4D64A

Structure of porin omp-pst1 from p. stuartii; the crystallographic symmetry generates a dimer of trimers.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
352
structure length
352
Chain Sequence
b'AEVYNKDGNKLDVYGKVDVRHYFASADKGKKSEDGDDSRVRLGVKGDTQITDQLTGFGRFEWETKTNKAENEGENKNRLAYAGLKFADFGSIDYGRNYGVVYDTNAWTDVFPLWGADTMAQTDNFMTSRNRNLLTYRNNNAFGYVDGLSFALQYQGKNGDNNKSSAGMAKDNGDGYGFSTAYELGWGVTLGGGYSSSSRTPNQKAGVVTSEGDSYYSATGKRAQAWNVGGKFDANNVYLAAMYGQTQNTSRYGDLDLIANKTENVELVAQYLFDFGLKPSIGYNQSKGKNLGNGYDNQDLVKYISVGSYYYFNKNMSAVVDYKINLLKDNDFTKEYGINTDNVLGLGLVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN 1
publication title Porin self-association enables cell-to-cell contact inProvidencia stuartiifloating communities.
pubmed doi rcsb
source organism Providencia stuartii
molecule tags Transport protein
total genus 98
structure length 352
sequence length 352
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d64A00
3SZVA 2XE5A 2FGRA 2Y2XA 4BUMX 4FRXA 2XE2A 4RJXA 4D64A 5JDPA 3POQA 3SY9A 3O0EA 4FRTA 1E54A 3POXA 3VY8X 2FGQX 4D65A 5DL5A 4FSPA 3K19A 3VZTX 3PORA 1MPFA 3A2SX 4FSOA 4GCQA 1HXXA 2O4VA 3UU2A 3T0SA 2Y0KA 5FVNA 2ZLDA 2J4UP 4RJWA 2Y0LA 1OPFA 7PRNA 2XE1A 3HWBA 4LSHA 4KRAA 4GCPA 2ODJA 3T24A 3UPGA 1HXTA 4FT6A 1PRNA 3VY9X 2PRNA 2Y0HA 8PRNA 3FYXA 4AUIA 2J1NA 2K4TA 3EMNX 1GFQA 3SYSA 4D5UA 3T20A 4FOZA 5PRNA 5DL7A 2PORA 1GFPA 3NSGA 1GFNA 1OSMA 1GFMA 3SZDA 3POUA 3PRNA 4LSFA 1HXUA 4LSIA 4KR4A 2XE3A 1H6S1 3VZWX 4KR8A 1PHOA 3WI4A 3JTYA 5DL6A 4GCSA 3VZUX 2QTKA 3WI5A 4C69X 4JFBA 4LSEA 1BH3A 5DL8A 2ZFGA 3SY7A 1GFOA 3HW9A 1BT9A 2OMFA 6PRNA 4FMSA 3SYBA 2XG6A
chains in the Genus database with same CATH superfamily
