4D5HA

Focal adhesion kinase catalytic domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
272
structure length
255
Chain Sequence
b'YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 79
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d5hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d5hA01
3UQFA 2X8DA 4U7ZA 5D12A 5IA5A 4HZSA 4C2WA 5I9YA 1YXUA 4LFIA 4FZ6A 2UW4A 3ZUVA 4NKSA 3H9OA 4M3QA 4NSTA 4YHTA 3HRBA 3OBJA 3W2PA 4EOSA 3HV3A 5C9CA 4GL9A 2ZM4A 3Q04A 4FKTA 2IPXA 5HKMA 4L45A 2VU3A 3O7LD 4BTJA 4F65A 4TYGA 3QLFA 3ORXA 4ZMEA 2R3MA 5L6WL 1DAYA 4NTTA 2IVVA 4EOJA 5KX8A 4I4FA 4I6QA 2YDJA 3D5UA 4G3FA 1Y6AA 4RC3A 4FTAA 3ZC5A 5IH4A 5JQ8A 2BRHA 2X6DA 4O86A 2YZAA 4IB5A 3QTSA 2Z7LA 3O50A 4X7QA 1OGUA 3DY7A 1G8SA 5KKRC 3A99A 5LCKA 5B2KA 4AOJA 5BYYA 5I3RA 5LVNA 3R9NA 3H0YA 3I6WA 3NCZA 4GYGA 3VS4A 3PLSA 2WMTA 3ZO2A 4CMTA 4J53A 4QYEA 4L7SA 3NUXA 4YLKA 4XG8A 4EL9A 3A8WA 5FBNC 2PPQA 4AT5A 3C4WA 4BCMA 4QPSA 4QMSA 1RE8A 2HIWA 2OIDA 2VTHA 3NVMB 4UMRA 2VTAA 3BV2A 5AUYA 4BKYA 2W1DA 2J0IA 1Q41A 2NPQA 3F3TA 2YIXA 4ZJIA 4E7WA 4XEYA 2YDIA 2OJGA 3QRUA 4JRNA 5AUTA 3OWPA 3PVUA 4O82A 3FHRA 2YLFA 4M8TA 4NEUA 3VWAA 3E7VA 4O0XA 4BRXA 3F3WA 3EQDA 3RCJA 1Q99A 4YSJA 5HTCA 4IC7A 1DI8A 4HGLA 4GIIA 1FVRA 3TNPC 4EYMA 2GNIA 4LM5A 1KE8A 4LV8A 4DG0E 4JJRA 4FIJA 5HU9A 3KRRA 3WZJA 4BFMA 3DDQA 4I20A 1QPDA 1PYXA 4ANNA 4J95A 4TY1A 1BI7A 4FC0A 1J91A 2BHEA 3DJ6A 5HQ0A 5CQUA 3BHYA 3G51A 5D11A 3DQWA 2W17A 4NIFA 2QCSA 3UP2A 4AP7A 2WMUA 2R3FA 3ZSGA 4RLKA 4ZY6A 1H1WA 3TG1A 4V0GA 2WTIA 4W9XA 3QKMA 2GPHA 4YUQA 5E8WA 1ZXEA 4BGGA 4TZRA 1UU9A 2QHMA 3ACKA 3QTWA 4IADA 4YJUA 4YZNA 3QTRA 4Y73A 2WQBA 3O0GA 4QT1A 3W1FA 3SVVA 3GCQA 2E9OA 3DFAA 4JIKA 3KEXA 4V05A 3ZLSA 2J50A 3VC4A 4ZEGA 4JDHA 4F0IA 2QOLA 4ALWA 4PRJA 2P55A 2BTSA 5LMKA 3PWYA 3BGPA 4EWQA 1OUKA 2JAMA 3HMIA 4L8MA 4DFXE 3SC1A 2E2BA 5IH6A 3DXPA 1JSUA 3GOPA 2XKCA 4HNFA 3WF6A 5IKWA 4DG3E 2R3OA 3ZUUA 5JRSA 2XK4A 3P7AA 1OBGA 4IFCA 1KOAA 4YPSA 3QAME 4RT7A 2JDOA 5CASA 5KO1A 2OXXA 5HD7A 2PY3A 1U54B 3KMWA 4IDTA 5I9VA 3QC4A 3UMWA 2RG5A 3QZHA 3IKAA 4PL4A 3IO7A 5F95A 2IG7A 3BLHA 3DDPA 2B9IA 3ORTA 4FKOA 3NUUA 3PXZA 4HOKA 4BBEA 4DG2E 5JFXA 5LVPA 3VIDA 2ITTA 4QP1A 2QONA 5HD4A 3KL8A 2QOFA 3NSZA 5KKRB 1MQ4A 1ZYDA 4Q5HA 5CX9A 3CKXA 3F3VA 3JPVA 3QFVA 4YZ9A 3TJCA 4BR3A 4CGAA 3FHIA 4G9RA 4E5AX 4YU2A 5TR6A 2O0UA 3BCEA 3KXNA 5CEOA 5HO6A 4MEDA 4UYNA 4BZNA 3FI3A 1OL1A 5CALA 2W4KA 2XIKA 3IOKA 4FTLA 4FSRA 3BLQA 5DVRA 4N6ZA 3RNYA 4XOYA 3GCUA 5J79A 2XBJA 3NAXA 2R2PA 2W9FB 4GU9A 4HJOA 4Y83A 4YZDA 3F69A 5L2IA 5BMSA 2VTNA 4WG4A 3BRBA 1U4DA 2CCIA 2F7ZE 5IISA 4XG9A 5EKNA 5DT4A 3DB8A 2BZIB 3PRIA 3PYYA 4H1MA 4X2JA 3W2OA 2GHGA 2BROA 2RF9A 4FYOA 3NZ0A 4MAOA 5CVHA 4E6AA 4EZ3A 4CLIA 3A62A 3QGYA 3MFUA 4S34A 2Y0AA 4BCGA 2BFXA 4O96A 3RM6A 2X7FA 2ONLA 3R8VA 2C30A 3RALA 5ETFA 3ZO3A 1TQMA 5GINE 1SVHA 5C8NA 5JRQA 3FY2A 2YA9A 3CIKA 3E92A 4Q5EA 2ITXA 5GHVA 2HY81 2GCDA 4MQ1A 3AGMA 5BUEA 2VTTA 4DEAA 4ERKA 4RFZA 4FUXA 4ZOGA 3DCVA 5FM3A 2HZNA 2UV2A 4W4VA 5CVFA 5DN3A 2O3PA 3OD6X 5BVKA 4C36A 4FV8A 4G2FA 2QQ7A 4LRMA 3ZZWA 2YLEA 3EN4A 4RWLA 3UIUA 2AYPA 3AT3A 2W5BA 1H0VA 2VWZA 3GUBA 4L42A 2Y6MA 3RK7A 3LXLA 1W98A 4D9TA 4R5YA 4QOXA 5JH6A 1Q62A 4WG5A 5FXQA 4BB4A 3SW7A 5CU0A 3MTLA 4OW8A 5CF4A 5F20A 3FI8A 5KMKA 1AQ1A 4A9YA 4DEGA 3TNIA 3DFCB 3C0HA 2R0UA 5DYJA 4R3RA 4FKWA 1PMNA 3AD4A 4N70A 3V5PA 4EOLA 5JGDA 4FEVA 4MKCA 3UNKA 4RJ5A 3LFBA 3FKOA 3KB7A 3MBLA 5FEQA 3R9OA 3SX9A 5CTPA 4RJ3A 3P5KA 3PPJA 2XP2A 4BHZA 3BYUA 4KABA 4CRSA 4ZMFA 3PA4A 3WZDA 4TNBA 4YTFA 5M08A 2XNMA 2OJFE 5L2TA 4PP9A 4ANSA 3JR1A 2IVUA 1PY5A 3QQJA 3WILA 3JY0A 3Q52A 4G9CA 2B0QA 2PMLX 4BYIA 3EQPA 3MVHA 2JC6A 2WKMA 2WELA 3LLTA 3W2SA 1XH6A 2UZTA 4FSWA 4NFMA 2VTRA 3R8MA 3I81A 4DH1A 3R9RA 2QVSE 2H34A 3EYGA 4XV9A 3RTPA 5DGZA 5FGKA 1MUOA 4WNPA 4XP3A 1JOWB 5HE2A 4DGMA 4NZWB 5BX0A 2BDJA 2W1HA 3HVCA 4I4EA 1V1KA 2X2LA 4BDEA 1FBNA 5I9ZA 2UW5A 4O91A 4BDGA 2PVLA 2WU7A 3KXXA 3Q4UA 4QMTA 2IVTA 3VS5A 5DLSA 5FP6A 3E62A 2W4OA 3ENMA 5FEDA 4EHEA 4RVKA 3RAWA 5E8UA 4CV8A 4D2VA 5J87A 5IU2A 4D1SA 3NUAA 2H6DA 4FK6A 4FT5A 5B0XA 1BL6A 4F6WA 5I0BA 3FMLA 4FKRA 3WF8A 2EXCX 5EQPA 2PZYA 4BDBA 4E4MA 4KIKA 5HTBA 1KE7A 3JUHA 4NK9A 5T6KA 4ZAUA 5AP2A 3MWUA 2JD5A 4YO4A 4PF4A 3VUIA 4GV1A 4IMYA 2ZV2A 5M07A 4L67A 4IWPA 4IAKA 5AV1A 3LXNA 1M2RA 4Q9ZA 3DB6A 3CBLA 4AZWA 1PXMA 4FSMA 4FNXA 4EWHA 5HI2A 4ZSGA 3UIMA 3ODYX 4F6SA 3HRCA 3VJNA 5HCXA 3JXWA 3R8PA 4O83A 5J7BA 2XUUA 4LMUA 3NVKI 2IW8A 3ATTA 4F4PA 2GNHA 5J9LA 2HWPA 5DWRA 3V6RA 2C3KA 3V01A 3ZLXA 1EH4A 4FTOA 3PJ8A 4UB7A 1Q8ZA 4DGNA 4KD1A 3I7CA 2BPMA 3RWPA 4DN5A 2QU6A 3HV7A 4BVUA 2JKKA 4CFVA 4I6HA 3O51A 5ETIA 4L00A 3HNGA 4D0XA 3CEKA 4AZSA 2OO8X 4I3ZA 3WF9A 5LMAA 1FGIA 2HOGA 3Q4CA 3DLSA 4LUDA 4N6YA 2HY0A 3VQUA 3ULZA 1OL5A 3KK9A 5JQ5A 4G3GA 4KRDA 4BKJA 4AGDA 4HGSA 2OU7A 4K33A 4GYIA 3UG2A 3CY2A 4QPMA 5A4TA 4WNKA 4M67A 3H0ZA 4HVGA 2JDSA 4R77A 4FOCA 3EOCA 4EQMA 3P9JA 1ZOHA 3QRJA 4TWNA 1OKZA 3CJGA 3LOKA 3O71A 2OW3A 3GU4A 5D1JA 3RHXA 3SW4A 2C5XA 5JK3A 4HCUA 3KGAA 4WSQA 5D9HA 4X6QC 5A3XA 5IZFA 4ALUA 