4D4HA

Understanding bi-specificity of a-domains
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
408
structure length
408
Chain Sequence
KQSIHQLFETQVERTPEAVAVLSEQGQLTYEELNTKANQLAHYLRTLGVKSETLVGVCVDRSLEMVIGLLAILKAGGAYVPLDPTYPRERLTYMVQDAQISVLVTQTQWSNLISDYQGQVICLDSQWAKIASYSQENLVNTVNPENLAYVIYTSGSTGKPKGVMIEHQSLVNFTKLAIAQYQITTSDRTLQFVSISFDVAAEEIYVTLCSGATLILRTEEMISSIPSFVQKSQDWQITVWSLPTAYWHLLVNELVKSKIALPDSLRLVIIGGERVQPELVRMWFKNVGNFPELINVYGPTEGTIAVSLCRLSQLTESQRNRTEIPIGKSLGENISVYVLDETLKTVPPETPGEIYIGGTALARGYLNRPELTAQKFIQDPFSPSERLYKTGDLGRYLADGNLEYLGRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Elucidation of the Bispecificity of a Domains as a Basis for Activating Non-Natural Amino Acids.
pubmed doi rcsb
source organism Planktothrix agardhii
molecule tags Hydrolase
molecule keywords APNAA1
total genus 147
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2014-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d4hA00
1V25A 5BSWA 3FCCA 3IEPA 2WD9A 5BSMA 3VNQA 2VZEA 4GR5A 3E7XA 5BSTA 5BSRA 3NI2A 4DG9A 2Y4NA 4DG8A 3E7WA 3NYQA 4G37A 4GS5A 3IESA 3WV5A 1V26A 3VNSA 5BSVA 3IERA 4FUTA 5DWVA 3E53A 3U17A 5KEIA 4E5DA 3LGXA 5E7QA 4LGCA 4IR7A 3T5CA 3IPLA 3WV4A 3A9VA 4D4HA 3WVNA 2Y27A 3RIXA 3T5BA 5BURA 4RVOA 3TSYA 4R1LA 4IZ6A 3O84A 3R44A 2Y4OA 3FCEA 3QYAA 4GR4A 4D57A 3U16A 4D56A 3ETCA 3B7WA 3VNRA 3GPCA 3RG2A 4M46A 5BSUA 3DAYA 4D4GA 3C5EA 4PZPA 4ISBA 4OXIA 4R0MA 3ITEA 3NYRA 4FUQA 3L8CA 3O83A 3G7SA 3EQ6A 3PBKA 3O82A 3IVRA 4R1MA 2V7BA 3DHVA 5BUQA 4GXRA 4GXQA 4WV3A 5GTDA 4W8OA 4D4IA 1ULTA 5D6NA 3T5AA 4RVNA 5BUSA
chains in the Genus database with same CATH superfamily
4CTJA 1Y4ZA 2R8ZA 3KYIB 3B5EA 3KT6A 2XUQA 3IDQA 4TWIA 3FX2A 5DLPA 1VJTA 2DCMA 3V6LA 1L1EA 4PSVA 3TNDA 1QYVA 4DLBA 4HDRB 5T5QA 4ER7A 4CKYA 4KE6A 3ACDA 3EJ6A 3Q9UA 3R5TA 2ZXUA 1LH0A 1OAAA 3FCYA 4U02A 3Q41A 2O5EA 5FOSA 1ZGAA 4QXPA 4KAXA 1XD8A 3ZTYA 3LIPA 3CNEA 5LLSA 2P6OA 1T13A 1W581 4LJAA 1UKVY 2R97A 4YP0A 4A15A 1BGXT 1TGYA 3B2NA 4MV5A 4ZA2A 4C05A 3OTIA 4WJZA 3ZDEA 1LTQA 1D03A 3FBGA 3CPSA 4ME6A 5FPTA 3G0DA 3AF2A 2DP4E 2QZJA 3DR5A 3LJKA 4P7BA 3FPBA 4WKOA 5DRYA 1M83A 5KSOA 1QFZA 2NSYA 2XV1A 1Z6XA 1PBNA 3REQA 3VPSA 1RHRA 4DIOA 5I47A 3BE5A 1II8A 4BLTA 1IQ0A 3GFFA 5EWLB 3D7MA 4KXVA 3T5MA 1UOEA 1FFXA 1Q6ZA 4HJXA 2JJ1D 4QJ5A 1ZFNA 1BW9B 2BUAA 1J99A 2D1YA 4W6QA 1QHNA 1LI4A 2VUSA 5M2QA 3L0OA 1YWGO 1NHWA 1Z5PA 4UMEA 6YASA 4AZTA 1EUDB 4IGFA 2H4FA 3LL4A 1DCKA 3TG2A 4RH3A 2FZ4A 3LLSA 4FDUA 4M1YA 3O7WA 1VE5A 1L5WA 1SKQA 2QMUA 2XTZA 3O26A 3QBVA 4XDZA 2YHSA 1VMKA 2V3WA 2JIDA 2O9JA 2ZRMA 3DEAA 2AR7A 3EQ2A 1QHGA 3DYVA 3NUZA 4WXMA 4X6XA 2VO1A 5F35A 5A7HA 3BUSA 3OPXA 3KU1A 3K09A 1YE5A 1SG9A 2GH1A 3HSSA 4HFMA 4L8WB 4QU8A 3Q8MA 5FXMA 1QTRA 4ZJUA 3GH1A 1R8QA 4J2OA 2EP5A 1F2UA 4RDCA 1EH5A 2A84A 4IUCS 4OQXA 3ED1A 1RZVA 4L6CA 1W34A 1XLUA 4W1RA 1JIJA 4YJGA 5G4KB 3FMVA 3Q8KA 1EVKA 5D87A 2G80A 3RUFA 1A0OA 4FVTA 1GHTA 3DDUA 4WOPA 3VC2A 4MCIA 2SBTA 3L0SA 5HGXA 4BV8A 4DEVA 4U4AA 4DNXA 2YN0A 2FXIA 3QXHA 5HIJA 2OQ2A 3DZBA 1VHWA 4BO9A 2AFRA 4IQ8A 3DCIA 3AB7A 4PC3A 5CB6A 3AKDA 2O8NA 4G1VA 1I80A 1RJEA 3BZUA 2FK8A 3CKYA 2QSYA 3ICPA 1S3GA 4LY6A 5JCJA 1NMZA 1IAQA 2R86A 4CPDA 1N36B 5KJEA 3ILXA 1S01A 2HX1A 2ENWA 2ZSKA 2ZJ3A 2M9MA 3IAM1 2AMFA 4L0DA 4BUJA 4A0SA 4DT1B 1HWYA 2WU0A 1W46A 4U00A 3E4DA 1GA4A 4MLPA 4EELA 5HKKA 2NU7B 4NZ9A 4QDKA 1ZUIA 3A9SA 1LDBA 2GHQA 1FZTA 1RBZA 3JALA 3PJDA 5EKXA 3KOOA 1M2FA 5FV7A 3RT7A 4DBLC 4AWXA 1HF3A 3UXYA 2ECPA 3HJHA 5JQGB 4EHJA 2GFHA 4UUPA 3D6HA 1PLJA 1YKGA 1ODIA 2C8VA 4XCVA 5JS7A 1CYEA 2HF8A 3OF5A 3AESA 2WJGA 3F1LA 1S0UA 3AR3A 2GEVA 3AJDA 1E2QA 5AK0A 2O2GA 4V1CA 3H2GA 2BDEA 1QZXA 5HMMA 5CA1A 4ARCA 2WD9A 3KQYA 2VP3A 1NW3A 2EBWA 4I3HA 4RVSA 2WV7A 2OLJA 2MYTA 1R8XA 2Q9BA 4RVDA 1EVZA 1JJVA 3BTOA 3NTRA 3ZHZA 1IQRA 3G6WA 1QANA 4LDZA 3R7DA 3U19A 2BFCA 1Z12A 5EIEA 2PS9A 3HNPA 3TSWA 2OCKA 4FONA 3ROQA 1Y3BE 4JHXA 3JATA 3WYEA 5JJBA 1NVAA 2XWJI 4Q15A 2ID7A 2E4AA 2FSGA 3UGJA 2XMPA 3DT6A 4RGQA 4CQNA 1W6RA 2J9FB 1JAZA 4K46A 3QMWA 4WLOA 4DMRA 2H6EA 5E0KB 4Y9UA 3R5KA 3TQIA 5F3DA 1G8AA 3GLVA 4Z4HA 1NE7A 2OBLA 1GTL1 4TV8F 1IIRA 2MIIA 3VZSA 4GWLA 3WICA 3ESZA 2PLNA 3QA9A 4KQ2A 4WK0B 4XVQA 1Z56C 1ORDA 1NSFA 2L42A 5I7AA 4ETWA 5HNKA 5T7BA 3D5QA 3OA0A 2G5TA 4NMMA 4RIIA 1BVYF 2RG7A 3GJZA 1PFKA 3LQFA 3T1HB 3J81A 1QIHA 4KO2S 4S0XA 3H04A 5KTSA 5DBHX 1L4UA 1LSJA 2IYRA 3E70C 3OZDA 1EG2A 4HYTA 1POWA 4BMZA 1T4BA 3QZUA 5AKEA 4F85A 3AWDA 4DDHA 3WDMA 4EATA 2V0NA 3BCHA 3B9PA 2O8FA 4IDFA 1MC5A 1AGRA 5F64A 3DQZA 4P80A 1Y7TA 3I8OA 1NURA 3RO7A 1JTEA 4EW3A 2JI8A 3JXEA 4FIDA 4HDRA 3O74A 5HYVA 221PA 1RLJA 2IYOA 3GFOA 3TI7A 3SJBA 3RDPA 3QUTA 4B80A 1FDRA 1FJHA 4DHEA 3ZHSA 4W8HA 2PUHA 2NP7A 2R84A 1IZ9A 1SXJE 4C6TA 2AOUB 4BNDB 1FTQA 1ONBA 2EERA 2HK8A 2ODAA 2ZBRA 1JJIA 4LWPA 3WB2A 1A8IA 1MDFA 4CKWB 5C52B 4QEZA 1QLJA 3VI4B 3X43A 3F49S 1XQ1A 3V4OA 4BMVA 1G5TA 421PA 1NVFA 1SR8A 2AOUA 2QD1A 4XSGA 2X0EA 3KIPA 1ZX1A 4NQZA 4R1TA 4X62B 1GRCA 2M1ZA 1L8LA 3NHJA 3TR5A 3ZLVA 5CA0F 2XB2A 3E1KA 2QGNA 2W00A 3OE4A 4WZAB 4MVJA 5KOHB 1V3VA 2MHCA 4GRAA 4QUEA 4QSHA 1TQ2A 3KHUA 3WP0A 2G83A 1IVNA 5EMMA 3RTCA 