4D64A

Structure of porin omp-pst1 from p. stuartii; the crystallographic symmetry generates a dimer of trimers.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
352
structure length
352
Chain Sequence
AEVYNKDGNKLDVYGKVDVRHYFASADKGKKSEDGDDSRVRLGVKGDTQITDQLTGFGRFEWETKTNKAENEGENKNRLAYAGLKFADFGSIDYGRNYGVVYDTNAWTDVFPLWGADTMAQTDNFMTSRNRNLLTYRNNNAFGYVDGLSFALQYQGKNGDNNKSSAGMAKDNGDGYGFSTAYELGWGVTLGGGYSSSSRTPNQKAGVVTSEGDSYYSATGKRAQAWNVGGKFDANNVYLAAMYGQTQNTSRYGDLDLIANKTENVELVAQYLFDFGLKPSIGYNQSKGKNLGNGYDNQDLVKYISVGSYYYFNKNMSAVVDYKINLLKDNDFTKEYGINTDNVLGLGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin self-association enables cell-to-cell contact inProvidencia stuartiifloating communities.
pubmed doi rcsb
source organism Providencia stuartii
molecule tags Transport protein
molecule keywords PORIN 1
total genus 98
structure length 352
sequence length 352
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d64A00
1PHOA 1GFQA 4LSFA 7PRNA 3VZUX 2PORA 2ZFGA 3SYSA 1GFOA 4FSOA 3VZWX 3UU2A 4FMSA 4FOZA 4D65A 4RJXA 4KRAA 4KR4A 3POQA 2XE1A 3FYXA 3EMNX 1GFPA 3SYBA 5DL5A 2J4UP 3SY9A 5DL7A 2XE3A 4FRXA 2Y0KA 3O0EA 4GCSA 1BT9A 3VZTX 2OMFA 3HW9A 3JTYA 3NSGA 8PRNA 4JFBA 1GFNA 4GCPA 2PRNA 4C69X 2XG6A 4D64A 5FVNA 1HXUA 4LSIA 2XE2A 4D5UA 2XE5A 3K19A 1HXTA 3WI4A 1BH3A 1E54A 4FRTA 2K4TA 3T0SA 3T24A 3A2SX 2QTKA 5DL6A 3SZDA 4LSHA 4FSPA 1GFMA 2O4VA 3UPGA 3PORA 2ZLDA 5JDPA 3VY8X 2J1NA 5PRNA 6PRNA 3WI5A 4RJWA 3HWBA 3POXA 1MPFA 4FT6A 1H6S1 4LSEA 3SY7A 3VY9X 2FGRA 2ODJA 2Y2XA 4AUIA 2Y0HA 4GCQA 2FGQX 3POUA 4BUMX 3PRNA 1OSMA 1PRNA 1OPFA 4KR8A 3SZVA 2Y0LA 3T20A 1HXXA 5DL8A
chains in the Genus database with same CATH superfamily
