4D64A

Structure of porin omp-pst1 from p. stuartii; the crystallographic symmetry generates a dimer of trimers.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
352
structure length
352
Chain Sequence
AEVYNKDGNKLDVYGKVDVRHYFASADKGKKSEDGDDSRVRLGVKGDTQITDQLTGFGRFEWETKTNKAENEGENKNRLAYAGLKFADFGSIDYGRNYGVVYDTNAWTDVFPLWGADTMAQTDNFMTSRNRNLLTYRNNNAFGYVDGLSFALQYQGKNGDNNKSSAGMAKDNGDGYGFSTAYELGWGVTLGGGYSSSSRTPNQKAGVVTSEGDSYYSATGKRAQAWNVGGKFDANNVYLAAMYGQTQNTSRYGDLDLIANKTENVELVAQYLFDFGLKPSIGYNQSKGKNLGNGYDNQDLVKYISVGSYYYFNKNMSAVVDYKINLLKDNDFTKEYGINTDNVLGLGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin self-association enables cell-to-cell contact inProvidencia stuartiifloating communities.
pubmed doi rcsb
source organism Providencia stuartii
molecule tags Transport protein
molecule keywords PORIN 1
total genus 98
structure length 352
sequence length 352
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d64A00
2FGRA 4KRAA 3HWBA 1HXXA 2XE3A 2XE1A 1PRNA 1HXUA 3PRNA 3FYXA 5DL5A 4D65A 3SZDA 4FSPA 5FVNA 3WI5A 7PRNA 3SYBA 2ZLDA 8PRNA 4FMSA 5DL6A 4C69X 4GCSA 1MPFA 3EMNX 3HW9A 3SYSA 4GCPA 3VZUX 2QTKA 4BUMX 1GFNA 2Y2XA 3POQA 2PRNA 5DL8A 4GCQA 4JFBA 2XE2A 3T20A 3VY9X 4LSFA 4KR4A 4RJXA 2PORA 4FOZA 1HXTA 1OPFA 4FRTA 2XE5A 2FGQX 3JTYA 2Y0HA 4D64A 4FSOA 3T0SA 2Y0LA 2K4TA 2OMFA 5DL7A 3PORA 5PRNA 2O4VA 3SZVA 3NSGA 4LSEA 3UU2A 1OSMA 1PHOA 5JDPA 1BT9A 2J1NA 1GFMA 3K19A 2J4UP 1GFPA 3SY9A 1GFOA 4LSHA 3VZTX 4LSIA 3SY7A 1H6S1 3POXA 2Y0KA 4D5UA 4KR8A 1E54A 1GFQA 1BH3A 3WI4A 2ODJA 2ZFGA 4FRXA 2XG6A 3VY8X 4FT6A 6PRNA 3T24A 3VZWX 3POUA 4AUIA 3UPGA 3O0EA 4RJWA 3A2SX
chains in the Genus database with same CATH superfamily