1MRYA 2PHKA 5EI8A 4QNYA 4UX9A 4KIQA 4S33A 3BI6A 4XV2A 4JNWA 3PIYA 4II5A 3PXYA 2ERZE 5DR6A 4U44A 3DZQA 2XB7A 2J7TA 4FV2A 3OCTA 5DFPA 3TL8A 1PXJA 3UVQA 4JT3A 3KRXA 3LFNA 5TF9A 4AOTA 2XIXA 2VGPA 3HDNA 4DLIA 5IQIA 4EOIA 4C3RA 3D15A 5CEPA 2REIA 4I24A 2G2IA 2PVJA 5ACBC 1JPAA 1T46A 4OR5A 3FZPA 3PIZA 2B7AA 1KWPA 3Q2JA 4IH8A 4MD8E 5L2WA 4JQ7A 4YLLA 2LGCA 4D2WA 2QKRA 5HVKA 2BFYA 5CU4A 3P0MA 2WU6A 5EK7A 1PXPA 2Y7JA 4ERWA 3FDNA 2WMQA 1MQBA 2E9PA 3QCQA 5ETAA 5M4FA 1WBPA 1ZYLA 3K2LA 3SXFA 4B4LA 2F7XE 4F0GA 5JFSA 1P2AA 1ZOEA 2Z7QA 3VUGA 2HW7A 4L3LA 3OTUA 4BWXA 2RGPA 1L3RE 3RWQA 3UBDA 4EH8A 3H9RA 2HYYA 4J98A 3GU6A 4LGHA 4R5SA 1UWJA 2HW6A 2XVDA 4JBVA 1ZY5A 3U9CA 1K3AA 2Y9QA 4IX4A 4DCAA 2ITYA 3OS3A 1UU3A 4FTIA 5CNOA 1ZZ2A 2C3JA 3PTGA 2GTMA 3Q5IA 5EG3A 3KULB 4RRVA 3W55A 4O0UA 5C26A 1H00A 3FUPA 3PG3A 4IX6A 4Q2AA 4C35A 4FKLA 4QTEA 3IW5A 4G1WA 3O23A 5AUWA 4JL9A 3DTCA 1H1SA 4QTDA 2GNFA 4CG9A 1BUHA 2UVYA 3R22A 4K2RA 3UTOA 1QPJA 4HVHA 5H9BA 3AT4A 4FV4A 3R1QA 4NCTC 3C4XA 1AD5A 1T45A 4QMLA 1UV5A 4FEXA 4J8MA 3DZOA 1V0OA 4RWJA 2CGUA 2W05A 4KUJA 2AC3A 4O6LA 4TN6A 4D1ZA 1J7IA 3ORIA 5HIEA 1JKSA 3TV6A 3D5VA 4Y5HA 3REPA 4M68A 2BRGA 4EZ5A 3LKMA 5CS6A 2PZRA 4XOZA 5AFVA 3QX2A 1CSNA 4USDA 3VHKA 3I79A 2QLUA 3CGFA 1FVVA 1R0EA 1YHSA 3U4UA 1OPLA 5CSXA 5EDPA 5C8KA 5I9XA 3CSVA 4O38A 3SG8A 3PPZA 5DH3A 4D1XA 3QQUA 4FEQA 5A4LA 3DT1A 5DG5A 2O5KA 1O6LA 2PZIA 4OTHA 2CKQA 4R7IA 4XCUA 2BMCA 1L8TA 3KF7A 2GQSA 2X9EA 1GIIA 2ERKA 5IEXA 2OZAB 5IQFA 4N57A 3ACJA 4XRJA 2XKFA 3UPXA 4XG3A 3W2CA 2YHVA 3R73A 4E20A 1XH8A 3FZRA 4OTDA 4Y72A 2Q0BA 4DFNA 4XG7A 5EDRA 3U54A 5F94A 1AGWA 3CTHA 4IB1A 4TYJA 3W8QA 5AP7A 4IM2A 3LM0A 4ZTLA 3OUKA 4I23A 1WBOA 3QQHA 4MH7A 4V01A 3DPKA 3AMYA 4EYJA 4H05A 4E6CA 3TZ9A 3V5JA 3S4QA 3PP0A 5EFQA 4CKRA 2R3IA 4IIRA 4HYSA 3D2IA 1WBSA 1M2PA 4XNEA 4FGBA 1NY3A 3LMGA 4FTTA 2R5TA 4GEOA 1E1VA 5JZJA 3E8CA 3DV3A 5CXZA 4UXQA 2CKPA 1RJBA 3Q4ZA 4ZS4A 4C0TA 4EOKA 2ZB0A 3TUDA 4YNOA 4FT9A 4QMUA 2CHLA 3DXNA 2CGVA 2VO6A 1W8CA 2VTSA 4EBWA 1XBAA 4EJNA 4FTNA 3DLZA 4CV9A 4X2NA 4FIHA 3LW0A 2VTIA 5HNGA 3VS0A 5ACKA 3EQHA 1OIYA 3F9NA 3ZCLA 4F64A 2ETMA 2HAKA 3ZH8A 2PK9A 3VAPA 5C03A 2WGJA 4G6OA 3ZHPC 3L9PA 5E1EA 3O8UA 2QO7A 1CM8A 4I6FA 1ZY4A 2YFXA 5M4CA 3F6XA 4O0YA 2C6LA 3HV6A 3S0OA 2R3NA 4NT4A 3CP9A 1UU7A 3IONA 3OCBA 3LCDA 1JNKA 5CY3A 3VS3A 3MFRA 5E8SA 2G15A 2FA2A 2VO7A 1XO2B 5FP5A 3S3IA 3TZ8A 1JVPP 3B2TA 3PJ3A 3HECA 1J1BA 3SXSA 2I7QA 4Z55A 4CMOA 2BIYA 5CENA 3SGCA 4FKIA 2QR7A 2Z7RA 3NUNA 3LQ3A 4DE4A 3MH2A 3NIEA 3AC2A 5CXHA 1HCKA 3ROCA 3FPMA 2Q0NA 2PE0A 4DEIA 5HU3A 4HGTA 3P08A 4PQNA 4HPUE 2W7XA 1XH7A 2X4FA 3ROYA 1JSTA 4FEWA 3ZBFA 3MI9A 3L8XA 3LHJA 4OTRA 4O0RA 4WRGA 2PSQA 3ELJA 3FC2A 4MHAA 4JG6A 5HNIX 1IASA 4TNDA 4AZEA 1OPKA 2JIVA 4Z9LA 3C9WA 5JT2A 4QQCA 4EORA 2XK9A 2XS0A 3DAJA 4C57A 4CFFA 4OTGA 5I9UA 4YR8A 4EONA 4TKSA 4BCHA 4C4EA 3PY1A 3C50A 3OEZA 4GT5A 5J7HA 4EH3A 5L4QA 5M56A 2XEZA 4C37A 2XK3A 4XBUA 3HUBA 4FTMA 3LMHA 4FIGA 5BQ0A 5AR8A 4IXPA 1LR4A 3HMOA 4FV5A 5AV2A 4BDIA 1M17A 4O27B 4AN3A 2RKUA 5EM8A 1R39A 3TXOA 2YWPA 1Q8UA 4G6LA 2J90A 5AADA 3EN7A 4FG8A 4O7SA 3MJ1A 2WMXA 2VUWA 2BAKA 4GMYA 2C6EA 4GSBA 4X3FC 3RMFA 5JGAA 2B1PA 3KY2A 3VN9A 5KMMA 4RVTA 5C4LA 2GS6A 5CF8A 5CYIA 3E8EA 2YM5A 3K5VA 2HCKA 3GU5A 3EZRA 2C1BA 2VAGA 3BZ3A 4MNEB 4RQKA 3OCSA 5EOLA 1Q8YA 4AW1A 4NW5A 2VTLA 3E87A 2OSCA 5CT0A 4M97A 4QP4A 3RPYA 5A4EA 3CR0A 1LEWA 3MPMA 3PE2A 2E9UA 3NW5A 4JR7A 4YTHA 1GOLA 4X6RA 4AW0A 4A7CA 2XKEA 4G3CA 3DKCA 4FA2A 5DEYA 2W06A 1WBTA 2ITQA 1Y8GA 3UO6A 2R9SA 3O8PA 2P33A 5DEWA 5B2MA 3ANRA 4RIXB 4AE6A 1JAMA 5AV3A 3IK3A 5FD2A 3FWQA 4KBKA 4UY9A 3QBNA 1NVSA 3RHKA 1U54A 5IQDA 1Y57A 3OWJA 4KBAA 1WZYA 1KE5A 4WUNA 3BU6A 4TT7A 2PVRA 2CKEA 1B38A 3G0FA 4CVAA 2I40A 2VD5A 3IQ7A 4ACHA 2O2UA 1YI4A 2Y6OA 4CFXA 5CAQA 3ZM9A 1SVEA 4E8AA 2GTNA 4ZZNA 3W10A 4E26A 4AOIA 2WFYA 2W4JA 4FTRA 3TT0A 1ZOGA 4U41A 1ZMVA 2IW6A 4IJ9A 2BCJA 3ZONA 3A7JA 2I0VA 4D55A 2X81A 3K5UA 3PSCA 3R00A 4R1YA 4O7VA 4AT4A 3LFQA 2O63A 5GNKA 3KRJA 3UPZA 4WOVA 4YP8A 4AW5A 1SM2A 2J4ZA 4IAZA 2PVNA 3V5LA 4EHZA 4QMWA 4FV0A 4YURA 4IWDA 4NL0A 3GFWA 2B9JA 2WMAA 4LI5A 3PZEA 2CDZA 3TNHA 5AR4A 3GNIB 5BMMA 2WTWA 4FG7A 3GB2A 5F4NA 3FEGA 3R1SA 3QCSA 4F6UA 4CTCA 3ERKA 1CKIA 3P79A 1ZZLA 2I6LA 2VX1A 3CC6A 3P78A 5LJJA 4EUUA 2XRUA 1URCA 3R02A 4FGRA 1IR3A 4FYNA 4DGOA 5BYLA 3FYJX 5CU2A 4MF0A 1P4FA 2VWIA 4O6EA 4RGJA 5DMZA 2OF2A 3NUPA 3QTIA 5AIRA 3MTFA 4F7LA 1TVOA 4O1PA 4KS8A 4YNEA 1Q5KA 4M15A 2RFDA 2ZJWA 4F0FA 2X8IA 3FC1X 2Z7SA 4FKQA 4IFGA 3U4WA 5J9ZA 4ZP5A 2JIUA 5HG8A 2GNLA 4H1JA 4FTKA 3COIA 4CFMA 4F9BA 1TQIA 4W4XA 4EK4A 4O7LA 4JR3A 1WBWA 5EYKA 2IZSA 3TIYA 4MX9A 4RC2A 4M14A 3BEAA 3BYMA 3CY3A 2W96B 2XNNA 3EKNA 1ATPE 3LXKA 2UZWE 3KCFA 3AG9A 2WB8A 3OWLA 1KUTA 3RPSA 3SA0A 4F1MA 2WEVA 3D5XA 4A06A 4DA5A 3PY3A 5M4UA 4JX7A 1BKXA 1O6KA 5E91A 3QUDA 3KRWA 1OUYA 4FTCA 3PA3A 3V04A 3VS1A 4J71A 5CAOA 3EL7A 1H07A 3FI2A 3WIKA 4IM0A 1APME 3MGYA 2JFLA 4K9YA 4UWYA 4X3JA 2PVMA 1PXNA 3PP1A 3QD4A 2X2KA 3Q9XA 3A8XA 3LJ0A 5BVFA 4BDCA 2V5QA 3LQ8A 1OIQA 2ZOQA 4FSNA 5ANEA 3R9DA 4ASZA 