1ZHXA 3AA6A 1PHOA 4GHBA 2R4OA 4PR7A 4O3ZA 3LK3A 1GFQA 1ZHWA 3C5OA 1MM5A 4O3YA 2KZ7B 3DA4A 4LSFA 7PRNA 3VZUX 2PORA 3BRZA 3JCUO 3PGUA 1S5LO 4N59A 2IWWA 3LK2B 2ZFGA 3SYSA 5ADXL 1GFOA 3DZMA 3HOEA 3AA0A 4AKRA 4FSOA 3VZWX 2R4LA 5GV0A 1ORMA 3UU2A 4FMSA 3AA6B 2KXPB 5GTHO 3A0BO 3AA1A 3LK42 4FOZA 4AKMA 1QJ9A 4D65A 1BXWA 2K0LA 2XMXA 4RJXA 4AZLA 1T16A 3KVDD 4KRAA 3UAQA 5B5EO 4KR4A 1IZNB 3POQA 4PJ0O 5GTIO 2XE1A 3FYXA 2F1VA 3LK2A 2Y7SA 3EMNX 1GFPA 3G7GA 3PQUA 1MM4A 5KAFO 3AA0B 5DL5A 3SYBA 2ERVA 4AKRB 5AFUL 5ADXK 2J4UP 4AYID 2IWVA 3SY9A 5DL7A 2XE3A 4FQEA 4U9CA 1G90A 2F1TA 3DA3A 4UB6O 4FRXA 2KZ7A 2Y0KA 3PF1A 4UB8O 3O0EA 2N2LA 4GCSA 1BT9A 1Q9FA 2GE4A 3A0HO 3AAAA 4F4BA 4K3CA 3AAEA 3VZTX 2JMMA 2XTRA 2OMFA 5AFUK 4QQ1A 1ZHYA 3AA7B 2WJRA 3PGSA 4RL9A 3HW9A 3JTYA 4RLBA 3NSGA 3BS0A 2LFUA 5KAIO 1QJ8A 8PRNA 4K3BA 3VE1A 4N58A 5IYUA 4G76A 1GFNA 2AXTO 1Q9GA 4JFBA 4GCPA 2PRNA 3AAAB 4C69X 4FUVA 2XG6A 3VE2A 4D64A 3AAEB 5FVNA 3WU2O 4IL6O 2W81C 1HXUA 3PQSA 4LSIA 4XNLA 2N2MA 4AYMC 4AYNA 4JCHA 2XE2A 2R4NA 4B61A 1QJPA 3LK3B 2JQYA 1ZHTA 2XTQA 2XE5A 3K19A 4C00A 4D5UA 5B66O 1HXTA 2MHLA 3WI4A 4CTDA 1BH3A 1E54A 4FRTA 2X27X 2LHFA 2K4TA 3AA7A 5TISO 3PGRA 2YPVA 4FESA 5G39A 5D5DA 3AA1B 5G3AA 3T0SA 3T24A 2R89A 3A2SX 4FZLA 2QTKA 5DL6A 3SZDA 2R8AA 4FZMA 3GP6A 4LSHA 4FSPA 1GFMA 2O4VA 4G75A 5EE2A 3PORA 3V8UA 3UPGA 4O4UA 2ZLDA 4PUXA 4AYDC 4FZNA 5G26A 5JDPA 3BRYA 2J1NA 2X9KA 5PRNA 3VY8X 1YS5A 6PRNA 3WI5A 5H2FO 4RJWA 3DWOX 3HWBA 1MPFA 3NJTA 3POXA 4FT6A 5G38A 4AFKA 4C4VB 1H6S1 4O4XA 3HOLA 2F1CX 4LSEA 3SY7A 3VY9X 4AYEC 1ZHZA 2KC0A 2WJQA 4E1TA 2M07A 2FGRA 2ODJA 3TZGA 1T1LA 3RBHA 2Y2XA 4AUIA 2Y0HA 3DWNA 3QRAA 4GCQA 4Z3TA 4XNKA 1THQA 2FGQX 2R88A 3POUA 3QRCA 4BUMX 3PRNA 2KXPA 4C4VA 1OSMA 1PRNA 4N74A 2YNKA 4GF4A 4N75A 4O3WA 1OPFA 4KR8A 3SZVA 2R4PA 1IZNA 1P4TA 2Y0LA 2M06A 3T20A 2KDYA 2MNHA 5T5FA 4RLCA 2W80C 1HXXA 3KZIO 2WVPA 4O49A 4E1SA 5E79O 3LK41 4O3XB 5DL8A
chains in the Genus database with same CATH topology