3PQUA 2K0LA 3KVDD 4XNKA 2R4LA 3LK2B 5GV0A 2FGRA 1ZHTA 1QJ8A 2MHLA 2KDYA 2JQYA 3AA0B 5GTIO 3AA1A 1MM4A 3HWBA 2N2MA 4KRAA 4CTDA 4G75A 4PJ0O 1HXXA 4N58A 2XE3A 2XE1A 1PRNA 2R4OA 1HXUA 2LHFA 2M06A 2M07A 2W81C 2XTQA 2YPVA 3PGRA 3PRNA 4O4XA 4RLCA 4AKMA 3FYXA 2KC0A 5DL5A 3DWOX 5AFUK 3AAAB 4D65A 3SZDA 4O4UA 4FSPA 3AA6B 5FVNA 3WI5A 7PRNA 3SYBA 1ZHZA 2KXPB 2ZLDA 3PGSA 8PRNA 1THQA 4FMSA 3LK42 5DL6A 4C69X 4GCSA 1MPFA 1Q9GA 3EMNX 3HW9A 3SYSA 4GCPA 4AZLA 4B61A 3VZUX 5GTHO 2QTKA 2WJRA 2ERVA 1GFNA 5KAFO 4AYMC 2Y2XA 4BUMX 3POQA 3LK3B 2PRNA 3HOEA 1IZNA 3AAEB 4PUXA 3HOLA 3BRYA 5DL8A 4GCQA 3QRCA 3KZIO 4JFBA 4RL9A 4AFKA 2XE2A 4AYNA 2N2LA 5ADXK 4O49A 3T20A 2Y7SA 3VY9X 4AYEC 5T5FA 5ADXL 4LSFA 4KR4A 3A0BO 4RJXA 1YS5A 2PORA 3BS0A 4E1SA 1ZHYA 4C4VB 1MM5A 2IWVA 4FOZA 5D5DA 5AFUL 1HXTA 2WVPA 4O3ZA 4O3WA 3AA7B 5G26A 4AKRB 5G3AA 1OPFA 4FRTA 3V8UA 2XE5A 1Q9FA 2R88A 2W80C 4JCHA 3JTYA 4N75A 1P4TA 4AYDC 2F1VA 2KZ7A 2R4PA 2R89A 4AYID 5H2FO 2Y0HA 5G39A 4D64A 4FSOA 5G38A 2Y0LA 3T0SA 3GP6A 3PF1A 4UB6O 4RLBA 3JCUO 5E79O 3VE2A 2K4TA 4K3BA 1QJPA 3UAQA 2MNHA 2OMFA 3G7GA 4O3YA 5DL7A 4PR7A 4E1TA 3C5OA 3PORA 5PRNA 3NJTA 3LK2A 4C4VA 2XMXA 3AA0A 3PGUA 4UB8O 2F1TA 3AA7A 2O4VA 4FZMA 3RBHA 4IL6O 3VE1A 3SZVA 3NSGA 4LSEA 5B5EO 1QJ9A 1BXWA 3UU2A 2WJQA 4O3XB 2KZ7B 4FZLA 4XNLA 1OSMA 2R8AA 1PHOA 5JDPA 1BT9A 1S5LO 4RJWA 2J1NA 1GFMA 2F1CX 3DA4A 3K19A 1GFPA 2J4UP 4F4BA 1T1LA 1G90A 2YNKA 3AA6A 3SY9A 2R4NA 2X27X 5EE2A 2XTRA 4FUVA 4G76A 1GFOA 2AXTO 3DZMA 4FZNA 4LSIA 4LSHA 3VZTX 2IWWA 4FESA 4N59A 3SY7A 1H6S1 3POXA 3LK41 1T16A 2Y0KA 4D5UA 5TISO 4FQEA 4K3CA 4C00A 4KR8A 3LK3A 4AKRA 1E54A 1ZHXA 1GFQA 2GE4A 3AA1B 1IZNB 3AAEA 4GHBA 1BH3A 3BRZA 3WI4A 4U9CA 4Z3TA 2ODJA 2ZFGA 4FRXA 3A0HO 2XG6A 3DA3A 4GF4A 1ORMA 3QRAA 3AAAA 3PQSA 3VY8X 4FT6A 2JMMA 6PRNA 3T24A 3TZGA 3VZWX 3POUA 3WU2O 2KXPA 4AUIA 3UPGA 1ZHWA 2LFUA 4QQ1A 3O0EA 2FGQX 3DWNA 5KAIO 5B66O 5IYUA 2X9KA 3A2SX 4N74A
chains in the Genus database with same CATH topology
