1W57 A;  2FFV A;  1H5T B;  4KC1 A;  2VFZ A;  1WT0 A;  4B2W A;  1H5R A;  3N9W A;  1FRW A;  3U2U A;  2RJ5 A;  3V90 A;  4AAW A;  2AE7 A;  3U2V A;  5FV9 A;  4IRQ A;  2D0J A;  3ST8 A;  5C38 A;  5IFY A;  1VZT A;  1R82 A;  3GUE A;  3SX5 A;  3E25 A;  3SX8 A;  3U2T A;  5EJZ A;  3I0E A;  2VXL A;  1QG8 A;  2RJ8 A;  3CKJ A;  3V8Y A;  1O23 B;  1H5S B;  1MP3 A;  4HO6 A;  1FO9 A;  4L41 C;  3K8E A;  1R80 A;  3U2W A;  4BMA A;  2JCL A;  3CKV A;  3FOQ A;  4KNR A;  1ZI5 A;  2WVM A;  2FYB A;  2X65 A;  4G3P A;  2OEF A;  3OC9 A;  5IDT A;  5J49 A;  4D48 A;  2Y4M A;  3V0L A;  1NF5 B;  1WVC A;  4CJC A;  3O3P A;  2V0L A;  1TW1 A;  1ZCY A;  3BRK X;  2ICX A;  3RMV A;  2Y4K A;  4FRL A;  2ZU9 A;  1TW5 A;  2I7B A;  2VD4 A;  3I0G A;  2XME A;  1K4V A;  1LL0 A;  1ZDG A;  5CQN X;  1GX0 A;  1YRO B;  2UX8 A;  1FR9 A;  4M2A A;  2Q4J A;  1O0R A;  4XWI A;  2QKX A;  1GWW A;  4UEG A;  3JUK A;  1LVW A;  4FRE A;  5EJ1 A;  2FFU A;  4MYB A;  1OQM B;  5C4C A;  1VGZ A;  1VZX A;  1H5S A;  3PKP A;  5FUH A;  3IOI A;  2XWM A;  3Q80 A;  2AES A;  1H4D A;  1HM8 A;  4FRO A;  3SXG A;  4HCQ A;  4NAN A;  4EEA A;  5C8R A;  1FOA A;  3PKQ A;  1XHB A;  1H7E A;  2X5Z A;  1V82 A;  2BO8 A;  3IOJ A;  5C4B A;  3D8V A;  2X60 A;  1H5S C;  3FWW A;  1WT3 A;  2OEG A;  2A8U A;  2OI7 A;  2PGY A;  2WGZ A;  2PA4 A;  5C1L A;  2FYA A;  3F1C A;  1YP2 A;  1H7L A;  1H7H A;  4MND A;  1FO8 A;  4EEG A;  1LL3 A;  3I0I X;  4Y6U A;  2W0V A;  3V91 A;  1HM9 A;  4DE7 A;  4NAL A;  3SX7 A;  1MP5 A;  1HM0 A;  1INI A;  3ZLL A;  4B4G A;  3EE5 A;  4AYL A;  2YQH A;  2OI6 A;  2YES A;  1HJL A;  1FGG A;  2YC5 A;  3ZGG A;  4ASY A;  2FY7 A;  1ZJ0 A;  3RMW A;  1NWG B;  5CQL X;  1NKH B;  3CKO A;  5C47 A;  1R7X A;  1VGU A;  3OH3 A;  1G95 A;  1JYK A;  2W0W A;  3PNN A;  2ZU8 A;  3U0X A;  1G0R A;  2XMH A;  4HO8 A;  5FTV A;  4HO4 A;  2O1F A;  1NQI B;  5IDS A;  2PX7 A;  4KQL A;  2BO4 A;  1JV1 A;  1YP3 A;  3K8D A;  1OMZ A;  1S4N A;  1QGS A;  5DDT A;  5C4F A;  1VIC A;  4KPZ A;  3Q7U A;  