1ZHXA 3AA6A 1PHOA 4GHBA 4O3ZA 3LK3A 1GFQA 1ZHWA 3C5OA 1MM5A 4O3YA 2KZ7B 3DA4A 4LSFA 7PRNA 3VZUX 2PORA 4N59A 3LK2B 2ZFGA 3SYSA 5ADXL 1GFOA 3HOEA 3AA0A 4AKRA 4FSOA 3VZWX 5GV0A 1ORMA 3UU2A 4FMSA 3AA6B 2KXPB 3LK42 3AA1A 4FOZA 4AKMA 1QJ9A 4D65A 1BXWA 2K0LA 2XMXA 4RJXA 4AZLA 3KVDD 4KRAA 3UAQA 4KR4A 1IZNB 3POQA 2XE1A 3FYXA 2F1VA 3LK2A 2Y7SA 3EMNX 1GFPA 3G7GA 3PQUA 1MM4A 3SYBA 3AA0B 5DL5A 4AKRB 2ERVA 5ADXK 2J4UP 4AYID 3SY9A 5DL7A 2XE3A 4U9CA 1G90A 2F1TA 3DA3A 4FRXA 2KZ7A 2Y0KA 3O0EA 2N2LA 4GCSA 1BT9A 1Q9FA 2GE4A 3AAAA 4F4BA 3AAEA 3VZTX 2JMMA 2XTRA 2OMFA 5AFUK 4QQ1A 1ZHYA 3AA7B 4RL9A 3HW9A 3JTYA 4RLBA 3NSGA 2LFUA 8PRNA 1QJ8A 5IYUA 3VE1A 4N58A 4G76A 1GFNA 4JFBA 1Q9GA 4GCPA 2PRNA 3AAAB 4C69X 4FUVA 2XG6A 3VE2A 4D64A 3AAEB 5FVNA 2W81C 1HXUA 3PQSA 4LSIA 4XNLA 2N2MA 4AYMC 4AYNA 4JCHA 2XE2A 4B61A 1QJPA 3LK3B 4D5UA 1ZHTA 2XTQA 2XE5A 3K19A 1HXTA 2MHLA 3WI4A 1BH3A 1E54A 4FRTA 2X27X 2LHFA 2K4TA 3AA7A 2YPVA 4FESA 5D5DA 3AA1B 3T0SA 3T24A 4FZLA 3A2SX 2QTKA 5DL6A 3SZDA 4FZMA 5EE2A 3GP6A 4LSHA 4FSPA 1GFMA 2O4VA 4G75A 3V8UA 3PORA 3UPGA 4O4UA 2ZLDA 4PUXA 4AYDC 4FZNA 5G26A 5JDPA 3VY8X 2J1NA 5PRNA 1YS5A 6PRNA 3WI5A 4RJWA 3HWBA 4AFKA 1MPFA 3POXA 4FT6A 1H6S1 4O4XA 3HOLA 4LSEA 4E1TA 3SY7A 3VY9X 4AYEC 1ZHZA 2KC0A 5AFUL 2M07A 2FGRA 2ODJA 3TZGA 3RBHA 2Y2XA 4AUIA 2Y0HA 3QRAA 4GCQA 4Z3TA 4XNKA 1THQA 2FGQX 3POUA 4BUMX 3QRCA 3PRNA 2KXPA 1OSMA 1PRNA 2YNKA 4GF4A 4O3WA 1OPFA 4KR8A 3SZVA 1IZNA 1P4TA 2Y0LA 2M06A 3T20A 2KDYA 2MNHA 5T5FA 4RLCA 2W80C 1HXXA 4O49A 4E1SA 3LK41 4O3XB 5DL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHO A;  1GFQ A;  4LSF A;  7PRN A;  3VZU X;  2POR A;  2ZFG A;  3SYS A;  1GFO A;  4FSO A;  3VZW X;  3UU2 A;  4FMS A;  4FOZ A;  4D65 A;  4RJX A;  4KRA A;  4KR4 A;  3POQ A;  2XE1 A;  3FYX A;  3EMN X;  1GFP A;  3SYB A;  5DL5 A;  2J4U P;  3SY9 A;  5DL7 A;  2XE3 A;  4FRX A;  2Y0K A;  3O0E A;  4GCS A;  1BT9 A;  3VZT X;  2OMF A;  3HW9 A;  3JTY A;  3NSG A;  8PRN A;  4JFB A;  1GFN A;  4GCP A;  2PRN A;  4C69 X;  2XG6 A;  4D64 A;  5FVN A;  1HXU A;  4LSI A;  2XE2 A;  4D5U A;  2XE5 A;  3K19 A;  1HXT A;  3WI4 A;  1BH3 A;  1E54 A;  