3PQUA 2K0LA 3KVDD 4XNKA 3LK2B 5GV0A 2FGRA 1ZHTA 1QJ8A 2MHLA 2KDYA 3AA0B 3AA1A 1MM4A 3HWBA 2N2MA 4KRAA 4G75A 1HXXA 4N58A 2XE3A 2XE1A 1PRNA 2YPVA 1HXUA 2LHFA 2M06A 2M07A 2W81C 2XTQA 4O4XA 3PRNA 4RLCA 4AKMA 3FYXA 2KC0A 5DL5A 5AFUK 3AAAB 4D65A 3SZDA 4O4UA 4FSPA 3AA6B 5FVNA 3WI5A 7PRNA 3SYBA 1ZHZA 2KXPB 2ZLDA 8PRNA 1THQA 4FMSA 3LK42 5DL6A 4C69X 4GCSA 1MPFA 1Q9GA 3EMNX 3HW9A 3SYSA 4GCPA 4AZLA 4B61A 3VZUX 2QTKA 2ERVA 1GFNA 4BUMX 2Y2XA 3POQA 3LK3B 2PRNA 3HOEA 1IZNA 3AAEB 4PUXA 3HOLA 5DL8A 4GCQA 3QRCA 4JFBA 4AFKA 4RL9A 4AYNA 2XE2A 2N2LA 5ADXK 4O49A 3T20A 2Y7SA 3VY9X 4AYEC 5T5FA 5ADXL 4LSFA 4KR4A 4RJXA 1YS5A 2PORA 4E1SA 1ZHYA 1MM5A 4FOZA 5D5DA 1HXTA 4O3ZA 4O3WA 4AKRB 3AA7B 5G26A 3V8UA 1OPFA 4FRTA 2XE5A 1Q9FA 2W80C 4JCHA 3JTYA 4AYDC 1P4TA 2F1VA 2KZ7A 4AYID 2Y0HA 4D64A 4FSOA 2Y0LA 3T0SA 3GP6A 4RLBA 3VE2A 2K4TA 1QJPA 3UAQA 2MNHA 2OMFA 3G7GA 4O3YA 5DL7A 4E1TA 3C5OA 3PORA 5PRNA 3LK2A 2XMXA 3AA0A 4AYMC 2F1TA 3AA7A 2O4VA 4FZMA 3RBHA 3VE1A 3SZVA 3NSGA 4LSEA 1QJ9A 1BXWA 3UU2A 4O3XB 2KZ7B 4FZLA 4XNLA 1OSMA 1PHOA 5JDPA 1BT9A 4RJWA 2J1NA 1GFMA 3DA4A 3K19A 2J4UP 1GFPA 1G90A 4F4BA 2YNKA 3AA6A 3SY9A 2X27X 5EE2A 2XTRA 4FUVA 4G76A 1GFOA 4FZNA 4LSHA 4LSIA 3VZTX 4FESA 4N59A 3SY7A 1H6S1 3POXA 3LK41 2Y0KA 4D5UA 4KR8A 3LK3A 4AKRA 1E54A 1ZHXA 1GFQA 2GE4A 3AA1B 1IZNB 3AAEA 4GHBA 1BH3A 3WI4A 4U9CA 4Z3TA 2ODJA 2ZFGA 4FRXA 2XG6A 3DA3A 4GF4A 1ORMA 3QRAA 3AAAA 3PQSA 3VY8X 4FT6A 2JMMA 6PRNA 3T24A 3TZGA 3VZWX 3POUA 4AUIA 2KXPA 3UPGA 1ZHWA 2LFUA 4QQ1A 3O0EA 2FGQX 5IYUA 3A2SX 5AFUL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGR A;  4KRA A;  3HWB A;  1HXX A;  2XE3 A;  2XE1 A;  1PRN A;  1HXU A;  3PRN A;  3FYX A;  5DL5 A;  4D65 A;  3SZD A;  4FSP A;  5FVN A;  3WI5 A;  7PRN A;  3SYB A;  2ZLD A;  8PRN A;  4FMS A;  5DL6 A;  4C69 X;  4GCS A;  1MPF A;  3EMN X;  3HW9 A;  3SYS A;  4GCP A;  3VZU X;  2QTK A;  4BUM X;  1GFN A;  2Y2X A;  3POQ A;  2PRN A;  5DL8 A;  4GCQ A;  4JFB A;  2XE2 A;  3T20 A;  3VY9 X;  4LSF A;  4KR4 A;  4RJX A;  2POR A;  4FOZ A;  1HXT A;  1OPF A;  4FRT A;  2XE5 A;  2FGQ X;  3JTY A;  2Y0H A;  4D64 A;  4FSO A;  3T0S A;  2Y0L A;  