2CU2 A;  1YP4 A;  4ZDQ A;  1PZY B;  1HJJ A;  1GQ9 A;  5FYE A;  4EVW A;  4FCE A;  5C3B A;  1GWV A;  2V0J A;  3OH0 A;  4D0T A;  3SXD A;  4M2B A;  1FR8 A;  1G2V A;  4FRD A;  1G23 A;  2DPW A;  1VM8 A;  4FRM A;  1ZI3 A;  1H4E A;  1E5K A;  1MP4 A;  5CQM X;  4C2S A;  3T7O A;  3CKN A;  2D7R A;  3CGX A;  2Z87 A;  2AH9 A;  2WE9 A;  5FTS A;  3TQD A;  4G3Q A;  3USR A;  1G97 A;  4AC3 A;  1H7T A;  1ZDF A;  2RJ1 A;  3SXE A;  2O1G A;  3DJ4 A;  4DEC A;  1H5S D;  4B4B A;  3SX3 A;  1ZCV A;  2WVK A;  5HS2 A;  4EE3 A;  4HO5 A;  2MZB A;  1VH3 A;  1FG5 N;  2PGV A;  3CKQ A;  3I0J A;  1Z90 A;  5CMG X;  3V8Z A;  4YS8 A;  2Y4L A;  4HO0 A;  3T7N A;  1G8O A;  5C4E A;  5CMH A;  3SPT A;  3ZLK A;  2FYC B;  2AM5 A;  2RJ9 A;  3ZGF A;  3NGW A;  4Y7V A;  5JQQ A;  5C36 A;  4B3U A;  3JUJ A;  1ZI1 A; 
#chains in the Genus database with same CATH topology
 1H7F A;  2XWN A;  1JVG A;  3SXC A;  1R7Y A;  4HOC A;  2V0K A;  2VS3 A;  1H4C A;  4ECM A;  1G93 A;  2NXV A;  1FZW A;  1H7G A;  3DK5 A;  2Z86 A;  2AM4 A;  4ARW A;  5CMI A;  2APC A;  3QVB A;  4KRV A;  4M28 A;  4B5B A;  3V0N A;  4KNX A;  4B2X A;  1I52 A;  1ON6 A;  5I1F A;  1VZU A;  2RIT A;  1JYL A;  2E3D A;  3D5N A;  4Y6N A;  2WEE A;  1ZJ1 A;  1LZ7 A;  4HO2 A;  5FU8 A;  1XZ6 A;  4FRB A;  3SXB A;  3ZF8 A;  4HO9 A;  2JCO A;  1W77 A;  1ZIZ A;  4AYJ A;  2A8W A;  2VSI A;  2D7I A;  2Y7A A;  4NAK A;  2AEC A;  4Y7U A;  1QWJ A;  2ZU7 A;  1EZI A;  1ON8 A;  1ZCU A;  4EE4 A;  2YCM A;  5C1G A;  3USQ A;  2XWL A;  1VH1 A;  2VXM A;  2RIX A;  1GA8 A;  4IRP A;  1ZJ3 A;  2V0I A;  4Y63 A;  2P72 A;  1JVD A;  4EEM A;  3HL3 A;  2BO7 A;  1FXO A;  2RJ0 A;  1LZJ A;  4HG6 A;  5C48 A;  5C49 A;  2X5S A;  5DDV A;  1ZJ2 A;  1ZHJ A;  4CVH A;  4DDZ A;  5C4D A;  1ZJO A;  1IIM A;  1LZ0 A;  1KWS A;  2RIY A;  5L6S A;  2GGO A;  5AJN A;  4CJ8 A;  2P73 A;  4B42 A;  1W55 A;  2RIZ A;  4Y62 A;  5FU0 A;  4LW3 A;  1IIN A;  3V0Q A;  5L6V A;  3I0L A;  2RJ4 A;  3E26 A;  1WSZ A;  4Y7F A;  3OKR A;  5BXC A;  1LL2 A;  1TZF