2VWBA 5DIAA 3A4OX 1H0WA 5AIKA 4ANMA 4AX8A 2HZIA 1TQPA 3FI4A 4RVMA 4GW8A 5J95A 2XIZA 4ZXTA 3BE2A 4AZTA 2C1AA 4BDKA 4C3PA 5KHXA 4ZS0A 3QRTA 3C13A 3FMEA 4TYIA 4YMJA 3COHA 4UEUA 4GK4A 5EHLA 3NNUA 3DBCA 5DRDA 4RSSA 5GIPE 3KVXA 4H3PA 2C6IA 3RJCA 2FO0A 3FLNC 1YI6A 5IQCA 2X4ZA 3B8RA 3HKOA 5DA3A 3W2RA 2O64A 4BL1A 2C4GA 4ENXA 3PY0A 4L53A 3FMDA 2WTCA 2VO0A 3L9NA 5DNRA 4BICA 3ZRKA 1GZKA 1WVYA 2HZ0A 4O7WA 4JAIA 1H28A 4L44A 5GZ8A 2IZTA 3BWFA 3EL8A 2WQEA 4PMMA 4PWNA 4ALVA 4CYJA 3LIJA 5TOZA 3C5IA 3DAEA 3QUPA 1G3NA 3QL8A 3NUSA 4PDSA 5AAGA 2XCHA 5LVOA 3ODZX 4EHVA 4FKSA 3FLZA 4P90A 5LVLA 4BCNA 4OAVB 1GIJA 4W4YA 5EW3A 3FKLA 5JKGA 1ERKA 2UW7A 2UZUE 3GCPA 3Q6WA 3KMMA 3MPAA 4KKHA 2XIYA 3AC8A 4FVRA 5HZNA 2JBOA 3I4BA 3VUHA 2W1ZA 2JLDA 3I1AA 3TKHA 3D2KA 3PJCA 3SHEA 1DI9A 2NRYA 2ITUA 4Z7GA 4BBFA 1FOTA 4FSZA 2BZHB 4GJ3A 5IUHA 4GIHA 5EHOA 5CU3A 2GFSA 3R7EA 4BDFA 2XNBA 4I6BA 4ANQA 3T8OA 4DBNA 4NH1A 2WMRA 3UVPA 1PJKA 2YCQA 4O0VA 2PZ5A 2X9FA 1SZMA 1P4OA 2XA4A 2WMWA 3FLSA 3W16A 5LMKC 5KMJA 2QC6A 3FXZA 1B39A 3QCYA 1R0PA 4J97A 4WT6A 3RVGA 3QYZA 4MBIA 2HELA 3A7IA 4P7EA 2YISA 4PDYA 3FMMA 4OBQA 3VVHA 3LFEA 2EUFB 4FMQA 2F2CB 4F7NA 5HGIA 4C58A 4C62A 2UZEA 5HORA 3ORKA 1UKIA 4L46A 4O0TA 4E4LA 2C0IA 2C6OA 3AD5A 4PMSA 4DH7A 2J0KA 2SRCA 5EKOA 4EBVA 3S2PA 3FXWA 4EZ7A 2CLQA 3BHVA 3H3CA 4TYHA 3G33A 4R8QA 5JFWA 3GGFA 4X0MA 5A14A 5IA3A 2GSFA 1H27A 1P14A 3UYSA 3N4UA 5DOSA 4CQEA 5KMNA 1YI3A 4BGQA 5EYMA 2UVXA 1O6YA 3D83A 3GU7A 3QQLA 4DINA 1Q3WA 4TTHB 4BC6A 5JFVA 4HVSA 3F2RA 2ZMCA 4X21A 2J6MA 1JLUE 3I6UA 4S30A 1OKYA 1PXIA 2FGIA 3R2YA 2BIKB 3WF5A 5LOHA 3UYTA 4YSMA 5HBJA 3IW6A 3UOKA 5M55A 3DK7A 3U6JA 4B99A 4B9DA 4S2ZA 5KUPA 3TUCA 2O65A 3OOMA 3U55A 3UE4A 2CNQA 3DBFA 3UJGA 3KRLA 3SOCA 5E9EA 5AUUA 1IAJA 4QP2A 3FKNA 3WZUA 4IBMA 3KXMA 4GT3A 4NJDA 4DITA 5EDQA 4BCJA 3MSSA 4XP2A 3JY9A 1IRKA 2VRXA 2JDVA 4DYMA 4QMQA 4PMPA 1DAWA 5D7VA 5BVWA 4YTCA 3CPBA 2OZOA 1VZOA 4IQ6A 4IVDA 4I21A 4C34A 4PDPA 3FLWA 4I0RA 3VF9A 4QQ5A 4FICA 4FF8A 3EQBA 1JBPE 5KCVA 2BDFA 2PUUA 3A7HA 3OUNB 2PVFA 2A4LA 1NVQA 3OROA 4JIAA 1PRYA 3MN3A 2XYUA 3PG1A 4KB8A 2W1IA 3T9TA 2B55A 5AJQA 5AP4A 3KC3A 2ONLC 4F70A 2BILB 2P2HA 1X8BA 3TNWA 4FKVA 4ONAA 3LPBA 4X2GA 4DH8A 3TUBA 2F49A 2C3IB 3BQRA 3FZOA 4GJ2A 2P4IA 4U81A 1BYGA 5BVOA 4QD6A 1VEBA 4FKJA 2QO2A 4NIFB 5DR9A 5IUIA 5CWZA 2QU5A 4IZ7A 3ZDUA 4V0GB 4EOMA 3D0EA 4IAFA 4FV3A 3LFSA 4NFNA 4QO9A 4E4XA 2V22A 4LUEA 4FV7A 4F1OA 3QLGA 3EYHA 4PTEA 1ZMUA 1XQZA 3BPRA 3AC4A 3KULA 2J0LA 2OWBA 2ZYBA 3KMUA 4MBLA 5LARA 4L01A 4DGGA 1SNUA 3FQEA 3IDBA 1ZLTA 4L52A 1JKTA 1OIRA 5CANA 5M4IA 2UW9A 2GMXA 1V0PA 2X6EA 2DUVA 3G9LX 4IDVA 4QNAA 3UG1A 1HCLA 2Z2WA 3FE3A 2R3PA 4HVIA 1UA2A 5IQGA 4JX3A 5IA0A 3UC3A 4OLIA 2J5FA 2ZV7A 3EMGA 3UNJA 3WI6A 4Z16A 5K0XA 5IA2A 1CKPA 2VWWA 5C8MA 4GK3A 4C2VA 3S95A 1E9HA 4O7NA 4G3DA 5HO7A 3M11A 4EEVA 4P2KA 5DBXA 2Z8CA 4GT4A 2IO6A 2YM7A 5HBHA 1YDSE 3MH0A 3D7TB 4QMXA 5AP5A 5GJGA 4LMNA 3WE4A 4AN9A 4C4JA 5LWNA 4OAUC 4MXXA 1XHAA 3UP7A 2ITOA 2DWBA 3VRYA 4MXYA 3GU8A 3D9VA 1VR2A 4BDDA 3CPCA 4KNBA 4NW6A 3H30A 3DBDA 3R63A 2IZRA 3FQHA 3QZFA 3R21A 1CKJA 2V62A 5ANJA 4ID7A 3TV7A 3UC4A 3H4JA 3EH9A 4BZOA 3EIDA 5LQFA 1XJDA 5ETCA 2UW8A 2WTKC 3OCGA 5IA4A 3OY3A 3VF8A 5B7VA 3M1SA 1OECA 2C0OA 4F9YA 4AQCA 3I0QA 3TNQB 2JKMA 3G5DA 4GCJA 2PMIA 4JQ8A 2WAJA 3R0TA 5DRBA 3NW6A 2OLCA 4BHNA 5DR2A 4JBOA 3R7OA 3MA6A 1R78A 3GC0A 4U0IA 5C1QB 3F7ZA 4FSTA 4GH2A 1CDKA 3MIYA 4YJNA 4MTAA 2YWVA 3AC1A 2ZDTA 5FDXA 4P5ZA 3GQIA 5E7RA 4DEEA 5L3AA 4OT5A 5HOAA 3C4FA 4A9UA 4E3CA 4LGDA 3TM0A 2WD1A 4ZJVA 2R3LA 5F9EA 1H08A 5AUXA 4FIIA 4EC8A 3LM5A 2A2AA 1NVRA 2OICA 4ASDA 3R28A 1XH9A 5AA9A 4D5HA 1F0QA 4KAOA 4BTMA 4RA4A 4JG8A 5IEVA 1OIUA 2W9ZB 2J5EA 3WOWA 4ZIMA 3WF7A 4IHPA 3D94A 1G5SA 3QHWA 2BVAA 3QALE 4RX7A 4CQGA 4F63A 3SQQA 4KKGA 4DTKA 5A6NA 4HVDA 3EFJA 3C7QA 3DQXA 2PYWA 3OZ6A 2VN9A 3PFQA 2WIPA 1Z57A 3DGKA 3FZ1A 4UYAA 3TZ7A 4RIWA 3ZFMA 3ZXZA 4DFUA 1JQHA 1LUFA 3LZBA 4LYNA 4C59A 4XV1A 4RIYB 1H1PA 3KXZA 5HIBA 5L2SA 2R3RA 3R7IA 5LXMA 3QF9A 5GZAA 3WE8A 3RI1A 3Q9ZA 1YHVA 2ITVA 3FY0A 4UXLA 3DA6A 3RKBA 5CZHA 3VS7A 3DU8A 1UKHA 3KN5A 4Y46A 4CCUA 4GVAA 3ZOSA 2XK8A 4ZY5A 5D41A 2PULA 5EM7A 1PMUA 4IE9A 3RBWA 2PZPA 2FYSA 2OH4A 2QODA 4C4GA 3AD6A 5E90A 2YJSA 5CNNA 4X2FA 3RPOA 3V5TA 4U6RA 2H96A 4F7JA 3QQGA 4HGEA 4MWIA 1OL6A 5AUVA 3A7FA 3A60A 4NM5A 1S9JA 4O22A 3BQCA 2GHLA 1G8AA 2WMVA 2V55A 1HOWA 4NM0A 2XNEA 4ASXA 4B7TA 4CKIA 4I41A 3V6SA 1Q8WA 4NWMA 2PVKA 3OTVA 5D10A 1K2PA 1YRPA 4LOOA 4U40A 2F57A 1JWHA 5AR2A 1JSVA 4TRLA 2YIWA 3ITZA 1UNGA 3QD3A 3NDMA 2V7OA 3OBGA 3PXFA 2F4JA 1J3HA 5KE0A 3SRVB 1UNHA 4A07A 4XH6A 5HCZA 3LQ5A 4XG4A 1QMZA 2WTKB 3U6HA 3DXQA 2C69A 3FSKA 2PUIA 4NU1A 1YWNA 2YCRA 4DFZE 2UW6A 4M0ZA 3FQSA 5LWMA 3CQUA 4L68A 4C38A 4QYYA 3ID6C 3MY0A 5E8VA 3WYXA 2ZB1A 4I5HA 2X7GA 3CE3A 3B2WA 4L7FA 4WKQA 4BCIA 4RG0A 4C02A 4M12A 3MH1A 1E1XA 3WZKA 2WEIA 2C5YA 3PJ2A 3NRMA 4OTWA 4ZTQA 1W0XC 1SMHA 2CLXA 2VWVA 1H01A 3JYAA 3SV0A 2QKWB 4EOOA 3SAYA 3I60A 3KCKA 3FSFA 3VBTA 3NYOA 4L6QA 4KIKB 5CSPA 3FAAA 4MNEA 2ITZA 4BCPA 4IZYA 4DHFA 2HXLA 3N51A 