4D6EA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (x01 mutant)
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
586
structure length
578
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYYTSAHWLSTSWIDKMYQKYPNLHGIFSTESYWIWANDIENKAADYLKVSAKNGGYFIWAEQNVGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 219
structure length 578
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6eA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6eA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6eA02
4WLCA 3GXFA 3N13A 4UQ9A 1K9DA 3PBGA 2OSWA 3WH6A 4Z2GA 3NSNA 3WQ5A 4J3TA 3WUBA 2WKLA 4AZCA 5AYIA 1HMUA 2X03A 1R86A 5LYRA 5JBDA 3VDBA 3W82A 3K8LA 4TX6A 4D6IA 5D9PA 1DWAM 4B3KA 2E4TA 3MANA 2CBUA 3WQ4A 3RJXA 1JFHA 3AFBA 3EDEA 1VF8A 2Q1FA 2QV4A 3AZSA 4FLSA 4W8BA 4OBSA 4W87A 3LPOA 1EIBA 1X1NA 1HJSA 4HA3A 4LXFA 5IDIA 4HU0A 4C7FA 3WUEA 2XVLA 3VD9A 1GOMA 1C91A 4ACZB 4LX4A 1UYQA 3T09A 2XGBA 4M8UA 4ZENA 1OJNA 3QOKA 5GNYA 3VGFA 5BXTA 1PAMA 4JCMA 1XRVA 3A4WA 2VMFA 5JBEA 4LGXA 5A8PA 2E24A 4MNLA 3W37A 3WIJA 4LYRA 1E4MM 1HT6A 2WMIB 3VIOA 1UR4A 3WH8A 3FW6A 3NUKA 2EPKX 3MUAA 4TVDA 4J28A 1JZ6A 1MFUA 3UEQA 4UTFA 3A3HA 3THDA 2WCSA 2OLHA 4JFUA 4D6JA 2W67A 1MW3A 2YJQA 3BLKA 1E43A 3VMPA 4CN1A 2W66A 5I6SA 1ITCA 2PF0A 3G6MA 1MW0A 4ZEPA 3WELA 1NOUA 3W81A 3BCDA 2BRPA 1W3JA 1AQMA 2XUCA 4CD7A 4QAWA 1B9ZA 1CGVA 5D8ZA 1UKOA 3VX0A 3DHUA 3N15A 4WJXA 4F8XA 3GM8A 1BGGA 1ISXA 2DH3A 2J79A 4D71A 2J7CA 4NF7A 2YA0A 1CPUA 2E3ZA 2J8FA 2V38A 2XHYA 1CDGA 3AHZA 5D9OA 1DWHM 5C8BB 3NSXA 1UKSA 2WZEA 4QCFA 2ZICA 1LQ0A 3AHXA 1W9DM 1NWTA 4HZ6A 3OA5A 1JYWA 1J18A 8A3HA 1R8LA 3AMKA 3KL5A 2WNWA 6CGTA 4Z2JA 3WH9A 4JZ5A 1V3LA 3PZ9A 2X8RA 1TVNA 4DUVA 3CMGA 3WFLA 1AQ0A 1HJVA 1HVXA 4PYSA 5I77A 4XV0A 1C92A 2XWEA 3L4TA 1JYVA 1V3MA 2E8ZA 4W88A 1UG6A 2WSPA 4YHEA 3SUSA 1NQ6A 1TA3B 1H41A 1HKKA 1RP9A 4ZXOA 3QOMA 1W9XA 1SR0A 2XFYA 5IHSA 3POCA 4FMVA 3RILA 4RE2A 1JZ5A 1FP8A 1HN0A 2CETA 1EQCA 1W3YA 3GBDA 1BGAA 2GK1A 4MDPA 2CXGA 3O9NA 4M29A 4AD3A 3MV01 1VBRA 4AW7A 4GQQA 4M81A 3VO0A 2WMGA 1JF5A 1E6NA 1FHDA 4AZGA 2WMFA 4CU7A 2W92A 3NDZA 3W28A 3W26A 1FHLA 2CKSA 4UCFA 3WH7A 4HTYA 3T08A 4CCCA 2IXUA 3I3BA 4AZ6A 2FHBA 5HOSA 2J7EA 1C90A 5A95A 4CD5A 5A6MA 4W8AA 2GUYA 1TMQA 2DT2A 2XGIA 3PZVA 4Z2IA 4AMCA 4J27A 4CD6A 1B3WA 3AI0A 1TFVA 4P8UA 1XC6A 2UY5A 3L2LA 1OD8A 4AIOA 2CBIA 3SUWA 3ARVA 5ABFB 1CGYA 2EXOA 2BFGA 3DC0A 4TXEA 2YOCA 4EE9A 3GH5A 1CGWA 2E40A 3J7HA 4EAMA 4N0RA 2WVVA 3VIPA 3F5LA 4TX8A 2VURA 4KRTA 3FHQA 3BAXA 3TTYA 1WDRA 3VVGA 1LOHA 5HBFA 3OLIA 2VCBA 4AEFA 4HMDA 4A3HA 3IAQA 1GQKA 1ZBWA 1QHOA 1CENA 2J74A 4WKFA 2D20A 2E9BA 1WE5A 3B8SA 5CGMA 4UQAA 3K8KA 3ZSTA 1EA9C 1JXKA 4GKLA 4UNIA 2ZUNA 5I3DA 1J0MA 1RW9A 2A3HA 3RCNA 3WY1A 1CEOA 1YHTA 2J8GA 1BPLB 3BLPX 6A3HA 1JD9A 3TP4A 1CB8A 2PWFA 2VI0A 2AAAA 2XSAA 1TUXA 2A3BA 2ZUUA 1F1SA 1EDQA 4ZFMA 4DM2A 2WDAA 1HN1A 2XVNA 1E4IA 3U7VA 1M01A 4W89A 2DPEA 2XVKA 1GOQA 3VIIA 2VT0A 4DWSC 1W32A 3W0KA 4PMYA 2CYGA 1H0GA 3FN9A 2YDQA 2X05A 3AROA 3K46A 5A6KA 3KL0A 1QNOA 5A8OA 3WD4A 3OG2A 3WNOA 1WPCA 1B0IA 2RGLA 3VNYA 3VIJA 4MB5A 3GH7A 1VFMA 1V6YA 1FH8A 4PMZA 4L4PA 3U57A 1B3YA 3SURA 4CVUA 1HJQA 3WF1A 1VFFA 1CGXA 3WDQA 2YLLA 2E8YA 1E6XM 2C7FA 3MSGA 1BYDA 3L4XA 3NDYA 3N11A 3KL3A 5CZKA 1QNQA 3SCQA 3ZMRA 2J7GA 5AY7A 1AMYA 2V3EA 2WMKA 2PB1A 2ZUWA 1CGUA 5IFPA 1X1JA 2Q8XA 2CITA 4HPHA 4H8UA 1WB0A 1HF6A 3U7BA 4W7VA 3EBVA 2EPLX 1NARA 4DUWA 3OLGA 3WDRA 3A4XA 3BXWA 3GNOA 3KZSA 3UR8A 2FHCA 2VX6A 1JNDA 1HM2A 2VX7A 3BAIA 3BMVA 4MAZA 1V0LA 5ECUA 5BXSA 2O92A 4C7GA 2A3EA 1CNVA 1XGZA 4KRUA 4ZE5A 3RJYA 2CHNA 4V28A 3CZJA 5TD4A 2FHFA 3WD1A 2NW0A 2D2OA 1IV8A 1HNYA 2VO5A 1DHKA 4B9YA 1RWGA 1CXHA 3N12A 1LL4A 2WHKA 1JDAA 2F8QA 4TOQA 1Q6DA 1LWHA 1O7AA 1ESWA 5JBFA 3GZAA 4GQRA 1HP4A 2VZTA 3KWXA 3E1F1 7A3HA 4M24A 1G9HA 2VVNA 4H7VA 1XHGA 2JALA 4R5EA 5A1AA 5E6ZA 2XSBA 4LQ1A 4JAWA 5KEZA 3TOPA 1G1YA 1GORA 2WYSA 4UQDA 4ATDA 2DSZA 2ZX9A 3O2LA 2WPGA 2EEXA 4D6EA 1LG1A 4P7OA 1TVPA 2Y8VA 1TR1A 3W6MA 2PWHA 3CUGA 1UWUA 3SUVA 4QP0A 5CQ1A 1UR2A 1PIFA 5LA0A 1E72M 1GQJA 4MB1A 1PEZA 3W27A 4JFVA 4JFWA 3CO4A 1G01A 2BXYA 3EDKA 4GI8A 2X09A 3VIMA 1BTCA 3VIFA 1J11A 1V08A 1W2PA 2BVTA 1GQLA 3WSUA 1OGBA 3K4DA 4XZBA 2BRWA 5FL1A 3AJ7A 3LPPA 1Y7VA 4S3KA 2JEQA 4XUYA 2UWFA 4BF7A 4GZIA 3WL1A 1UD8A 4PMRA 2WK2A 1JGIA 3WNNA 4AIUA 3GH4A 1B31A 3IJ8A 3D3AA 2XIIA 3OIHA 3WF3A 1KBKA 3VIHA 4KMQA 4GO9A 3SUUA 4Y7EA 3SCNA 1HM3A 2WMHA 1V6UA 3VDCA 3AMDA 2YDSA 1M04A 4V27A 1E5NA 4ZE4A 3VDHA 1KWGA 3TA9A 4UOZA 1UKPA 1I1WA 2D23A 2VOTA 4AZHA 1TZ7A 1UQYA 4U2ZA 1V6VA 3THCA 1UOKA 