A;  1R7V A;  2O1H A;  4FCU A;  2Y4J A;  1VGT A;  1WT1 A;  2JCJ A;  1MC3 A;  4D11 A;  2RJ7 A;  1SS9 A;  4FIY A;  4E1K A;  1WT2 A;  4GBP A;  2QGI A;  4G3S A;  3F1Y A;  2VSH A;  1H7Q A;  1QGQ A;  3U2X A;  1ZCT A;  4K6R A;  5C3D A;  3V0O A;  1PZT A;  2BO6 A;  2YQC A;  2WVL A;  4HO3 A;  4FRH A;  4Y7T A;  4D11 C;  1OMX A;  2J0B A;  5C1H A;  4KPX A;  4P00 A;  1FWY A;  1H5T A;  4BQH A;  3DUV A;  4FIX A;  4D0Z A;  4Y9X A;  3V0M A;  3IOH A;  2I5E A;  2C0N A;  3D98 A;  1TVY A;  5C3A A;  1FXJ A;  1EYR A;  1R81 A;  3I0D A;  3BCV A;  3JTJ A;  4JD0 A;  3TZT A;  4JIS A;  1GQC A;  4EEO A;  2AGD A;  1O7O A;  1V83 A;  1GX4 A;  4R7P A;  4ASJ A;  3POL A;  5CQO A;  1HV9 A;  1S4O A;  3I0H A;  1FGX A;  3R2W A;  3OH1 A;  1R7U A;  2V0H A;  3V0P A;  1S4P A;  1VPA A;  3I0C A;  2FYD B;  4KXO A;  4KC2 A;  2GGQ A;  1LZI A;  3T7M A;  4P02 A;  4Y64 A;  2Y6P A;  2JCK A;  1O7Q A;  1G3L A;  2OI5 A;  3OAM A;  2I5K A;  3RSB A;  4KT7 A;  2AM3 A;  3R3I A;  4G87 A;  1H5R B;  1VGW A;  3KIA A;  3OH4 A;  1R7T A;  2YQJ A;  2WAW A;  2VS5 A;  4NAI A;  5CMJ A;  1G1L A;  4FRP A;  1G9R A;  4MIX A;  4FRQ A;  3CU0 A;  2VS4 A;  5CMF X;  1H3M A;  1V84 A;  2E8B A;  2VK9 A;  4LW6 A;  5EIY A;  4FQW A;  4FRA A;  4KC4 A;  2RJ6 A;  2ICY A;  2YQS A;  4EE5 A;  5AJP A;  5CQP A;  4CJB A;  1JV3 A;  2YC3 A;  3U0Y A;  3Q4S A;  4M4K A;  4Y7G A;  1ZJP A;  3LW6 A;  3SXA A;  3I0K A;  4J18 A;  1INJ A;  1ZI4 A;  2P6W A;  5AJO A;  3I0F A;  3OGZ A;  4B4M A;  1NHE B;  1NMM B;  2QH5 A;  3OH2 A;  1W57 A;  2FFV A;  1H5T B;  4KC1 A;  2VFZ A;  1WT0 A;  4B2W A;  1H5R A;  3N9W A;  1FRW A;  3U2U A;  2RJ5 A;  3V90 A;  4AAW A;  2AE7 A;  3U2V A;  2J0A A;  5FV9 A;  4IRQ A;  2D0J A;  5D91 A;  3ST8 A;  5C38 A;  5IFY A;  1VZT A;  1R82 A;  3GUE A;  3SX5 A;  3E25 A;  3SX8 A;  3U2T A;  5EJZ A;  3I0E A;  2VXL A;  1QG8 A;  2RJ8 A;  3CKJ A;  3V8Y A;  1O23 B;  1H5S B;  1MP3 A;  4HO6 A;  1FO9 A;  4L41 C;  3K8E A;  1R80 A;  3U2W A;  4BMA A;  2JCL A;  3CKV A;  3FOQ A;  4KNR