3SZVA 2XE5A 4CTDA 3QRAA 4AYDC 4N58A 3DA3A 4N75A 2KDYA 3LK42 1ZHTA 1YS5A 2FGRA 4O3WA 4F4BA 3AA0A 2W80C 2Y2XA 2Y7SA 3UAQA 2LHFA 4FRXA 4BUMX 2XE2A 5AFUL 4RJXA 3AA7A 5TISO 3VE2A 4C00A 4D64A 5JDPA 2YNKA 4JCHA 4U9CA 3POQA 4C4VB 4PR7A 1Q9GA 4Z3TA 5G39A 5D5DA 3BRYA 2WVPA 4AKRB 4FZNA 3SY9A 1IZNB 3O0EA 4FRTA 2GE4A 1E54A 3POXA 1MM4A 2FGQX 5E79O 5DL5A 3VY8X 4D65A 5GTHO 1T1LA 3JCUO 2M06A 3K19A 4FSPA 3VZTX 1THQA 4AYEC 3PORA 1MPFA 4UB8O 4AYMC 4PUXA 1T16A 3A2SX 3PQUA 4FSOA 4GCQA 1IZNA 3AA6B 5G3AA 3LK2B 2R4OA 5GTIO 5B5EO 3RBHA 1BXWA 1HXXA 2O4VA 2KZ7B 4AYNA 3UU2A 4IL6O 1QJ9A 3DZMA 5GV0A 3T0SA 2Y0KA 3KVDD 2ZLDA 3PGUA 4K3CA 5FVNA 5IYUA 4RJWA 2J4UP 2Y0LA 5ADXK 1OPFA 2R4PA 7PRNA 1MM5A 2XE1A 4O3XB 4O3ZA 3HWBA 2R89A 4LSHA 2KC0A 4KRAA 4GCPA 2ODJA 2M07A 4AYID 3T24A 2R8AA 2W81C 3PQSA 2JMMA 3DWNA 3HOEA 4GF4A 3UPGA 2IWVA 3AAAB 1G90A 1HXTA 2LFUA 3A0HO 4C4VA 4AZLA 1PRNA 1P4TA 4FT6A 4G75A 2KXPB 4FZMA 5ADXL 4AKRA 2X27X 4GHBA 4O4XA 4RL9A 2R4NA 2PRNA 2Y0HA 2XMXA 4RLBA 5EE2A 3VY9X 5T5FA 4E1SA 8PRNA 5KAIO 2MHLA 3FYXA 4AUIA 2J1NA 2K4TA 3EMNX 3TZGA 1ZHXA 3AAEB 2F1TA 1ZHWA 2F1VA 4FZLA 4N74A 1GFQA 3SYSA 4D5UA 3LK3B 3DWOX 3AA6A 4G76A 2AXTO 3LK2A 3T20A 4FOZA 5PRNA 4B61A 4N59A 4FESA 2KZ7A 3PGSA 2X9KA 5DL7A 2PORA 1QJPA 3BRZA 1GFPA 3NSGA 1GFNA 1OSMA 2N2MA 3A0BO 4O49A 1GFMA 3LK3A 4RLCA 4AKMA 5B66O 1S5LO 3GP6A 3QRCA 3POUA 3SZDA 3PRNA 2XTQA 3HOLA 4LSFA 1ZHZA 3WU2O 1HXUA 4LSIA 2JQYA 1ZHYA 4KR4A 2XE3A 3AA7B 1H6S1 3AA1B 2IWWA 4PJ0O 3BS0A 4UB6O 2N2LA 2R4LA 3VZWX 3KZIO 3AAAA 4KR8A 2R88A 4XNLA 5KAFO 4O4UA 1PHOA 3AA1A 3PF1A 3WI4A 2K0LA 2XG6A 2KXPA 3JTYA 4GCSA 2F1CX 3C5OA 5DL6A 3V8UA 4FQEA 3VZUX 3G7GA 2WJRA 2YPVA 2QTKA 4E1TA 3WI5A 1ORMA 4C69X 4JFBA 4LSEA 2WJQA 3PGRA 4O3YA 1BH3A 5DL8A 2ERVA 2ZFGA 3AAEA 4K3BA 1GFOA 3HW9A 5G38A 3SY7A 4FUVA 4AFKA 1BT9A 5AFUK 5H2FO 3NJTA 2OMFA 1QJ8A 2MNHA 3AA0B 3LK41 6PRNA 4FMSA 3VE1A 5G26A 4QQ1A 3SYBA 3DA4A 2XTRA 1Q9FA 4XNKA
chains in the Genus database with same CATH topology