4FRT A;  2K4T A;  3T0S A;  3T24 A;  3A2S X;  2QTK A;  5DL6 A;  3SZD A;  4LSH A;  4FSP A;  1GFM A;  2O4V A;  3UPG A;  3POR A;  2ZLD A;  5JDP A;  3VY8 X;  2J1N A;  5PRN A;  6PRN A;  3WI5 A;  4RJW A;  3HWB A;  3POX A;  1MPF A;  4FT6 A;  1H6S 1;  4LSE A;  3SY7 A;  3VY9 X;  2FGR A;  2ODJ A;  2Y2X A;  4AUI A;  2Y0H A;  4GCQ A;  2FGQ X;  3POU A;  4BUM X;  3PRN A;  1OSM A;  1PRN A;  1OPF A;  4KR8 A;  3SZV A;  2Y0L A;  3T20 A;  1HXX A;  5DL8 A; 
#chains in the Genus database with same CATH topology
 1ZHX A;  3AA6 A;  1PHO A;  4GHB A;  2R4O A;  4PR7 A;  4O3Z A;  3LK3 A;  1GFQ A;  1ZHW A;  3C5O A;  1MM5 A;  4O3Y A;  2KZ7 B;  3DA4 A;  4LSF A;  7PRN A;  3VZU X;  2POR A;  3BRZ A;  3JCU O;  3PGU A;  1S5L O;  4N59 A;  2IWW A;  3LK2 B;  2ZFG A;  3SYS A;  5ADX L;  1GFO A;  3DZM A;  3HOE A;  3AA0 A;  4AKR A;  4FSO A;  3VZW X;  2R4L A;  5GV0 A;  1ORM A;  3UU2 A;  4FMS A;  3AA6 B;  2KXP B;  5GTH O;  3A0B O;  3AA1 A;  3LK4 2;  4FOZ A;  4AKM A;  1QJ9 A;  4D65 A;  1BXW A;  2K0L A;  2XMX A;  4RJX A;  4AZL A;  1T16 A;  3KVD D;  4KRA A;  3UAQ A;  5B5E O;  4KR4 A;  1IZN B;  3POQ A;  4PJ0 O;  5GTI O;  2XE1 A;  3FYX A;  2F1V A;  3LK2 A;  2Y7S A;  3EMN X;  1GFP A;  3G7G A;  3PQU A;  1MM4 A;  5KAF O;  3AA0 B;  5DL5 A;  3SYB A;  2ERV A;  4AKR B;  5AFU L;  5ADX K;  2J4U P;  4AYI D;  2IWV A;  3SY9 A;  5DL7 A;  2XE3 A;  4FQE A;  4U9C A;  1G90 A;  2F1T A;  3DA3 A;  4UB6 O;  4FRX A;  2KZ7 A;  2Y0K A;  3PF1 A;  4UB8 O;  3O0E A;  2N2L A;  4GCS A;  1BT9 A;  1Q9F A;  2GE4 A;  3A0H O;  3AAA A;  4F4B A;  4K3C A;  3AAE A;  3VZT X;  2JMM A;  2XTR A;  2OMF A;  5AFU K;  4QQ1 A;  1ZHY A;  3AA7 B;  2WJR A;  3PGS A;  4RL9 A;  3HW9 A;  3JTY A;  4RLB A;  3NSG A;  3BS0 A;  2LFU A;  5KAI O;  1QJ8 A;  8PRN A;  4K3B A;  3VE1 A;  4N58 A;  5IYU A;  4G76 A;  1GFN A;  2AXT O;  1Q9G A;  4JFB A;  4GCP A;  2PRN A;  3AAA B;  4C69 X;  4FUV A;  2XG6 A;  3VE2 A;  4D64 A;  3AAE B;  