A;  1ZI5 A;  2WVM A;  2FYB A;  2X65 A;  4G3P A;  2OEF A;  3OC9 A;  5IDT A;  5J49 A;  4D48 A;  2Y4M A;  3V0L A;  1NF5 B;  1WVC A;  4CJC A;  3O3P A;  2V0L A;  1TW1 A;  1ZCY A;  3BRK X;  2ICX A;  3RMV A;  2Y4K A;  4FRL A;  2ZU9 A;  1TW5 A;  2I7B A;  2VD4 A;  4O6N A;  3I0G A;  2XME A;  1K4V A;  1LL0 A;  1ZDG A;  5CQN X;  1GX0 A;  1YRO B;  2UX8 A;  1FR9 A;  4M2A A;  2Q4J A;  1O0R A;  4XWI A;  2QKX A;  1GWW A;  4UEG A;  3JUK A;  1LVW A;  4FRE A;  5EJ1 A;  2FFU A;  4MYB A;  1OQM B;  5C4C A;  1VGZ A;  1VZX A;  1H5S A;  3PKP A;  5FUH A;  3IOI A;  2XWM A;  3Q80 A;  2AES A;  1H4D A;  1HM8 A;  4FRO A;  3SXG A;  4HCQ A;  4NAN A;  4EEA A;  5C8R A;  1FOA A;  3PKQ A;  1XHB A;  1H7E A;  2X5Z A;  1V82 A;  2BO8 A;  3IOJ A;  5C4B A;  3D8V A;  2X60 A;  1H5S C;  3FWW A;  1WT3 A;  2OEG A;  2A8U A;  2OI7 A;  2PGY A;  2WGZ A;  2PA4 A;  5C1L A;  2FYA A;  3F1C A;  1YP2 A;  1H7L A;  1H7H A;  4MND A;  1FO8 A;  4EEG A;  1LL3 A;  3I0I X;  4Y6U A;  2W0V A;  3V91 A;  1HM9 A;  4DE7 A;  4NAL A;  3SX7 A;  1MP5 A;  1HM0 A;  1INI A;  3ZLL A;  4B4G A;  3EE5 A;  4AYL A;  2YQH A;  2OI6 A;  2YES A;  1HJL A;  1FGG A;  2YC5 A;  4Q7C A;  3ZGG A;  4ASY A;  2FY7 A;  1ZJ0 A;  3RMW A;  1NWG B;  5CQL X;  1NKH B;  3CKO A;  5C47 A;  1R7X A;  1VGU A;  3OH3 A;  1G95 A;  1JYK A;  2W0W A;  3PNN A;  2ZU8 A;  3U0X A;  1G0R A;  2XMH A;  4HO8 A;  5FTV A;  4HO4 A;  2O1F A;  1NQI B;  5IDS A;  2PX7 A;  4KQL A;  2BO4 A;  1JV1 A;  1YP3 A;  3K8D A;  1OMZ A;  1S4N A;  1QGS A;  5DDT A;  5C4F A;  1VIC A;  4KPZ A;  3Q7U A;  2CU2 A;  1YP4 A;  4ZDQ A;  1PZY B;  1HJJ A;  1GQ9 A;  5FYE A;  4EVW A;  4FCE A;  5C3B A;  1GWV A;  2V0J A;  3OH0 A;  4D0T A;  3SXD A;  4M2B A;  1FR8 A;  1G2V A;  4FRD A;  1G23 A;  5D92 A;  2DPW A;  1VM8 A;  4FRM A;  1ZI3 A;  1H4E A;  1E5K A;  1MP4 A;  5CQM X;  4C2S A;  3T7O A;  3CKN A;  2D7R A;  3CGX A;  2Z87 A;  2AH9 A;  2WE9 A;  5FTS A;  3TQD A;  4G3Q A;  3USR A;  1G97 A;  4AC3 A;  1H7T A;  1ZDF A;  2RJ1 A;  3SXE A;  2O1G A;  