1GOWA 3FNDA 3PZUA 4HPGA 5EB8A 4PCTA 2A3AA 1HVQA 5E09A 3CTTA 3QHOA 3L4VA 1FFQA 2QMKA 2ZUTA 1W9UA 4OBRA 3DYPA 1CXKA 1OJPA 3ZT6A 3VD4A 2J7HA 3F4VA 4IUGA 1UHVA 2VNCA 5A6JA 1V6WA 4MJ2A 4JL1A 2ZX7A 2BY3A 5FKYA 3W24A 3M7SA 3O6AA 1UZ1A 3L2MA 3CPUA 4FF5A 2XPKA 1BG4A 2ESCA 4IPNB 2WMJA 1P6WA 4H04A 3N04A 3QHMA 2IUZA 4XX6A 1CLVA 4QFUA 1M7XA 3ZR6A 1QVBA 1QI5A 2Y8KA 3WQWA 4HOXA 3PTKA 2AOSA 5DFAA 1UD4A 2BXZA 5I79A 1V03A 1VEMA 5CPQA 1ZU8A 3SCOA 1BYAA 4HOZA 4L4OA 1OIFA 5M3WA 2GDUA 1JZ7A 3D5HA 3NIYA 1UKTA 3WEOA 4K68A 1K9TA 3CHFA 4UOJA 3N9KA 2W91A 2E22A 2EPOA 1GVIA 1LG2A 3BAYA 2Y4SA 1GW1A 5EBAA 3GDBA 3GYCA 3CMJA 4OOUA 1KR0A 1E3XA 4XB3A 3M07A 3UG5A 5A6LA 1UD5A 3BAWA 1VAHA 2A3CA 3SIMA 4W7UA 1X1IA 1DWJM 2YA1A 1CGTA 3WUFA 1E5JA 1MVYA 4UZUA 5D9MA 1WZAA 1GNXA 1C8QA 2XG9A 3OZPA 1J0NA 1V02A 2JE8A 2WVTA 3SCPA 1ZJAA 3M46A 2GVYA 1OGGA 1E1FA 1ODZA 1UD3A 1CZ1A 3UETA 2ZX8A 2J25A 1V0MA 1OJMA 4S3JA 5A2CA 4D72A 1LL6A 5F7UA 4JKLA 1XCXA 3CUHA 4YPJA 3A47A 2ZIDA 4QLKA 3AYSA 4TVUA 2VZUA 1JI1A 1UZ4A 2YL6A 1FP9A 3CZEA 2CHOA 1ISYA 1E15A 3AOFA 4BA0A 2VVSA 4MADA 3VX1A 1JZ8A 4J3XA 4X0VA 2FH6A 5EFFA 4AC1X 1J0JA 1RH9A 3N18A 5EFDA 1DP0A 2J78A 4W7WA 4AD2A 3ARPA 1BFNA 1J10A 4BS0A 3BMWA 2D0HA 1KFWA 4PMDA 1CXFA 2NT1A 4U3CA 5FIPA 1ZBKA 2GSJA 4PTVA 2VQTA 1UR8A 4D6DA 3CHEA 4M56A 3UG4A 4PEEA 4GINA 2VRQA 4YN5A 1JZ3A 1OM0A 2CNCA 1E4LA 1JZ2A 1J0ZA 4PMQA 1GOOA 2EBNA 4Q22A 3WDHA 2D22A 2YL9A 2WLZA 3VGDA 1E4NA 4CCEA 3AS1A 1V6XA 3IJ7A 2DSUA 1H11A 1KXTA 2WZHA 5A94A 1C3FA 1GOKA 1CIUA 4NRRA 4PMNA 1UKQA 3AMCA 2G3JA 2CBJA 1Q6CA 3L4WA 4UZSA 1LXKA 3A4AA 2G4FA 3T0BA 4WIWA 1QNRA 3NSMA 1N7NA 3ZO9A 2QF8A 2D3LA 2O9RA 2FGZA 1EO5A 2J7DA 4RE3A 1DTUA 2DIJA 1E0WA 1E73M 4PMUA 5I23A 4ACZA 3MV11 1UUQA 4UOQA 4W93A 3LMYA 3CZGA 2F2HA 4XZWA 1SMDA 2ZXDA 3CH9A 2W62A 1U30A 5A69A 4AD0A 5E6YA 1QBBA 1TCMA 3ALGA 5HNNA 2GFTA 3PTMA 5DO8A 4WKAA 1E6ZA 4Z2KA 1OT2A 4TTGA 2WMIA 3OLEA 2GDVA 3OGRA 1VEPA 4UFLA 5JIPA 1ECEA 4F66A 3BAKA 5E70A 1J12A 4R27A 5IXEA 4GZEA 2X2YA 3WNPA 4OZOA 4CN4A 1A47A 5HPOA 2VQUA 5A8NA 3F5JA 1WZKA 1ODUA 2O9OA 3APGA 1AQHA 5A6SA 2GJPA 1GOIA 5M5DA 1JFXA 4F9DA 4UQBA 1G5AA 3ARXA 4U2YA 3RDKA 1N82A 1GJUA 1HIZA 1KXQA 1CWYA 4JL2A 3VD5A 2ZXAA 2BNJA 1RWFA 2WZIA 1PZ2A 1OSEA 3RM4A 3WKZA 3SCRA 1W1PA 4HOWA 1CLXA 2EO7A 4CD8A 3EDJA 3T2OA 3LPGA 2WVSA 3MUZ1 1BYCA 1X1HA 1WDQA 4PBGA 4IISA 2YLAA 1J0HA 1QI3A 2QMJA 1GUVA 3T0DA 4A3YA 1HL9A 4F9JA 2PBGA 2IXVA 1UH4A 1MW1A 5I2UA 4LYPA 1OWQA 2QPSA 1CYGA 4MJ4A 3K1DA 1W9PA 3BSHA 2YBUA 4OJYA 1HXJA 3VGBA 1WZLA 1MQQA 5M03A 1XD1A 4J7RA 1QNPA 3AS0A 1FH9A 4U5KA 1PPIA 1TA3A 5D9NA 1BLIA 1JI2A 4OKDA 3ARYA 4BZYA 1DWFM 2J77A 5DT7A 5BXRA 2DSWA 1V3IA 1UR0A 2G41A 1XH0A 3HU7A 1FA2A 5FL0A 2PI6A 1ZB5A 1IZKA 1V3HA 3ARRA 1ZBVA 3W6LA 2GJXB 1PIGA 3LPFA 8CGTA 1V3JA 5CLWA 5LA1A 1N7PA 1X6NA 2DT1A 2WC3A 4BQ4A 2Y24A 1SMAA 1WKYA 1JDCA 1OD0A 2WHJA 3ZJ7A 1EXPA 1ISZA 3GNRA 3WFZA 4D6HA 4PTMA 3CIVA 4W84A 2E0PA 1W3LA 4H8VA 1H3GA 1EGZA 1QOXA 1W9VA 2V5DA 4F79A 2ZOXA 4UQEA 3A6OA 3VGHA 1CTNA 3AIWA 1C7SA 1E0XA 2D0FA 2VZVA 2CIPA 3EYPA 4AISA 1I75A 1SYTA 1CXEA 2XTKA 3RPMA 1ZS2A 1RD6A 2G3MA 3PN8A 5ABFA 4E8DA 5C71A 1UQZA 2WC7A 2DIEA 3BGAA 2V3FA 2XVPA 3IANA 1VFUA 4DUXA 1C7TA 4H41A 1E6QM 3SCUA 4ML4A 2FDMA 3OZOA 4RE4A 5BROA 2BY1A 2XFFA 3QHNA 3WNLA 1OGSA 3OGSA 3VKKA 1OIMA 1WCGA 4J3VA 2XVGA 3VU2A 2O9PA 1UWIA 3QGVA 3G6LA 1QHZA 3WMCA 2WWCA 4DWSB 3GXDA 1H0IA 4A4AA 1JAEA 3AIEA 2VL4A 1QBAA 4B16A 4JIEA 1WP6A 1EHAA 4MTVA 1US3A 1PZ3A 3SEPA 4P7QA 1UWRA 2CKRA 3WQ8A 1JD7A 1M03A 3ZT7A 3OGVA 1B3ZA 1BAGA 1B1YA 4PSPA 1DEDA 1H5VA 2CBVA 5E9AA 4W85A 4TVCA 3EMZA 3RMEA 4OIFA 4J3UA 1J0YA 1N7QA 3UG3A 1UR9A 1UWTA 4W86A 1BVNP 1Q4NX 1W3HA 1K6AA 3AIVA 3ARZA 1E0VA 5BCAA 2BVDA 1NWSA 1CXIA 2WLYA 1ITXA 1KR1A 1ISVA 2BHZA 2VTFA 3WF2A 3SCSA 3ZIZA 4BQ2A 3RM8A 2XM1A 4AZCB 3POHA 4JKKA 3PZNA 3VD7A 4AZIA 1RPKA 5ABHA 1C93A 3WUGA 2PWGA 3BCFA 2YBTA 1JG9A 3TTSA 2ZXBA 1HX0A 4PSRA 3I3EA 2CESA 1G94A 3MUY1 1XYZA 1US2A 2YKKA 1JXJA 1M53A 1IT0A 2WBGA 3FAWA 3N17A 3ZJKA 3CZKA 5I24A 1HP5A 1QW9A 3NJ3A 3B9DA 5EMYA 4WK9A 5LA2A 2CERA 2ZUSA 4FK9A 3AMLA 1E6PA 4AXNA 1KCLA 3CUIA 1UR1A 2VJXA 3L4UA 3ARWA 1JYNA 3BC9A 3HJEA 4Q7NA 2UY3A 4KGLA 3BSGA 3QR3A 5HPCA 3KEHA 1UWQA 1XYFA 1E40A 1E55A 2WAGA 1E71M 3VGGA 3CZLA 4UFJA 5CLTA 3AHTA 2YDRA 3U5UA 1MXGA 3CUFA 1UA3A 2W4XA 2D1ZA 2WM0A 3EDDA 5A2BA 3WL0A 3EMQA 1PX4A 2CEQA 1N7OA 3K4AA 1B3XA 2F61A 2MANA 3NCOA 2CCRA 2J7FA 3ARUA 4PMXA 3T2QA 4Z2LA 1L0PA 1VRXA 3BAJA 5GQBA 2XJ7A 2ZE0A 2Y2WA 1XSKA 1F4AA 4UFKA 2HVMA 3UR7A 4D1IA 3AIRA 5D4YA 3ZM8A 2ZXQA 1GONA 1VIWA 2OWWA 3W53A 2W5FA 1MXDA 5CG0A 