5FVN A;  3WU2 O;  4IL6 O;  2W81 C;  1HXU A;  3PQS A;  4LSI A;  4XNL A;  2N2M A;  4AYM C;  4AYN A;  4JCH A;  2XE2 A;  2R4N A;  4B61 A;  1QJP A;  3LK3 B;  2JQY A;  1ZHT A;  2XTQ A;  2XE5 A;  3K19 A;  4C00 A;  4D5U A;  5B66 O;  1HXT A;  2MHL A;  3WI4 A;  4CTD A;  1BH3 A;  1E54 A;  4FRT A;  2X27 X;  2LHF A;  2K4T A;  3AA7 A;  5TIS O;  3PGR A;  2YPV A;  4FES A;  5G39 A;  5D5D A;  3AA1 B;  5G3A A;  3T0S A;  3T24 A;  2R89 A;  3A2S X;  4FZL A;  2QTK A;  5DL6 A;  3SZD A;  2R8A A;  4FZM A;  3GP6 A;  4LSH A;  4FSP A;  1GFM A;  2O4V A;  4G75 A;  5EE2 A;  3POR A;  3V8U A;  3UPG A;  4O4U A;  2ZLD A;  4PUX A;  4AYD C;  4FZN A;  5G26 A;  5JDP A;  3BRY A;  2J1N A;  2X9K A;  5PRN A;  3VY8 X;  1YS5 A;  6PRN A;  3WI5 A;  5H2F O;  4RJW A;  3DWO X;  3HWB A;  1MPF A;  3NJT A;  3POX A;  4FT6 A;  5G38 A;  4AFK A;  4C4V B;  1H6S 1;  4O4X A;  3HOL A;  2F1C X;  4LSE A;  3SY7 A;  3VY9 X;  4AYE C;  1ZHZ A;  2KC0 A;  2WJQ A;  4E1T A;  2M07 A;  2FGR A;  2ODJ A;  3TZG A;  1T1L A;  3RBH A;  2Y2X A;  4AUI A;  2Y0H A;  3DWN A;  3QRA A;  4GCQ A;  4Z3T A;  4XNK A;  1THQ A;  2FGQ X;  2R88 A;  3POU A;  3QRC A;  4BUM X;  3PRN A;  2KXP A;  4C4V A;  1OSM A;  1PRN A;  4N74 A;  2YNK A;  4GF4 A;  4N75 A;  4O3W A;  1OPF A;  4KR8 A;  3SZV A;  2R4P A;  1IZN A;  1P4T A;  2Y0L A;  2M06 A;  3T20 A;  2KDY A;  2MNH A;  5T5F A;  4RLC A;  2W80 C;  1HXX A;  3KZI O;  2WVP A;  4O49 A;  4E1S A;  5E79 O;  3LK4 1;  4O3X B;  5DL8 A; 
#chains in the Genus database with same CATH homology
 1ZHX A;  3AA6 A;  1PHO A;  4GHB A;  4O3Z A;  3LK3 A;  1GFQ A;  1ZHW A;  3C5O A;  1MM5 A;  4O3Y A;  2KZ7 B;  3DA4 A;  4LSF A;  7PRN A;  3VZU X;  2POR A;  4N59 A;  3LK2 B;  2ZFG A;  3SYS A;  5ADX L;  1GFO A;  3HOE A;  3AA0 A;  4AKR A;  4FSO A;  3VZW X;  5GV0 A;  1ORM A;  3UU2 A;  4FMS A;  3AA6 B;  2KXP B;  3LK4 2;  3AA1 A;  4FOZ A;  4AKM A;  1QJ9 A;  4D65 A;  1BXW A;  2K0L A;  2XMX A;  4RJX A;  4AZL