3DJ4 A;  4DEC A;  1H5S D;  4B4B A;  3SX3 A;  1ZCV A;  2WVK A;  5HS2 A;  4EE3 A;  4HO5 A;  2MZB A;  1VH3 A;  1FG5 N;  2PGV A;  3CKQ A;  3I0J A;  1Z90 A;  5CMG X;  3V8Z A;  4YS8 A;  2Y4L A;  4HO0 A;  4O6M A;  3T7N A;  1G8O A;  5C4E A;  5CMH A;  3SPT A;  3ZLK A;  2FYC B;  2AM5 A;  2RJ9 A;  3ZGF A;  3NGW A;  4Y7V A;  5JQQ A;  5C36 A;  4B3U A;  3JUJ A;  1ZI1 A; 
#chains in the Genus database with same CATH homology
 1H7F A;  2XWN A;  1JVG A;  3SXC A;  1R7Y A;  4HOC A;  2V0K A;  2VS3 A;  1H4C A;  4ECM A;  1G93 A;  2NXV A;  1FZW A;  1H7G A;  3DK5 A;  2Z86 A;  2AM4 A;  4ARW A;  5CMI A;  2APC A;  3QVB A;  4KRV A;  4M28 A;  4B5B A;  3V0N A;  4KNX A;  4B2X A;  1I52 A;  1ON6 A;  5I1F A;  1VZU A;  2RIT A;  1JYL A;  2E3D A;  3D5N A;  4Y6N A;  2WEE A;  1ZJ1 A;  1LZ7 A;  4HO2 A;  5FU8 A;  1XZ6 A;  4FRB A;  3SXB A;  3ZF8 A;  4HO9 A;  2JCO A;  1W77 A;  1ZIZ A;  4AYJ A;  2A8W A;  2VSI A;  2D7I A;  2Y7A A;  4NAK A;  2AEC A;  4Y7U A;  1QWJ A;  2ZU7 A;  1EZI A;  1ON8 A;  1ZCU A;  4EE4 A;  2YCM A;  5C1G A;  3USQ A;  2XWL A;  1VH1 A;  2VXM A;  2RIX A;  1GA8 A;  4IRP A;  1ZJ3 A;  2V0I A;  4Y63 A;  2P72 A;  1JVD A;  4EEM A;  3HL3 A;  2BO7 A;  1FXO A;  2RJ0 A;  1LZJ A;  4HG6 A;  5C48 A;  5C49 A;  2X5S A;  5DDV A;  1ZJ2 A;  1ZHJ A;  4CVH A;  4DDZ A;  5C4D A;  1ZJO A;  1IIM A;  1LZ0 A;  1KWS A;  2RIY A;  5L6S A;  2GGO A;  5AJN A;  4CJ8 A;  2P73 A;  4B42 A;  1W55 A;  2RIZ A;  4Y62 A;  5FU0 A;  4LW3 A;  1IIN A;  3V0Q A;  5L6V A;  3I0L A;  2RJ4 A;  3E26 A;  1WSZ A;  4Y7F A;  3OKR A;  5BXC A;  1LL2 A;  1TZF A;  1R7V A;  2O1H A;  4FCU A;  2Y4J A;  1VGT A;  1WT1 A;  2JCJ A;  1MC3 A;  4D11 A;  2RJ7 A;  1SS9 A;  4FIY A;  4E1K A;  1WT2 A;  4GBP A;  2QGI A;  4G3S A;  3F1Y A;  2VSH A;  1H7Q A;  1QGQ A;  3U2X A;  1ZCT A;  4K6R A;  5C3D A;  3V0O A;  1PZT A;  2BO6 A;  2YQC A;  2WVL A;  4HO3 A;  4FRH A;  4Y7T A;  4D11 C;  1OMX A;  2J0B A;  5C1H A;  4KPX A;  4P00 A;  1FWY A;  1H5T A;  4BQH A;  3DUV A;  4FIX A;  4D0Z A;  