2BY0A 4ATWA 7TAAA 3WBAA 4AZBA 1X6LA 4KWUA 2G3NA 2XYLA 5D8WA 2WBKA 1H49A 1DWGM 3AXIA 4OUEA 3WD0A 4RL3A 1WDPA 3PZTA 4U5IA 1R7AA 3MKKA 3ZR5A 5AC4A 1LLOA 2VRJA 4B9ZA 1W9BM 3WENA 2WW5A 3VPLA 4JHZA 1GHSA 1XSIA 5DF0A 4CGTA 3JUGA 1DWIM 1G0CA 2Z1SA 4HU8A 1J0IA 3MO4A 1QNSA 5IFTA 1KB3A 5BRQA 4GXPA 1RP8A 1MFVA 1ZJBA 1WDSA 4BQ3A 1WAWA 1KQYA 1SFSA 2D3NA 1MW2A 2GK1B 4KGJA 1V3KA 5GPRA 1JNEA 5JUVA 2NT0A 1F4HA 2YA2A 4M82A 2BRVX 2WVUA 2VZSA 1NOWA 1QI0A 2WKGA 1A3HA 1W1YA 3W38A 2J4GA 2X0HA 4NSBA 3AZRA 2D0GA 1EGUA 1NM9A 1U33A 3VTRA 1EQPA 2UY2A 3GNPA 3FAXA 1BYBA 1OB0A 1E3ZA 2WANA 3SCTA 3CHCA 2AMGA 2WB5A 2C0HA 5BWFA 2WCAA 1E6SM 2J62A 4MDOA 1CBGA 2FGLA 3UERA 4AY1A 2OYLA 3VM5A 4GO8A 4LYQA 4W8LA 3VD3A 2WVVB 3MUIA 1VB9A 3PTQA 2WWDA 2PC8A 2Y5EA 1E56A 1J01A 4AEEA 3WQVA 2W63A 4HZ8A 5BRPA 5A8QA 1H1NA 1W91A 1CECA 1FFRA 4PRWA 3AHVA 3GBEA 3F5KA 1HKIA 1KCKA 5A6BD 2X0YA 2BHYA 2DT3A 4W5UA 4BQ5A 1FOBA 5CPTA 1NP2A 5I5RA 5A2AA 1B2YA 5FOOA 5KZ6A 3DHPA 4FLQA 5A6BA 5A6AA 4M80A 5M17A 1MQRA 2DH2A 3WD2A 3VNZA 1B90A 4FLRA 4TUFA 4DM1A 3B9AA 3CBWA 2V5CA 4CU8A 2J47A 5ABEA 2XFRA 4CU6A 1FH7A 1CXLA 1VJSA 2JIWA 1LWJA 4PN2A 2PWEA 1R85A 4X9YA 9CGTA 3L4ZA 3DECA 4CD4A 3II1A 2ZUMA 1XSJA 2BHUA 2YL8A 1WNOA 1HL8A 1B30A 4UFHA 1RWHA 1W1VA 2VUYA 2BVYA 3WBEA 4V2XA 1KXVA 4EANA 5A8MA 1I8QA 5CSUA 1EOKA 2FH8A 1GCYA 2EJ1A 3K8MA 5E0FA 3VGEA 4GPNA 4MB3A 1JYXA 4U31A 3T0AA 1BVZA 4CCDA 2ZWZA 1QHPA 1KGUA 2WSKA 1TG7A 2YIHA 5BYWA 1ISWA 1JAKA 4D1JA 1J0KA 4JHOA 2W61A 4AZ7A 1BSIA 3W25A 3ECQA 3N1AA 3OB8A 3ALFA 1NP0A 3AICA 3IJ9A 3MS8A 5ABGA 3PZGA 1UH3A 2DGAA 4FLOA 3AXXA 2CPUA 2G8ZA 2XIBA 5GNXA 1KWKA 1S46A 2PWDA 3WDPP 1NOFA 3PZIA 4J3WA 1B3VA 4MPKA 3VM7A 4EK7A 4D6FA 3S6TA 2VX5A 3AIQA 3S2CA 1QI2A 1Z32X 5FD0A 4HMCA 3FXYA 1GHRA 1V0NA 2D24A 1WO2A 1XCWA 2VRKA 3AS2A 4ZXLA 4P7NA 4AYSA 3RM9A 3AHYA 3ZQ9A 1VFOA 4URIA 3WEZA 4J3SA 3EDFA 4P7RA 4HP5A 1C8XA 3VIGA 4NRSA 1GPFA 2V3DA 1KBBA 4PUDA 3UESA 3ZSSA 4WSJA 1IZJA 5AC5A 4QCEA 4YHGA 2V3GA 3AQUA 4HA4A 4JKMA 4PMOA 3AIUA 1BF2A 3B9EA 2QHAA 4OOZA 4CKQA 2VCCA 1MWOA 3WQ6A 3L4YA 1E9LA 2C8NA 3GTNA 3IAPA 3DYMA 1GJWA 3TTOA 4EKJA 2ZUVA 3CLWA 3VIKA 1HJUA 4AWEA 4GI6A 6TAAA 3PZQA 1LL7A 4AD1A 1C82A 3MMWA 3SCWA 2QPUA 1D3CA 4PUEA 1BQCA 4QLJA 3WMSA 2DT0A 2J7BA 3VOCA 1ZL1A 1JZ4A 7CGTA 4B15A 3AISA 5DEZA 1OT1A 2JF7A 4JFTA 2VZOA 5I0DA 4C7DA 3WDIA 3TONA 1EO7A 1NH6A 1GQIA 4MNMA 2WHLA 5JIWA 2Z1KA 4UR9A 3KE0A 4H2CA 1XV8A 3EMCA 2OSXA 1QPKA 2VR5A 1MQPA 4WF7A 2WC4A 2GJRA 4M1RA 1NWUA 1R7OA 3WEMA 4MAVA 2EQDA 4GIAA 4H8HA 3SCVA 1PJ9A 1W2VA 3M6DA 2J75A 1OJOA 1O6IA 1Q6FA 1OCQA 1EH9A 4UFMA 1J9YA 1N7RA 3WN6A 3WF0A 3NYDA 2BV9A 1V0KA 2BS9A 1JF6A 4JFSA 3VMOA 2VCAA 1QW8A 1H09A 4UQCA 3WF4A 3ZJ6A 2ZX5A 1OBAA 1LF1A 3MU7A 5CPSA 1PBGA 1V02E 2YL5A 1KXHA 3MMUA 1QI4A 2XWDA 2JIEA 2VC9A 4BCEA 4HMEA 1H2JA 1EOMA 4UFIA 4D6GA 2DQXA 4QLLA 3AYRA 1F9GA 1HJXA 1NWRA 1UD2A 4IM4A 5DT5A 1D7FA 3VILA 3OLDA 2QLYA 3FY1A 3UCQA 2NSXA 2G3IA 1KGWA 4P8XA 3VDAA 2ZX6A 3IK2A 3AXHA 2JF6A 1HMWA 1D2KA 2WCOA 2JEPA 1KQZA 2DEPA 1ZBCA 3AIBA 1BG9A 1JDDA 3ZJ8A 3VUPA 3GXIA 4JCLA 4CVWA 4TTUA 4MB4A 4WKHA 3WDJA 1E1EA 2OYKA 1LXMA 1C8YA 2GJXA 4HA1A 3HN3A 4IPLA 1YQ2A 2X1IA 3WH5A 4CUCA 4Z2HA 3TTQA 3ARSA 5BXPA 1EDTA 5DMYA 2ZWYA 4QDMA 1GVYA 1H4PA 3W4RA 3CGTA 2O9TA 4P8VA 1LJYA 5HXMA 4E8CA 3OBAA 1W3KA 1VBUA 3PHAA 2XM2A 3CHDA 3VINA 4ATLA 4AZ5A 1PX3A 4CN6A 1L8NA 5HDRA 1UWSA 3MSDA 1E70M 4WSKA 1E6RA 2VX4A 4P7LA 2DSKA 4NZCA 5FCZA 2HISA 1AVAA 1UD6A 1VEOA 3I3DA 4W5ZA 4P8WA 4HZ7A 4AD4A 1W1TA 2DSVA 5A3HA 3U5YA 4D6CA 4PTXA 3AZTA 2EPMX 3FHAA 4N42A 4E2OA 3RO8A 1TE1A 2E9MA 1VENA 4MNKA 2BY2A 1KGXA 1JIBA 3CUJA 1EDGA 1R87A 1EHNA 1HJWA 1OINA 3WD3A 2OYMA 4GZJA 4MNJA 2OSYA 3PZOA 4LPCA 3ZT5A 4GI9A 5CGTA 3DYOA 4AIEA 1HKMA 1XH1A 3SUTA 3VMNA 4DWSD 3CZ8A 2VR4A 1Q6EA 4ACYA 1PX8A 5I78A 2UY4A 3T2PA 3ZOAA 3WMBA 2WXDM 2DDXA 5CSYA 1XD0A 1RWCA 4DWSA 2WCGA 4PCSA 4KH2A 1K9FA 3AMGA 3W29A 1Q6GA 2OWXA 2EPNA 1BHGA 5C70A 1K9EA 3AS3A 2B31A 1VJZA 1WZMA 5CJ5A 4X0NA 2TAAA 5AYBA 3WNKA 4PTWA 1UH2A 3WNMA 1GZJA 1MYRA 2WHMA 4NI3A 2OWCA 3BH4A 3GXMA 4E4PA 1JL8A 3RIKA 2JFEX 4U33A 1I1XA 4AD5A 2RGMA 5IHRA 5GNZA 1U2YA 3HMCA 1XH2A 5E0CA 3PZMA 4PMVA 2E9LA 5CXPA 3ARTA 3MMDA 1UA7A 1RWAA 1HKJA 2PBOA 3ARQA 4U3AA 4B3LA
chains in the Genus database with same CATH superfamily