A;  3KVD D;  4KRA A;  3UAQ A;  4KR4 A;  1IZN B;  3POQ A;  2XE1 A;  3FYX A;  2F1V A;  3LK2 A;  2Y7S A;  3EMN X;  1GFP A;  3G7G A;  3PQU A;  1MM4 A;  3SYB A;  3AA0 B;  5DL5 A;  4AKR B;  2ERV A;  5ADX K;  2J4U P;  4AYI D;  3SY9 A;  5DL7 A;  2XE3 A;  4U9C A;  1G90 A;  2F1T A;  3DA3 A;  4FRX A;  2KZ7 A;  2Y0K A;  3O0E A;  2N2L A;  4GCS A;  1BT9 A;  1Q9F A;  2GE4 A;  3AAA A;  4F4B A;  3AAE A;  3VZT X;  2JMM A;  2XTR A;  2OMF A;  5AFU K;  4QQ1 A;  1ZHY A;  3AA7 B;  4RL9 A;  3HW9 A;  3JTY A;  4RLB A;  3NSG A;  2LFU A;  8PRN A;  1QJ8 A;  5IYU A;  3VE1 A;  4N58 A;  4G76 A;  1GFN A;  4JFB A;  1Q9G A;  4GCP A;  2PRN A;  3AAA B;  4C69 X;  4FUV A;  2XG6 A;  3VE2 A;  4D64 A;  3AAE B;  5FVN A;  2W81 C;  1HXU A;  3PQS A;  4LSI A;  4XNL A;  2N2M A;  4AYM C;  4AYN A;  4JCH A;  2XE2 A;  4B61 A;  1QJP A;  3LK3 B;  4D5U A;  1ZHT A;  2XTQ A;  2XE5 A;  3K19 A;  1HXT A;  2MHL A;  3WI4 A;  1BH3 A;  1E54 A;  4FRT A;  2X27 X;  2LHF A;  2K4T A;  3AA7 A;  2YPV A;  4FES A;  5D5D A;  3AA1 B;  3T0S A;  3T24 A;  4FZL A;  3A2S X;  2QTK A;  5DL6 A;  3SZD A;  4FZM A;  5EE2 A;  3GP6 A;  4LSH A;  4FSP A;  1GFM A;  2O4V A;  4G75 A;  3V8U A;  3POR A;  3UPG A;  4O4U A;  2ZLD A;  4PUX A;  4AYD C;  4FZN A;  5G26 A;  5JDP A;  3VY8 X;  2J1N A;  5PRN A;  1YS5 A;  6PRN A;  3WI5 A;  4RJW A;  3HWB A;  4AFK A;  1MPF A;  3POX A;  4FT6 A;  1H6S 1;  4O4X A;  3HOL A;  4LSE A;  4E1T A;  3SY7 A;  3VY9 X;  4AYE C;  1ZHZ A;  2KC0 A;  5AFU L;  2M07 A;  2FGR A;  2ODJ A;  3TZG A;  3RBH A;  2Y2X A;  4AUI A;  2Y0H A;  3QRA A;  4GCQ A;  4Z3T A;  4XNK A;  1THQ A;  2FGQ X;  3POU A;  4BUM X;  3QRC A;  3PRN A;  2KXP A;  1OSM A;  1PRN A;  2YNK A;  4GF4 A;  4O3W A;  1OPF A;  4KR8 A;  3SZV A;  1IZN A;  1P4T A;  2Y0L A;  2M06 A;  3T20 A;  2KDY A;  2MNH A;  5T5F A;  4RLC A;  2W80 C;  1HXX A;  4O49 A;  4E1S A;  3LK4 1;  4O3X B;  5DL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...