2K4T A;  2OMF A;  5DL7 A;  3POR A;  5PRN A;  2O4V A;  3SZV A;  3NSG A;  4LSE A;  3UU2 A;  1OSM A;  1PHO A;  5JDP A;  1BT9 A;  2J1N A;  1GFM A;  3K19 A;  2J4U P;  1GFP A;  3SY9 A;  1GFO A;  4LSH A;  3VZT X;  4LSI A;  3SY7 A;  1H6S 1;  3POX A;  2Y0K A;  4D5U A;  4KR8 A;  1E54 A;  1GFQ A;  1BH3 A;  3WI4 A;  2ODJ A;  2ZFG A;  4FRX A;  2XG6 A;  3VY8 X;  4FT6 A;  6PRN A;  3T24 A;  3VZW X;  3POU A;  4AUI A;  3UPG A;  3O0E A;  4RJW A;  3A2S X; 
#chains in the Genus database with same CATH topology
 3PQU A;  2K0L A;  3KVD D;  4XNK A;  2R4L A;  3LK2 B;  5GV0 A;  2FGR A;  1ZHT A;  1QJ8 A;  2MHL A;  2KDY A;  2JQY A;  3AA0 B;  5GTI O;  3AA1 A;  1MM4 A;  3HWB A;  2N2M A;  4KRA A;  4CTD A;  4G75 A;  4PJ0 O;  1HXX A;  4N58 A;  2XE3 A;  2XE1 A;  1PRN A;  2R4O A;  1HXU A;  2LHF A;  2M06 A;  2M07 A;  2W81 C;  2XTQ A;  2YPV A;  3PGR A;  3PRN A;  4O4X A;  4RLC A;  4AKM A;  3FYX A;  2KC0 A;  5DL5 A;  3DWO X;  5AFU K;  3AAA B;  4D65 A;  3SZD A;  4O4U A;  4FSP A;  3AA6 B;  5FVN A;  3WI5 A;  7PRN A;  3SYB A;  1ZHZ A;  2KXP B;  2ZLD A;  3PGS A;  8PRN A;  1THQ A;  4FMS A;  3LK4 2;  5DL6 A;  4C69 X;  4GCS A;  1MPF A;  1Q9G A;  3EMN X;  3HW9 A;  3SYS A;  4GCP A;  4AZL A;  4B61 A;  3VZU X;  5GTH O;  2QTK A;  2WJR A;  2ERV A;  1GFN A;  5KAF O;  4AYM C;  2Y2X A;  4BUM X;  3POQ A;  3LK3 B;  2PRN A;  3HOE A;  1IZN A;  3AAE B;  4PUX A;  3HOL A;  3BRY A;  5DL8 A;  4GCQ A;  3QRC A;  3KZI O;  4JFB A;  4RL9 A;  4AFK A;  2XE2 A;  4AYN A;  2N2L A;  5ADX K;  4O49 A;  3T20 A;  2Y7S A;  3VY9 X;  4AYE C;  5T5F A;  5ADX L;  4LSF A;  4KR4 A;  3A0B O;  4RJX A;  1YS5 A;  2POR A;  3BS0 A;  4E1S A;  1ZHY A;  4C4V B;  1MM5 A;  2IWV A;  4FOZ A;  5D5D A;  5AFU L;  1HXT A;  2WVP A;  4O3Z A;  4O3W A;  3AA7 B;  5G26 A;  4AKR B;  5G3A A;  1OPF A;  4FRT A;  3V8U A;  2XE5 A;  1Q9F A;  2R88 A;  2W80 C;  4JCH A;  3JTY A;  4N75 A;  1P4T A;  4AYD C;  2F1V A;  2KZ7 A;  2R4P A;  2R89 