4UQ9A 3S5YA 4LW7A 1K9DA 2BOFX 1XIHA 3SSZA 1PYMA 3RCMA 3WUBA 1PKYA 1AZ2A 5KZMA 5LYRA 1NY1A 4XO6A 1TPFA 4D6IA 2VFIA 5D9PA 3UWZA 3UW6A 4RK8A 1P48A 4XK2A 3DFPA 3RJXA 4GYKA 4TR9A 1LBMA 1JFHA 3AFBA 1DKWA 1SQ7A 3EDEA 2Q1FA 1REQA 2ADAA 3AZSA 4DJFC 2DIKA 4FLSA 4O0QA 4W8BA 5HMDA 1O0SA 4L9XA 2YXOA 3SIZA 3TSMA 4IIHA 3NO1A 4LXFA 5DLCA 3NQBA 1W6TA 1GOMA 1F3TA 2GGIA 4ACZB 1UYQA 4Q8TA 3C56A 3QOKA 5GNYA 2VMFA 2GGEA 2PFHA 5A8GA 2KZHA 4YWSA 3EX2A 4MNLA 1W5OA 3NEVA 1LLWA 2I1OA 3RAOA 3WIJA 4S3CA 5HAOA 3UU0A 3DFQA 3STPA 2ISFA 3VIOA 2HK1A 5JQ9A 5CBBA 2CLIA 3ABOA 1YMYA 3NUKA 3G1FA 1UP3A 4ZQCA 3IRSA 1JZ6A 4Y9OA 2REQA 3UEQA 1P4CA 3NXFA 3THDA 1GK8A 2OLHA 4JFUA 3D6NA 4D6JA 1NAL1 4GNVA 2DVTA 4CQDA 5PTDA 2WNZA 1YTKA 4DELA 4MF4A 4QSFA 1WXZA 1ITCA 3EKGA 8XIAA 3U2ZA 2R1PA 3V1HA 5FJTA 3W81A 3BCDA 1G4PA 1AQMA 1GEHA 4QAWA 4DLMA 1VR6A 3BICA 4F8XA 4C1NB 3GDLA 4D71A 2QVNA 2J7CA 1CPUA 2ZVRA 3QC3A 2E3ZA 2J8FA 3V0SA 1DWHM 3NQAA 4IG2B 1S5TA 4QCFA 1JPKA 3N2CA 1FWWA 1NWTA 4DXVA 1JYWA 1J18A 8A3HA 2WNWA 3HBLA 5ENLA 3WH9A 4C6OA 1V3LA 3H7UA 1KBIA 5H8PA 3F4WA 1OCBA 4PYSA 4YCPA 5I77A 4HPXA 4XV0A 1AMKA 2QUVA 4C6FA 3K2GA 1V3MA 3T4WA 1UG6A 4YHEA 3MDUA 4QNEA 3SUSA 1HKKA 3SN0A 1RP9A 4ZXOA 1TB3A 4QE1A 1EF2A 3TW7A 1ME8A 3POCA 3RILA 2BTMA 1U5VA 2A7PA 1HN0A 2GK1A 1GWJA 3P61A 2BVWA 2AGKA 4M29A 1X7FA 3A3XA 3MV01 1FBAA 4AW7A 4RE0A 4HGXA 4GFIA 1OK6A 2HQAA 4RNIA 1JF5A 1HZYA 1ECQA 2QCFA 3AXMA 5ECVA 4JTAA 4FNRA 4HTYA 4QG8A 3YPIA 3T08A 1XDJA 4I9MA 4AZ6A 4DRSA 1PKNA 4O8AA 4RNJA 4JDBA 1WUEA 7REQB 4QJ5B 1O5RA 4W8AA 2GUYA 3OP2A 2XGIA 4KWOA 2VELA 4P8UA 1XC6A 2DW7A 3L2LA 4PC8A 4AIOA 3IIPA 3ARVA 3G22A 3RNDA 5ABFB 2EXOA 4PB3A 3DC0A 2HPIA 4N9DA 1OC7A 4OU1A 1CX9A 1A5KC 1CGWA 4N0RA 1PTDA 3F5LA 2JQXA 2J6VA 1OEPA 5LNWA 4L64A 1TKKA 1ZJHA 3FSUA 5AFDA 3QF0A 4A3HA 1ZBWA 4AWSA 2J74A 5KTLA 2PDNA 3UJFA 2E9BA 2NSOA 1WV2A 4FNSA 2VGIA 3ZSTA 1JXKA 2A1YA 3W1XA 3NPVA 5I3DA 3V16A 2Z4GA 3NG3A 1CEOA 4D8ZA 1BPLB 4NAEB 3TQKA 2ZDRA 3MJMA 1CB8A 3GIQA 1XGEA 4GJ1A 4NZ3A 2PWFA 2AAAA 1T40A 1A3XA 4GUHA 3U48A 3S1VA 3FJ4A 3M0ZA 3W71A 3B4UA 3VZZA 1ZGDA 4DM2A 3U7VA 4G6CA 3PUEA 3UJ2A 2XVKA 3C2VA 3PG9A 5L9FA 2VT0A 3KX6A 1WXYA 3R11A 2CYGA 4ADSA 5AYXA 3FN9A 1P0DA 2X05A 3TX9A 3WD4A 3RYSA 3P0WA 3PY2A 3NR0A 4A8LA 3GH7A 4UR8A 5CZJA 3IWPA 2C3ZA 3G8RA 4PMZA 4B5VA 5C55A 1HJQA 4UIOA 1IXNA 4C6QA 4RDYA 3WDQA 2C7FA 2WV8A 5FEXA 1BYDA 4RPQA 1S5VA 3BZJA 4IMEA 3N11A 1YNYA 5CZKA 1H7OA 4TV6A 1DTNA 3LXCA 1AMYA 3TMQA 1R38A 7ODCA 2WMKA 1V7AA 5IFPA 1ZPTA 1RA5A 1M68A 4HPHA 3EOUA 4FOKA 3EWUA 4JTGA 3QSRA 3OLGA 4LS1A 4U10A 1RK5A 3WDRA 3A4XA 2V8ZA 5AHNA 1LRTA 3ORWA 3UR8A 3UFYA 2FHCA 2VX6A 2BZNA 2VX7A 1EP1A 4GZ7A 2R14A 3LCIA 3BMVA 3FEQA 4YYCA 1MUMA 1VQTA 1H7XA 2V5KA 2A3EA 1CNVA 3HG2A 3MCOA 4QBXA 1A0CA 4Q8WA 1EX5A 4S2BA 1O94A 5BW6A 4DZ5A 1DHKA 4IIEA 2PU0A 4IGNA 4G8TA 3N12A 1XBVA 1LWHA 3W23A 4H7CA 4RLIA 4G7EA 1HP4A 2VZTA 3FKKA 4B2DA 1G9HA 3S1WA 3UZJA 5E6ZA 1OFBA 4DB7A 4QITA 3W7KA 5KEZA 1XLDA 1P0BA 3O2LA 1KTBA 4QE4A 2EEXA 3QLLA 3W6MA 3SM0A 3CUGA 1UWUA 3SUVA 4KETA 2PU1A 5AHIA 4WY0B 5LA0A 3LA4A 3SI9A 4MFEA 4JFVA 1Z48A 2B0MA 3EDKA 4GI8A 3VIMA 1BTCA 3W1LA 1J11A 1W2PA 4H83A 3WSUA 4MLJA 3F2DA 3K4DA 4XZBA 3E2SA 1Y7VA 2GLKA 1OG6A 1O5KA 3PUOA 3ZFHA 1UD8A 3IJ6A 2WK2A 1NELA 3MP5A 3WNNA 3C86A 2Y63A 3DXIA 3GH4A 3LHZA 2V5BA 4Z42C 3TU9A 5C9WA 1UMYA 2DVUA 3KDNA 1HFBA 3SCNA 1V6UA 3LBMA 4ZE4A 3TA9A 4UOZA 3MBDA 2D23A 2B4GA 2VOTA 4LC6A 4ML9A 3M0LA 4RX0A 1UOKA 1GOWA 3FNDA 4HPGA 3TUUA 2FKPA 4UC5A 3DYPA 4JTQA 3ERPA 2FMNA 5AHLA 4OECA 3PC0A 3TCEA 1OYCA 2E1DA 4ZTXA 3QY6A 3KBTC 3BQ6A 4ADTA 1J5TA 4JQAA 3EB3A 4FF5A 2NV1A 4Q4MA 3CJPA 3HM7A 2XPKA 1ZAIA 3W7EA 3N04A 3WLPA 2IUZA 2QCCA 4O1DA 4DZHA 1QVBA 1QI5A 3BLFA 4QE5A 5DFAA 5I79A 3P5ZA 3E5BA 5CPQA 1QK2A 1LT8A 4L4OA 1OIFA 2GDUA 2OZ3A 3QBUA 1JZ7A 3D5HA 2JK2A 1UKTA 5AN7A 1GVQA 3G1XA 1K8XA 3W85A 4IX2A 4UOJA 3N9KA 5C54A 1JUEA 2BSLA 2EPOA 3OYXA 4JOMA 1VPXA 3BAYA 3T42A 5EBAA 4NASA 4IQLA 3HGOA 3PTDA 3UG5A 1FWDC 4XUGA 9RUBA 3SIMA 5B7YA 3GO2A 5TF0A 2TODA 1F3EA 2YA1A 3JS3A 5CZ0A 1E5JA 3MMTA 3W7RA 3MJYA 2FTYA 1S3HA 3IJLA 1J0NA 2ZRWA 2WVTA 1ZJAA 3M46A 1QW7A 2F6XA 2ISDA 1OGGA 3V0TA 1JULA 2WZTA 2ZX8A 2GQ8A 2QULA 2FGBA 1EGVA 4JKLA 1XCXA 1TRDA 4QLKA 3VE9A 1JCNA 3BV7A 2YDAA 1UZ4A 2YL6A 2CHOA 1ISYA 1Q7MA 3AOFA 1RLCL 1JZ8A 4J3XA 4X0VA 1GVEA 3I4KA 5LGZA 4XBJA 3STCA 5BZAA 3W7OA 2V2HA 1ZSXA 3WQGA 3ABSA 2C1IA 5CSRA 2MNRA 1FKWA 1WKFA 3C5QA 5FJUA 3KZPA 4Z1CA 3TKFA 4WOZA 2P0IA 1UR8A 3CHEA 1W17A 3ITYA 5T9CE 3UG4A 3LSBA 2C6QA 1VS1A 1J0ZA 1ONXA 3QV6A 4KF1A 4O1BA 4POCA 4RXGA 2P1FA 4A8IA 2ANUA 3GU2A 4G2DA 2PDYA 3AS1A 4Y8FA 3DEQA 2WZHA 3IGXA 4NJJA 1R2SA 2A79A 3FFSA 3H8AA 5AYZA 1IGWA 2G3JA 1GVOA 1LXKA 4L1WA 1Z8AA 2J66A 2G4FA 3IK4A 3T0BA 4WIWA 2OOFA 1GVFA 2FGZA 2J7DA 1XPYA 1XIMA 3UPMA 1E0WA 1E73M 2W27A 3V36A 3LGGA 1NU5A 5IRPA 3CZGA 2J13A 3P81A 4G5DA 4GI4A 3TQ0A 4I6KA 4CLMA 1OFOA 2ZXDA 