3ISJA 5JASA 2PXAA 1HQKA 1KFJB 3Q3CA 2L82A 2IUUA 2DWPA 2BFFB 3TVTA 3NH6A 4K3UA 4PX5A 2XSZD 2YINC 1BRTA 2R7MA 5HK8A 2O2ZA 1T43A 1QFYA 4V38A 4A16A 3ZJ5A 4RLHA 1G3IA 5H4HA 1LQ2A 4COOA 4KO3S 5AKJA 4LVOA 4U2EA 3GRKA 2OPBA 3IT3A 4UULA 4UXJA 4EJMA 3MTGA 1I6MA 5F5NA 2VJMA 2QMEA 3A6LA 3RSQA 3E18A 5C3UA 3RSFA 1XZLA 5BN1A 2GDZA 3SDZA 3RS4A 2I99A 4FHZA 3K09C 2ZRNA 3NP9A 3TNLA 4AZ0B 4GUAA 4JUBA 1IN5A 4EZIA 3E9DA 1U0OC 1L9KA 3IJ5A 3CVVA 2AA3A 1RWVA 1AQ6A 2PIAA 4MRMB 5E3HA 3BPSA 3AHHA 1GAJA 4ETNA 2CVFA 4Q93A 4DMFA 1VL6A 4FYPA 2Q0QA 3ZWYA 4QXRA 1O95C 4FW8A 4I5FA 1SA0B 5K20A 3ZWCA 4DB2A 3ASUA 3OJCA 3GEMA 1WPQA 1SD1A 3E7WA 2QAGC 4MUXA 4E2FA 3JQEA 5U4QA 1IATA 2BGGA 2F4VB 1K4YA 5CLHA 4MS4A 4N5DA 5HK9A 2B36A 5L3VA 1M6HA 4URWR 3WL5A 4EYQA 4DCNA 2FSIA 3T7EA 3IMCA 3DHWC 3GGPA 3MT0A 4II2A 5EXDA 3SHFA 2VJYA 1PX2A 5EP2A 5H5JA 4D0NA 3IL2A 1XU9A 1J0DA 3NIBA 3NBFA 1DKLA 4DCGA 2JHCA 3K92A 4FR2A 1U8ZA 1DJLA 4CQJA 4EF4A 5DEIA 2V1UA 1CHNA 1DTSA 2P5SA 1KY4A 1L5FA 1NYRA 2FPWA 1ZS9A 4Q39A 3WGZA 2HDHA 2JIQA 4MX8A 3FPAA 4Q7JB 3FGZA 5KNBD 3E2IA 3R0JA 3OFVA 3QX8A 3C5WP 4H4DA 2A0WA 3A1UA 1Z0FA 1OV6A 2AZMA 3I12A 4OHMA 2NZXA 4RA9B 1S2OA 1OGIA 1QAQA 3R3ZA 3TSCA 3UQZA 1IRXA 3LTNC 2XTMA 4D8YA 4Q03A 2RK3A 1FSZA 3A1DA 3HMKA 1QHIA 1QU3A 1VPEA 2EZ8A 5L7TA 3D59A 1E5XA 3MJCA 4I9NA 5FL7D 1Q0PA 2D1TA 1QPZA 1IK6A 4L9RA 4WK2B 3MSXA 3OJLA 2DBRA 3O8OB 4KPEC 2INGX 4FGLA 5EWMB 4IRMA 4BVKA 3CNHA 3C6XA 2R1VA 4LRWA 3W6OA 1WKCA 4DJAA 4F8EA 5KQGA 1Y9AA 1D2EA 1ENPA 2D4AA 2PXXA 1WW3A 2GPNA 1I3OA 4OA8A 5EI5A 2NUAB 3WKAA 1B3RA 4NNOA 1YZTA 2ECKA 1YZHA 1E3EA 1P60A 3L8FA 2DQZA 1XVTA 4RESA 1S1CA 4M9XA 4YP7A 3KR1A 1IJKA 1CUSA 3M0EA 5ALJA 5DO9A 4BQQA 3GFTA 1IG0A 1JJ7A 2Z6UA 3M4NA 1DEHA 4PZPA 4C06A 1JZQA 1X7YA 2OO5C 4Q9AA 1EP9A 4JGBA 3PG5A 2MYUA 1XU4A 4ZYZA 2RMKA 4F7WA 1DTEA 1ZSNA 1FP6A 1QE5A 2JEYA 1C8LA 1EK1A 4I4CA 4DSUA 2O8DB 2VA9A 5LZ9A 1IPHA 3LOQA 1ND5A 2ZSAA 1O58A 2J4DA 1SUPA 4FBMA 3L1KA 4MWZA 1TZJA 3RHTA 1YT5A 2BBOA 1SOUA 1W25A 2H1RA 4R1SA 4Z2AA 3L1UA 3LT1A 5KWIA 4RABA 4E94A 1FNCA 4AP6A 3C7DB 5J4VA 5IBCA 1Z82A 1Z74A 3HADA 4H6WA 3FNIA 3HCWA 2GUWA 1PZXA 4D4IA 1WHTA 4OJMX 3SJ7A 4FK8A 4J16C 1E3MA 4NX2A 5JATA 4KO1S 1Q57A 4GSKA 5ECGC 4OLJA 1M2GA 1EXWA 1PNRA 1T25A 1OWOA 1UBHS 1UQTA 2CYBA 1ZRNA 2I80A 4IGEA 1ADGA 3VSCA 4C87A 4YDRA 1S7CA 1SULA 4PO9A 2OPHA 3THYB 4H6PA 1QU2A 4EMTA 3VAZA 3V6MA 1YNSA 1EG7A 1R1DA 2ZWPA 1LUAA 2ZIFA 4NMLA 5C46F 2QDXA 2VQ3A 1RBYA 1NT4A 3NW9A 4IXWA 1DWOA 3HHEA 5B3LA 1G16A 1P2DA 1BXGA 2GN6A 3ZLUA 4ZMRA 1XTUA 3CY6A 3I72A 3BTUA 4UPDA 4EUHA 3DUFA 4PINA 4NVRA 1F5SA 2W4MA 2RGNA 2J45A 3LWDA 4GGPA 1RWQA 2A6PA 4CV3A 1TD1A 1TXGA 4OQZA 1C8BA 5K3EA 4R9VA 1T6YA 4NATA 4PYIA 2FP3A 4L4YA 4MW5A 3VZDA 1YJ5A 2CXSA 2QR3A 3BM5A 3G2OA 4G0QA 2HK6A 4DWWA 4EB0A 4EITA 1G5QA 4W5TA 4B76A 4EB6A 3VPCA 1SVMA 1WWKA 2BZSA 3RNLA 4F60A 4PTLA 2WT9A 3VR2D 1CVIA 1CW2B 3BGOS 1YCHA 2Y93A 3LKDA 3E5NA 4KCGA 1LX6A 1I2DA 2KLHA 3HZOA 3MWLA 1CS4C 1T4GA 4KVAA 4TGLA 4R16A 2XQIA 1JDPA 2OD9A 3K9WA 2PG3A 1X1EA 1P18A 2FQQA 1NQTA 2GAJA 2QUIA 2XCQA 3GLHB 3Q9SA 4MZDA 3O9VA 3U3DA 4D4HA 3RS7A 1VG8A 3EFBA 4MRNA 3C3XA 4UAVA 4DSAA 5ICEA 2BKVA 4D3XA 4ENPA 3FY4A 5B1SA 3L7JA 3ND7A 3VYTB 3ZE8A 4FQ5A 4IFTA 1DCMA 2WF6A 2J3IA 4K9DA 2PGLA 2JD2A 5G2OA 1N2OA 1UBTS 4RKQA 2G72A 5KUTA 1KDOA 5T3YA 3LRPA 4Y6GB 4K6MA 2XKJE 3R3XA 5CX1A 3ZNQA 1XVIA 2BFWA 4UEJA 2O8CB 4Y7DA 1HC7A 1SGWA 3STHA 1DQPA 2JAQA 1CEXA 2WIJA 1ORTA 4G0YA 4FD3A 3E5HA 1VDZA 2ZAMA 1ZH6A 4V0ME 2Q1XA 1HRKA 2CXXA 5LPNA 3NAMA 3MT9A 3WIBA 1GNSA 2KM1A 5CFPA 3K0SA 1MH1A 1ZAYA 3EXIB 3TRJA 4YP6A 1K5HA 2V65A 4FFLA 4Z4GA 1CR1A 4PRYA 2CB0A 1NNUA 3CG0A 2VF2A 5A04A 3ASYA 4PZ0A 4DDVA 4Z7QB 2F3TA 4EJ0A 3MFQA 1LF0A 2YW9A 1W87A 3B8HA 5L45A 4BO2A 3H0EA 2BFEA 1CULC 4MKZA 1ZD4A 2GFIA 3DOJA 2IEZA 4K1LA 4O4LB 2JFVA 2WIDA 3OWXA 4D9FA 4ZVOA 1XA4A 1WZCA 2JFQA 4DQVA 1O6BA 2V9PA 3VKWA 3CMMA 1IAVA 4M9CA 3OC6A 4ANFA 1TVMA 3TNFA 1KNXA 2IZ0A 3MF4A 5E6RA 3PNBA 1KZ1A 2OD2A 4DA4A 3F6RA 4EYGA 1KI9A 1UOOA 1U7UA 1CF2O 2FF7A 2V45A 4FDAA 4KIJA 4KQ9A 4PYOA 4QHSA 4MKXA 5GIPE 2VXBA 2XYQA 1BWPA 1D2HA 3BDAA 1CD5A 4JI4B 5CTAA 1ZL2A 3U4IA 3Q3HA 3HP7A 2B1IA 3RUEA 3R9XB 4XUDA 4R40A 4FE3A 4HGZA 2XF2A 2DFDA 2H7XA 4HXFB 1A98A 1YRQA 1FDSA 1ZGZA 2NTYC 1EK0A 4WUVA 3T8YA 2F1OA 1Z7BA 4MICA 4DMLA 1Z3CA 2Q3EA 3TTWA 2OKCA 4BY9E 4DUGA 5BSMA 2P3QA 4ND1A 5EUCA 2VDOB 3DZGA 1QP8A 1SUIA 2GETA 4GR5A 4W5WA 2RHCA 1I33A 4JP2A 4NCKA 4MQFB 1U7OA 2FW8A 4PICA 3AY7A 5H81A 4HS9A 5JPCA 3A4VA 4HMOA 1KFEB 3PUXA 4TL8A 2P9TA 4GG1A 3RRFA 2P4QA 2REOA 4US0R 1P9OA 4W7SA 4EO4A 2GFQA 1CUUA 2EKQA 2ZYSA 1RHUA 2Z6AA 2GCOB 4X3OA 4NYJQ 3D81A 5GZ6A 3W79A 1QORA 1KJNA 4F6RB 5J2TA 1IM5A 3AOEC 4KXWA 4PZLA 3WK7A 1TM2A 4U9IS 3TH5A 4JZKA 4PQRA 2CXNA 1QJCA 1EQ2A 2J41A 2E4YA 3EDQA 4LCBA 3A37A 5JIBA 1RQNA 4O33A 1KEUA 1TIKA 1CV2A 4RQAA 2HZBA 1I6KA 3N3BC 4WD3A 2GR9A 2VP0A 1ZGCA 3OTWA 4Q9KA 4BXOB 2GCPA 2WZBA 3OQ1A 2E4ZA 3TSAA 1G8MA 1KEEB 4LMAA 1HG1A 4TSRA 1WUYA 3O1IC 2WD8A 2ZI7A 2QVGA 2LUOA 3EGIA 1EA7A 3OY7A 3VJKA 4ESEA 4EHKA 3C2QA 3DHNA 1SY7A 5EZSA 1AQIA 1DC4A 4I46A 4P3YA 4RTLA 1C2TA 3G5MA 2B1JA 4KQGA 1DDIA 3ESDA 4C29A 2FW9A 5TJHA 2PUCA 1K75A 