3SZVA 2XE5A 3QRAA 4AYDC 4N58A 3DA3A 2KDYA 3LK42 1ZHTA 1YS5A 2FGRA 4O3WA 4F4BA 3AA0A 2W80C 2Y2XA 2Y7SA 3UAQA 2LHFA 4FRXA 4BUMX 2XE2A 5AFUL 4RJXA 3AA7A 3VE2A 4D64A 5JDPA 2YNKA 4JCHA 4U9CA 3POQA 4Z3TA 1Q9GA 5D5DA 4AKRB 4FZNA 3SY9A 1IZNB 3O0EA 4FRTA 2GE4A 1E54A 3POXA 1MM4A 2FGQX 3VY8X 5DL5A 4D65A 2M06A 3K19A 4FSPA 3VZTX 1THQA 4AYEC 3PORA 1MPFA 4AYMC 4PUXA 3A2SX 3PQUA 4FSOA 4GCQA 1IZNA 3AA6B 3LK2B 3RBHA 1BXWA 1HXXA 2O4VA 2KZ7B 4AYNA 3UU2A 1QJ9A 5GV0A 3T0SA 2Y0KA 3KVDD 2ZLDA 5FVNA 5IYUA 2J4UP 4RJWA 2Y0LA 5ADXK 1OPFA 7PRNA 1MM5A 2XE1A 4O3XB 4O3ZA 3HWBA 4LSHA 2KC0A 4KRAA 4GCPA 2ODJA 2M07A 4AYID 3T24A 2W81C 3PQSA 2JMMA 3HOEA 4GF4A 3UPGA 3AAAB 1G90A 1HXTA 2LFUA 4AZLA 1PRNA 1P4TA 4FT6A 4G75A 2KXPB 4FZMA 5ADXL 4AKRA 2X27X 4GHBA 4O4XA 4RL9A 4RLBA 2PRNA 2Y0HA 2XMXA 5EE2A 3VY9X 5T5FA 4E1SA 8PRNA 2MHLA 3FYXA 4AUIA 2J1NA 2K4TA 3EMNX 3TZGA 1ZHXA 3AAEB 2F1TA 1ZHWA 2F1VA 4FZLA 1GFQA 3SYSA 4D5UA 3LK3B 3AA6A 4G76A 3LK2A 3T20A 4FOZA 5PRNA 4B61A 4N59A 4FESA 2KZ7A 5DL7A 2PORA 1QJPA 1GFPA 3NSGA 1GFNA 1OSMA 2N2MA 4O49A 4RLCA 1GFMA 3LK3A 1Q9FA 4AKMA 3GP6A 3QRCA 3POUA 3SZDA 3PRNA 2XTQA 3HOLA 4LSFA 1ZHZA 1HXUA 4LSIA 1ZHYA 4KR4A 2XE3A 3AA7B 1H6S1 3AA1B 3VZWX 2N2LA 3AAAA 4KR8A 4XNLA 4O4UA 1PHOA 3AA1A 3WI4A 2K0LA 3JTYA 2KXPA 5DL6A 4GCSA 3C5OA 3VZUX 3V8UA 3G7GA 2YPVA 2QTKA 4E1TA 3WI5A 1ORMA 4C69X 4JFBA 4LSEA 4O3YA 1BH3A 5DL8A 2ERVA 2ZFGA 3AAEA 3SY7A 1GFOA 3HW9A 5AFUK 4FUVA 4AFKA 1BT9A 2OMFA 1QJ8A 2MNHA 3AA0B 3LK41 6PRNA 4FMSA 3VE1A 5G26A 4QQ1A 3SYBA 3DA4A 2XTRA 2XG6A 4XNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZV A;  2XE5 A;  2FGR A;  2Y2X A;  4BUM X;  4FRX A;  2XE2 A;  4RJX A;  4D64 A;  5JDP A;  3POQ A;  3SY9 A;  3O0E A;  4FRT A;  1E54 A;  3POX A;  3VY8 X;  2FGQ X;  4D65 A;  5DL5 A;  4FSP A;  3K19 A;  3VZT X;  3POR A;  1MPF A;  3A2S X;  4FSO A;  4GCQ A;  1HXX A;  2O4V A;  3UU2 A;  3T0S A;  2Y0K A;  5FVN A;  2ZLD A;  2J4U P;  4RJW A;  2Y0L A;  1OPF A;  7PRN A;  2XE1 A;  3HWB A;  4LSH A;  4KRA A;  4GCP A;  2ODJ A;  3T24 A;  3UPG A;  1HXT A;  4FT6 A;  1PRN A;  3VY9 X;  2PRN A;  2Y0H A;  8PRN A;  3FYX A;  4AUI A;  2J1N A;  