2G95A 2PPGA 5E6YA 1TCMA 4KFPA 3ALGA 3DERA 2PDWA 5DO8A 3VFCA 3BSMA 3WQCA 1YBQB 5D37A 4Z2KA 5M2FX 5HA7A 1FXPA 5J5RA 2GDVA 5HMEA 3FX4A 4PMJA 1ECEA 1HKVA 1J12A 4L4LA 3VUSA 4GZEA 4CN4A 1A47A 5HPOA 2C1GA 4LUTB 4KRZA 5A8NA 4LF1A 1FWAC 4ZL1A 3B0VC 2ZZ6A 1MO0A 2B7PA 2Q8ZA 2QJGA 2DQWA 1WAUA 3BLDA 1PDZA 4GOAA 2XSXA 3NGFA 1N82A 3RXZA 1OABA 3VD5A 2WZIA 3RHGA 2Q8LA 5HR6A 3LXAA 3DKJA 1K03A 5RUBA 3LDVA 2PDQA 3SY8A 3W1UA 3EDJA 3T2OA 3GUGA 5J04A 2EHHA 4WDWA 2NQ5A 4PBGA 3PANA 2QMJA 1KM4A 1I2PA 1W1ZA 3CQ0A 2CXEA 3SFWA 4F9JA 3RUBL 2IXVA 1UH4A 1MW1A 3ABZA 3PFMA 5I2UA 3UZ5A 4BF9A 4PB4A 2QPSA 3EWDA 1B3OA 3CQKA 4LBSA 3BARA 4LB3A 1PHQA 5M03A 4IICA 4J7RA 3VXGA 4O0ZA 3MP4A 1TA3A 5D9NA 4JICA 1JI2A 4YYFA 4BZYA 1DWFM 5FF7A 4IFKA 1U5JA 1UR0A 4UTWC 3DX5A 5FL0A 2PI6A 3BJTA 2IKIA 1OX4B 2NQLA 3N2XA 1IZKA 1V3HA 1XS2A 4C6MA 2FTPA 4JIRA 4PRTA 1C9DA 4PL2A 5CLWA 3SY1A 5DANA 5D02A 2WC3A 2HVNA 2WHJA 3ZJ7A 1EP2A 4IMDA 3WFZA 4LBUA 4PTMA 1P7TB 1X8CA 3OODA 1H3GA 1EGZA 2V5DA 3TWAA 2PDUA 1DXIA 1IWPA 3KRBA 1RALA 3MYOA 2QCDB 4AISA 5EYWA 1SYTA 1QAPA 2XTKA 3RPMA 2BGNE 1RD6A 4F48A 1TV8A 4C6NA 3URBA 3S5ZA 3MC5A 3LCHA 3B06A 3CU2A 4PUUA 3IJIA 5CKSA 4GCAA 3PFRA 1O5XA 3OZOA 3E6EA 1A5MC 2XFFA 2I14A 2RH9A 3QHNA 2ZVIA 1UPPA 3CT7A 1TJ1A 1OGSA 5FSDC 4JBRA 1KFLA 3VKKA 1OIMA 2XVGA 3S5OA 2AQWA 3G6LA 3NO5A 5E9XA 3T81A 2POZA 5LKYA 1H0IA 2PDFA 4GQBA 2HNHA 3DZ1A 1WP6A 1LBFA 1P1MA 3G0UA 3SEPA 4EAYA 3CB3A 5D32A 1E1CA 5K2ZA 4XISA 3D46A 3ZT7A 4Q8VA 1B1YA 5HULA 4PSPA 4N4QA 2Z24A 1ITUA 5E9AA 5HK4A 3RMEA 4NZ1A 4J3UA 1SVDA 2YCIX 3T8LA 2PUZA 4HNOA 1K6AA 5HANA 1B5TA 3ARZA 2V4IB 4DJEC 1W8GA 3LBOA 1SU5A 2V5LA 4HTBA 4BQ2A 3RM8A 3UXAA 4HVXA 4R53A 4AZCB 2DZXA 3K4WA 4W9TA 4AZIA 2POTA 4WVXA 4IUOA 1C93A 3BCFA 2YBTA 4C90A 1HGYA 1JG9A 2XZ7A 2BASA 4PSRA 1HX0A 2WKJA 2OU4A 3BW2A 2O55A 1ADDA 4IGHA 1G94A 1GKQA 1XYZA 3HQ1A 1JXJA 2R1MA 3IT6B 3B8IA 2E25A 1MEHA 3FJ6A 3AXKA 2C0AA 1IXOA 3BOLA 1OC6A 4LAOA 3AUOA 3O16A 1E6PA 3WQEA 2NQZA 4Q33A 5J8LA 3CUIA 1DJYA 2EJAA 3ZVIA 3L4UA 4FX8A 2ZTKA 4O1EA 3ABQA 4NNAA 1Q13A 4GX8A 3BSGA 3EWWA 1POJA 4CQAA 3QR3A 1GKRA 2YZ5A 3K1GA 1POKA 4LCSA 1UWQA 1VHCA 4N4PA 1A3WA 1SO3A 1E71M 4B5NA 1MXGA 1MDLA 1UA3A 2PEVA 2WM0A 3UA3A 3WL0A 1R9ZA 4EWJA 6REQA 5AZ0A 3KW3A 1B3XA 2BOEX 4NJIA 3EB2A 3UD6A 2BGQA 2CCRA 2QVHA 3M4HA 2J7FA 3ARUA 3T2QA 1VRXA 2PD9A 3WBWA 2OTDA 1ALDA 1XSKA 3ITXA 5D33A 3BW3A 5DY3A 1NJJA 4KBXA 5D4YA 3KXQA 4WXZA 4XVEA 2DZUA 4HCLA 4H7ZA 1OJXA 2VDIA 4NG3A 3WBAA 3PWIA 3VCNA 3U2EA 1XLCA 1X6LA 3UXIA 4IIDA 2HSAA 4PCPA 2ZA3A 4UMCA 1DWGM 3WD0A 2VKZG 2X41A 3GS6A 1VZWA 3O7UA 1WDPA 2TRSA 2DUZA 4I8DA 1H1YA 1PWLA 1XDMA 3BQ5A 3MKKA 5AC4A 3LLXA 1RY0A 4DLOA 4B9ZA 2HS8A 2Q02A 3WENA 3MHUA 3NOYA 1GQNA 3SR7A 3U8GA 5FF3A 3TJIA 3XIMA 4CGTA 3JUGA 1DWIM 4RV3A 1LZOA 4ICNA 4AWUA 3N14A 3C3UA 2IKJA 1BXCA 3AALA 1KB3A 3NZ1A 3W2KA 1RP8A 1MFVA 3WMLA 4A3QA 1TREA 1SFSA 4KQNA 1MW2A 4KGJA 5GPRA 3HFTA 5JUVA 2NT0A 2YA2A 2C19A 1OFEA 3G1HA 3KS6A 2QJHA 4HKPA 2QZRA 2WKGA 2YSWA 3W38A 3M5XA 3AZRA 2GYIA 1EGUA 1NM9A 3ZWSA 1EQPA 1Q8AA 2UY2A 3P8IA 4R7JA 1FCBA 1FWGC 1OB0A 3B9OA 3VKDA 3CHCA 4G9PA 3IVTA 4MLRA 3KDOA 3G0XA 4C5YA 4QROA 4MDOA 1XLGA 1OG0A 3R6IA 3LQGA 1RD5A 1J6OA 2PP0A 3AAMA 1EGMA 4GO8A 3VD3A 3MUIA 2WWDA 5CBJA 1E56A 1KO0A 4GNKB 2DZBA 5A8QA 2OG9A 1JPMA 2DT3A 4C65A 2UV8G 1FOBA 3WZ0E 5CPTA 1NP2A 1B2YA 2P5NA 5KZ6A 3SRKA 3DHPA 1GTEA 2LLEA 1QTWA 3VNZA 2ABBA 4FLRA 4HSOA 4TUFA 2DZWA 1EPVA 2P8CA 4F3HA 3WYZA 3MVIA 5TNVA 2P76A 2Y7EA 3LS9A 1JCTA 5FF0A 1CXLA 1VJSA 2GGGA 2JIWA 3OQEA 4X9YA 3TYBA 3A9BA 4PUJA 1XSJA 1DIDA 1XISA 2BHUA 3CAKA 3SB0A 1LOLA 1TR9A 1KBLA 4WXYA 3AWNA 1HL8A 4K39A 3M0HA 4IGSA 1YPXA 1QT1A 1CLKA 1U5HA 3FGCA 4LF2A 5A8MA 1FWIC 1TTIA 1EOKA 2FH8A 2EJ1A 3K8MA 5E0FA 1EC7A 3WQPA 3SDOA 3DI1A 4X2PA 3STEA 2YW4A 3T0AA 4CCDA 2ZWZA 1QHPA 4HYWA 1EJUC 1Q4WA 3OOQA 1TG7A 2YIHA 3V0UA 1ISWA 1UCWA 1JAKA 3MTWA 1J0KA 4AZ7A 3W25A 5KITA 1R3WA 5AECA 1Q6RA 2PLMA 3IJ9A 3T44A 2HE8A 2DGAA 1O95A 3WLTA 2GWGA 1S46A 2PWDA 2G50A 3UXKA 4FR6A 5FACA 4NJKA 4CNSA 1EPXA 3HIJA 1OCNA 4D6FA 4GGBA 3W1NA 1DYSA 3E0IA 5LXXA 4HMCA 1F74A 4AY8A 4IMGA 4IF2A 1IF2A 3KS5A 1V0NA 2D24A 1XCWA 3DGBA 1IWAA 3P93A 4ZODA 1A5LC 3AHYA 3RM9A 3ZQ9A 1OYBA 4J3SA 3GW3A 4HP5A 3QR1A 1C8XA 4MUZA 3VNMA 1GPFA 4PUDA 3PVFA 2PWUA 3TN6A 3AQUA 4HA4A 4JKMA 5G4HC 2VEMA 4B3ZA 1SW3A 3B9EA 3UVIA 2HMCA 3S2NA 4NJHA 1G7VA 3P5YA 3T0TA 5K9CA 3LV5A 3DYMA 2DFAA 1BEUA 3CLWA 1OC5A 1C82A 3MMWA 1LRNA 2CWNA 2YB4A 1BKHA 4BHYA 3GHTA 4HYRA 4B5UA 2DT0A 1ZL1A 3B0UX 3AISA 1EBGA 1OT1A 4XBSA 3KTSA 1U22A 4LTSA 1PKMA 3KWSA 4AC7C 1YRRA 4QSHA 1AD4A 1VIZA 3ITCA 