3C3WA 1STOA 2AOTA 4ZCQA 4ZAGA 2V96A 2ERCA 1KC1A 2HCTA 1L4FA 4OHKA 5JROA 1QRUA 1U9YA 2AX4A 3KX2A 4M46A 3BJIC 2HXYA 1JT2A 1T3ZA 3HCOA 1R74A 4KEAA 4LXHA 1ZD8A 5JZOA 3DO8A 4EHFA 2RGNC 2A8YA 3F67A 2HRCA 3GMDA 3O3NB 4K28A 4EY8A 3FI0A 2AQIA 5AKYA 2Q3JA 4FR5A 3SIWA 2BGMA 3C6MA 2JIZD 3SQLA 5IJ9A 3ZWKA 3PPXA 1LPMA 4PGAA 1GNVA 2YFQA 3C6BA 1EBFA 2FF5A 3NCHA 4M0KA 1BROA 2HJGA 2AG0A 4N47A 2Z3VA 4AF6A 4FFVA 5SV2A 1NZDA 4I5IA 1JQBA 5JBQA 2GN2A 1KAOA 1U0HC 3I9LA 2DQYA 1RIIA 3U3MA 1MA0A 1E2LA 2JAPA 2WHQA 4TRRA 5JD6A 3EODA 5HIAA 1KYXA 1M2HA 2G9UA 2B8NA 2PA3A 1F4LA 2E6KA 3G5AA 1XXHB 4ZZ2A 3RYFB 2VHYA 4G4SO 3LW7A 2O8EB 4UU1A 4CEJB 3EHEA 2QTVA 2XT0A 1Z5ZA 2QP3A 1SKYB 5HUJA 3FTEA 1YJXA 1UBSB 2AJBA 3P2KA 2RCYA 1HK7A 2KHZA 2ZE5A 3FDZB 4RK5A 4E0BA 1Q7GA 5KNCD 3GLRA 3OPYA 3ITNA 5K2MA 4E12A 1FLAA 2H4XA 2QTNA 3K9LA 2UUAB 2R1ZA 1UM9B 4JI0B 1ESZA 2GZAA 5BPHA 1US8A 5A4IS 4I1PA 2O59A 4QNRA 1MJGM 3D4IA 1TUBB 4R4JA 1TK3A 3SJUA 1UJ5A 4CNQA 1X1CA 2CFRA 2OM6A 1VSBA 5FADA 4OM8A 1D2MA 3LM8A 2DFLA 3L05A 5LD2C 2YZKA 2YMQA 2WSSA 2J3LA 3WK8A 5HKBA 2FG5A 4OLAA 4F5ZA 3F0TA 3RV4A 4LA4A 4EPTA 3BFKA 3ELBA 3ONDA 4GNKA 4PU0A 4PNEA 4YB8A 1Y7IA 1YH3A 1Z6GA 2I4TA 3BFJA 2FWIA 2P9YA 5IBRA 3H11B 3STXA 3V1KA 5ICGA 3KAKA 3EVDA 2F8MA 3FLEA 4XR4A 4OYLA 1S4MA 4L07A 3HKBA 5JSZB 4QIHA 2QRZA 3RJZA 1SXQA 1EEHA 2NU6B 4G4SP 1PQ4A 5B1IA 3G2PA 1C3XA 3H9EO 1L7OA 4GLOA 1E98A 1JJBA 4YXWD 1GNQA 4F46A 3FNQA 4RY0A 2HIHA 1I5OA 3A4MA 5JAPA 2OXCA 3AHFA 3ORRA 2XRFA 2NAFA 3GGOA 1V43A 3BXHA 3CZRA 4MW9A 5JAZA 1NKSA 4UHFA 4UM8B 1C4WA 3TWOA 2W6ID 2JS7A 3OICA 4U7FA 4LEIA 3RVKA 2HHLA 3ZCVA 5AW5A 1RMQA 4R9RA 2VDPB 5E4YA 4M53A 1W36B 3VPXA 1I4DD 5DHAA 1VKHA 5ER6A 3WJ2A 3ZWXA 5IZ4A 1QKIA 1QVZA 1OBHA 5CH3A 4RQBA 1T26A 3L46A 4D0SA 1N1MA 1R37A 2JAXA 2ZULA 2H08A 3ACCA 3DE7X 1FUYB 2ZREA 4Y6RA 4YA6A 1M0SA 3WHPA 4J75A 2OT3B 2AUMA 4HNGA 4B3FX 4AY5A 1UC8A 2C9MA 1QX4A 4X00A 5CAEB 3NH9A 5DPMA 2BDUA 1DWQA 3GPIA 5ALKA 5JYDA 4AD8A 2CDAA 1DBVO 4YHBA 2FN7A 3IRUA 3O75A 5TEWA 3BXEA 3LPNA 3MRVA 4FFMA 5HXAA 5LUAA 1ACJA 4RIHA 1XP8A 1XNJA 3P5SA 1G17A 3ZZUA 3IBTA 1A7JA 2YUTA 2P2YA 4BLVA 4Q16A 4QA9A 1NUHA 2C8KA 5EJAA 2PMCA 4WAUA 1QPBA 1W36D 4MR7A 4N6OA 1QXSA 3EXHB 2WTAA 3PA8A 4FYMA 3B52X 5H59A 3R8XA 3PNQA 1PIWA 4JKYA 2XQVA 3RSZA 3TLEA 1XEWX 3AOEA 4MLCA 1DXYA 4XKJA 5ADUS 2ZJ2A 3D2CA 1GOTA 5BMOA 4WMLA 2Q2VA 5KYGA 4QUGA 5I4CA 2FMTA 5LYJB 1ISMA 2OYSA 3D3NA 3WHLA 4AY4A 3OIGA 3QKUA 2J7KA 3A7DA 2GBPA 2RJ3A 4XSVA 2Z83A 3WWCA 4DUGD 4C3UA 3SX2A 2QIOA 4F4JA 5AVVA 4YO8A 4NAUA 2J0UB 2PUJA 5E7JA 2ZKIA 4JB3A 3ORHA 1WMAA 2PYZA 3ADKA 3EIOA 2H63A 4MLZA 4RA6A 4BQSA 1KE1A 1GQRA 3T7RA 3O92A 2QVXX 2CVQA 2GI4A 1V45E 2N42A 1RXCA 1DEAA 2NO0A 1VJDA 1XV5A 4M9SA 4BNIA 4GIBA 5K7SA 1LK5A 3SQDA 3UBMA 3SICE 3LMKA 5AI5A 4CQMD 5JH7F 3WP1B 4B2LA 2CJYA 2O0HA 4M76B 3RSLA 3R1IA 2H3HA 3CJTA 4RS4A 4Q4CA 1SVSA 4YRGA 3PPWA 5JO9A 9ATCA 5JSHA 2W2OA 3V1UA 3PK0A 1QRTA 1EB9A 3DAGA 3EH2A 3KB2A 1U6JA 3DULA 2Y0BA 4IDEA 1KEVA 1NDQA 1NZFA 1R16A 2AW5A 3L93A 1CLUA 3HMQA 3KZCA 2PX2A 2JGLA 2OLKA 4IDAA 2XXBA 4RL6A 3TLMA 4C0BA 1DIHA 1WIWA 4RZSA 5LP6B 3IODA 4GYKA 4Q12A 5IANA 2E7ZA 2PXCA 2Z2IA 2JFYA 2VK1A 1A4UA 3CKMA 4B2YA 4F56A 3K5WA 1J7JA 1N6KA 2ID4A 2REXB 5K0CA 3ZE0B 2OZVA 3ELUA 1USVA 2O57A 3H5WA 2PSDA 3S99A 4F72A 1K2WA 3FM9A 1AJEA 2RK4A 3MC1A 2R00A 1HPLA 3HY4A 1XQ9A 3RVJA 2R4TA 2OD7A 4G0XA 5EVCA 5TT1A 3PIRA 1C1DB 4EVIA 2QPTA 5TR9A 4HXEB 2WIFA 2SICE 3DXFA 1JN0A 3FGOA 1W5SA 3D2LA 3KJZA 1V6AA 3DWFA 3I2YX 4DCTA 3TECE 1SCUB 4BE7B 3ZVLA 1CP2A 1BQ3A 1ZDMA 1Q0ZA 2EJTA 2JIPA 1I0IA 3KYBA 2W2LA 4NFLA 1J25A 2C9DA 2NV6A 3CURA 1BVHA 1CU1A 1WP9A 4AMUA 3DC7A 2XXAA 4YJ2B 3K96A 1G291 4B40A 3O95A 4D57A 2R7AA 1FP1D 2C54A 1RTKA 3E61A 4R2LA 1RAGA 3PICA 3T7AA 1AKWA 3EAGA 3T7CA 4RPCA 1ZUD1 2D2VA 2OK8A 3SFTA 1BWQA 2X5JO 5JCOA 4O8ZA 4E1BA 1Y3IA 3MELA 1H6DA 4I2VA 3BILA 4KB5A 5GP1A 3V80A 3V8NA 1G7CA 1CTQA 2P41A 2BKXA 3GPCA 4P3XA 2D0IA 3HDQA 4LOLA 4ALJA 3Q2KA 3A58B 3EXFB 3V34A 4NU0A 2HA4A 1IMOA 1P4RA 3VDXA 3BULA 2HA3A 4QEKA 3VAAA 3KFVA 1GPJA 4ECEA 1ZSYA 2OMKA 2XZPA 4PRLA 5JSZA 2IIBA 4MB0A 3FCXA 2IYLD 2O1SA 2XE7A 2FRVA 1SKMA 2EP7A 1D6NA 2AEMA 3VR5A 1XOIA 2WAAA 5G4LA 1XTBA 1FVOA 2WUFA 1DUIA 4M7WA 3T3GA 2WVHA 2BGUA 3A1TA 3RAFC 1D6JA 4UAGA 1J2RA 3EMVA 4FE4A 1PK9A 1GTSA 4LV8B 2I62A 3L0PA 4W8GA 3DLPX 3MUFA 5DNVA 4QTTB 4N03A 4Y7CA 4JIMA 1TIBA 3GXBA 4ARZA 2AFIB 5DM70 3D0QA 4ARIA 4LJ6A 3LWBA 4MVJI 2ETVA 2XODA 3OLXA 2AGVA 3BMQB 5DGIA 3D6NB 3O2QB 4I7EA 4BZWA 1M8FA 2YMMA 1H8HD 3JYPA 1MZPA 1RC0A 3L4JA 3Q7QA 2PUWA 2QX9A 3U6BA 4LZZA 4RHXA 4ZGGA 4KSYA 5LR6A 1TW3A 2NT4A 3NVKI 3S81A 1MOSA 2GXSA 2O1EA 2QD5A 3HH8A 3QEMB 1ZNQO 1JA9A 3LXMA 4K2AA 3ZEAA 1SWWA 2BFBA 2O0KA 1MOPA 4MI9A 3P7MA 1IC6A 1PT8A 2ZB8A 4RHUA 3FUCA 4QHYA 3W05A 1NI3A 3IJRA 3ZV6A 3V8EA 1I7QB 1E3SA 1P2FA 1E5DA 3G2IA 3DWEX 5E1MA 5ILGA 4BBAA 1P72A 2G6BA 1ZOPA 1AN0A 5FB3A 4EPWA 1KIAA 3U1VA 3KM0A 1V4VA 5GOTA 3RUPA 1OAKA 4J4BA 2J3MA 1M6EX 3DE4X 1ISHA 1LRKA 2NQTA 1X77A 2QTMA 4TSKA 4G37A 4YJ2F 2YWDA 1JFFA 1QIFA 3TKYA 3FE2A 1YQTA 5J5VA 1V4NA 3WV5A 1QWOA 1K92A 4BMYA 3ZYCA 3DOOA 2GZSA 1UJBA 1NJGA 2I8CA 2YFKA 4MV7A 4BFSA 3FTDA 2C9OA 4CLXA 