A;  4AYI D;  5H2F O;  2Y0H A;  5G39 A;  4D64 A;  4FSO A;  5G38 A;  2Y0L A;  3T0S A;  3GP6 A;  3PF1 A;  4UB6 O;  4RLB A;  3JCU O;  5E79 O;  3VE2 A;  2K4T A;  4K3B A;  1QJP A;  3UAQ A;  2MNH A;  2OMF A;  3G7G A;  4O3Y A;  5DL7 A;  4PR7 A;  4E1T A;  3C5O A;  3POR A;  5PRN A;  3NJT A;  3LK2 A;  4C4V A;  2XMX A;  3AA0 A;  3PGU A;  4UB8 O;  2F1T A;  3AA7 A;  2O4V A;  4FZM A;  3RBH A;  4IL6 O;  3VE1 A;  3SZV A;  3NSG A;  4LSE A;  5B5E O;  1QJ9 A;  1BXW A;  3UU2 A;  2WJQ A;  4O3X B;  2KZ7 B;  4FZL A;  4XNL A;  1OSM A;  2R8A A;  1PHO A;  5JDP A;  1BT9 A;  1S5L O;  4RJW A;  2J1N A;  1GFM A;  2F1C X;  3DA4 A;  3K19 A;  1GFP A;  2J4U P;  4F4B A;  1T1L A;  1G90 A;  2YNK A;  3AA6 A;  3SY9 A;  2R4N A;  2X27 X;  5EE2 A;  2XTR A;  4FUV A;  4G76 A;  1GFO A;  2AXT O;  3DZM A;  4FZN A;  4LSI A;  4LSH A;  3VZT X;  2IWW A;  4FES A;  4N59 A;  3SY7 A;  1H6S 1;  3POX A;  3LK4 1;  1T16 A;  2Y0K A;  4D5U A;  5TIS O;  4FQE A;  4K3C A;  4C00 A;  4KR8 A;  3LK3 A;  4AKR A;  1E54 A;  1ZHX A;  1GFQ A;  2GE4 A;  3AA1 B;  1IZN B;  3AAE A;  4GHB A;  1BH3 A;  3BRZ A;  3WI4 A;  4U9C A;  4Z3T A;  2ODJ A;  2ZFG A;  4FRX A;  3A0H O;  2XG6 A;  3DA3 A;  4GF4 A;  1ORM A;  3QRA A;  3AAA A;  3PQS A;  3VY8 X;  4FT6 A;  2JMM A;  6PRN A;  3T24 A;  3TZG A;  3VZW X;  3POU A;  3WU2 O;  2KXP A;  4AUI A;  3UPG A;  1ZHW A;  2LFU A;  4QQ1 A;  3O0E A;  2FGQ X;  3DWN A;  5KAI O;  5B66 O;  5IYU A;  2X9K A;  3A2S X;  4N74 A; 
#chains in the Genus database with same CATH homology
 3PQU A;  2K0L A;  3KVD D;  4XNK A;  3LK2 B;  5GV0 A;  2FGR A;  1ZHT A;  1QJ8 A;  2MHL A;  2KDY A;  3AA0 B;  3AA1 A;  1MM4 A;  3HWB A;  2N2M A;  4KRA A;  4G75 A;  1HXX A;  4N58 A;  2XE3 A;  2XE1 A;  1PRN A;  2YPV A;  1HXU A;  2LHF A;  2M06 A;  2M07 A;  2W81 C;  2XTQ A;  4O4X A;  3PRN A;  4RLC A;  4AKM A;  3FYX A;  2KC0 A;  5DL5 A;  5AFU K;  3AAA B;  4D65 A;  3SZD A;  4O4U A;  4FSP A;  3AA6 B;  5FVN