4Z7HA 1WCCA 3UVRA 3I7BA 4PV0A 3R7GA 3LFCA 5KNJA 3QTXA 2QOCA 4KBCA 4I5PA 4OTFA 4Y8DA 2OF4A 4J99A 3IW4A 3U87A 3W32A 3R01A 4LQMA 4TWCA 3DNEA 4YO6A 4GS6A 4JI9A 1PXOA 3HV5A 3IG7A 2WTDA 4MXOA 2IVSA 3ETAA 3Q5ZA 4RIXA 5CZIA 3S00A 3EQGA 5L8KA 3CKWA 5IDNA 3NX8A 4AUAA 1VYWA 1FVTA 3POOA 4XP0A 1LEZA 4CFNA 4H58A 4FV9A 3U6IA 4FSQA 4Y5QA 3O2MA 4ITIA 5DT3A 3EFLA 3SG9A 4ZSLA 4E5WA 4XJ0A 2XRWA 5EH0A 3Q9YA 4QRCA 3NMUF 2UZBA 3W18A 3BBTB 3DBEA 4Z3VA 2YCSA 4WBBB 3V51A 1PXKA 3KXGA 3GP0A 2CPKE 2BAQA 2QOHA 4FV6A 4QP6A 3SDJA 3PXRA 3FL4A 4TYEA 2WOTA 2G1TA 3KF4A 3TJDA 4HYUA 1KE6A 1OPJA 5AP0A 3C51A 4KIOA 5HVJA 4E6DA 3C1XA 4UWCA 3ORPA 3QX4A 1Q4LA 2NRUA 4YTIA 4BCFA 2C5OA 2NNWB 4MK0A 3R7YA 3V5QA 2VWUA 1QPCA 3BU3A 2KULA 2IZUA 5M51A 3OW4A 3QUEA 5K0KA 4ZTNA 3CD3A 2QOBA 3E3PA 2IJMA 3F61A 4IW0A 3GFEA 2C6MA 2VO3A 3GQLA 3HP2A 3PVGA 4NUSA 3R2BA 4QMYA 3QRIA 5A6OA 5A9UA 1YOLA 1JKKA 4DFLA 3LFFA 4CLJA 3W8LA 4NYEA 3KXHA 4D2SA 5IH5A 2YIRA 3HA6A 2XMYA 3PVWA 3QTQA 1W84A 2I0YA 3CGOA 3NYVA 1UNLA 4M84A 4XLVA 3RAIA 3A61A 4FR4A 5E92A 3D5WA 3L9MA 3K3IA 4KA3A 1ZAOA 3R30A 5JGBA 3OC1A 4DC2A 5TKDA 4R1VA 3QHRA 4DH3A 3EJ1A 3RNIA 4E93A 3UZTA 4V04A 3BHUA 4EH2A 2A27A 3SXRA 5IQAA 1W82A 4QMOA 3HX4A 5K5XA 4FE2A 3HEGA 1YOJA 5JN2A 1OVEA 2YM4A 2ZV9A 3MYGA 4QTAA 5CQWA 4C4FA 4ANOA 3LLAA 4D4VA 3VBWA 5AA8A 1H26A 2WOUA 1MP8A 3IPHA 3NR9A 4FL2A 4M69B 2E9VA 1KSWA 2FSLX 5KMIA 2R3GA 1Q61A 2XK7A 2XK6A 2EB3A 4E6QA 4WA9A 4PY1A 3COKA 4MXCA 4JBPA 4ZLYA 3NS9A 1OBDA 2H9VA 5J1WA 4TPTA 2UZLA 3PLAE 1O9UA 3ZYAA 4O84A 2OIBA 3KKVA 2QOIA 2G01A 5BVNA 4K18A 1FPUA 4IC8A 4P5QA 3PUPA 3OXIA 3JVRA 2PWLA 1NT2A 3P86A 4BDAA 5AR3A 2QLQA 3AC3A 5JEBA 3BIZA 4BY9E 5DPVA 3BYVA 4PTGA 4KINA 2C68A 2R64A 5ANKA 5D7AA 2LAVA 3NEWA 4O7TA 1BL7A 3TV4A 4CXAA 4UWBA 4BIDA 4EQUA 3PSBA 3CTJA 2R3HA 4W9WA 3BV3A 3GEQA 4A4LA 5IQEA 4RJ6A 4O1OA 4K6ZA 2WTJA 2X7OA 4B8MA 3R8UA 4CT2A 4AE9A 5HCYA 4B8LA 5I3OA 4HYIA 2VTMA 3POZA 2A19B 1WVWA 2YM8A 3IDCA 4ARKA 2PMOX 3HMPA 4LRJA 4WO5A 3RPVA 3TDWA 2RFEA 5B2LA 1CTPE 3F5UA 2O8YA 1KOBA 5AWMA 4FZDB 5FDPA 2J51A 2QO9A 5FTQA 2CSNA 3MH3A 4E73A 4RIOA 4RZWA 4RQVA 4EK8A 4BIBA 2VV9A 4O7RA 2ZM1A 3VBXA 1KV1A 4H3QA 5JSMA 2VX3A 5AAEA 3P23A 2GHMA 4IZ5A 4XG6A 2H8HA 2QOQA 3DJ5A 2I1MA 2VZ6A 4FSUA 4USFA 2NO3A 4BF2A 4ZTMA 5J1VA 2X0GA 3MV5A 4JVGA 3QA0A 5HESA 3CJFA 2IW9A 2BHHA 3LCSA 4GRBA 3ZFXA 5HLNA 4XMOA 4K11A 3II5A 4K0YA 4QTBA 3GCVA 5FLFA 4R3CA 3QWJA 5J5SA 1ZRZA 2F2UA 2YEXA 2V0DA 5FBOA 2UZOA 3LJ2A 4NM7A 3ZTXA 4A9TA 4AT3A 4BN1A 2VWYA 3D14A 4FOBA 2ETRA 4YZMA 4F9AA 3CQEA 2OXYA 1V0BA 4K77A 3RAKA 1RW8A 3TZMA 4C4IA 3M2WA 4MWHA 5H8GA 3R04A 3RCDA 3PJ1A 5M09A 1PYEA 3VUTA 2QR8A 4TW9A 4A4OA 3G2FA 3PA5A 4IAIA 4FG9A 3HYHA 3VBYA 4MF1A 3IECA 3PXQA 4YJQA 3VUMA 3MFTA 5LMBA 2Z02A 3MS9A 4ITHA 3EQFA 3G9NA 5AR7A 3FJQE 5IUGA 3SLSA 3HP5A 5E4HA 3UGCA 5CF6A 3BX5A 4JBQA 5AAFA 1YWRA 4R3PA 1SVGA 1GZOA 3LCKA 4C33A 4EKLA 1NA7A 4QYGA 4LRKA 4RZVA 4K8AA 5E8YA 4IJPA 2WO6A 1FQ1B 4LOPA 2GNGA 4FKGA 5HLWA 4Y95A 4EOQA 3QTUA 3GC9A 2EWAA 2OK1A 4I0TA 3P4KA 4EQCA 2PUNA 4RJ8A 4KIPA 3I0OA 5HG7A 3BWJA 4AF3A 5CI6A 2JGZA 3SOAA 2XYNA 1A06A 2B4SB 4Q9SA 4B6LA 3PWDA 3ET7A 2OH0E 4O7YA 1FINA 3L1SA 4WSYA 1XR1A 1OM1A 3R1YA 5AR5A 1STCE 4ACCA 3QQKA 3ORLA 3C4ZA 2Y8OA 4AGCA 3ZSIA 2J0JA 1YDTE 3NWWA 4D4RA 3RM7A 1MRUA 2KTYA 2RG6A 3C4EA 5G1XA 1U59A 3G6HA 3WYYA 2G2FA 3E8NA 4FI1A 4YJOA 3S1HA 5JMSA 1XH4A 3H10A 4UBAA 3Q6UA 5HNBA 4G6NA 1ZMWA 4MBJA 4X3FB 2C6DA 3MIAA 4FVQA 2CN8A 1XH5A 2AUHA 4JAJA 2JEDA 1Q8TA 4C7TA 2QOOA 2DYLA 4KKEA 3LE6A 4E1ZA 3FMKA 5E1SA 3L9LA 2BRBA 2YCFA 4FL1A 3TACA 3ZEWA 4YJVA 3GT8A 4U45A 5A54A 3RZFA 2CNVA 4ZJJA 3B8QA 4YZCA 4F9WA 4FT0A 1GZ8A 4LG4A 3TEIA 4PNIA 2XBAA 3C0IA 3T3UA 1ZYSA 4AGWA 3VO3A 3E7OA 4E5BA 4YJTA 1J7UA 3ZUTA 2BTRA 5HBEA 1B6CB 2P3GX 4RVLA 2A0CX 3BEGA 5DT0A 4X2KA 2IWIA 4IVCA 5AMNA 3TKUA 4CZYB 5BPYA 5HE0A 4RX9A 4WG3A 3AMBA 2YITA 4HYHA 5AX3A 1JKLA 3PZHA 4JDKA 1Q3DA 1Q97A 3GCSA 1CMKE 4UN0C 4CKJA 3GBZA 3VUKA 2XJ2A 3U51A 3ZS5A 3NNXA 3W33A 4QMPA 5BVDA 4D2TA 3BHHA 4I93A 3T9IA 2G9XA 3R6XA 4S31A 3VUDA 1H1QA 3OFMA 4FK3A 4MQ2A 3ZU7A 4MXZA 2JKQA 2FH9A 3ZDIA 1PMEA 3VNTA 3FYKX 2BKZA 1F3MC 5ANDA 3W2QA 4WHZA 4RFMA 1VJYA 5CEIA 3QTZA 5H8EA 3THBA 3QKKA 2RFSA 3R7UA 3UNZA 4AZFA 2FVDA 3JS2A 4IEBA 2BZKB 5IA1A 4AU8A 2XNGA 5BYZA 5CSWA 3TKIA 4CEGA 2WQOA 2RIOA 2XCKA 3ALOA 2YACA 3A4PA 4R6VA 3TTJA 4MVFA 3QA8A 3E93A 4GU6A 4CRLA 4FV1A 2XJ1A 4BI1A 1WBNA 1PW2A 1OITA 3ENHA 3QC9A 2OI4X 4U97A 4ZTSA 4YJSA 4DEBA 5HTIA 3PSDA 3AQVA 1QL6A 3OF0A 2JITA 4TXCA 3BHTA 4EKKA 5HX6A 5LCJA 3WARA 1OB3A 4P4CA 3SKCA 3TN8A 2HWOA 3O7LB 1UVRA 2XZSA 5H8BA 3V5WA 3D7TA 4GFOA 3FLYA 2C3LA 1IA9A 1FGKA 3EWHA 4BGHA 4QMVA 3ZO4A 2P0CA 4FZ7A 3MA3A 3E63A 3GENA 5KZ0A 3VW8A 1M7QA 2FB8A 2XKDA 4ASEA 3MPTA 1A48A 1QPEA 1BI8A 4UMTA 5AM7A 4AFEA 4AA0A 1BX6A 3ALNA 3P7BA 2BRNA 4EH6A 5AV0A 1PMVA 5KMLA 5M53A 4DF3A 4WNMA 2YIYA 5L8JA 4EH5A 2PMNX 3HAVA 2OBJA 2W5HA 5EHYA 2VNWA 2HZ4A 4AG8A 4L43A 3WZEA 4DT9A 2BR1A 2PE2A 3UQCA 3QCXA 4JS8A 4RFYA 2FSMX 4ZSEA 4FKUA 1R1WA 3HDMA 4IACA 4PP7A 2J2IB 4DCEA 4M66A 3KN6A 5JZNA 2X2MA 2ZV8A 4AWIA 1ND4A 4GG5A 