2K4T A;  3EMN X;  1GFQ A;  3SYS A;  4D5U A;  3T20 A;  4FOZ A;  5PRN A;  5DL7 A;  2POR A;  1GFP A;  3NSG A;  1GFN A;  1OSM A;  1GFM A;  3SZD A;  3POU A;  3PRN A;  4LSF A;  1HXU A;  4LSI A;  4KR4 A;  2XE3 A;  1H6S 1;  3VZW X;  4KR8 A;  1PHO A;  3WI4 A;  3JTY A;  5DL6 A;  4GCS A;  3VZU X;  2QTK A;  3WI5 A;  4C69 X;  4JFB A;  4LSE A;  1BH3 A;  5DL8 A;  2ZFG A;  3SY7 A;  1GFO A;  3HW9 A;  1BT9 A;  2OMF A;  6PRN A;  4FMS A;  3SYB A;  2XG6 A; 
#chains in the Genus database with same CATH topology
 3SZV A;  2XE5 A;  4CTD A;  3QRA A;  4AYD C;  4N58 A;  3DA3 A;  4N75 A;  2KDY A;  3LK4 2;  1ZHT A;  1YS5 A;  2FGR A;  4O3W A;  4F4B A;  3AA0 A;  2W80 C;  2Y2X A;  2Y7S A;  3UAQ A;  2LHF A;  4FRX A;  4BUM X;  2XE2 A;  5AFU L;  4RJX A;  3AA7 A;  5TIS O;  3VE2 A;  4C00 A;  4D64 A;  5JDP A;  2YNK A;  4JCH A;  4U9C A;  3POQ A;  4C4V B;  4PR7 A;  1Q9G A;  4Z3T A;  5G39 A;  5D5D A;  3BRY A;  2WVP A;  4AKR B;  4FZN A;  3SY9 A;  1IZN B;  3O0E A;  4FRT A;  2GE4 A;  1E54 A;  3POX A;  1MM4 A;  2FGQ X;  5E79 O;  5DL5 A;  3VY8 X;  4D65 A;  5GTH O;  1T1L A;  3JCU O;  2M06 A;  3K19 A;  4FSP A;  3VZT X;  1THQ A;  4AYE C;  3POR A;  1MPF A;  4UB8 O;  4AYM C;  4PUX A;  1T16 A;  3A2S X;  3PQU A;  4FSO A;  4GCQ A;  1IZN A;  3AA6 B;  5G3A A;  3LK2 B;  2R4O A;  5GTI O;  5B5E O;  3RBH A;  1BXW A;  1HXX A;  2O4V A;  2KZ7 B;  4AYN A;  3UU2 A;  4IL6 O;  1QJ9 A;  3DZM A;  5GV0 A;  3T0S A;  2Y0K A;  3KVD D;  2ZLD A;  3PGU A;  4K3C A;  5FVN A;  5IYU A;  4RJW A;  2J4U P;  2Y0L A;  5ADX K;  1OPF A;  2R4P A;  7PRN A;  1MM5 A;  2XE1 A;  4O3X B;  4O3Z A;  3HWB A;  2R89 A;  4LSH A;  2KC0 A;  4KRA A;  4GCP A;  2ODJ A;  2M07 A;  4AYI D;  3T24 A;  2R8A A;  2W81 C;  3PQS A;  2JMM A;  3DWN A;  3HOE A;  4GF4 A;  3UPG A;  2IWV A;  3AAA B;  1G90 A;  1HXT A;  2LFU A;  3A0H O;  4C4V A;  4AZL A;  1PRN A;  1P4T A;  4FT6 A;  4G75 A;  2KXP B;  4FZM A;  5ADX L;  4AKR A;  2X27 X;  