3LYEA 2GVJA 3RITA 4MNMA 2UBPC 2WHLA 2Z1KA 3E0FA 3QPZA 4FA3A 2QW5A 1NWUA 1UROA 5D09A 1EYEA 3I7SA 1PJ9A 2WSRA 1UBPC 1W2VA 3U2CA 2J75A 1NEYA 2HJPA 4DO5A 1OCQA 3BL3A 3F4DA 4UFMA 3WN6A 3MKVA 5EBUA 3CXOA 2YFOA 2WSYA 2P3EA 1QW8A 1XBZA 4JTCA 4UQCA 3TXVA 4X22A 5TQLA 4O0KA 1KXHA 3MMUA 2JIEA 4PRRA 4BCEA 4UFIA 3TOYA 1I0DA 4D6GA 2DQXA 4GYPC 3CAQA 5FESA 1XUUA 4B5SA 1F9GA 1EEXA 4WOQA 2DVXA 1HJXA 1NWRA 4MWAD 3CPRA 1ME9A 3MZNA 4IM4A 1MUCA 2QJIA 1JPIA 2ACRA 3M7WA 2ZQ0A 4O8RA 1F61A 3UXDA 1L2UA 3LHWA 3K13A 1ENUA 3CQJA 1L8PA 3AXHA 3T8QA 4DBEA 3GG1A 2JF6A 4CNNA 4GK8A 3DENA 1D2KA 2WCOA 2OQHA 2PLCA 2JEPA 3RRXA 4GBDA 2ZFAA 5F1UA 3DC8A 2CLHA 3NQ6A 4H9XA 2OZTA 1UIOA 1SZGA 4LCQA 3ZXWA 4CVWA 4GC4A 4MB4A 3P82A 3WK1A 3O6CA 3SRHA 3GR7A 4J40A 1NDWA 3WDJA 1MNZA 2OYKA 1GVSA 3HN3A 1FHVA 4Z2HA 3TTQA 2BWGA 3ISIX 3BG5A 2FPVA 5EGRA 4LVBA 2OB3A 2ZWYA 4X9SA 3N3TA 4P8VA 4Y8EA 5HXMA 4E8CA 1W3KA 3PHAA 5K7JA 4DAFA 2XM2A 3KOXA 4KWSA 5FEZA 1L8NA 3W7DA 4GE8A 3H2NA 2VZKD 3KOYA 2DSKA 4NZCA 4GIEA 2HISA 3S9YA 4IT1A 1AVAA 1UD6A 1Q6LA 1VEOA 3I3DA 4DYEA 4P8WA 3U5YA 3E2RA 4YTTA 4LUIA 4DO4A 4E2OA 3HQNA 2Z6IA 4Q6XA 3SRDA 1GKPA 4MNKA 1VCVA 4M6VA 2UZ9A 1SFTA 1EDGA 2VM8A 4K7VA 4DBUA 3WD3A 4ECLA 5D04C 4GZJA 1DBTA 2VD9A 1XF0A 5CGTA 1OYAA 3DYOA 3A64A 3MSRA 1XH1A 3VNKA 2A4AA 3P62A 4DWSD 2FZNA 1KFEA 5D2VA 4ACYA 3M0VA 2PODA 2UY4A 2PMQA 3T2PA 1XC4A 2PURA 3EKLA 2KXSA 3UD1A 2FFIA 2WXDM 1AH3A 1RWCA 5EMLA 2WCGA 2XH0A 1K9FA 4G7FA 1OY0A 1K9EA 1B4EA 4UTWA 3QFEA 1FY6A 4X0NA 2TAAA 3WNKA 1Q85A 2FVKA 1LP6A 3HGSA 3B8DA 2GUUA 2XGZA 2GQ9A 3T4CA 3RIKA 1KD0A 2QCNA 1FWBC 1I1XA 3NVTA 2RGMA 5GNZA 2PGWA 4J1OA 3PZMA 1EB3A 4QISA 3W02A 2E9LA 3MMDA 2Z25A 3N19B 3R79A 2ACQA 1RWAA 1HKJA 1S2CA 3ARQA 4Q4OA 3UXLA 3ZZ1A 4WLCA 1QPRA 3OJGA 4E6MA 2OSWA 3NSNA 3O8AA 4HNUA 2WKLA 5AYIA 3QMSA 2PD5A 1DOSA 2I9EA 4PCFA 3VDBA 4H8NA 3QY7A 1KRAC 3BLOA 1DWAM 4B3KA 3WQ4A 2QUNA 4IH3A 2FVMA 2PAJA 1KA9F 1XYLA 3H6OA 2QV4A 4IPIA 4HCHA 5MHBA 3B9NA 1Y65A 4W87A 3LPOA 1EIBA 1V6TA 5HR7A 1OFAA 1V4YA 1C9WA 3GXNA 5IDIA 4LRTA 3NQ2A 1SSDA 4C7FA 3MHFA 1VYPX 4QGCA 3RPTA 3TYZA 1KRCC 4ZO7A 4JY8A 1Q5MA 3L65A 4L1GA 4M8UA 1OJNA 3VGFA 4PUMA 3A4WA 3OU8A 4UTUA 3PR2A 3ID7A 4M6QA 3NQCA 5BU9A 5G2IA 5A8PA 1ZFJA 1ZTVA 1RJQA 1ME7A 3UVAA 2QF7A 1G69A 1E4MM 2YXXA 1VFTA 5F4SA 3WH8A 2R94A 2VEFA 1W5PA 7TIMA 2OLAA 4TVDA 2RKXA 3W2LA 3N4EA 1EWEA 4O53A 5ABTA 2Q3OA 4L5ZA 1Z6KA 2XFWA 3E3HA 4MZYA 1NF0A 2W67A 4DJEA 3BLKA 2X0SA 3C2EA 5EU9A 4H9VA 1M65A 1U1HA 1MW0A 3P2VA 3WELA 4ZEPA 1GW9A 3LI1A 1L9WA 1W3JA 3GUWA 1FKXA 4CD7A 1B9ZA 4QNWA 1UKOA 2Z1XA 4WZHA 4WJXA 4US5A 2AKMA 2FDSA 4LVGA 3GM8A 4E2BA 5HNRA 1ISXA 2CZEA 2C71A 2J79A 4FIRA 1R3RA 2D2JA 4NF7A 4JN7A 2YA0A 3VNLA 4EOUA 3KBVA 2XHYA 5XIAA 1WOAA 4J5NA 2WZEA 1IHIA 4LNCA 2ZICA 3IS4A 4HZ6A 3IVUA 3AMKA 4GHRA 6CGTA 4DPPA 4JNMA 3LG3A 2X8RA 1TZ9A 2OKOA 4DUVA 4REQA 4O14A 3R4IA 1IEWA 2XWEA 3EWYA 3DG6A 3IV8A 3QOMA 6PTDA 2PTWA 1XLMA 3A5FA 3UY7A 3E5PA 1FP8A 5HWNA 1DJXA 2CLFA 1W3YA 4MWAC 4MDPA 3O9NA 1VBRA 1VYRA 1XLBA 4M81A 1VYSX 3NPUA 4Y9PA 1PO9A 3VO0A 2WMGA 4AZGA 3VOHA 1AW5A 1RBOB 3W28A 4C1KA 4C6LA 3W26A 1FHLA 2Y85A 4ZQNA 2CZDA 1KFKA 3I3BA 3VC5A 1XJBA 5HOSA 1C90A 4CD5A 4LT9A 3EEZA 1Q7ZA 4AMCA 2ZZ3A 4J27A 2V6AA 3GE7A 2EF9A 5TIMA 3U4AA 3O0FA 1U1JA 3VE7A 3PUDA 2NUWA 2PE4A 1TSIA 3SUWA 4L9YA 4O18A 4EE9A 2GJLA 2E40A 4EAMA 2V5JA 1XICA 1M7OA 3FLUA 1TE6A 3APTA 3FHQA 1WDRA 2GGJA 4KCTA 4LANA 5HBFA 3OVPA 4AEFA 4HMDA 3IAQA 1GQKA 1TVLA 1ZY9A 1TJ2A 1CENA 3UT0A 4WKFA 4JX6A 1R3QA 4JQ4A 3S8HA 1TPH1 1WE5A 4AVFA 5CGMA 4XSMA 3TVAA 3CQIA 3EOEA 1RBAA 3JZEA 1RW9A 3RCNA 3ABXA 4H6EA 2J8GA 5JH1A 3R0KA 3BLPX 3WJXA 1JD9A 3C2OA 6A3HA 4LWWA 3G18A 2XDFA 4A21A 1HO4A 4UUIA 4AUBA 3QTGA 3W3OA 4ZFMA 3WLHA 1E4IA 4XIMA 1AJ2A 1GOQA 1OF8A 4DWSC 1W32A 3UCCA 2W9MA 2H3BA 2XU2A 1H0GA 3M0IA 2QCLA 1G6CA 3W7HA 3K46A 4DLQA 3KL0A 2PTYA 1TTQA 3OG2A 3WNOA 5EPDA 2RGLA 3GD6A 3VIJA 4LC8A 1VFMA 2YCKX 3W1QA 1FH8A 3QQ0A 4L4PA 3IIZA 1YE6A 3C0JA 4KW2A 3WF1A 1VFFA 4DIAA 3LHYA 3GVGA 3L4XA 1FCVA 1W3NA 4K1WA 3EWZA 3GTHA 1HL2A 3W76A 3GVQA 2V3EA 2PB1A 4DX3A 1JQVA 2CITA 4J9JA 2RHGA 1WB0A 1SW0A 2R82A 1HF6A 5U4NA 2XH7A 2YPIA 1WBHA 3WLRA 4GIRA 4L6OA 4XAFA 4DUWA 3P8JA 4Z1DA 3BXWA 1M7JA 3GNOA 1EZ2A 1OCJA 1BQGA 1JNDA 3B8TA 1HM2A 5K9DA 1EYWA 4MAZA 4ES4A 2TMDA 1V0LA 2ZC8A 2ZE3A 2R24A 4IPJA 4ZE5A 1XKJA 4V28A 2FHFA 4C6KA 1OK4A 2NW0A 2F7FA 4JTFA 5BOOA 2VO5A 3MWCA 3DESA 2NQHA 1RCXB 3FYPA 4ROQA 3BLEA 4PCNA 2YEPF 1JDAA 1TCDA 4B2DD 1AJ0A 3S5SA 1AH0A 1O7AA 3PULA 4I5UA 2PRHA 1LORA 3GZAA 3R7MA 2Z28A 3ZR4A 4KKXA 2INZA 3M0YA 3G1AA 5HATA 1PTAA 4M24A 4H6QA 4R5EA 