4MD7E 5K9IA 4TWPA 3K54A 3NGAA 1RQQA 2PVYA 2CNUA 5FXSA 5L2QA 2VTJA 4KSPA 1XBBA 4J96A 2GNJA 5DE2A 4FNZA 3QQFA 4ITJA 3E8DA 4QPAA 2VTPA 2QURA 2X39A 3HUCA 4LGGA 4ORKA 4RLLA 3P1AA 4UV0A 4QYFA 3DK6A 4GFMA 4I94A 2WNTA 3EN6A 4BCKA 4UMQA 4H39A 5IMXA 5FEEA 4JRVA 2JBPA 4I0SA 3EKKA 4PL3A 3R8ZA 3GXLA 5J8IA 4EHGA 4EJ7A 3ATSA 5I9WA 2Z60A 4GG7A 4I5MA 1NW1A 4BKZA 2Q83A 2VNYA 4OGRA 4M7IA 2Y4IC 1SNXA 3LVPA 1H24A 4U3YA 3ZZEA 2XJ0A 4B0GA 3NYXA 3QRKA 3V8WA 3DOGA 4O2ZA 3M42A 2WMSA 3NNWA 2NP8A 3UQGA 4BZDA 3F82A 3Q60A 4O0WA 4A9SA 3VHEA 1OI9A 4CZTA 4O81A 3MY5A 2QHNA 2OG8A 4FIEA 4GKHA 3EQIA 3CXWA 4EI4A 2GFCA 4DBXA 3OOGA 4BI0A 4RIYA 1YWVA 3ZFYA 4D9UA 5FUTA 2EVAA 4YJRA 1REJA 2OJIA 3HZTA 5FTOA 3HGKA 5K4JA 4RX5A 5CU6A 3V8SA 4PTCA 4DH5A 1Y91A 5AP1A 3PE1A 4FBXA 2GS2A 4KWPA 3ZMMA 1IEPA 4ZSAA 4BTKA 4RA5A 2WZJA 3PDTA 3UO5A 1PXLA 4YC8A 2XIRA 2W1CA 3E88A 3PIXA 5ANOA 3RP9A 3DKOA 5T3QA 5AP6A 3L8PA 2YAAA 3DNDA 3BKBA 3NYNA 5EW9A 4ACMA 4ZZMA 4D2PA 3NAYA 3Q9WA 4NKAA 2UZVA 4WRSA 4UMUA 4YJPA 4N0SA 1Y6BA 1ZYJA 2UUEA 3F7WA 4XS2A 4EC9A 5FG8A 1YDRE 2R3QA 4PMTA 1PKDA 4NTSA 3NPCA 2C47A 3CD8A 4QQTA 2A1AB 2CGWA 3CTQA 3OP5A 3RAHA 4FZAB 4FZFB 4D0WA 1GY3A 2XH5A 3MESA 2PE1A 5EYCA 4CTBA 3BBWA 4QMZA 4U9AA 4BDHA 5ANGA 4GKIA 2WMBA 3IS5A 3LJ1A 4S32A 2ITWA 4USEA 3SRVA 1IAHA 3E5AA 2C5VA 2VTOA 4YGAA 2XF0A 4PX6A 3TI1A 4IB0A 5FQDC 5EM5A 3TTIA 5IEYA 5AEPA 4QQJA 4DT8A 4FL3A 1W7HA 3A2CA 4IM3A 3HMNA 4GFGA 3F2AA 5CLPA 1H1RA 5CEMA 5ITAA 4R7BA 5F1ZA 1MRVA 1A9UA 3MVLA 2PVHA 5KBQA 5A46A 2BALA 3WBLA 2EXMA 4I92A 2C0TA 2GU8A 2C5NA 3ORZA 3CS9A 4DFBA 2R3JA 3ZXTA 5ANIA 4Y85A 2XM8A 3KU2A 3U8WA 3LAUA 5ICPA 4G17A 5KMOA 2B54A 2RL5A 3BELA 1YXVA 1WVXA 4C4HA 4G3EA 3ANQA 1OL7A 1YXXA 3CCNA 1W83A 2OZAA 2VGOA 2W1GA 2X8EA 2YAKA 4LOQA 4MCVA 5TT7A 4DLJA 4FKPA 3G6GA 2GS7A 1WFCA 3VW6A 1H4LA 2OXDA 5HE3A 4YLJA 3BYSA 4RC4A 5HIDA 5KBRA 3IDPA 2HK5A 4JDIA 2BKKA 4CZUA 3G90X 1WBVA 3OVVA 4QP8A 4A4XA 3DBQA 4EH7A 2Y4IB 3PXKA 3VS6A 4C3FA 4IAYA 5L6PA 2B9FA 5AP3A 2C6TA 3UOLA 3MW1A 3ZSHA 4GUEA 5H2UA 1J1CA 4CG8A 3U9NA 3K3JA 3KQ7A 5EOBA 2R3KA 3ZRMA 1PKGA 2DQ7X 2JAVA 2XM9A 3FV8A 5FXRA 3DAKA 3MFSA 3HMMA 1M7NA 4DGLC 3F5PA 4GUBA 4TYHB 1ZARA 4U5JA 4XLIA 4AS0A 1IG1A 3HLLA 4J52A 2FSOX 2VWXA 3EQRA 4HNIA 4PNKA 3N4VA 3R8LA 4IZAA 5I5ZA 1OMWA 2FSTX 4G5JA 4IVBA 2WPAA 4FSYA 4EH9A 3BU5A 3PPKA 5LVMA 4I1ZA 5HO8A 2R0IA 1GZNA 5C27A 4C8BA 4F7SA 2R4BA 4QP7A 4APCA 2UVZA 3LMIA 4XUFA 2R7BA 5C01A 4I5CA 4DFYA 2YM6A 3F66A 2WXVA 3EHAA 3Q4TA 4FEUA 2OFVA 2F7EE 4ZTRA 4QYHA 2I0EA 2E9NA 5CEKA 3AMAA 2CJMA 4G5PA 4W8DA 2XNPA 3HL7A 4CT1A 4HW7A 1WAKA 1DM2A 1YW2A 1TKIA 1DS5A 2WTVA 4IX5A 4MYGA 3QXOA 4FNYA 4KRCA 1OZ1A 4U8ZA 4AXAA 1BLXA 4BTFA 4UMPA 4ZLOA 5IF1A 2R7IA 3ZLWA 2F9GA 4G34A 3KA0A 3F2NA 4HCVA 1PF8A 1YKRA 2XNOA 1FMKA 4NCTA 1M52A 2OFUA 1I44A 4U3ZA 3Q2MA 3HAMA 2AC5A 3Q32A 5HE1A 3ULIA 3QZIA 4FT7A 5EI6A 3TWJA 1GAGA 3ZM4A 4AA4A 4CYIA 4APPA 2ZDUA 3BGZA 4DEDA 2CN5A 4W8EA 1OL2A 4OTPA 3FPQA 3GVUA 3UOJA 5AX9A 3ZLYA 2UW0A 3DK3A 2ACXA 1ZWSA 4IWQA 5EYDA 4OBPA 4M69A 4N4SA 2ZVAA 3OEFX 3UO4A 2ETKA 4HCTA 3UIXA 2GDOA 3D7ZA 1KV2A 2BRMA 2W1EA 5C4KA 3R83A 4D58A 4ZY4A 4QMNA 4HZRA 2QD9A 5CI7A 5BUJA 4ZK5A 3UODA 1Q24A 3RPRA 3IGOA 3UIBA 5E8ZA 2ESMA 5K3YA 2PUPA 3L8SA 4CFWA 3Q96A 1P5EA 4AN2A 5CAPA 4CCBA 2BDWA 4BCOA 3GI3A 4D28A 3QYWA 4XRLA 2QI8A 3BLRA 4YPDA 5I4NA 3MVJA 3D4QA 4DEHA 2W99B 3FL5A 3QWKA 3NUYA 3R1NA 4FNWA 4FTUA 3ORNA 1I09A 2YJRA 4O0SA 3DKGA 5GJFA 3EQCA 3FZTA 3FMHA 3QD0A 3GOKA 4IVAA 4YC3A 3TIZA 3EB0A 3E64A 4GK2A 4GVJA 4RJ4A 2B9HA 5GZ9A 4CSVA 4YHFA 5K5NA 3AC5A 5GIOE 2C6KA 2JFMA 2JDRA 3TCPA 3O17A 4IANA 3LXPA 4WD5A 4PPCA 4YBKA 4BIEA 3EZVA 4KS7A 4IB3A 1Z5MA 4WUAA 3ZC6A 4CMUA 2GQRA 3MB6A 5EQEA 4H3BA 2OKRA 3RK9A 3KK8A 4FT3A 4F9CA 5AV4A 5KHWA 1Z9XA 3G15A 3IW8A 4PUZA 3MVMA 3R9HA 3H9FA 4KSQA 2UZDA 2Y4PA 4A9RA 1YXSA 4AACA 1RDQE 4YC6A 1S9IA 5IQBA 2WHBA 4FODA 3T3VA 4ANLA 4YBJA 4RBLA 2X1NA 3BYOA 4QTCA 3O96A 5GJDA 3ZBXA 3F3ZA 3QD2B 4YHJA 4WIHA 2UW3A 3NNVA 4G31A 5CAVA 5T68A 5FTGA 2UZNA 1U5RA 4XYFA 4AFJA 3NW7A 4TL0A 2B53A 5EM6A 3IGGA 3Q53A 4QMMA 4IWOA 4LL0A 1OKWA 4CD0A 1UWHA 3BGQA 3QKLA 4QP3A 3RGFA 2QOKA 4PPAA 2JIIA 3KFAA 4OT6A 4HPTE 4LL5A 5E8XA 3OG7A 5CVGA 1OKVA 3C0GA 4JXFA 5TE0A 4G16A 3PVBA 3RK5A 2GQGA 1WMKA 4E4NA 2JKOA 3IOPA 3UZPA 2QG5A 4F08A 2YABA 4XG2A 3OMVA 3LCTA 3I5NA 3VULA 4PDOA 5M06A 3EFKA 1M2QA 3F88A 4BBMA 1R3CA 5A4CA 3VS2A 5K4IA 2QNJA 2ITNA 4JQEA 4EK3A 4C61A 3LFAA 4F09A 2WQNA 5IDPA 4DTBA 1XBCA 5M44A 4O21A 1M14A 3I5ZA 1J7LA 4QP9A 3N4TA 2JDTA 3RINA 2J9MA 3C5UA 4BI2A 3QU0A 5IMEA 1IA8A 1KE9A 1BMKA 2VTQA 3UZRA 3P7CA 5FRIA 3COMA 2G2HA 3OXZA 1QCFA 4ACDA 4O7ZA 3C4CA 5E8TA 4ZTHA 4D2RA 4FUYA 4W4WA 5G6VA 4DTAA 4M0YA 4MNFA 3NLBA 4RWIA 4LV5A 5H3QA 2BZJA 3HV4A 3UDBA 2VX0A 3OT3A 4ENYA 3IW7A 4RIWB 5HHWA 4DAWA 1U5QA 1Y8YA 3QZGA 1YVJA 3N9XA 5HG9A 3FBVA 3F3UA 3ZO1A 1H8FA 1ZYCA 4JLCA 2BUJA 5IQHA 3MDYA 3FLQA 5CT7A 2YZLA 2RFNA 5L8LA 3UOHA 4AA5A 4AGUA 3AXWA 2OJ9A 4NM3A 2W0JA 2YIQA 3EN5A 5IPJA 5EW8A 3FMJA 5HICA 4FVPA 1XWSA 5KZIA 3OWKA 4X3FA 4PPBA 5HG5A 5HEZA 3HRFA 3GC8A 1URWA 5AUZA 4J7BA 3UMXA 4M13A 