2Y3IA 3QEOA 4MQFA 1OZFA 4FNAA 4QOGA 4TKVA 3LP5A 4HWRA 4CIDA 2IK8A 3PGVA 2IX3A 1LFAA 1QO0D 1X8KA 3AF5A 3OE7A 3SSAA 5AI9A 4XQ0A 3SSNA 4E5UA 5LQRA 1ZOSA 3C3EA 5M3BA 3ROEA 4JL8A 2F17A 2JATA 5TB5A 4HGRA 4IHJA 4LGCA 1KVQA 1MOQA 3KZ1E 5B1DA 5ABPA 1IONA 3JYOA 3IPLA 1RZRA 1AF7A 4HZGA 3PI7A 4XGQA 4M1SA 2HHCA 3AI7A 3THXB 3KTAB 1XTKA 3VHXA 4TKLA 2PZLA 3HK2A 2FDCA 2CMFA 3F6CA 2BFPA 3LUKA 2WG1A 1SUAA 2ADOA 2FZEA 3VKUA 1PKEA 4DA8A 4E51A 2G1PA 4YXFA 2XJ9A 2GYYA 3N0TA 3IEMA 2EJUA 2WYWA 2PMEA 4YRRA 3PUWA 4JI1B 3RV3A 3SHQA 3UCXA 4F86A 1T24A 3T0IA 2IOFK 2A9RA 4R9SA 1ZKMA 2QNIA 2X1HA 3CF4A 5JCJD 3MOGA 2X14A 4HO1X 3H3FA 4MV1A 4HMQA 3ZKWA 1Z0SA 3NEPX 3P9ZA 4ZU1X 4TS3A 5DHFA 4MQ4A 3OZSA 1I94B 4JBHA 3H3JA 3DJFA 2GK7A 2RG1A 2QVYX 4IWYA 4AT1A 3AM4A 1Z8FA 1XPRA 1ZC3A 2C07A 3PNOA 4FKMA 3B9QA 4JP1A 2ZIGA 1G2QA 2X4LA 4OJKA 4DQUA 4GM1A 2W6ZA 2EATA 4M1QA 3PFGA 3QVOA 2J9YB 5DNAA 1J5EB 1ODKA 4UVIA 1NV8A 4W99A 2ZSUA 3LHSA 4DZZA 3U7EB 3Q12A 1M8JA 3CUKA 1F8FA 4R8LA 4TLEA 2FAXA 5GV8A 5I7HA 1GTRA 3STTA 4C6RA 2DKNA 1D6SA 1F1JA 1G18A 1MB2A 1ZM3A 2IOHA 2ZS8A 4PYQA 4WADA 4HATA 4PBTA 4UPEA 2AXPA 1W85B 2QRNA 4C4PA 1OFIA 2FPGA 2UDPA 1GZDA 3R7LA 3MGAA 1IXKA 3I3SR 1X15A 3F74A 3DS8A 3LXXA 1M2OA 5I7RA 5MF6A 3IOMA 1OLXB 3DFMA 3L40A 5F1OA 5LSAA 2CLHB 1ZONA 1HKHA 1ESNA 2H1HA 3EG9B 1C1XB 3P0EA 1VI2A 3QNWA 1UL1X 4PW0A 4C6HA 1JZTA 5BQ3A 1WF6A 3B1KA 1NA5A 4PO1A 3EH1A 1MU0A 1KYZA 3TL6A 4FOTA 3T3DA 3JS5A 3RYHB 1M2WA 4MS3B 3LCCA 3TIGA 1GGEA 1JG3A 1KGDA 2ZQYA 2FRDA 1ZCFA 4JASB 4RGBA 4UD2A 1I7NA 1OI3A 4UBOA 3TVYA 1H0SA 1K9SA 2EWVA 2WTXA 4ND8A 5F9HA 3H2KA 1EX9A 2FEXA 1TM3E 3B20A 3NOXA 1HV8A 1DEOA 1IJFA 1XLVA 3G2HA 5ANRB 3BRCA 4BGIA 4OHCA 1U5CA 1S5PA 4DLLA 3K05A 2C83A 3OOWA 1BKYA 4O4HB 1BXKA 2C82A 1VB3A 3B85A 4CL2A 2Q2NA 5T6MA 1CUFA 2CL6X 1BNCA 1CXZA 1NVXQ 1R3DA 1SVKA 4MGHA 1KYYA 4RY2A 4DG9A 4Q9HA 3QMVA 1CY2A 3EBPA 2BHNA 2TYSB 2MSNA 5F7OA 1E6WA 3MEQA 2HNBA 2VPZA 3OU2A 5KOIA 2EJVA 2IDJA 1JR4A 2OB1A 5DYGA 4ZXFA 4KYIB 4W9MC 5I4IA 4YC7A 4ZEWA 1W4RA 1Y6ZA 1MT0A 4FYKA 3UENA 3FMIA 1N6LA 5ECWA 5J4KA 3UATA 2X5XA 4HVLA 4DLVA 2FR8C 3N70A 4X1YB 3HFRA 3AF4A 2Y9PB 3RIGA 5HW0A 4J2TA 1HDZA 1N2CA 1IEVA 2SNIE 3BZBA 4FEEA 4J0EA 4MW6A 4U6SA 2NO6A 3C4JA 4LJKA 3BE6A 4PLYA 1K7XB 2OG2A 4CL8A 1M6VA 3TOXA 3C87A 2B20A 3AMVA 4HMPA 1ZKDA 3GFBA 1N9KA 1M1ZA 1RQLA 4DQLA 3WRXC 1RS0A 2QT0A 3FWYA 2GXUA 2X7XA 5EAIA 3NBZC 4P8RA 3HR7A 4JU8A 1C30B 1YA6A 4O0MA 5T41A 2CKMA 3CH7A 3PQ8A 2HMWA 1E7YA 1FDTA 4HAXA 3D6VA 2JNWA 1JLLB 2GGSA 3AVWA 1XMPA 1Q22A 5TV2A 2WE7A 3AY3A 1U6KA 5E9WA 4E7OA 4JI3B 2VBGA 2A1IA 1X0XA 1MX1A 1NSYA 1RLIA 3N7TA 3OZEA 1RADA 3QYAA 3L82B 4UU0A 5DDIP 4QWMA 3AJ9A 3GMTA 3G0CA 3TCXB 1OZGA 2R3SA 1G3RA 1YAHA 1OF1A 3A1WA 4GOLD 2YRXA 3OX2A 1YK1A 5GM1A 3RB8A 4CDGA 2NUPB 2ZOSA 4V24A 4NEQA 4D80A 4I14A 5CUQA 3PEWA 3WNCA 4BKQA 3MS4A 4F2HA 3CR3C 3E23A 5IMSA 3LYLA 1MP0A 4NKRA 2AL7A 2H0QA 5EMJA 4HRVA 3AP2A 1NP6A 3C3JA 3HB4X 3OF3A 3WQBA 4F3CA 4KNYA 1UDRA 2W48A 1DUVG 3FG9A 2ASVA 4GKJB 4JY7A 3DVRX 4RTRA 2CLKB 2X13A 3N8NA 1V5GA 2HMTA 2QIPA 3KXPA 3W5AA 3KJEA 4KQEA 4QDTA 2PUGA 4I9GA 4F3RA 3EWNA 2AZ4A 2ZJ5A 1DHRA 4YFYA 2EV9A 4M7RA 4FLFA 3S40A 4ALNA 4BZZA 5IJ0B 5TPWB 1IB6A 4RTNA 4MR8B 5AUOB 1E1NA 2G5PA 4YYEA 4X94A 3IR7A 1VLHA 4BS9A 4CMEC 1BS1A 2EJWA 2P40A 2C00A 2GM5A 4REQB 1RKBA 3RYTC 4OBBA 4LDJA 1NAIA 1L5SA 1QF9A 4MR8A 2IPOA 1DT5A 3K16A 5KYUB 5LFAA 3LH5A 4ILEA 2H5JA 2I2CA 3IXMA 2A9QA 1PGNA 2ZE6A 2OV8A 3C6KA 2YWFA 5GADl 3AVYA 3IJEB 1E7QA 2Q2QA 3KSAC 3U4GA 1WSWA 3ONEA 4J1TC 4TLAA 2YV2A 5M29A 1IHDA 2XUDA 5IAEA 5KSZA 2VHUA 2R11A 1D5CA 4X85A 2NV2B 2B6HA 1PJRA 2POQX 4X0EA 2ISCA 1JMKC 1H2BA 4CUZA 1VKNA 4CCSA 5EHXA 3IDAA 4F84A 4HQKA 5JSFA 1TEHA 5ELMA 1XIVA 2XT6A 5A03A 4G41A 4J7AA 1QS0B 5EL0A 4ZVSA 5I7SA 3OZCA 1KBZA 3IUJA 3GH3A 3R7SA 4YRAA 5EEGA 1XROA 1CUEA 2YY7A 3IB6A 2SCUB 4QPNA 5LZ2A 1GRVA 4FOLA 4LHVA 5DCWA 2XMZA 2NU7A 5DM4A 2PZGA 1LJUA 1PT9A 1I24A 1U98A 3U62A 4CNBA 2K7FA 5TC4A 4IZHA 5GWXA 2B7BA 4JA2A 1RWPA 1RAEA 2O07A 2AEFA 5LA6B 1OREA 3CEJA 2FOXA 4EB6B 5BP7A 3OKFA 4AUNA 1NIJA 1VLLA 4KITB 1NXSA 4D0RA 4DR5B 1U7HA 1OTYA 1OLXA 3HY6A 1I2BA 4HB2A 2N46A 3KV3O 1TD9A 2HBYA 3FSGD 4ON9A 3TOVA 1TAQA 1DIOB 4DCVA 3TLXA 1A9RA 5TQJA 4MUFA 1XVLA 4JLNA 5T4EA 3QPBA 3T4UA 1TTPB 1WEHA 3JQ7A 1IN7A 2W6QA 4IIJB 3KOWA 3KQVA 2OK7A 2ZZMA 5DX0A 3OT1A 1KO8A 4NDZA 2R4QA 1SWVA 2DAPA 3AJRA 3K0BA 3A6JA 4FCWA 1FNSA 1GGNA 2RGBA 2QQEA 4IJKA 3CCBA 1ZK2A 4L50A 1GQOA 3SR3A 3WB9A 5T64A 3IEKA 2G9VA 4P6VF 3GVCA 1HNZB 3NM5A 4KIUA 2OY0A 4FC7A 4NENA 1OTHA 3A4LA 3AR5A 1Q0LA 4RXTA 1H1LA 1L4YA 2ZSHA 1GFSA 1JVNA 1O0SA 2CMHA 4NE9A 5G41A 3TGWA 4Z3OA 3TLJA 4MPTA 4FWIB 4FZRA 1Z62A 1PWEA 1FOEB 3DCJA 3ZHQA 4IXTA 1H3NA 4AG5A 4ZOBA 4S3MA 1K88A 4LF6B 5ITZB 2BGRA 3I6BA 2DUWA 1W44A 2QYOA 3K70C 4UU8A 3FYHA 3G0HA 3RC2A 1NF3A 5CB4F 5K05A 4ASUA 4FFBA 5FWYB 3HNRA 2VJMB 3OX4A 4C76A 5J2UA 2V7PA 1BKSB 2PNFA 4WCVA 3QFCA 5FULA 1A88A 3BRSA 4E88A 1GPYA 5C4GB 1E0SA 4L28A 4RD4A 1RDFA 3EEQA 3EN0A 4D8TA 4DADA 4L85A 2HO4A 1QHEA 3RVLA 3RYCB 3NGXA 2FN8A 3E9QA 4GYJA 3QELB 4S1TA 1TYBE 3S5UA 1NVVR 2QV7A 3KV1A 4NICA 1N2EA 2PRIA 2OM2A 4W82A 1XX6A 2IZ7A 3B1XA 2IC5A 5LLDA 