2OQLA 2XSBA 5CEWA 3NQGA 1G1YA 1O4UA 4S38A 4UQDA 1S5WA 3ATZA 2ZX9A 1W8SA 2WPGA 1K7FA 2ZRZA 3TV8A 1XI3A 1UR2A 1QWGA 4DEFA 3TYUA 1E72M 3V4BA 1PEZA 3FA4A 1FTXA 1LUCB 1OZMA 5DXXA 1KM2A 2WJEA 3VNDA 1V08A 2DW6A 2YCJA 1GQLA 1ONRA 2AAMA 4DUOA 2BRWA 4HHPA 2AL2A 3MI3A 2UWFA 4J3ZA 2DZVA 1HKWA 3WL1A 5BU6A 4PMRA 3NQVA 1V79A 4Y2WA 1BD0A 4FX7A 1D8WA 3ENLA 1YXYA 3LTYA 1KBKA 3G1VA 5I07A 4Y7EA 1XLKA 2IQ0A 4GH1A 1A49A 4N6EA 2G37A 4XZNX 3VDCA 3W7IA 2YDSA 4UBPC 4V27A 2HK0A 3THCA 2NQ9A 5HUPA 4Q8NA 3QEZA 3EZ4A 3PZUA 4HSHA 3QFWA 1FFQA 2ZUTA 1OJPA 1TV2A 4GYFA 2VDGA 4I7WA 2VNCA 3MT1A 3NM3A 1S39A 2QCMA 1V6WA 1OFQA 3FJNA 2Q01A 4HNCA 3H4XA 4JL1A 2ZX7A 2BY3A 3CV1A 3HPFA 3LCLA 1ZENA 4J2MA 3IARA 3FJLA 2ZBTA 4O16A 3PG8A 1DE5A 2ESCA 2WMJA 1P6WA 4H04A 3HFYA 3QHMA 2ZTJA 3PJWA 1CLVA 1FQ0A 2QCHA 3NEHA 3WQWA 3BDKA 3PS7A 4B92A 2IMRA 1B54A 1VEMA 4MZ8A 3SN1A 1DORA 4V15A 4DJDC 1K7XA 5LSMA 3VAVA 4TO8A 3DI0A 3H24A 3S3GA 5KMYA 1WXJA 1YE4A 1KNWA 3WEOA 2ABAA 2FVLA 1T41A 1XINA 4RUBA 2W91A 1MNSA 3CV2A 3R1ZA 5K4ZA 1LG2A 1R2TA 2Y4SA 2F2KA 5C5YA 3KBWA 3CMJA 4OOUA 1FXQA 1E3XA 4XB3A 4OBTA 3M07A 2C16A 2VP8A 3DOPA 4ZCWA 2Z2UA 1C8VA 1RA0A 4GYPA 1VAHA 4HCDA 6XIMA 4GH3A 4XAYA 4AH7A 1X1IA 4O19A 2W3ZA 1CGTA 2DY3A 4Z17A 4ORIA 4N2YA 1C8QA 4OE7A 3SGZA 1FUYA 1E1FA 1YPIA 2YYUA 1CZ1A 5F1VA 5K9XA 4S3JA 4WDUA 5BNKA 4YPJA 2QGYA 1E0TA 4F2TA 3LM7A 4JEQA 4TVUA 3NL6A 1AD1A 3VOFA 3FOKA 1E15A 1JVNA 4TV5A 3VX1A 2WZMA 2YXGA 4TIMA 5EFFA 4AC1X 4A2SA 4IIGA 4W7WA 4OT7A 4AD2A 6TIMA 1VGAA 3NO3A 1KFWA 3HPZA 5CSSA 3UR2A 4U3CA 3JU2A 4H6KA 4ZOEA 2D2HA 2GSJA 4PTVA 1ADSA 4D6DA 2PRMA 3F4NA 4GINA 4BI7A 2VRQA 2OGYA 1RJRA 2EBNA 3WJSA 1MXSA 1TMLA 2YL9A 4FNPA 1VRAB 2VEKA 1XW8A 1K8CA 4HBKA 2WLZA 3VGDA 3NPWA 2ZRVA 3VA8A 4BJHA 4OWGA 1H11A 3NL5A 1R3YA 1TO3A 1CIUA 1TTJA 3K30A 3L2IA 4ZMGA 2CBJA 1MRAA 1K6WA 3WO8A 3CTLA 2DJLA 3OEXA 5TBOA 1Q45A 1YDOA 3L67A 5FJIA 3TDFA 2OPJA 3CHVA 4YTSA 4HK5A 1ZP4A 3B03A 3NSMA 4NXKA 2D3LA 2O9RA 4LAZA 4RE3A 1QU4A 2IPGA 3LOTA 2DIJA 2XINA 1J6PA 2A3LA 4PMUA 4ACZA 3S6DA 2A85A 4NNBA 3W7GA 1MMFA 1U30A 1G4SA 1XLJA 2GFTA 3A21A 3ITTA 3PTMA 4LS2A 3S9ZA 4YCOA 4WKAA 1AL8A 3DFOA 1TJPA 4PODA 3LCGA 3BAKA 5E70A 3FYOA 4R27A 3T40A 1DJGA 2X2YA 3CL8A 2VQUA 4O17A 1U1UA 3F5JA 4FNQA 1WZKA 1XBXA 3APGA 5M5DA 3C0QA 4IIFA 4F9DA 4UQBA 5B7ZA 1G5AA 3UD2A 5FJRA 3HG3A 1B9BA 1HIZA 5I02A 1XFCA 1PZ2A 2Y7FA 5C2XA 4LUSB 1SJDA 3WKZA 1XLAA 4DJFD 2Z27A 4HOWA 4C1NA 1W0MA 1UOZA 3CASA 3G77A 1R6WA 3T1GA 3LPGA 2P8BA 4Z0SA 4A8NA 2Z0IA 2ZRXA 1FDJA 1WDQA 3MQTA 1TRIA 4IG2A 2YLAA 3DGRA 3LNPA 3QPEA 2QYGA 3BUVA 4A3YA 3JW7A 1SM9A 3V7PA 3BTNA 4R9XA 1L6WA 3CNYA 3PK7A 1WKDA 4O10A 4MJ4A 4ENLA 3EA2A 1GZ1A 2YBUA 1HXJA 4OJYA 3RFAA 1MQQA 1FX6A 2V81A 4S3AA 3AS0A 3KHDA 1PPIA 1BLIA 1E0UA 4OKDA 1XP3A 3Q67A 5DT7A 2PGEA 1V3IA 2G41A 3EA1A 4BI6A 3HU7A 1FA2A 1MZHA 3BVJA 2QNEA 4I9JA 5DQPA 3W6LA 2GJXB 1OVDA 1RV8A 3MI6A 3CIXA 2NVAA 2XIMA 3A12A 4BQ4A 2Y24A 1SMAA 5AOUA 2I17A 1JDCA 4IXXA 1YDNA 3BW4A 4HPJA 3FIGA 4HB7A 1S38A 3GTFA 1ISZA 3LX9A 3LM3A 2AKZA 1W9VA 2ZOXA 1ZLPA 3A6OA 3E74A 4O1FA 1GOXA 3H2AA 3NPXA 3VGHA 1UW9A 2CIPA 4MYXA 1MEIA 1YNQA 2Y8UA 1R9YA 1S2WA 3S2LA 3UP8A 1FWTA 2OZ8A 3GRIA 1PUDA 4BI5A 3S47A 3FYYA 5ABFA 4NX5A 5CBIA 3E0WA 3U6WA 1QATA 1OFDA 4H3DA 2VEIA 1UQZA 5LIWX 2DIEA 3BGAA 4DWDA 3IANA 3UF9A 3MWAA 4NUWA 1NIUA 1C7TA 4H41A 1E6QM 1A5AA 1XLEA 2AQVA 1FWJC 4ML4A 2FDMA 1PE1A 1I2OA 2VHLA 4JQ1A 3RCYA 4H9UA 3WNLA 3GWQA 3VKAA 4J3VA 2O9PA 4C6JA 1UWIA 1PXGA 3AYTA 3WLJA 4YTRA 5AYYA 3R5EA 4EACA 1JAEA 4YVPA 1CT5A 2VL4A 1QBAA 1RR2A 3HB9A 4NAEA 1EHAA 3BMXA 3A13A 3GNDA 1UWRA 1HTIA 2CKRA 3WQ8A 1JD7A 2EG6A 3OGVA 1N55A 3KAOA 2VR2A 1H5VA 3FEMA 4TVCA 3QSTA 3EMZA 1H62A 4GACA 5FSEC 4L1XA 3UG3A 4B90A 2H6RA 3W88A 1JCLA 3DKLA 1Q4NX 1W3HA 3VNIA 4O1CA 4K8HA 2DJXA 2KAUC 1LOSA 3W7MA 4QDPA 5BCAA 4EX4A 2WLYA 2BHZA 3LD5A 2C1HA 3SCSA 3P3BA 3VCCA 4GVHA 2XM1A 4L6DA 4C6EA 2F6UA 1SO5A 3QR0A 2CESA 3CMFA 3PB2A 1KM6A 4H01A 3MUY1 4Q3MA 4NZ4A 2WBGA 1NF7A 5I24A 1HP5A 4GNJA 3NJ3A 3B9DA 4JTSA 3E38A 3OBEA 5LA2A 3DIPA 3B4YA 1QPNA 1V7YA 3IV3A 1KM0A 3N2OA 3ATYA 3QGAC 4EXAA 1VLWA 3ITLA 3HJEA 4Q7NA 4KIRA 2UY3A 4QRNA 4M19A 2ZKMX 4I7VA 5LHFA 4YVXA 5L6UA 2E6YA 5CLTA 3U5UA 4S3DA 5GJNA 2D1ZA 2A7RA 3JVAA 5A2BA 3BOFA 4QTGA 1XKYA 1YW1A 3OO2A 4ZOBA 1EXBA 2MANA 2HS6A 4PMXA 4KFOA 1PCKA 2ICSA 4IFRA 2NUYA 3RLHA 1F4AA 4N9EA 4UFKA 3AIRA 3ZM8A 1GONA 1V8EA 5CG0A 2BY0A 2GQAA 3W2MA 1JPHA 4WY0A 4AZBA 2OT1A 5HJLA 4NKCA 2XYLA 2W0UA 5D8WA 1L2QA 1H49A 3AXIA 4OUEA 2J6XA 2P10A 4WX2A 3EWCA 4RL3A 4RPPA 3PZTA 1RY8A 5MF5A 2PDKA 3LQLA 3VC6A 1XLIA 2CFFA 4EP8C 2VRJA 