3NCGA 5M57A 3JVSA 2EB2A 3ORMA 4RJ7A 5L6OA 1XKKA 3DS6A 1REKA 2I0HA 3QXPA 1F5QA 4R7HA 4FTJA 4U42A 3DTWA 3AOXA 4BDJA 4K1BA 4EK6A 2PTKA 3NIZA 4ZLZA 2ZMDA 4L3JA 2QG7A 3MB7A 2OGVA 3FMNA 1LPUA 3BE9A 5EI2A 4XV3A 3SD0A 4XX9A 5HLPA 4BYJA 3VJOA 2P2IA 5HX8A 2WQMA 4D4YA 5A4QA 3TDVA 5AM6A 3FZSA 3Q3BA 4XBRA 4BWPA 5IG1A 5CF5A 2EU9A 3OXTA 4ZZOA 4YZBA 2DS1A 2PL0A 3VRZA 2YM3A 4XHKB 5FWKK 4RX8A 2FUMA 3G0EA 3OT8A 3O8TA 3KREA 4D4SA 4JDJA 5J5TA 1PHKA 4UALA 3VBVA 5BNJA 4EOPA 4UZDA 1GNGA 1UU8A 4OBOA 4CNHA 3L8VA 3OHTA 4UZHA 3GC7A 2EXEA 4RWKA 4ZSJA 3LCOA 4MD9E 5EQYA 2ZM3A 3PRFA 4RPVA 1YOMA 4L3PA 2CMWA 4L9IA 3R71A 2RSVA 3VQHA 4H36A 4WBOA 2YDKA 2B52A 3R7VA 2OIQA 4ACGA 2PU8A 4IX3A 2YN8A 4U43A 2V7AA 1YXTA 2YERA 1H25A 5BVEA 4J1RA 4JG7A 3KVWA 5J9YA 4EK5A 3DKFA 4BWKA 3F5XA 5CSHA 1SYKA 5TO8A 3OY1A 3CLYA 4FX3A 5CSVA 3OW3A 3CQWA 5HVYA 2CGXA 4AW2A 4EUTA 5BUIA 3WIGA 2W5AA 3VBQA 4AZVA 3E3BX 2BAJA 3HA8A 1GIHA 4JOAA 2W1FA 4OTIA 2CKOA 4IAAA 2ITPA 3EN9A 4FIFA 3DJ7A 3MY1A 4F1TA 2J0MB 3AGLA 4I22A 4J8NA 1FMOE 4PL5A 3V8TA 1K9AA 1U46A 4AAAA 4R78A 1LP4A 4TWOA 3AT2A 5DI1A 3ZRLA 4O2PA 2IN6A 4U79A 2HXQA 2XEYA 2ZAZA 3EFWA 4F99A 4BCQA 4MXAA 1YQJA 5FM2A 3V3VA 3RZBA 5CEQA 3A7GA 1NXKA 2CCHA 3LFDA 4OTQA 4U80A 4ANBA 2WIHA 5DHJA 4NJ3A 4D5KA 1GJOA 3F5GA 4EH4A 3FXXA 1VYZA 3QGWA 3ZEPA 5CAUA 4FTQA 2HENA 4RMZA 2OJJA 3MJ2A 4OUCA 4CFUA 1YHWA 4WNOA
chains in the Genus database with same CATH superfamily
3UQFA 2X8DA 4U7ZA 5D12A 5IA5A 4HZSA 4C2WA 5I9YA 1YXUA 4LFIA 4FZ6A 2UW4A 3ZUVA 4NKSA 3H9OA 4M3QA 4NSTA 4YHTA 3HRBA 3OBJA 3W2PA 4EOSA 3HV3A 5C9CA 4GL9A 2ZM4A 3Q04A 4FKTA 1ST0A 2IPXA 5HKMA 4L45A 2VU3A 3O7LD 4BTJA 4F65A 4TYGA 3QLFA 3ORXA 4ZMEA 2R3MA 5L6WL 1DAYA 4NTTA 2IVVA 4EOJA 5KX8A 4I4FA 4I6QA 2YDJA 3D5UA 4G3FA 1Y6AA 4RC3A 4FTAA 3ZC5A 5IH4A 5JQ8A 2BRHA 2X6DA 4O86A 2YZAA 4IB5A 3QTSA 2Z7LA 3O50A 4X7QA 1OGUA 3DY7A 1G8SA 5KKRC 3A99A 5LCKA 5B2KA 4AOJA 5BYYA 5I3RA 5LVNA 3R9NA 3H0YA 3I6WA 3NCZA 4GYGA 3VS4A 3PLSA 2WMTA 3ZO2A 4CMTA 4J53A 4BJJA 4QYEA 4L7SA 3NUXA 4YLKA 4XG8A 4EL9A 3A8WA 5FBNC 2PPQA 4AT5A 3C4WA 4BCMA 4QPSA 4QMSA 1RE8A 2HIWA 2OIDA 2VTHA 3NVMB 4UMRA 2VTAA 3BV2A 5AUYA 4BKYA 2W1DA 2J0IA 1Q41A 2NPQA 3F3TA 2YIXA 4ZJIA 4E7WA 4XEYA 2YDIA 2OJGA 3QRUA 4JRNA 5AUTA 3OWPA 3PVUA 4DDIA 4O82A 3FHRA 2YLFA 4M8TA 4NEUA 3VWAA 3E7VA 4O0XA 4BRXA 3F3WA 3EQDA 3RCJA 1Q99A 4YSJA 5HTCA 4IC7A 1DI8A 4HGLA 4GIIA 1FVRA 3TNPC 4EYMA 2GNIA 4LM5A 1KE8A 4LV8A 4DG0E 4JJRA 4FIJA 5HU9A 3KRRA 3WZJA 4BFMA 3DDQA 4I20A 1QPDA 1PYXA 4ANNA 4J95A 4TY1A 1BI7A 4FC0A 1W2FA 1J91A 2BHEA 3DJ6A 5HQ0A 1OGYA 5CQUA 3BHYA 3G51A 5D11A 3DQWA 2W17A 4NIFA 2QCSA 3UP2A 4AP7A 2WMUA 2R3FA 3ZSGA 4RLKA 4ZY6A 1H1WA 3TG1A 4V0GA 2XAMA 2WTIA 4W9XA 3QKMA 2GPHA 4YUQA 5E8WA 1ZXEA 4BGGA 4TZRA 1UU9A 2QHMA 3ACKA 3QTWA 4IADA 4YJUA 4YZNA 3QTRA 4Y73A 2WQBA 3O0GA 4QT1A 3W1FA 3SVVA 3GCQA 2E9OA 3DFAA 4JIKA 3KEXA 4V05A 3ZLSA 2J50A 3VC4A 4ZEGA 4JDHA 4F0IA 2QOLA 4ALWA 4PRJA 2P55A 2BTSA 5LMKA 3PWYA 3BGPA 4EWQA 1OUKA 2JAMA 3HMIA 4L8MA 4DFXE 3SC1A 2E2BA 5IH6A 3DXPA 1JSUA 3GOPA 2XKCA 4HNFA 3WF6A 5IKWA 4DG3E 2R3OA 3ZUUA 5JRSA 2XK4A 3P7AA 1OBGA 4IFCA 2NYAA 1KOAA 4YPSA 3QAME 4RT7A 3VONA 2JDOA 5CASA 5KO1A 2OXXA 5HD7A 2PY3A 1U54B 3KMWA 4IDTA 5I9VA 3QC4A 3UMWA 3UDSA 2RG5A 3QZHA 3IKAA 4PL4A 3IO7A 5F95A 2IG7A 3BLHA 3DDPA 2B9IA 3ORTA 4FKOA 3NUUA 3PXZA 4HOKA 4BBEA 4DG2E 5JFXA 5LVPA 3VIDA 2ITTA 4QP1A 2QONA 5HD4A 3KL8A 4O4DA 2QOFA 3NSZA 5KKRB 1MQ4A 1ZYDA 4Q5HA 5CX9A 3CKXA 3F3VA 3JPVA 3QFVA 4YZ9A 3TJCA 4BR3A 4CGAA 3FHIA 4G9RA 4E5AX 4YU2A 5TR6A 2O0UA 3BCEA 3KXNA 5CEOA 5HO6A 4MEDA 4UYNA 4BZNA 3FI3A 1OL1A 3W0NA 5CALA 2W4KA 2XIKA 3IOKA 4FTLA 4FSRA 3BLQA 5DVRA 4N6ZA 3RNYA 4XOYA 3GCUA 5J79A 2XBJA 3NAXA 2R2PA 2W9FB 4GU9A 4HJOA 4Y83A 4YZDA 3F69A 5L2IA 5BMSA 2VTNA 4WG4A 3NFGB 3BRBA 1U4DA 2CCIA 2F7ZE 5IISA 4XG9A 5EKNA 5DT4A 3DB8A 2BZIB 3PRIA 3PYYA 4H1MA 4X2JA 3W2OA 2GHGA 2BROA 2RF9A 4FYOA 3NZ0A 4MAOA 5CVHA 4E6AA 4EZ3A 4CLIA 3A62A 3QGYA 3MFUA 4S34A 2Y0AA 4BCGA 2BFXA 4O96A 3RM6A 2X7FA 2ONLA 3R8VA 2C30A 3RALA 5ETFA 3ZO3A 1TQMA 5GINE 1SVHA 5C8NA 5JRQA 3FY2A 2YA9A 3CIKA 3E92A 4Q5EA 2ITXA 5GHVA 2HY81 2GCDA 4MQ1A 3AGMA 5BUEA 2VTTA 4DEAA 4ERKA 4RFZA 4FUXA 4ZOGA 3DCVA 5FM3A 2HZNA 2UV2A 4W4VA 5CVFA 5DN3A 2O3PA 3OD6X 5BVKA 4C36A 4FV8A 4G2FA 2QQ7A 4LRMA 3ZZWA 2YLEA 3EN4A 4RWLA 3UIUA 2AYPA 3AT3A 2W5BA 1H0VA 2VWZA 3GUBA 4L42A 4DHJA 2Y6MA 3RK7A 3LXLA 1W98A 4D9TA 4R5YA 4QOXA 5JH6A 1Q62A 4WG5A 5FXQA 4BB4A 3SW7A 5CU0A 3MTLA 4OW8A 5CF4A 5F20A 3FI8A 5KMKA 1AQ1A 4A9YA 4DEGA 3TNIA 3DFCB 3C0HA 2R0UA 5DYJA 4R3RA 4FKWA 1PMNA 3AD4A 4N70A 3V5PA 4EOLA 5JGDA 4FEVA 4MKCA 3UNKA 4RJ5A 3LFBA 3FKOA 3KB7A 3MBLA 5FEQA 3R9OA 3SX9A 5CTPA 4RJ3A 3P5KA 3PPJA 2XP2A 2XALA 4BHZA 3BYUA 4KABA 4CRSA 4ZMFA 3PA4A 3WZDA 4TNBA 4YTFA 5M08A 2XNMA 2OJFE 5L2TA 4PP9A 4ANSA 3JR1A 2IVUA 1PY5A 3QQJA 3WILA 3JY0A 3Q52A 4G9CA 2B0QA 2PMLX 4BYIA 3EQPA 3MVHA 2JC6A 2WKMA 2WELA 3LLTA 3W2SA 1XMMA 1XH6A 2UZTA 4FSWA 4NFMA 2VTRA 3R8MA 3I81A 4DH1A 3R9RA 2QVSE 2H34A 3EYGA 4XV9A 3RTPA 5DGZA 5FGKA 1MUOA 4WNPA 4XP3A 1JOWB 5HE2A 4DGMA 4NZWB 5BX0A 2BDJA 2W1HA 