4GHB A;  4O4X A;  4RL9 A;  2R4N A;  2PRN A;  2Y0H A;  2XMX A;  4RLB A;  5EE2 A;  3VY9 X;  5T5F A;  4E1S A;  8PRN A;  5KAI O;  2MHL A;  3FYX A;  4AUI A;  2J1N A;  2K4T A;  3EMN X;  3TZG A;  1ZHX A;  3AAE B;  2F1T A;  1ZHW A;  2F1V A;  4FZL A;  4N74 A;  1GFQ A;  3SYS A;  4D5U A;  3LK3 B;  3DWO X;  3AA6 A;  4G76 A;  2AXT O;  3LK2 A;  3T20 A;  4FOZ A;  5PRN A;  4B61 A;  4N59 A;  4FES A;  2KZ7 A;  3PGS A;  2X9K A;  5DL7 A;  2POR A;  1QJP A;  3BRZ A;  1GFP A;  3NSG A;  1GFN A;  1OSM A;  2N2M A;  3A0B O;  4O49 A;  1GFM A;  3LK3 A;  4RLC A;  4AKM A;  5B66 O;  1S5L O;  3GP6 A;  3QRC A;  3POU A;  3SZD A;  3PRN A;  2XTQ A;  3HOL A;  4LSF A;  1ZHZ A;  3WU2 O;  1HXU A;  4LSI A;  2JQY A;  1ZHY A;  4KR4 A;  2XE3 A;  3AA7 B;  1H6S 1;  3AA1 B;  2IWW A;  4PJ0 O;  3BS0 A;  4UB6 O;  2N2L A;  2R4L A;  3VZW X;  3KZI O;  3AAA A;  4KR8 A;  2R88 A;  4XNL A;  5KAF O;  4O4U A;  1PHO A;  3AA1 A;  3PF1 A;  3WI4 A;  2K0L A;  2XG6 A;  2KXP A;  3JTY A;  4GCS A;  2F1C X;  3C5O A;  5DL6 A;  3V8U A;  4FQE A;  3VZU X;  3G7G A;  2WJR A;  2YPV A;  2QTK A;  4E1T A;  3WI5 A;  1ORM A;  4C69 X;  4JFB A;  4LSE A;  2WJQ A;  3PGR A;  4O3Y A;  1BH3 A;  5DL8 A;  2ERV A;  2ZFG A;  3AAE A;  4K3B A;  1GFO A;  3HW9 A;  5G38 A;  3SY7 A;  4FUV A;  4AFK A;  1BT9 A;  5AFU K;  5H2F O;  3NJT A;  2OMF A;  1QJ8 A;  2MNH A;  3AA0 B;  3LK4 1;  6PRN A;  4FMS A;  3VE1 A;  5G26 A;  4QQ1 A;  3SYB A;  3DA4 A;  2XTR A;  1Q9F A;  4XNK A; 
#chains in the Genus database with same CATH homology
 3SZV A;  2XE5 A;  3QRA A;  4AYD C;  4N58 A;  3DA3 A;  2KDY A;  3LK4 2;  1ZHT A;  1YS5 A;  2FGR A;  4O3W A;  4F4B A;  3AA0 A;  2W80 C;  2Y2X A;  2Y7S A;  3UAQ A;  2LHF A;  4FRX A;  4BUM X;  2XE2 A;  5AFU L;  4RJX A;  3AA7 A;  3VE2 A;  4D64 A;  5JDP A;  2YNK A;  4JCH A;  4U9C A;  3POQ A;  4Z3T A;  1Q9G A;  5D5D A;  4AKR B;  4FZN A;  3SY9 A;  1IZN B;  3O0E A;  4FRT A;  2GE4 A;  1E54 A;  3POX A;  