A;  3WI5 A;  7PRN A;  3SYB A;  1ZHZ A;  2KXP B;  2ZLD A;  8PRN A;  1THQ A;  4FMS A;  3LK4 2;  5DL6 A;  4C69 X;  4GCS A;  1MPF A;  1Q9G A;  3EMN X;  3HW9 A;  3SYS A;  4GCP A;  4AZL A;  4B61 A;  3VZU X;  2QTK A;  2ERV A;  1GFN A;  4BUM X;  2Y2X A;  3POQ A;  3LK3 B;  2PRN A;  3HOE A;  1IZN A;  3AAE B;  4PUX A;  3HOL A;  5DL8 A;  4GCQ A;  3QRC A;  4JFB A;  4AFK A;  4RL9 A;  4AYN A;  2XE2 A;  2N2L A;  5ADX K;  4O49 A;  3T20 A;  2Y7S A;  3VY9 X;  4AYE C;  5T5F A;  5ADX L;  4LSF A;  4KR4 A;  4RJX A;  1YS5 A;  2POR A;  4E1S A;  1ZHY A;  1MM5 A;  4FOZ A;  5D5D A;  1HXT A;  4O3Z A;  4O3W A;  4AKR B;  3AA7 B;  5G26 A;  3V8U A;  1OPF A;  4FRT A;  2XE5 A;  1Q9F A;  2W80 C;  4JCH A;  3JTY A;  4AYD C;  1P4T A;  2F1V A;  2KZ7 A;  4AYI D;  2Y0H A;  4D64 A;  4FSO A;  2Y0L A;  3T0S A;  3GP6 A;  4RLB A;  3VE2 A;  2K4T A;  1QJP A;  3UAQ A;  2MNH A;  2OMF A;  3G7G A;  4O3Y A;  5DL7 A;  4E1T A;  3C5O A;  3POR A;  5PRN A;  3LK2 A;  2XMX A;  3AA0 A;  4AYM C;  2F1T A;  3AA7 A;  2O4V A;  4FZM A;  3RBH A;  3VE1 A;  3SZV A;  3NSG A;  4LSE A;  1QJ9 A;  1BXW A;  3UU2 A;  4O3X B;  2KZ7 B;  4FZL A;  4XNL A;  1OSM A;  1PHO A;  5JDP A;  1BT9 A;  4RJW A;  2J1N A;  1GFM A;  3DA4 A;  3K19 A;  2J4U P;  1GFP A;  1G90 A;  4F4B A;  2YNK A;  3AA6 A;  3SY9 A;  2X27 X;  5EE2 A;  2XTR A;  4FUV A;  4G76 A;  1GFO A;  4FZN A;  4LSH A;  4LSI A;  3VZT X;  4FES A;  4N59 A;  3SY7 A;  1H6S 1;  3POX A;  3LK4 1;  2Y0K A;  4D5U A;  4KR8 A;  3LK3 A;  4AKR A;  1E54 A;  1ZHX A;  1GFQ A;  2GE4 A;  3AA1 B;  1IZN B;  3AAE A;  4GHB A;  1BH3 A;  3WI4 A;  4U9C A;  4Z3T A;  2ODJ A;  2ZFG A;  4FRX A;  2XG6 A;  3DA3 A;  4GF4 A;  1ORM A;  3QRA A;  3AAA A;  3PQS A;  3VY8 X;  4FT6 A;  2JMM A;  6PRN A;  3T24 A;  3TZG A;  3VZW X;  3POU A;  4AUI A;  2KXP A;  3UPG A;  1ZHW A;  2LFU A;  4QQ1 A;  3O0E A;  2FGQ X;  5IYU A;  3A2S X;  5AFU L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...