2QTRA 4ICIA 1XLWA 4H7DA 3WBKA 5EFZA 1EE9A 2D54A 4M0LA 2H0AA 5DXFA 2Q29A 4J43A 1KI1A 4MITA 3QE9Y 4D9GA 2HYDA 4RDXA 1IMJA 1QDEA 2HH9A 3AEUA 3GEPA 3E3AA 5HPYB 2C2BA 1NW5A 2JK0A 3QKTA 4N18A 5FI3A 4C0QC 1PSWA 4IXNA 3S2SA 1T9DA 1IEWA 3PGLA 5CD9A 4K9KA 3P0HA 4TV9A 3UYLA 4FPXA 2CDNA 2PVPA 2Y68A 4PGHA 2JVKA 5IG2A 1LCIA 2W2QA 4CUKA 3ER6A 1TZ2A 1XJ0A 3LX5A 4JC4A 3NWEA 2QLMA 3HJTA 4IMJB 4EG5A 1MVOA 1D2RA 3E9YA 4Q7EA 2PK3A 4C0SA 2BP7B 1A8UA 4C4XA 3ESXA 1JDNA 3L7KA 5I8PA 2HBQA 4LGMA 5K3OA 1GZVA 4MTLA 2H54A 4OX9B 1F8XA 1YBHA 4JL6A 3DQQA 4L76A 2ZZNA 1I3CA 2IPAB 3RFFA 3O6VA 1S9DA 4B82A 3P2OA 2CSXA 4ARSA 2D3TA 1RI1A 4YMTA 3PXBA 1EWVA 1E66A 5EP3A 2HLDA 3GRZA 3T06B 5AW0A 4NYMR 3X2FA 3EJWA 1FXSA 1LBEA 1Q5PA 2BEKA 2RKWA 3ROZA 5EKTA 3SHVA 2VNJA 4CM4B 3IC5A 3E35A 3ZGVA 3QVTA 5F76A 1GSAA 3C1UA 3OZRA 4YRTA 1E3IA 3Q8WA 1BRMA 3MA0A 2WAYA 5FF9A 3W1EA 3HM2A 2P0AA 3MT8A 5EINA 1JB9A 3GY0A 2GTIA 2BE7A 3CVOA 3DTTA 4NCIA 2LCQA 3ZPXA 3CWCA 4ZI3A 3C8DA 2BEVA 4C7JA 4HAUA 2QUKA 4ECAA 2EOAA 1WUHS 3C5CA 5JZMA 1B3BA 1T3HA 1Y33E 2X3FA 2BFDA 3A11A 4V02A 3LSYA 1U7TA 1X9GA 2Y27A 3QXSA 5PNTA 3U31A 4ZYXA 3OTOB 2ACKA 2ZITA 3DZJA 4WNAA 2E4UA 4RVGA 4W1QA 1ST2A 1Y1KE 3O1LA 4J9VA 4YMIA 5ALIA 4W5JA 2BHLA 1MEOA 1KQFA 1YE3A 1F2DA 4AVYA 4Y1FA 3DVSX 1LNSA 1Q74A 1CDEA 2X8LA 2VT7A 2WP0A 1GLGA 1U31A 1QUFA 2IYTA 4NAVA 3TE7A 4S1WA 3VV2A 3K71B 1JQJC 3CSUA 4R31A 1VA4A 2WQ6A 2CDCA 1T2NA 2PGXA 1QAMA 3MWGA 4HWGA 1E2FA 4DIUA 1Z4JA 2OAP1 3IILA 2UUBB 4YAUA 4OF4A 5JYBA 4EHLA 5JU6A 2IV3A 1RKQA 2G63A 5AFSA 3VO1A 2X9QA 2YOFA 3G13A 3L7CA 5GGXA 1KEKA 4H3VA 3O91A 4MW2A 4PIPA 4HDMA 4L15A 4JLUA 2FUCA 5C7OO 3LA6A 4ISBA 3VVLA 4C3OB 4HWKA 5DXJA 4O2LA 4A2QA 3BSYA 4CF6A 4WA7A 4NCBA 1YIOA 4RXMA 2ZUBA 2EW1A 1ID1A 2XVAA 4CHGA 4P36A 4BVFA 3ANSA 5FUVA 3BMCB 1VA5A 1O54A 3B9RA 3FMOB 3IHKA 4FJ0A 2WEKA 1T8RA 4UDXX 4BC1A 2GN9A 4RE5A 1U1GA 4EQ6B 4LOKA 3GAZA 4RACA 3LA8A 3ITKA 4H18A 4J3NA 2B1RA 3E3NA 3WL7A 2B8JA 2FQ1A 4IMRA 5BW4A 2FLVA 3PJFA 4EG0A 1DEXA 4F1KA 2MDTA 1OZAA 1ZLXA 2C3UA 4RUKA 3DWGA 1E2EA 2FW7A 4UKDA 2A5JA 3G2LA 2LXNA 2GN4A 2J9FA 1KQ3A 2WMOB 3OKCA 4RWEA 4CKBB 4YRZA 5KQRA 3QKRA 1QHSA 1SCAA 1MNAA 2ZK7A 1BHQ1 4DPKA 3WMXA 3CKLA 4OFBA 1PG0A 4IOJA 2CLEB 2JH9A 2NO7A 2CHFA 3C3YA 5NLLA 4WASA 2QF7A 1GG2A 3TQRA 4G0MA 1KBQA 5ALDA 4UBLA 1QFSA 1VE3A 2VSFA 3IP5A 1R7RA 5IDYA 4CIXA 4EHNA 4QC2A 2PR2A 2PL3A 3H2BA 1DG9A 4Z1OA 3WI7A 4IZIA 4IIXA 3FYSA 4UMDA 4A0RA 2HWYA 1SJ9A 4K9SA 5HFJA 2CUKA 1WZ2A 3OOEA 3DV9A 3IQXA 4JGIA 5AUPB 1XZGA 3LX4A 1XRLA 3UN1A 2ZIXB 1ZA1A 3LYHA 3RANA 3PC6A 4GLBA 1PL6A 4D81A 4XVUA 1Z6QA 3EIUA 3P0RA 4OGKA 1Y6QA 3AX6A 5ALMA 3STUA 5EJ8A 2GZ2A 1WW8A 4GPEA 1N8TA 3BT7A 1T10A 2GZDA 4GZMA 2WT4A 3PJGA 4OFZA 3HUDA 5KWJA 3VC3A 4B6EA 2BMJA 6ABPA 1B8UA 4AO8A 1GT91 1RYBA 4Y9DA 3GCWA 3DTYA 3ZWNA 3Q3JB 2WWFA 2IELA 2JZOA 2WNIA 1G64A 3ITDA 5B4TA 4GRDA 1SVNA 3OIWA 3M6MD 3LUDA 4KE9A 5FNVF 1SG0A 4DHWA 3AF0A 2YNMD 4KQ6A 5LP6F 2IBSA 1VJ5A 5CGQB 2RGCA 2X6TA 2EF0A 3VZBA 3PA6A 4BP9A 1U7PA 5JCPA 2BH2A 2FUG6 4Q4LA 3VUEA 2H2AA 2F1IA 1RRMA 3QVLA 1YU6A 2J5BA 2WUEA 5FOUA 2Q07A 4A8HA 3HJRA 3A3PA 4K9OA 2OCBA 2PUTA 4EBBA 3FNEA 3CB2A 5LYYA 3TLCA 1UKEA 4Y1EA 1KS9A 2VHQA 3UAWA 4BMOB 2BCEA 3PUKA 1CVRA 4RVUA 2HSGA 2VAVA 1V47A 2IW1A 2C20A 1A04A 2ZZKA 3LXUX 3D7SA 4CN9A 1Y34E 1VBNA 1Q1EA 5LWHA 2C7RA 1CZNA 1JEEA 1PS8A 1W8DA 2DPGA 2N3ZA 4GYWA 1YVUA 2IWHA 3V3TA 5FO1A 2CLFB 4Q4AB 4ZOAA 2PX5A 3AJEA 1R6XA 4TYPA 1APBA 4OHUA 4FMCF 2I4LA 1OILA 2QPOA 4ARAA 2PUFA 3DBIA 2O7NA 2Y0PA 4DDWA 4M6WA 1ABBA 1SQ5A 2V7QD 1Y80A 2WNHA 3FF1A 3V7YA 1E0AA 3FBWA 4U7PB 3TN7A 4JYMA 1EWYA 2AOVA 5L3QA 2I6GA 2XWSA 2XNDD 2FB9A 3CZ4A 3P45A 4MWOA 4LK2A 5JDCC 4Z4CA 1DPFA 1KYTA 4YDSA 5IX8A 2XNSA 4ZV9A 2GM3A 3GLUA 3WNVA 5LQMA 4X66B 1RYZA 4IZOA 4OIMA 4X95A 4IOMA 1PF7E 3LT4A 3DM9B 4U9UA 2XGOA 5FOWA 3WLIA 3ZBTA 1WZNA 3VKFA 2BI4A 2W6PA 3CBGA 2VH1A 2I7VA 2XOEA 1FXWA 3LKBA 4GOND 4PLWA 2E4WA 5LQUA 1BE8A 2FWJA 5DM2A 4D6YA 3D1JA 2PS0A 4FQ7A 1BFKA 3D3EA 3K1AA 1YJCA 4Q7LA 4XUEA 6Q21A 1EVIA 3AVXA 2CV1A 3HA2A 5BOSB 2GESA 3DAPA 3JR7A 1QK3A 5EJ9A 2BTOA 2YJ4A 3SCZA 3TG8A 5ALVA 3NWPA 4POAA 5C4IA 3UXEA 4GKKB 4YXWA 3HNOA 2HQOA 3MAAC 1MX5A 3LBYA 4C4SA 1L7MA 1X7XB 4B81A 2JLVA 3CVJA 1JDBC 4O4LA 4IH1A 4D45A 2NADA 3FZYA 2YDXA 1IXSB 1PN3A 1K5GA 1P9RA 2EZTA 2YYZA 3KB8A 4K81B 5EPUA 2Q2OA 1WNFA 2AVNA 2CDRA 3ZK7A 2OHVA 1T9AA 3KSBC 2FGKA 2KLBA 1J70A 1N2IA 2ILVA 2GJKA 4NHOA 1Z33A 1U28A 3BHJA 4YIHA 3O8CA 2A5LA 2AE2A 2JJ2D 4Y6LA 3IP3A 4AMGA 4POOA 2FZ5A 5JADA 3D3WB 2Q9UA 4A03A 1B7GO 2QW1A 3CW8X 3PGJA 3GQBA 5DOVA 1DRUA 2CC2A 5A5VA 1IBMB 4HWSA 1TM5E 5JPIA 3WGNA 4WI1A 1PJQA 2JB9A 5K45A 1EGQA 2RC5A 1IIBA 5E3IA 2IEIA 3KVRA 2WYUA 1JTFA 3UANA 5CHYA 3OQPA 3O8DA 4Q3OA 1I7DA 3TLGB 2N1MA 2J5KA 1QR2A 4KXLA 5CRIA 4ZI7A 1NNEA 1PK8A 1W1IA 1Z2DA 3TLZA 4UW9A 4G5GA 3OCUA 1RMYA 4TVKA 4EHIA 2H1OA 2WZQA 3F6YA 4QASA 3A26A 3CNQS 1KYWA 3KSUA 5IJ9B 1NVGA 1TCBA 3DEZA 1OIXA 1PLLA 3HEMA 1GZ5A 2WAXA 3WSWA 1T0PA 2X6QA 5JMWA 1Y3AA 5MGBA 1KK1A 2HIAA 3PNVA 2BZGA 5ILQA 2CL0X 3IP1A 4ZMSA 1N2SA 1S2MA 3KXLA 4WBSA 1QVRA 4ABYA 4UZFA 4YY3B 2ZEJA 4F38A 1B1CA 2ZRDA 3KK0A 1U2PA 3KYCB 4XWAA 2H9IA 1FSFA 2JFPA 3Q3VA 