3HVCA 4I4EA 1V1KA 2X2LA 4BDEA 1FBNA 5I9ZA 2UW5A 4O91A 4BDGA 2PVLA 2WU7A 3KXXA 3Q4UA 4QMTA 2IVTA 3VS5A 5DLSA 5FP6A 3E62A 2W4OA 3ENMA 5FEDA 4EHEA 4RVKA 3RAWA 5E8UA 4CV8A 4D2VA 5J87A 5IU2A 4D1SA 3NUAA 2H6DA 4FK6A 4FT5A 5B0XA 1BL6A 2XANA 4F6WA 5I0BA 3FMLA 1TZDA 4FKRA 3WF8A 2EXCX 5EQPA 2PZYA 4BDBA 4E4MA 4KIKA 5HTBA 1KE7A 3JUHA 4NK9A 5T6KA 4ZAUA 5AP2A 3MWUA 2JD5A 4YO4A 4PF4A 3VUIA 4GV1A 4IMYA 2ZV2A 5M07A 4L67A 4IWPA 4IAKA 5AV1A 3LXNA 1M2RA 4Q9ZA 3DB6A 3CBLA 4AZWA 1PXMA 4FSMA 4FNXA 4EWHA 5HI2A 4ZSGA 3UIMA 3ODYX 4F6SA 3HRCA 3VJNA 5HCXA 3JXWA 3R8PA 4O83A 5J7BA 2XUUA 4LMUA 3NVKI 2IW8A 3ATTA 4F4PA 2GNHA 5J9LA 2HWPA 5DWRA 3V6RA 2C3KA 3V01A 3ZLXA 1EH4A 4FTOA 3PJ8A 4UB7A 1Q8ZA 4DGNA 4KD1A 3I7CA 2BPMA 3RWPA 4DN5A 2QU6A 3HV7A 4BVUA 2JKKA 4CFVA 4I6HA 3O51A 5ETIA 4L00A 3HNGA 4D0XA 3CEKA 4AZSA 2OO8X 4I3ZA 3WF9A 5LMAA 1FGIA 2HOGA 3Q4CA 3DLSA 4LUDA 4N6YA 2HY0A 3VQUA 3ULZA 1OL5A 3KK9A 5JQ5A 4AAYA 4G3GA 4KRDA 4BKJA 4AGDA 4HGSA 2OU7A 4K33A 4GYIA 3UG2A 3CY2A 4QPMA 5A4TA 4WNKA 4M67A 3H0ZA 4HVGA 2JDSA 4R77A 4FOCA 3EOCA 4EQMA 3P9JA 1ZOHA 3QRJA 4TWNA 1OKZA 3CJGA 3LOKA 3O71A 2OW3A 3GU4A 5D1JA 3RHXA 3SW4A 2C5XA 5JK3A 4HCUA 3KGAA 4WSQA 5D9HA 4X6QC 5A3XA 5IZFA 4ALUA 1MRYA 2PHKA 5EI8A 4QNYA 4UX9A 4KIQA 4S33A 3BI6A 4XV2A 4JNWA 3PIYA 4II5A 3PXYA 2ERZE 5DR6A 4U44A 3DZQA 2XB7A 2J7TA 4FV2A 3OCTA 5DFPA 3TL8A 1PXJA 3UVQA 4JT3A 3KRXA 3LFNA 5TF9A 4AOTA 2XIXA 2VGPA 3HDNA 4DLIA 5IQIA 4EOIA 4C3RA 3D15A 5CEPA 2REIA 4I24A 2G2IA 2PVJA 5ACBC 1JPAA 1T46A 4OR5A 3FZPA 3PIZA 2B7AA 1KWPA 3Q2JA 4IH8A 4MD8E 5L2WA 4JQ7A 4YLLA 2LGCA 4D2WA 2QKRA 5HVKA 2BFYA 5CU4A 3P0MA 2WU6A 5EK7A 1PXPA 2Y7JA 4ERWA 3FDNA 2WMQA 1MQBA 2E9PA 3QCQA 5ETAA 5M4FA 1WBPA 1ZYLA 3K2LA 3SXFA 4B4LA 2F7XE 4F0GA 5JFSA 1P2AA 1ZOEA 2Z7QA 3VUGA 2HW7A 4L3LA 3OTUA 4BWXA 2RGPA 1L3RE 3RWQA 3UBDA 4EH8A 3H9RA 2HYYA 4J98A 3GU6A 4LGHA 4R5SA 1UWJA 2HW6A 2XVDA 4JBVA 1ZY5A 3U9CA 1K3AA 2Y9QA 4IX4A 4DCAA 2ITYA 3OS3A 1UU3A 4FTIA 5CNOA 1ZZ2A 2C3JA 3PTGA 2GTMA 3Q5IA 5EG3A 3KULB 4RRVA 3W55A 4O0UA 5C26A 1H00A 3FUPA 3PG3A 4IX6A 4Q2AA 4C35A 4FKLA 4QTEA 3IW5A 4G1WA 3O23A 5AUWA 4JL9A 3DTCA 1H1SA 4QTDA 2GNFA 4CG9A 1BUHA 2UVYA 3R22A 4K2RA 3UTOA 1QPJA 4HVHA 5H9BA 3AT4A 4FV4A 3R1QA 4NCTC 3C4XA 1AD5A 1T45A 4QMLA 1UV5A 4FEXA 4J8MA 3DZOA 1V0OA 4RWJA 2CGUA 2W05A 4KUJA 2AC3A 4O6LA 4TN6A 4D1ZA 1J7IA 3ORIA 5HIEA 1JKSA 3TV6A 3D5VA 4Y5HA 3REPA 4M68A 2BRGA 4EZ5A 3LKMA 5CS6A 2PZRA 4XOZA 5AFVA 3QX2A 1CSNA 4USDA 3VHKA 3I79A 2QLUA 3CGFA 1FVVA 1R0EA 1YHSA 3U4UA 1OPLA 5CSXA 5EDPA 5C8KA 5I9XA 3CSVA 4O38A 3SG8A 3PPZA 5DH3A 4D1XA 3QQUA 4FEQA 5A4LA 3DT1A 5DG5A 2O5KA 1O6LA 2PZIA 4OTHA 2CKQA 4R7IA 4XCUA 2BMCA 1L8TA 3KF7A 2GQSA 2X9EA 1GIIA 2ERKA 5IEXA 2OZAB 5IQFA 4N57A 3ACJA 4XRJA 2XKFA 3UPXA 4XG3A 3W2CA 2YHVA 3R73A 4E20A 1XH8A 3FZRA 4OTDA 4Y72A 2Q0BA 4DFNA 4XG7A 5EDRA 3U54A 5F94A 1AGWA 3CTHA 4IB1A 4TYJA 3W8QA 5AP7A 4IM2A 3LM0A 4ZTLA 3OUKA 4I23A 1WBOA 3QQHA 4MH7A 4V01A 3DPKA 3AMYA 4EYJA 4H05A 4E6CA 3TZ9A 3V5JA 3S4QA 3PP0A 5EFQA 4CKRA 2R3IA 4IIRA 4HYSA 3D2IA 1WBSA 1M2PA 4XNEA 4FGBA 1NY3A 3LMGA 4FTTA 2R5TA 4GEOA 1E1VA 5JZJA 3E8CA 3DV3A 5CXZA 4UXQA 2CKPA 1RJBA 3Q4ZA 4ZS4A 4C0TA 4EOKA 2ZB0A 3TUDA 4YNOA 4FT9A 4QMUA 2CHLA 3DXNA 2CGVA 2VO6A 1W8CA 2VTSA 4EBWA 1XBAA 4EJNA 4FTNA 3DLZA 4CV9A 4X2NA 4FIHA 3LW0A 3PFYA 2VTIA 5HNGA 3VS0A 5ACKA 3EQHA 1OIYA 3F9NA 3ZCLA 4F64A 2ETMA 2HAKA 3ZH8A 2PK9A 3VAPA 5C03A 2WGJA 4G6OA 3ZHPC 3L9PA 5E1EA 3O8UA 2QO7A 1CM8A 4I6FA 1ZY4A 2YFXA 5M4CA 3F6XA 4O0YA 2C6LA 3HV6A 3S0OA 2R3NA 4NT4A 3CP9A 1UU7A 3IONA 3OCBA 3LCDA 1JNKA 5CY3A 3VS3A 4DDGA 3MFRA 5E8SA 2G15A 2FA2A 2VO7A 1XO2B 5FP5A 3S3IA 3TZ8A 1JVPP 3B2TA 3PJ3A 3HECA 1J1BA 3SXSA 2I7QA 4Z55A 4CMOA 2BIYA 5CENA 3SGCA 4FKIA 2QR7A 2Z7RA 3NUNA 3LQ3A 4DE4A 3MH2A 3NIEA 3AC2A 5CXHA 1HCKA 3ROCA 3FPMA 2Q0NA 2PE0A 4DEIA 5HU3A 4HGTA 3P08A 4PQNA 4HPUE 3W0OA 2W7XA 1XH7A 2X4FA 3ROYA 1JSTA 4FEWA 3ZBFA 3MI9A 3L8XA 3LHJA 4OTRA 4O0RA 4WRGA 2PSQA 3ELJA 3FC2A 4MHAA 4JG6A 5HNIX 1IASA 4TNDA 4AZEA 1OPKA 2JIVA 4Z9LA 3C9WA 5JT2A 4QQCA 4EORA 2XK9A 2XS0A 3DAJA 4C57A 4CFFA 4OTGA 5I9UA 4FJVA 4YR8A 4EONA 4TKSA 4BCHA 4C4EA 3PY1A 3C50A 3OEZA 4GT5A 5J7HA 4EH3A 5L4QA 5M56A 2XEZA 4C37A 2XK3A 4XBUA 3HUBA 4FTMA 3LMHA 4FIGA 5BQ0A 4DHIB 5AR8A 4IXPA 1LR4A 3HMOA 4FRFA 4FV5A 5AV2A 4BDIA 1M17A 4O27B 4AN3A 2RKUA 5EM8A 1R39A 3TXOA 2YWPA 1Q8UA 4G6LA 2J90A 5AADA 3EN7A 4FG8A 4O7SA 3MJ1A 2WMXA 2VUWA 2BAKA 4GMYA 2C6EA 4GSBA 4X3FC 3RMFA 5JGAA 2B1PA 1W2CA 3KY2A 3VN9A 5KMMA 4RVTA 5C4LA 2GS6A 5CF8A 5CYIA 3E8EA 2YM5A 3K5VA 2HCKA 3GU5A 3EZRA 2C1BA 2VAGA 3BZ3A 4MNEB 4RQKA 3OCSA 5EOLA 1Q8YA 4AW1A 4NW5A 2VTLA 3E87A 2OSCA 5CT0A 4M97A 4QP4A 3RPYA 5A4EA 3CR0A 1LEWA 3MPMA 3PE2A 2E9UA 3NW5A 4JR7A 4YTHA 1GOLA 4X6RA 4AW0A 4A7CA 2XKEA 4G3CA 3DKCA 4FA2A 5DEYA 2W06A 1WBTA 2ITQA 1Y8GA 3UO6A 2R9SA 3O8PA 2P33A 5DEWA 5B2MA 3ANRA 4RIXB 4AE6A 1JAMA 5AV3A 3IK3A 5FD2A 3FWQA 4KBKA 4UY9A 3QBNA 1NVSA 3RHKA 1U54A 5IQDA 1Y57A 3OWJA 4KBAA 1WZYA 1KE5A 4WUNA 3BU6A 4TT7A 2PVRA 2CKEA 1B38A 3G0FA 4CVAA 2I40A 2VD5A 3IQ7A 4ACHA 2O2UA 1YI4A 2Y6OA 4CFXA 5CAQA 3ZM9A 2IEWA 