4Y9X A;  3V0M A;  3IOH A;  2I5E A;  2C0N A;  3D98 A;  1TVY A;  5C3A A;  1FXJ A;  1EYR A;  1R81 A;  3I0D A;  3BCV A;  3JTJ A;  4JD0 A;  3TZT A;  4JIS A;  1GQC A;  4EEO A;  2AGD A;  1O7O A;  1V83 A;  1GX4 A;  4R7P A;  4ASJ A;  3POL A;  5CQO A;  1HV9 A;  1S4O A;  3I0H A;  1FGX A;  3R2W A;  3OH1 A;  1R7U A;  2V0H A;  3V0P A;  1S4P A;  1VPA A;  3I0C A;  2FYD B;  4KXO A;  4KC2 A;  2GGQ A;  1LZI A;  3T7M A;  4P02 A;  4Y64 A;  2Y6P A;  2JCK A;  1O7Q A;  1G3L A;  2OI5 A;  3OAM A;  2I5K A;  3RSB A;  4KT7 A;  2AM3 A;  3R3I A;  4G87 A;  1H5R B;  1VGW A;  3KIA A;  3OH4 A;  1R7T A;  2YQJ A;  2WAW A;  2VS5 A;  4NAI A;  5CMJ A;  1G1L A;  4FRP A;  1G9R A;  4MIX A;  4FRQ A;  3CU0 A;  2VS4 A;  5CMF X;  1H3M A;  1V84 A;  2E8B A;  2VK9 A;  4LW6 A;  5EIY A;  4FQW A;  4FRA A;  4KC4 A;  2RJ6 A;  2ICY A;  2YQS A;  4EE5 A;  5AJP A;  5CQP A;  4CJB A;  1JV3 A;  2YC3 A;  3U0Y A;  3Q4S A;  4M4K A;  4Y7G A;  1ZJP A;  3LW6 A;  3SXA A;  3I0K A;  4J18 A;  1INJ A;  1ZI4 A;  2P6W A;  5AJO A;  3I0F A;  3OGZ A;  4B4M A;  1NHE B;  1NMM B;  2QH5 A;  3OH2 A;  1W57 A;  2FFV A;  1H5T B;  4KC1 A;  2VFZ A;  1WT0 A;  4B2W A;  1H5R A;  3N9W A;  1FRW A;  3U2U A;  2RJ5 A;  3V90 A;  4AAW A;  2AE7 A;  3U2V A;  2J0A A;  5FV9 A;  4IRQ A;  2D0J A;  5D91 A;  3ST8 A;  5C38 A;  5IFY A;  1VZT A;  1R82 A;  3GUE A;  3SX5 A;  3E25 A;  3SX8 A;  3U2T A;  5EJZ A;  3I0E A;  2VXL A;  1QG8 A;  2RJ8 A;  3CKJ A;  3V8Y A;  1O23 B;  1H5S B;  1MP3 A;  4HO6 A;  1FO9 A;  4L41 C;  3K8E A;  1R80 A;  3U2W A;  4BMA A;  2JCL A;  3CKV A;  3FOQ A;  4KNR A;  1ZI5 A;  2WVM A;  2FYB A;  2X65 A;  4G3P A;  2OEF A;  3OC9 A;  5IDT A;  5J49 A;  4D48 A;  2Y4M A;  3V0L A;  1NF5 B;  1WVC A;  4CJC A;  3O3P A;  2V0L A;  1TW1 A;  1ZCY A;  3BRK X;  2ICX A;  3RMV A;  2Y4K A;  4FRL A;  2ZU9 A;  1TW5 A;  2I7B A;  2VD4 A;  4O6N A;  3I0G A;  2XME A;  1K4V A;  1LL0 A;  1ZDG A;  5CQN X;  1GX0 A;  1YRO B;  2UX8 A;  1FR9 A;  4M2A A;  2Q4J A;  1O0R A;  4XWI A;  2QKX A;  1GWW A;  4UEG