4OAPA 1WNTA 5GJVC 1FFCA 3JASB 2WPDD 4EAAA 2GNOA 4P1ZA 3LBAA 2BKLA 2FPSA 4UTRA 5IUNC 5KQMA 1MAAA 4ZDJA 5KZMB 1VIDA 5J2TB 5CJJA 3WK5A 4U8GA 4G63A 4NBLA 4NMXB 2QS9A 4EIWA 1MFPA 4YAGA 1BHJA 1WOYA 4PLCA 1B73A 1LC0A 2V7TA 4KDRA 4MZXA 3ZY6A 1KK0A 5KO2A 4LX8A 1A69A 2C7BA 2IE0A 3ZJYA 1OXTA 2O6LA 1UPXA 5AR1A 3VO2A 3A4YA 3K8OE 2IZZA 2NNLD 4FCTA 5IMBA 2ZROA 3DR3A 5KMGA 4OXRA 5GV7A 3U16A 3PLNA 1EFPA 1DI0A 1AHHA 2C1XA 1BXGB 4WVLA 1PFYA 2FN3A 3JARA 4MP6A 5CLFA 4NU6A 2FDRA 1YSCA 5LZ8A 2CEAA 3WG9A 3DPIA 3OU7A 2AF4C 4IIGA 5DNDA 3IUQA 1NMSA 1U1EA 3A6DA 4Q3AA 3KAPA 1KKMA 4Q24A 3RASA 2ZAIA 3UMFA 5KVSA 5IKOA 5T67A 4JMLA 2QLJA 3F7OA 5JAUA 3ZIAA 1Z4KA 3ON5A 5WRFA 1H2XA 3QFFA 3ZCRA 5DYWA 2JGDA 2W11A 2QAJA 1IEXA 5A4MS 1CPYA 1OROA 4CMGA 3T5DA 5BUSA 3FH0A 3DZKA 3P1JA 1JEYA 3JD2A 1BA2A 1Z6ZA 5BR7A 1IH8A 2VVTA 5KSWB 2X86A 4JJEA 1OFUA 1C3VA 2BFNA 2YBDA 2HHHB 3JY6A 2ZJ7A 5KTMA 5B3AA 2OECA 4I81A 1CG6A 1BSVA 3UZUA 1VHLA 4PLFA 1NATA 3U48A 3MAGA 1YB4A 1E0KA 3PP8A 4XZ3A 1J7KA 1S8AA 3FVVA 3PT5A 2OAQ1 1B2LA 2HA7A 1YHNA 4F3YA 3HWRA 3UV6A 4GMDA 4DQXA 3SBXA 1T8TA 2AIRA 1SOMA 3MLBA 1C4XA 3LF1A 5CT8A 5IRCD 3NT4A 1L0BA 5LZ5A 4L8GA 1SD5A 3L2OB 3P4UA 3VGJA 1JLHA 1QIMA 2DHEA 2PA0A 2B98A 3IP9A 4QYXA 1S2NA 3FFXA 4ND4A 4LVUA 1I4EB 1W36C 3N2EA 1DAIA 3NWBA 4TSFA 3SMVA 4BU1A 4CKCA 1ADBA 1DIRA 1HLGA 2FRXA 2ZRJA 2JGRA 5I7OA 1UM9A 1U11A 4DUPA 4GPTA 3UFBA 3I1IA 4TL9A 4KSCA 1CSEE 3WLHA 3P97A 4BL5A 4CM7A 4ER5A 1ODFA 3DAOA 3AO0B 1GCUA 2TECE 1TC1A 5BT8A 2UUOA 1MJNA 3U3JA 1X42A 4HD8A 3FSEA 4BJ5A 4XRGA 2ES4A 5A5DA 4HNVA 5K2OA 1NFQA 2CJXA 3CNOA 5D86A 1M5TA 2HTEA 1JPUA 4ALMA 5BMVA 3R6GA 2IZOA 2R79A 3WMRA 4RYDA 1U5BB 4IQFA 4KO8A 4ENTA 3N75A 4RK6A 7ADHA 1Z17A 5F23A 1JKJA 2XNCA 4M86A 5TPZD 1XHLA 2XCOA 4QXMA 2PY6A 1Q1BA 5D5PA 4U0JA 2V4ZA 4QLAA 5BN3A 1W7AA 4EX7A 2HHJA 5AK4A 3OQ6A 3HYNA 3SG0A 3ZKWB 3FZEA 1DXHA 3TXYA 4CF4A 3CONA 2HEIA 1UFVA 1YDGA 2EGHA 3HKDB 3QQ5A 2VDJA 3ZDFA 2YYYA 1CUWA 4KRGA 1C29B 5LOVF 2WM2A 1NVBA 1U3WA 3LQ2A 2E4XA 1Y1QA 2ZSBA 1EXVA 4A92A 3ET5A 2C2KA 3B6KA 3GZ4A 2J09A 1M54A 4Y2PA 4WXPA 3FVQA 4G25A 4NC9A 1S3FA 3CB4A 4DGSA 1D0IA 3A25A 1RLMA 5CEFA 1XRQA 3DOEA 4RH0A 2WTUA 4ZV7A 1P3DA 2WWXA 3CPEA 2VUUA 3IVAA 3UNXA 1XCJA 3PR1A 2D8MA 2QY6A 2VZ8A 2VXOA 4B87A 2PBFA 2CEKA 2H7CA 4PR3A 3QVSA 4MYHA 4XX0A 3UT6A 3WLRA 4EKDA 3H1PA 2IXTA 2QTGA 3TFQA 3W2TA 1DFIA 2WV9A 3HVHA 4OBXA 4BBJA 1VIMA 4C4TA 2A4MA 2XUIA 2EYUA 4OA5A 4TYNA 1CUDA 1KXZA 1UZUA 3ESRA 4FT2A 2Q3BA 3QX7A 1MVLA 4KAJA 4BDSA 1VQ1A 3UY4A 3M6FA 4RVHA 4JT4A 5GONB 3RF6A 2VH5R 1BKDR 1PYDA 521PA 3F9IA 1T5OA 1JMYA 1QH0A 3BWXA 2IQIA 3M6XA 5FL3A 1QQAA 2GCNA 2JVIA 2W8BB 4RCVA 3TTVA 2AKEA 2BVNA 1AZLA 3ANTA 1TM7E 4QT0A 4JELA 3FROA 3VISA 1X80A 4QICA 1DC6A 4XIYA 4BJHB 3WZLA 5AVRA 3EGWA 1OXKB 1F06A 4WLEA 3IV7A 5P21A 3CF6R 4I36A 5AH0A 1HX7A 3HCDA 1L6RA 5H80A 5KSYA 3MERA 3OZFA 4Y1RA 5EXXA 3DBLA 3OQOA 2WJJA 1SXJC 2VPYA 3OEED 2XBMA 4BMPB 1TU0A 3V2GA 2ZUFA 1O8BA 2G6TA 1YQWA 2IYPA 3RSCA 2ACWA 4WBNB 4GAEA 3GLFB 3BTSA 3IBCA 3ZUGA 1JQ3A 2IHTA 2P0YA 2ETXA 6PFKA 3NDBB 2NVOA 4A0FA 2PX6A 4NDNE 1ILWA 4KN5A 4I4LA 1B15A 1BX0A 6LDHA 3AIKA 4WBNA 2QM0A 3UUGA 1W75A 4P7GA 1TA9A 3FR8A 5THQA 2ACVA 2BM8A 2P90A 1N3IA 3FZNA 1U3UA 5HILA 3I2FA 4NBNA 2ALJA 2HQSA 4GXTA 3HWX1 1ENYA 3Q88A 5DE3A 2GARA 3OX1A 4M60A 4IXDA 5AW9A 3SP1A 3QJ5A 3WHIA 1NJSA 3ZE7A 4KLAA 1SBTA 4UVDA 4J0IA 4DRYA 1MB9A 2Y9MB 3CXUA 3GJ4A 5CMLA 2COKA 1Q12A 2H9AA 1V5WA 1T0IA 4GI2A 2PRKA 4MVJD 5ESWA 3SS8A 3HCFA 1OPRA 3TO5A 2I4NA 1XFAA 1G7TA 1HYQA 4KWEA 5IVDA 1NXWA 5JNSA 3L4KA 5GJBA 3OZUA 3NIFB 2VC2B 4HUQA 3U26A 2J3QA 1KETA 4PZUA 2VYFA 3V9AA 2PGNA 4WKCA 1HDGO 1WE2A 4TVOA 2YH2A 4X20B 5JC1A 1P4GA 3EXG1 4PQEA 1V0JA 3AW9A 5A3VA 2QTLA 1U90A 1D6MA 1EHYA 3L4SO 5IC5A 5IF3A 3OOSA 3UT5A 4A3SA 1KH2A 1LU9A 1GKUB 3HJUA 2XMDA 3WL4A 4H08A 2VNIA 3COWA 4UPVA 1Q3HA 3QKWA 2QG6A 5MN6A 1GNPA 3EY4A 4JVLA 2F3UA 2WFMA 1WW2A 3E9RA 1L5KA 2DLDA 1U3VA 1IOWA 1O9HA 3AJ8A 2OCGA 4LVCA 1PWXA 1Z28A 2WHXA 3FKJA 5REQB 3RVDA 3MQ4A 4Q4AA 3U1TA 1LV7A 1TZMA 2O0LA 3JAWB 5FL7A 5T6BA 1XMSA 1UUFA 3Q40A 1ISJA 2EFGA 3LI2A 3OD5A 4KRYA 1FK8A 5FPKA 5HMLA 2WSIA 3QWHA 3SI7A 9GPBA 2I1WA 1E63A 4YCMA 1WDKA 1B74A 9ABPA 3EY9A 3I62A 1WD5A 1SOWA 1XP5A 4JBNA 5AVTA 2VHVA 2ZVDA 3HJFA 3T7SA 3GLQA 4WNAB 2YCBA 4DDTA 3RVNA 3ZW9A 4L2IB 2FFAA 1QC5A 4KXUA 3SNHA 3EAFA 4Z3KA 3KB6A 4K05A 3UMGA 2WYHA 3IMKA 4MW4A 4BYGA 3JQ9C 1AKMA 1U0LA 4AMYA 3WGVA 1DWUA 1EK2A 3SKYA 1NUAA 2HDOA 1N4DA 3I2JA 4ZT4A 2QM7A 3ABZA 1F0YA 1CVLA 3HB0A 2RHBA 5LJIA 1ECLA 2B9VA 1VPTA 3M3DA 1E4OA 2ZKLA 3W5BA 3A3YA 3R5JA 5ALRA 3R6WA 3AR6A 2CLOB 2OYCA 3IESA 3FOCA 3IXLA 3M6UA 3ZHTA 5EQJB 4CV1A 1JHPA 1R6AA 3ETJA 1J2EA 3NDPA 4L5AA 2H5LA 3PXAA 4NNJA 4RIFA 1WABA 4MR9A 3H1AA 4YPFA 4A27A 3H42B 3FB4A 4OH7A 3ZNPA 2UUCB 4MI3A 1GZ4A 1PL7A 1QHXA 1L7DA 3PXCX 2BLNA 3IA2A 4RPJA 1G20E 3OHPA 4R1PA 4JWKA 2Y2VA 1MZVA 3WDKA 4ZK6A 2RBKA 4JSRA 1QONA 3RVOA 3COZA 3TUJC 3CA8A 2E1PA 3FDJA 5L95A 3EGCA 2GPBA 2G4LA 3NIDB 2ID8A 5JMPA 4FDLA 4E5SA 3TW6A 2YUIA 4FGSA 2F8TA 4ZVKA 4CXMA 4B48A 3T7DA 2LVBA 3I5AA 3LWZA 3KUXA 2WIAA 4ZREA 1Y6GA 1JS1X 2B2CA 1MTOA 3T9FA 1P0CA 4OHBA 4F4HA 2NZUG 4ROSA 2VJBA 3B1ZA 