1SVEA 4E8AA 3AKJA 2GTNA 4ZZNA 3W10A 4E26A 4AOIA 2WFYA 2W4JA 4FTRA 3TT0A 1ZOGA 2AQXA 4U41A 1ZMVA 2IW6A 4IJ9A 2BCJA 3ZONA 3A7JA 2I0VA 4D55A 2X81A 3K5UA 3PSCA 3R00A 4R1YA 4O7VA 4AT4A 3LFQA 2O63A 5GNKA 3KRJA 3UPZA 1G8JA 4WOVA 4YP8A 4AW5A 1SM2A 2J4ZA 4IAZA 2PVNA 3V5LA 4EHZA 4QMWA 4FV0A 4YURA 4IWDA 4NL0A 3GFWA 2B9JA 2WMAA 4LI5A 3PZEA 2CDZA 3TNHA 5AR4A 3GNIB 5BMMA 2WTWA 4FG7A 3GB2A 5F4NA 3FEGA 3R1SA 3QCSA 4F6UA 4CTCA 3ERKA 1CKIA 3P79A 1ZZLA 2I6LA 2VX1A 3CC6A 3P78A 5LJJA 4EUUA 2XRUA 1URCA 3R02A 4FGRA 1IR3A 4FYNA 4DGOA 5BYLA 3FYJX 5CU2A 4MF0A 1P4FA 3UDTA 2VWIA 4O6EA 4RGJA 5DMZA 2OF2A 3NUPA 3QTIA 5AIRA 3MTFA 4F7LA 1TVOA 4O1PA 4KS8A 4YNEA 1Q5KA 4M15A 2RFDA 2ZJWA 4F0FA 2X8IA 3FC1X 2Z7SA 4FKQA 4IFGA 3U4WA 5J9ZA 4ZP5A 2JIUA 5HG8A 2GNLA 4H1JA 4FTKA 3COIA 4CFMA 4F9BA 1TQIA 4W4XA 4EK4A 4O7LA 4JR3A 1WBWA 5EYKA 2IZSA 3TIYA 4MX9A 4RC2A 4M14A 3BEAA 3BYMA 3CY3A 2W96B 2XNNA 3EKNA 1ATPE 3LXKA 2UZWE 3KCFA 3AG9A 2WB8A 3OWLA 1KUTA 3RPSA 3SA0A 4F1MA 2WEVA 3D5XA 4A06A 4DA5A 3PY3A 5M4UA 4JX7A 1BKXA 1O6KA 5E91A 3QUDA 3KRWA 1OUYA 4FTCA 3PA3A 3V04A 3VS1A 4J71A 5CAOA 3EL7A 1H07A 3FI2A 3WIKA 4IM0A 1APME 3MGYA 2JFLA 4K9YA 4UWYA 4X3JA 2PVMA 1PXNA 3PP1A 3QD4A 2X2KA 3Q9XA 3A8XA 3LJ0A 5BVFA 4BDCA 2V5QA 3LQ8A 1OIQA 2ZOQA 4FSNA 5ANEA 3R9DA 4ASZA 2VWBA 5DIAA 3A4OX 1H0WA 5AIKA 4ANMA 4AX8A 2HZIA 1TQPA 3FI4A 4RVMA 4GW8A 5J95A 2XIZA 4ZXTA 3BE2A 4AZTA 2C1AA 4BDKA 4C3PA 5KHXA 4ZS0A 3QRTA 3C13A 3FMEA 4TYIA 4YMJA 3COHA 4UEUA 4GK4A 5EHLA 3NNUA 3DBCA 5DRDA 4RSSA 5GIPE 3KVXA 4H3PA 2C6IA 3RJCA 2FO0A 3FLNC 1YI6A 5IQCA 2X4ZA 3B8RA 3HKOA 5DA3A 3W2RA 2O64A 4BL1A 2C4GA 4ENXA 3PY0A 4L53A 3FMDA 2WTCA 2VO0A 3L9NA 5DNRA 4BICA 3ZRKA 1GZKA 1WVYA 2HZ0A 4O7WA 4JAIA 1H28A 4L44A 5GZ8A 4DHZA 2IZTA 3BWFA 3EL8A 2WQEA 4PMMA 4PWNA 4ALVA 4CYJA 3LIJA 5TOZA 3C5IA 3DAEA 3QUPA 1G3NA 3QL8A 3NUSA 4PDSA 5AAGA 2XCHA 5LVOA 3ODZX 4EHVA 4FKSA 3FLZA 4P90A 5LVLA 4BCNA 4OAVB 1GIJA 4W4YA 5EW3A 3FKLA 5JKGA 1ERKA 2UW7A 2UZUE 3GCPA 3Q6WA 3KMMA 3MPAA 4KKHA 2XIYA 3AC8A 4FVRA 5HZNA 2JBOA 3I4BA 3VUHA 2W1ZA 2JLDA 3I1AA 3TKHA 3D2KA 3PJCA 3SHEA 1DI9A 2NRYA 2ITUA 4Z7GA 4BBFA 1FOTA 4FSZA 2BZHB 4GJ3A 5IUHA 4GIHA 2IF8A 5EHOA 5CU3A 2GFSA 3R7EA 4BDFA 2XNBA 4I6BA 4ANQA 3T8OA 4DBNA 4NH1A 2WMRA 3UVPA 1PJKA 2YCQA 4O0VA 2PZ5A 2X9FA 1SZMA 1P4OA 4LDTA 2XA4A 2WMWA 3FLSA 3W16A 5LMKC 5KMJA 2QC6A 3FXZA 1B39A 3QCYA 1R0PA 4J97A 4WT6A 3RVGA 3QYZA 4MBIA 2HELA 3A7IA 4P7EA 2YISA 4PDYA 3FMMA 4OBQA 3VVHA 3LFEA 2EUFB 4FMQA 3W0SA 2F2CB 4F7NA 5HGIA 4C58A 4C62A 2UZEA 5HORA 3ORKA 1UKIA 4L46A 4O0TA 4E4LA 2C0IA 2C6OA 3AD5A 4PMSA 4DH7A 2J0KA 2SRCA 5EKOA 4EBVA 3S2PA 3FXWA 4EZ7A 2CLQA 3BHVA 3H3CA 2AEGA 4TYHA 3G33A 4R8QA 5JFWA 3GGFA 4X0MA 5A14A 5IA3A 2GSFA 1H27A 1P14A 3UYSA 3N4UA 5DOSA 4CQEA 5KMNA 1YI3A 4BGQA 5EYMA 2UVXA 1O6YA 3D83A 3GU7A 3QQLA 4DINA 1Q3WA 4TTHB 4BC6A 5JFVA 4HVSA 3F2RA 2ZMCA 4X21A 2J6MA 1JLUE 3I6UA 4S30A 1OKYA 1PXIA 2FGIA 3R2YA 2BIKB 3WF5A 5LOHA 3UYTA 4YSMA 5HBJA 3IW6A 3UOKA 5M55A 3DK7A 3U6JA 4B99A 4B9DA 4S2ZA 5KUPA 3TUCA 2O65A 3OOMA 3U55A 3UE4A 2CNQA 3DBFA 3UJGA 3KRLA 3SOCA 5E9EA 5AUUA 1IAJA 4QP2A 3FKNA 3WZUA 4IBMA 3KXMA 4GT3A 4NJDA 4DITA 5EDQA 4BCJA 3MSSA 4XP2A 3JY9A 1IRKA 2VRXA 2JDVA 4DYMA 4QMQA 4PMPA 1DAWA 5D7VA 5BVWA 4YTCA 3CPBA 2OZOA 1VZOA 4IQ6A 4IVDA 4I21A 4C34A 4PDPA 3FLWA 4I0RA 3VF9A 4QQ5A 4FICA 4FF8A 3EQBA 1JBPE 5KCVA 2BDFA 2PUUA 3A7HA 3OUNB 2PVFA 2A4LA 1NVQA 3OROA 4JIAA 1PRYA 3MN3A 2XYUA 3PG1A 4KB8A 2W1IA 3T9TA 2B55A 5AJQA 5AP4A 3KC3A 2ONLC 4F70A 2BILB 2P2HA 1X8BA 3TNWA 4FKVA 4ONAA 3LPBA 4X2GA 4DH8A 3TUBA 2F49A 2C3IB 3BQRA 3FZOA 4GJ2A 2P4IA 4U81A 1BYGA 5BVOA 4QD6A 1VEBA 4FKJA 2QO2A 4NIFB 5DR9A 5IUIA 5CWZA 2QU5A 4IZ7A 3ZDUA 4V0GB 4EOMA 3D0EA 4IAFA 4FV3A 3LFSA 4NFNA 4QO9A 4E4XA 1XMLA 2V22A 4LUEA 4JMQA 4FV7A 4F1OA 3QLGA 4O4FA 3EYHA 4PTEA 1ZMUA 1XQZA 3BPRA 3AC4A 3KULA 2J0LA 2OWBA 2ZYBA 3KMUA 4MBLA 5LARA 4L01A 4DGGA 1SNUA 3FQEA 3IDBA 1ZLTA 4L52A 1JKTA 1OIRA 5CANA 5M4IA 2UW9A 2GMXA 1V0PA 2X6EA 2DUVA 3G9LX 4IDVA 4QNAA 3UG1A 1HCLA 2Z2WA 3FE3A 2R3PA 4HVIA 1UA2A 5IQGA 4JX3A 5IA0A 3UC3A 4OLIA 2J5FA 2ZV7A 3EMGA 3UNJA 3WI6A 4Z16A 5K0XA 5IA2A 1CKPA 2VWWA 5C8MA 4GK3A 4C2VA 3S95A 1E9HA 4O7NA 4G3DA 5HO7A 3M11A 4EEVA 4P2KA 5DBXA 2Z8CA 4GT4A 2IO6A 2YM7A 5HBHA 1YDSE 3MH0A 3D7TB 4QMXA 5AP5A 5GJGA 4LMNA 3WE4A 4AN9A 4C4JA 5LWNA 4OAUC 4MXXA 1XHAA 3UP7A 4QDVA 2ITOA 2DWBA 3VRYA 4MXYA 3GU8A 3D9VA 1VR2A 4BDDA 3CPCA 4KNBA 4NW6A 3H30A 3DBDA 3TMOA 3R63A 3P5JC 2IZRA 3FQHA 3QZFA 3R21A 1CKJA 2V62A 5ANJA 4ID7A 3TV7A 3UC4A 3AKKA 3H4JA 3EH9A 4BZOA 3EIDA 5LQFA 1XJDA 5ETCA 2UW8A 2X0OA 2WTKC 3OCGA 5IA4A 3OY3A 3VF8A 5B7VA 3M1SA 1OECA 2C0OA 4F9YA 4AQCA 3I0QA 3TNQB 2JKMA 3G5DA 4GCJA 2PMIA 4JQ8A 2WAJA 3R0TA 5DRBA 3NW6A 2OLCA 4BHNA 5DR2A 4JBOA 3R7OA 3MA6A 1R78A 3GC0A 4U0IA 5C1QB 3F7ZA 4FSTA 4GH2A 1CDKA 3MIYA 4YJNA 4MTAA 2YWVA 3AC1A 2ZDTA 5FDXA 4P5ZA 3GQIA 5E7RA 4DEEA 5L3AA 4OT5A 5HOAA 3C4FA 4A9UA 4E3CA 4LGDA 3TM0A 2WD1A 4ZJVA 2R3LA 5F9EA 1H08A 5AUXA 4FIIA 4EC8A 3LM5A 2A2AA 1NVRA 2OICA 4ASDA 3R28A 1XH9A 5AA9A 4D5HA 1F0QA 4KAOA 4BTMA 4RA4A 4JG8A 5IEVA 1OIUA