1MM4 A;  2FGQ X;  3VY8 X;  5DL5 A;  4D65 A;  2M06 A;  3K19 A;  4FSP A;  3VZT X;  1THQ A;  4AYE C;  3POR A;  1MPF A;  4AYM C;  4PUX A;  3A2S X;  3PQU A;  4FSO A;  4GCQ A;  1IZN A;  3AA6 B;  3LK2 B;  3RBH A;  1BXW A;  1HXX A;  2O4V A;  2KZ7 B;  4AYN A;  3UU2 A;  1QJ9 A;  5GV0 A;  3T0S A;  2Y0K A;  3KVD D;  2ZLD A;  5FVN A;  5IYU A;  2J4U P;  4RJW A;  2Y0L A;  5ADX K;  1OPF A;  7PRN A;  1MM5 A;  2XE1 A;  4O3X B;  4O3Z A;  3HWB A;  4LSH A;  2KC0 A;  4KRA A;  4GCP A;  2ODJ A;  2M07 A;  4AYI D;  3T24 A;  2W81 C;  3PQS A;  2JMM A;  3HOE A;  4GF4 A;  3UPG A;  3AAA B;  1G90 A;  1HXT A;  2LFU A;  4AZL A;  1PRN A;  1P4T A;  4FT6 A;  4G75 A;  2KXP B;  4FZM A;  5ADX L;  4AKR A;  2X27 X;  4GHB A;  4O4X A;  4RL9 A;  4RLB A;  2PRN A;  2Y0H A;  2XMX A;  5EE2 A;  3VY9 X;  5T5F A;  4E1S A;  8PRN A;  2MHL A;  3FYX A;  4AUI A;  2J1N A;  2K4T A;  3EMN X;  3TZG A;  1ZHX A;  3AAE B;  2F1T A;  1ZHW A;  2F1V A;  4FZL A;  1GFQ A;  3SYS A;  4D5U A;  3LK3 B;  3AA6 A;  4G76 A;  3LK2 A;  3T20 A;  4FOZ A;  5PRN A;  4B61 A;  4N59 A;  4FES A;  2KZ7 A;  5DL7 A;  2POR A;  1QJP A;  1GFP A;  3NSG A;  1GFN A;  1OSM A;  2N2M A;  4O49 A;  4RLC A;  1GFM A;  3LK3 A;  1Q9F A;  4AKM A;  3GP6 A;  3QRC A;  3POU A;  3SZD A;  3PRN A;  2XTQ A;  3HOL A;  4LSF A;  1ZHZ A;  1HXU A;  4LSI A;  1ZHY A;  4KR4 A;  2XE3 A;  3AA7 B;  1H6S 1;  3AA1 B;  3VZW X;  2N2L A;  3AAA A;  4KR8 A;  4XNL A;  4O4U A;  1PHO A;  3AA1 A;  3WI4 A;  2K0L A;  3JTY A;  2KXP A;  5DL6 A;  4GCS A;  3C5O A;  3VZU X;  3V8U A;  3G7G A;  2YPV A;  2QTK A;  4E1T A;  3WI5 A;  1ORM A;  4C69 X;  4JFB A;  4LSE A;  4O3Y A;  1BH3 A;  5DL8 A;  2ERV A;  2ZFG A;  3AAE A;  3SY7 A;  1GFO A;  3HW9 A;  5AFU K;  4FUV A;  4AFK A;  1BT9 A;  2OMF A;  1QJ8 A;  2MNH A;  3AA0 B;  3LK4 1;  6PRN A;  4FMS A;  3VE1 A;  5G26 A;  4QQ1 A;  3SYB A;  3DA4 A;  2XTR A;  2XG6 A;  4XNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...