4RY8A 2B8TA 3W5DA 2BEWA 3JSAA 2PKQP 1JNXX 4C5BA 2I4IA 2DH5A 2O52A 4P3OA 5K9ZA 2P2CA 5K0ZA 1BXRA 2G9NA 1TM1E 3R6TA 2FZKA 4V0LA 4HAOA 2HV8A 4PHCA 5KTTA 3D54D 4TQGA 1O4VA 4TRNA 3VR2A 1PSDA 1VG0B 2P1DA 4GH5A 5FPQA 1N2CE 3WQRA 3IIIA 1QIKA 1X1AA 3D9QX 2QSUA 1BS2A 1FQOA 1SCBA 3CF0A 3DLTA 1X7YB 2Z5FA 3I6QA 3MAJA 1F4PA 4IQGA 4EVQA 1ULZA 4KTVE 1M74A 3DG9A 1N4AA 4NBVA 1Q6YA 1C81A 4KE8A 4AECA 2PMDA 3U49A 3VNVA 3BWYA 3EIFA 1OFVA 5IJWA 2PKCA 3OM0A 1JWBB 2UAGA 1QRAA 1SXJA 3E8MA 3MJSA 1ADJA 1RWKA 4URHA 4BWFB 1RHKA 4Y2RA 1IY8A 3ZNNA 5ICSA 2PYDA 4OMDA 2WJHA 3EGXB 3WLTA 2EG5A 3G9QA 4BNMA 4Z53A 1PT7A 1Z0ZA 2LZ0A 1K5DA 3PU6A 1F14A 2VPWA 3U17A 3UJ7A 2LKDA 2Q3LA 2PT5A 4CG3A 2VTBB 1L5OA 1YVEI 1A9OA 1DFHA 2EW2A 2XOKA 2Z1NA 4U7WA 4ESOA 3SM9A 2BKUA 2J67A 1TO6A 5IN4A 3MXTA 3HA5A 1CJBA 2R87A 3UMSA 3I1JA 5A4JA 1TTQB 4QNNA 2P9ZA 2QM3A 4D79A 2UVDA 1W4BA 3BN3A 3RI3A 2UYCA 4RDHA 1SELA 1G2IA 1J2UA 5TEVA 3S27A 5DN6D 3C7AA 3I4LA 1Y4UA 1JIKA 1K97A 4BNKA 4URZR 3JQGB 4LOAA 4PG4A 3NO4A 3FW1A 1GDHA 3L7AA 3O8QA 1FDUA 2I7DA 2IU4A 3DDCA 3I6ZA 4R01A 3BXGA 4XFJA 5GJWC 1GFIA 4HX2A 1CDOA 3LP6A 4AUMA 1WDWB 1X9HA 3OESA 5HSGA 5JXHA 3ONNA 1QM5A 2Y8EA 1IHOA 3F5SA 4WCFC 3WMEA 1UBMS 2FWNA 4HCJA 3ZDQA 1HRDA 1M2JA 5J63A 3L7BA 3P0IA 4DM3A 2HNKA 1GJRA 3IALA 3CCCA 4NBSA 1R15A 4LRUA 4BMXA 2UXBB 2DCUA 3E3OA 3FJ1A 3GJRA 4WDQA 1SU4A 3NX4A 1QB8A 1B8OA 5ER9A 5IM5A 3X1YA 1QTNA 1MAWA 2GD2A 5BNIA 5CFRA 5A5EA 2FPIB 3HDJA 3ZBPA 1BFDA 2JFHA 5B1HA 3LZCA 4OO3A 1ZISA 2I22A 1UEJA 2OUIA 4N1AA 2VHZA 3KEQA 5ETJA 3PQ6A 1OH6A 1XU7A 4RLQA 1TCCA 2XNKA 3NHRA 3K1JA 5A9RA 1CZHA 2JF0A 3KYCA 1YAJA 2HRRA 5DT9A 3ER8A 1G41A 5HJEA 2B5WA 4OBWA 4UTOA 1M1UA 1T9GR 1CFJA 1QQ5A 3UH0A 4DTIA 1NQXA 1G6KA 1T5BA 2QNBA 4H3SA 2RARA 1NY6A 1HEUA 4FYXA 1UBNA 1EGVB 4IHAA 5FLKA 4HDCA 4AB1A 4BFYA 4DQDA 4LYJA 4X1KA 1JI0A 5IUJC 3GJ8A 1IHPA 2FFRA 1RYNA 3DZ8A 2WC1A 3W8EA 4DREA 3K53A 1KZ9A 3G5UA 4DC9A 2XUZA 2JIBA 1U0BB 1LBQA 5A4AA 3JQCA 4XWTA 5AVYA 2A9FA 3R40A 3V1NA 4GP6A 3I45A 2P62A 3F98A 3QKIA 4LJ7A 1QH9A 3WMWA 1H23A 3B7WA 2Q4BA 1QQTA 2E21A 1B8PA 1NVUQ 2HJVA 2N75A 2F3SA 3BMQA 3DZCA 4S2EA 2K7ZA 3FR7A 3ZX4A 5JZ9A 3ZZNA 3GUVA 4NCJA 3GN2A 1RAAA 5HRAA 1VB5A 4IF6A 4JITA 4M0DA 5TGZA 1C0IA 2Y1OA 1JVBA 1A4RA 2QYTA 1X7ZB 1VRVA 5EYPB 3ZY3A 2FZLA 5G0TA 5CFMA 5LDGA 3HA7A 4HS4A 4AIIA 1UBEA 4PTYA 1U2GA 4MV9A 5TF0A 2IXFA 1E9CA 3ETLA 3G7UA 4AN0A 1SVWA 3LLUA 4OL0A 1QWSA 3M2TA 1OB5A 3UMMA 5E3JA 3BMXA 4Z1MA 1QZZA 1O03A 3PVCA 4KFRA 1UIRA 2IBMA 3FYUB 4B3IA 4YQEA 3DHVA 1QFXA 1CRQA 1PLKA 3KD3A 2M6KA 1MO6A 4AAYA 4DLTA 2BKAA 5DGHA 3HTXA 3ES9A 3TIFA 4W5RA 2UXCB 5K3AA 2ZB4A 5EHQA 1D4OA 3IPCA 3RVBA 3CX7A 2UZIR 3R5XA 4B3CA 2GUGA 1II9A 3UK6A 3CUTA 4LOJA 1JNYA 4U6NA 1ECFA 2ZRPA 5D6NA 3MWKA 3RS5A 2ZIZA 3W5SA 4CFYA 4A0QA 1ONPA 3ZV3A 2JGMA 3PDWA 4OFXA 1ETHA 4G8JA 2EU8A 3A28A 5AW6A 3LCJA 1S2DA 1O94C 1V25A 1Z68A 2NUPA 3MS7A 1N9ZA 4JROA 1WSDA 3BK1A 1PTJA 1ZLYA 3Q5EA 4ZPJA 1NYLA 4DWOA 4IDOA 4NE2A 3ZBQA 4FMCB 5EEHA 3W9BA 3W78A 1CUGA 3AVOA 1E5LA 1AKRA 3ZWQA 1T6XA 2HBRA 5CCXA 4G5SA 4HB4A 4EGFA 1CUAA 3DMDA 4P3NA 3MS2A 5JAIA 4B4VA 3UUEA 2ID9A 2A0XA 3U2QA 2RH8A 2IUTA 1XCPA 4QUDA 4PSDA 2WF8A 3IQGX 1L7VC 3UJNA 2VSNA 1XMOB 2P1RA 3CRVA 3AEQB 3LDUA 3R3SA 3GG9A 4E32A 4ZWNA 4O4HA 4QDUA 3W2EA 2HA5A 3QFRA 1OX4B 4LN1A 1RJ9B 4XI9A 1SXJB 1XJCA 3EFEA 2F8SA 2VPIA 2Z57A 1XEFA 4JMPA 1W73A 2JGFA 2LW7A 2ENUA 4CWAA 1Y0BA 2QY9A 4MA5A 2QX4A 2VP6A 3NXKA 4KXXA 5F2EA 2AI2A 4R5MA 4C01A 2AJ8A 3SBOA 1Q21A 1T8UA 3BRQA 1FS4A 3BWMA 4JEHA 2G8LA 5KNCA 1GLNA 2OO3A 3WKEA 3NU1A 1WUIS 3B48A 3GT7A 3WBFA 1PR5A 2ZM6B 1KMHB 3ECSA 4K9PA 1W47A 3QU5A 1TX4B 1XE3A 2O2HA 2WT8A 4YMWA 4CFSA 1O9GA 1ZC4A 5CJPA 3BCUA 1F3OA 1P74A 1T5SA 4GD3Q 1WQ4A 2YWGA 4PE5B 2HFJA 4UUAA 2AC2A 1E3WB 1M8GA 1X7DA 5HE9A 1J0AA 1T1EA 2R6AA 1HBJA 1R64A 1UPCA 2EW8A 3OETA 4UNSA 1QRRA 4XA8A 5EOVA 3BMOB 1K6EA 2CSUA 3AP1A 4RM3A 4RK4A 5EFOA 4DNQA 5LOVA 4B6OA 1HURA 5TJ9A 3D0RA 1AZTA 2R4UA 3BHNA 2EG9A 1RW4A 1XXHE 1HUQA 3AKCA 4W1SA 1GWNA 1Q7TA 1GN8A 4TTPA 4X63A 5AO9A 3EVNA 3FMGA 4BRWA 2ODTX 4WUTA 4AIRA 5BRJA 2EWMA 3LFTA 2ECQA 1AB6A 1YZYA 2WJAA 4NS4A 1TVEA 2C0PA 4QYMA 4DOMA 1J8QA 4JVOA 3I9OA 3ONVA 2FG7C 2TMYA 2XY4A 4XQCA 4YRFA 1YHYA 3F5QA 2VWPA 3R7BA 1VPVA 3UPDA 2C98A 1KKLA 2QW8A 3TAXA 1T2VA 3M4YA 2GBLC 1J56A 3GJ5A 3ANNA 1UPBA 5DOZA 3VZRA 1UKBA 1VCHA 4YRCA 4Z54A 3FHOA 5KTOA 1GXSA 1ZK3A 1CY0A 2X1LA 5IKXA 3BH7A 3P20A 3I34X 1Z6AA 3K9CA 3U7QA 5K09A 5JXIA 1H2WA 4F4UA 5JJKA 3RC3A 4IGKA 3EC2A 1Z7GA 5IKPA 1CUJA 2AQKA 3RYFA 1K0FA 1GXSB 3Q4GA 2CZQA 4ND2A 5NULA 2CWWA 4K8RB 3DC2A 2EFDB 3W1WA 4HUTA 5C7YA 3EZXA 4O2AA 4NZMA 4EAQA 1MO5A 1TADA 7GPBA 5HG0A 3SOZA 3TLYA 4MYRA 3VOBA 2WAOA 4RMGA 1NPTO 1AC5A 3ESQA 4PANA 2PTGA 2R5WA 3G1WA 1B6SA 4FGKA 4MGKR 1B6GA 1YGPA 3AUYA 4NOJA 4EQZA 2QAIA 5JNTA 2O8CA 2G77B 2YXEA 3N2GA 4P83A 1Y4DE 3L5KA 3RIYA 1RXYA 4YECA 1OA1A 3MNFA 4TMXA 1M3SA 1X2BA 3ZNOA 5B53A 2A9PA 4EY4A 3NBQA 4GI5A 4LYHA 1V6SA 3ZGOA 2H52A 4YJKA 4UM9B 1ZCZA 1UINA 3QELA 4O4JA 1LF5A 3HBAA 1J5PA 2G25A 2VDMB 3CVYA 2CYAA 3C15C 1GKYA 1NUPA 1QUEA 2DPLA 1JAYA 1Y5RA 3R3WA 4EP1A 5IDXA 2VF5X 4WESA 1LDNA 3CQ9A 5K0FA 2HT1A 1YRHA 2LTAA 2GMWA 2Z9DA 1KP2A 