A;  3JUK A;  1LVW A;  4FRE A;  5EJ1 A;  2FFU A;  4MYB A;  1OQM B;  5C4C A;  1VGZ A;  1VZX A;  1H5S A;  3PKP A;  5FUH A;  3IOI A;  2XWM A;  3Q80 A;  2AES A;  1H4D A;  1HM8 A;  4FRO A;  3SXG A;  4HCQ A;  4NAN A;  4EEA A;  5C8R A;  1FOA A;  3PKQ A;  1XHB A;  1H7E A;  2X5Z A;  1V82 A;  2BO8 A;  3IOJ A;  5C4B A;  3D8V A;  2X60 A;  1H5S C;  3FWW A;  1WT3 A;  2OEG A;  2A8U A;  2OI7 A;  2PGY A;  2WGZ A;  2PA4 A;  5C1L A;  2FYA A;  3F1C A;  1YP2 A;  1H7L A;  1H7H A;  4MND A;  1FO8 A;  4EEG A;  1LL3 A;  3I0I X;  4Y6U A;  2W0V A;  3V91 A;  1HM9 A;  4DE7 A;  4NAL A;  3SX7 A;  1MP5 A;  1HM0 A;  1INI A;  3ZLL A;  4B4G A;  3EE5 A;  4AYL A;  2YQH A;  2OI6 A;  2YES A;  1HJL A;  1FGG A;  2YC5 A;  4Q7C A;  3ZGG A;  4ASY A;  2FY7 A;  1ZJ0 A;  3RMW A;  1NWG B;  5CQL X;  1NKH B;  3CKO A;  5C47 A;  1R7X A;  1VGU A;  3OH3 A;  1G95 A;  1JYK A;  2W0W A;  3PNN A;  2ZU8 A;  3U0X A;  1G0R A;  2XMH A;  4HO8 A;  5FTV A;  4HO4 A;  2O1F A;  1NQI B;  5IDS A;  2PX7 A;  4KQL A;  2BO4 A;  1JV1 A;  1YP3 A;  3K8D A;  1OMZ A;  1S4N A;  1QGS A;  5DDT A;  5C4F A;  1VIC A;  4KPZ A;  3Q7U A;  2CU2 A;  1YP4 A;  4ZDQ A;  1PZY B;  1HJJ A;  1GQ9 A;  5FYE A;  4EVW A;  4FCE A;  5C3B A;  1GWV A;  2V0J A;  3OH0 A;  4D0T A;  3SXD A;  4M2B A;  1FR8 A;  1G2V A;  4FRD A;  1G23 A;  5D92 A;  2DPW A;  1VM8 A;  4FRM A;  1ZI3 A;  1H4E A;  1E5K A;  1MP4 A;  5CQM X;  4C2S A;  3T7O A;  3CKN A;  2D7R A;  3CGX A;  2Z87 A;  2AH9 A;  2WE9 A;  5FTS A;  3TQD A;  4G3Q A;  3USR A;  1G97 A;  4AC3 A;  1H7T A;  1ZDF A;  2RJ1 A;  3SXE A;  2O1G A;  3DJ4 A;  4DEC A;  1H5S D;  4B4B A;  3SX3 A;  1ZCV A;  2WVK A;  5HS2 A;  4EE3 A;  4HO5 A;  2MZB A;  1VH3 A;  1FG5 N;  2PGV A;  3CKQ A;  3I0J A;  1Z90 A;  5CMG X;  3V8Z A;  4YS8 A;  2Y4L A;  4HO0 A;  4O6M A;  3T7N A;  1G8O A;  5C4E A;  5CMH A;  3SPT A;  3ZLK A;  2FYC B;  2AM5 A;  2RJ9 A;  3ZGF A;  3NGW A;  4Y7V A;  5JQQ A;  5C36 A;  4B3U A;  3JUJ A;  1ZI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...