3ENNA 3ESYA 3K2IA 3W5JA 3MCZA 3MM4A 4BNYA 3DE3X 1F4VA 4ZHQA 2OWEA 3X1MA 1N6OA 3MUNA 2BCGY 4YN3A 3LUCA 1PZFA 1GZHB 2G67A 2ANBA 2VSXA 1RKXA 1ZU4A 4EHAA 2XXJA 2VDWA 1Z5VA 3L02A 1AK2A 3ICWA 2P5TB 2EXXA 1NR5A 3ENQA 1I0LA 2NT3A 4LZPA 4BZXA 3H4IA 3WGTA 4YGYA 2AX3A 1UK7A 3UHFA 1JDBB 2SKCA 2OOKA 4G85A 4MWGA 4MWBA 2GWHA 4WQMA 4RTOA 1RT9A 4MVJF 4NCXA 1MIOA 3SKXA 4BNVA 3DKVA 4UREA 4Q05A 3NOQA 5CIQA 3TOSA 1N78A 1L8AA 3KKKA 2J32A 4XCXA 5JFOA 2QJRA 3HFGA 4YALA 1H4QA 2CFCA 3S5JA 1AK9A 1Y98A 1EBBA 1AB5A 2I4OA 4REOA 4DT1A 2I55A 4AMVA 1Z8HA 3NOVA 3I2GA 3PYMA 4YV7A 4I1IA 1CUYA 4LRSB 5F3RA 1NXOA 4YWHA 4FEGA 4EPRA 1PTJC 2O8VA 4RKRA 2YWHA 3GFPA 4L16A 1WSAA 3HXOA 1RXVA 1J8VA 3DVQX 3U0BA 3VNRA 3OM9A 1SURA 3ETGA 3PEUA 4OLHA 2LDXA 4MAMA 5ELLA 5EMKA 5DYNA 4OYHA 3A3NA 3F5FA 1YJAA 2DWUA 1P5HA 2BEWB 4I1VA 4UUOA 5BV0A 2YJGA 1H2EA 2IXEA 2BD0A 2YYAA 4YP1A 4C89A 1OV4A 1JXAA 3AVUA 5EJ2A 2WM8A 2DUMA 2DWOA 1FUKA 1W9MA 4H3KB 2GJ8A 1AKVA 2EYQA 4YRLA 4AJLA 2CVPA 3PNYA 1TQDA 1SXJD 2IE8A 1YCGA 3L8CA 3S1LA 2I5PO 1KMNA 3G7SA 3LQYA 4ALIA 3PBKA 5C8DA 1I9CA 4XSHA 4Z0HO 2P78A 3BWVA 1NLYA 3USES 3VYUB 4UCXA 4BB9A 1L6IA 1GL3A 3GEEA 1GUYA 3T1OA 4CIWA 5I9IA 4P84A 3TS1A 5KJ6A 4N7RA 4UVGA 5CB4B 4ZQCB 4E4RA 4GM0A 5DN9A 2W0MA 2YZ7A 4Q1EA 3L8MA 2N47A 1KMIY 3K8ZA 3U6KA 1FVXA 3EZ9A 3JARB 1SO8A 1WDTA 1DARA 5TQ2A 1JPVA 1M73E 1IZ7A 3B70A 4RE6A 3PVZA 4JD5A 4C4AA 1KSGA 3VH4A 4A0GA 3LO8A 3O8BA 2PVCA 3K9BA 2FPOA 1WUJS 4DMCA 3FZQA 5HRUA 1RPAA 2R6HA 3PC8A 2FEKA 2CKDA 2HSWA 4ZOLB 5TMPA 2NVUB 1XZQA 4YRKA 3V4FA 3E1SA 2OQIA 3ELYA 5SYAA 4CN8A 3WQHA 4D9HA 1XYGA 2H4HA 4L5YA 3R3YA 2QLLA 4UNPA 1RAIA 4ZHQF 5CCEA 3PNPA 4MPJA 4HVAA 3VVMA 2VYVA 3W5VA 1BYUA 2CFIA 3HI6A 4YCDA 1UP6A 1L5HA 4DG8A 1EESA 2WB4A 3C8UA 4QRHA 2PS3A 5KU7A 3E58A 4OUKX 4B31A 4EQ6A 2V6GA 5JYCA 2X6RA 3GFSA 3QFTA 5DCLA 1R0SA 1UXIA 1P75A 2BSAA 2FVYA 3CZ5A 4INJA 2Y1XA 1GQSA 4D9CA 1UM8A 3R74A 2XIJA 3UCEA 1CUVA 3CWZA 3ZWAA 1ZR2A 2FGJA 3BRWD 4EVRA 4V1CB 4A8JC 4ZI5A 4CGYA 1DKPA 2WM3A 4H1WA 2JGKA 5FAXA 4RZHA 4QM7A 2Q1SA 4P5DA 3H1BA 3HY3A 2H8GA 1J23A 3KDPA 3MJFA 5FOXA 1SRQA 4KAAA 5CW2A 2Q7DA 3G9ZA 1SVOA 4V2UA 5I9TA 4BBZA 2ONCA 1HETA 2O06A 3QF4B 2J6HA 2BEUB 2BFFA 4F5DA 1YQEA 2F62A 4ZDKA 3EF1A 1KVSA 4L4SA 3PXXA 4IUDS 2G06A 2ZANA 4D9IA 3OM8A 4YMSA 1NOJA 4MKRA 1GSHA 1YQUA 2HR1A 3P9YA 4LGYA 3Q87B 2JCGA 1G5HA 1CZKA 1GPLA 3NQ41 5JTUA 4UE3S 2BIFA 4MHTA 4I1SA 3ZHRA 1FTNA 1KEPA 3TOZA 2QJWA 2I7XA 1C3OA 4QKQA 3OIYA 2YZ2A 1H6CA 3QVMA 1SQ0A 3EGXA 4PX9A 5ITVA 1E2MA 4BNTA 1EQAA 4N41A 2VJPA 3SF8B 5IULC 5JS1A 1PGQA 5L7WA 8GPBA 3KZKA 1DQRA 2FR8A 4B3SB 1SUBA 10MHA 1CUBA 5KNBH 1A9PA 1OXMA 2MSWA 4Y2VA 5E2IA 3O8RA 1DBSA 3GG2A 4Z9BA 4H27A 5BN3B 4G3XA 5C8YA 5KYKA 1JHAA 3AUXA 1UEIA 1N92A 3NTVA 2HU7A 5KTNA 1WB9A 1UJ6A 1U5AA 2HWWA 4OQLA 2WB2A 4BKPA 1NMEA 2CXRA 5MDHA 3L1JA 4LZOA 1N3LA 2WFAA 2JAUA 1IUOA 4AN1A 1AMUA 4KKVA 1IXZA 1YKSA 3II6X 4L72A 2Q1YA 2HLPA 4MMZB 4ZO8A 2OB2A 5IXSA 2BTQB 5A62A 3M33A 2JFOA 4QYWA 3KPYA 2P79A 3OCYA 3PDCA 3GLKA 2VT2A 2O7QA 1G21A 4PYRA 5CAEA 1KJWA 2OGSA 1CIPA 1NNI1 1DIAA 1X7HA 1YUNA 2NLOA 2QRQA 2DTDA 3SJCA 4L5BA 5IT5A 2PEZA 2B34A 2HV9A 4LSGA 2AOXA 4OOEA 3QI2A 4B7UA 1OBCA 2PKEA 4I2NA 3ROTA 4BO5A 4BEBA 5BO5A 1U2RA 2NU8A 4NY1A 5AVSA 1GPAA 4FHEA 4P31A 2P67A 4QTUB 3TTXA 1UKAA 5A2QA 1TIPA 2YZNA 3IA7A 3LAWA 3ZI0A 4HXGA 3K1ZA 2JLYA 2YC4C 3DT9A 5ESXA 4D42A 4DE5A 3HCRA 4DJJA 1G6OA 1FYVA 1LBTA 1UWKA 2PDAA 1SCDA 4JSYA 4R1NA 2C29D 4TM7A 4B3RB 3KYJB 1BEZA 5JBNA 3OFSA 1BXRB 2GF2A 4AP9A 2R6ZA 4BBPA 1NN1A 1H5NA 2Q50A 3LTEA 1QGZA 2DVMA 4JJFA 3PTAA 1KSJA 2RHOA 1GKIA 1YCFA 2F48A 3VH3A 3A04A 2Y0EA 2YWCA 3COVA 3LSTA 5G3ZA 2Y66A 4CE6A 2CL5A 2PXHA 4FGZA 2RKBA 1F12A 2AI1A 4RMNA 5ES3A 3UK0A 1WB6A 2J6IA 4BNNA 1P2TA 1ODCA 3OECA 1GZUA 3GOQA 4EA6A 4Y9TA 3KBOA 3A05A 3BB1A 2OL4A 1VL2A 2VXCA 1A3CA 2XXAB 5FUYA 1H2FA 1XTSA 3MD9A 2O7SA 4EPYA 1LW7A 1Z0AA 2IP4A 1W88A 1Y6FA 4K0KB 5JD5A 3LVRE 3ONWA 5JLJA 4X54A 4QSMA 1IY0A 2I1VB 1MF7A 1ZK1A 2SKEA 2E1RA 1GQYA 3N8HA 4HZUB 2G4VA 5IAGA 1R9MA 2WSBA 1I3KA 2DKOA 2CHGA 4UXIA 1M1NA 3HJCA 4Z0PA 2IV7A 2C57A 3IAS1 3UHJA 1FW8A 3GPBA 4AJ4A 5IVPA 2CHEA 3KOXA 1MW8X 3PE4A 4RTQA 1V1RA 3T1QA 4DYDA 3GJ6A 1E6CA 2PZFA 2WHEA 2O2XA 2J46A 3PZBA 2VOJA 3GUHA 1WDLA 3SLGA 2G28A 2O50A 1RXEA 4EK9A 3MBKA 1Z5OA 1E6LA 3EQ9A 3HP4A 3B8EA 4CTNA 1DRVA 2PMFA 2W6CX 4GICA 3TGLA 4II3A 2DXIA 1RLOA 2OZEA 5CBPB 1VIYA 2ZDHA 3OJFA 5CFLA 3HN2A 3NBYC 3M2PA 1TGVA 1RHMA 1UDXA 4B75A 2AF3C 4YJFA 5HQ3A 3M3HA 4X3CA 3V1LA 2WVAA 3I23A 3PLRA 2OXFA 4IUBS 4ALKA 2JFXA 3TAUA 3EDCA 1NM5A 2ZRFA 1A76A 3KYDA 2GA8A 1FDVA 3DEJA 3N39C 2RAFA 1ISIA 4WLNA 5LC1A 3WGMA 1YR1A 2HQBA 4FP9A 4RZ2A 4MGZR 3Q8LA 5JXWA 3I42A 3B5JA 4JGGA 4KQ1A 4BGUA 1UWLA 1VPDA 1YXMA 3VYSB 3BKWA 3NCTA 4LBYA 3SZOA 3S8YA 4LFBB 1XF9A 2JW5A 5MN4A 3NMUF 4BFTA 3R20A 1TVKA 1JQDA 1N34B 3IO3A 3L7MA 3B78A 5AJZA 3DBHB 2UZ4A 2QMYA 3PUHA 1XKTA 5CLLA 4DA7A 2H9YA 3EF3A 2BFBB 1T6BY 4KMRA 5BSKA 2WPNA 3RRBA 4OB7A 4PONA 4XD2A 2IIQA 3QU4A 5DTRA 3DVLA 1B93A 1VJ0A 3EDYA 3FNGA 4GZ6A 1BEEA 4RAOA 3SR0A 3WOHA 5J2UF 4DV2B 4WKNA 1G8PA 1U8EA 4PSCA 4TLLB 4ZPXA 3G23A 4YRPA 1UXGA 4NJMA 4XYMA 3VKHA 2V7UA 4OPMA 3INRA 4BO4A