1BF6A 3V1PA 1JDFA 3L0GA 2JBMA 3LZ3A 4E4FA 1W1A1 2WW5A 5DN1A 4Q7IA 3VPLA 1IEVA 5T9BG 1XSIA 1G0CA 3GSMA 2Z1SA 2BODX 3KVMA 4OTKA 1RLDA 2GJNA 3XISA 2PSNA 4GCXA 5IFTA 4HK7A 4S3FA 3UZZA 1WDSA 4BQ3A 3FS2A 3PAJA 3TFCA 3V5OA 3BV4A 3SRFA 3CWOX 3BLLA 4MOZA 3WQOA 4GVGA 3FV9A 1O5QA 1QI0A 3AC0A 2ACSA 4KS0A 2J4GA 2X0HA 4RZBA 1Z3NA 1EKOA 4NNCA 4GWEA 3GX9A 1DV7A 2PLJA 1Q66A 4I7UA 1U33A 3GNPA 2NUXA 1BYBA 4O12A 1XRSA 4PUKA 3IIXA 3SCTA 2J24A 3GXPA 2WB5A 4UNLA 1E6SM 5FF4A 4JYDA 2E1WA 3QMTA 3VM5A 1AH4A 2R1NA 3D3FA 2D2GA 2WVVB 4O57A 3PTQA 2PC8A 3UGVA 1RCQA 4IL0A 4R9OA 3WQVA 4AEEA 1XG3A 2W63A 2QS8A 4HZ8A 3T9PA 4DXXA 3QW3A 4PRWA 2ZDSA 3AHVA 3GBEA 3F5KA 1HKIA 4L61A 4S2CA 2CWXA 2VFEA 4W5UA 5I5RA 5A2AA 3PSVA 5FOOA 3PBUA 3MO7A 4JIIX 1MQRA 3WD2A 1B90A 1XIJA 1VPQA 1T6MA 3GDMA 1A4LA 2V5CA 2J47A 5ABEA 4ORMA 1FH7A 4RR4A 1YADA 2HBVA 3DECA 3II1A 3S6OA 2ZUMA 1D7KA 2BBFA 2I5GA 1KTNA 4E4UA 4KPLA 1LOQA 1B30A 3BGGA 1RWHA 5H8MA 1W1VA 3NURA 2VUYA 2BVYA 4V2XA 1KXVA 3HOJA 4RKAA 2TPSA 5CSUA 2VC6A 1ZQ5A 5C9XA 1GCYA 3NNTA 4XZLX 4GABA 3ONBA 1WDDA 4IQJA 1F6YA 4MB3A 1JYXA 3DN5A 4XKYB 4U31A 5EMMA 1BVZA 4B4FA 4IHCA 3RGTA 2WSKA 5DBUA 4OV4A 5AHEA 4D1JA 4JHOA 1US0A 2OO0A 2WJFA 4HNNA 1NP0A 2Y0FA 5ABGA 5JMUA 3CWHA 1UH3A 2F6KA 3URAA 4FIQA 4QEEA 3W2UA 1T8QA 3WCZA 2G96A 4KCVA 1KWKA 4W4QA 4DJDA 5H8UA 1NOFA 3M0MA 2KXRA 4J3WA 4GUGA 2Z2BA 3AJXA 3AO0A 3WLSA 4OVXA 4IP5A 1T96A 3VM7A 4EK7A 3S6TA 3HPAA 4UTMA 2V82A 1W56A 1X8FA 4UTIA 3S2CA 4JNZA 1QI2A 1FWNA 5FD0A 1K4GA 4P5UA 3FXYA 3LCWA 3TEVA 4P7NA 3G1RA 4URIA 4PR4A 1D3GA 3CPGA 2P0OA 1BWLA 1NVMA 4IWWA 2O7QA 4NRSA 2V3DA 4XAZA 4FNUA 4DVOA 3ZSSA 1IZJA 5HNUA 1RAKA 5AC5A 2YEPB 3NA8A 4HMNA 5EY5A 4AVOA 3TN4A 1F2JA 4GD0A 3NOEA 1H60A 4OOZA 1MWOA 1F05A 5T8GA 3UZYA 3L4YA 5LNSA 3IAPA 4AWEA 3VIKA 2NX9A 3PZQA 3RLUA 1LL7A 4AD1A 3O05A 1NDVA 2QPUA 4F40A 1TWDA 4QLJA 1PYFA 2HTMA 2J7BA 3PF3A 4YL2A 2FTWA 3TN5A 3VOCA 4ADUA 2WJDA 1I4NA 7CGTA 1O60A 4J35A 2HNEA 3WDIA 2L5HA 1EO7A 1S1RA 2ALDA 1YBQA 2NXIA 4V1XA 4P61A 3KE0A 1PVNA 1XV8A 3EMCA 1MQPA 4M1RA 3WEMA 1WQ5A 4NL1A 4LUTA 4GIAA 4H8HA 3Q2DA 4Y96A 4UXDA 3GDTA 4NYUA 4ZO9A 1TPB1 5HMSA 1I2NA 2Z6JA 4K3ZA 1J9YA 2PDCA 3NYDA 3TQVA 1SO4A 4H1ZA 1UBSA 3G8EA 2VCAA 2BDQA 4HYVA 5CC5A 3ZJ6A 3F2CA 1OX5A 2I9UA 1OBAA 4H9ZA 4C5ZA 6ALDA 2OCZA 1V02E 4X63A 4JYFA 1QI4A 4JN6A 3VNJA 1W1B1 3INPA 5AB3A 1H2JA 4QLLA 3DFYA 3AYRA 1A4MA 5J5DA 1QFEA 3E9AA 3MZ2A 3DU0A 4QJ3B 2IS7A 1LWIA 3I65A 3G24A 2G3IA 4N7QA 1IEXA 4IOTA 4ERAA 4Q4QA 1HMWA 3FVDA 1KQZA 1K7EA 4GMEA 2ZADA 3IACA 2HE5A 3VUPA 1AQFA 3SW6A 4I90A 1K02A 3VOJA 1F9CA 3GXIA 4JCLA 5CAKA 3Q37A 4F0MA 3RG6A 1OX4A 3RU6A 1QCWA 3ME3A 1VD6A 3M5YA 3ELFA 3L68A 3M0XA 3MY9A 5BXPA 4MY9A 4UWMA 2W6RA 1GTHA 1H4PA 3W4RA 2VEGA 4XZMX 3OBAA 1VBUA 2R6OA 3CHDA 3VINA 3BK0A 1P5BA 1VBGA 2QIWA 1P7TA 4CN6A 1R0MA 3MSDA 3BO9A 2HEJA 1E6RA 3PAOA 3S1XA 5FEWA 2QCDA 5FCZA 1W54A 1G4EA 4HZ7A 4AD4A 3M64A 2PTXA 2YX0A 1KW1A 3AZTA 3FHAA 4MG4A 2GZXA 2V9DA 2PA6A 3CUJA 3IUDA 1EHNA 1OINA 2OYMA 4MNJA 3VOIA 3PZOA 3TCSA 4GI9A 3QGKC 1DL3A 1KTCA 3KLKA 4AIEA 1HKMA 3H54A 1VP5A 3PBWA 2I7GA 3WBYA 3VMNA 1RQHA 3QW4B 1YDVA 2ZCGA 5I78A 4Y6GA 3CUXA 2DDXA 3UPBA 4KH2A 1Q6GA 5C70A 3QZAA 4ZSTA 5HJXA 3IUIA 2R1KA 1VJZA 3EPMA 1WZMA 1JCJA 3FA5A 1UH2A 3I4EA 4E8GA 4NQ1A 3SQLA 1E51A 2OWCA 1SZFA 4UNKA 5CZTA 1VKFA 4X3ZA 3B8UA 1XXXA 5IHRA 3U3HA 3E02A 4O4WA 1RVKA 3NM1A 5JVLA 3FA3A 3HMCA 2NQJA 3WLKX 1XH2A 4DHGA 4PMVA 5CXPA 3ARTA 4GY0A 1UA7A 4F0LA 2PBOA 1TJ0A 3JR2A 4O4VA 3GXFA 3LERA 4KEVA 2B7OA 2VFHA 3PBGA 1PWMA 2EG7A 3WJYA 4AZCA 4YVVA 5IOBA 2X03A 3NZPA 5JBDA 5D2XA 3ZWTA 3CQHA 1WDWA 1Z44A 2VFDA 3L5AA 4AYGA 2E4TA 2CBUA 3TXZA 5C9UA 4TMCA 4JR5A 2YCEA 4XTDA 2Y5JA 1IXQA 1DJZA 4NT0A 4A8RA 1X1NA 3THQA 1HJSA 2ATMA 1WUFA 4S3GA 3WUEA 1J2WA 3VD9A 3GAKA 1C91A 3QPYA 2A7NA 4WGHA 3T09A 1DIOA 1ONWA 4MVAA 1XR2A 1PAMA 1I60A 2AQOA 1PL9A 1I2QA 3CEUA 5EMKA 4LGXA 4Y9AA 2E24A 5CG7A 4WR3A 1EC8A 3LTPA 4JIHA 4LYRA 4LFYA 1QMLA 4IP7A 2ISVA 4HJFA 2WMIB 9XIMA 1UR4A 3QC0A 3FW6A 2EPKX 3S2MA 2NV2A 3KBMA 1A5UA 4J28A 4DJED 1MFUA 3UG8A 4UTFA 3W86A 3A3HA 2WCSA 3A24A 3P6LA 4ZQOA 3CWNA 3EXSA 3CK5A 3RR1A 2V68A 3RK8A 3VMPA 2WNQA 3L21A 4H6RA 4CN1A 2PF0A 1VCFA 2A2IA 3G6MA 4H9MA 1U83A 1NOUA 1XL9A 5H6HA 5D8ZA 3LLFA 2NX1A 3DHUA 1LDCA 5HMFA 1BGGA 3TJXA 3IT4B 4EF9A 3VDGA 3CO8A 3KP1A 2V38A 3AHZA 1CDGA 1ICSA 5C8BB 4HHLA 3NSXA 1UKSA 4RNFA 1SJAA 1LQ0A 3H4WA 4B5WA 2RDWA 3W7NA 3KL5A 3T0CA 3WX7A 4ZR8A 3PZ9A 1TVNA 3CMGA 4NZFA 2NXGA 3SADA 1H61A 4ALDA 1C92A 4HD5A 1JCXA 2E8ZA 1NQ6A 3MB9A 3NFUA 1EUNA 1SR0A 2J9ZA 2XFYA 4FMVA 5IHSA 4RE2A 2VFGA 1OZQA 1EQCA 3GBDA 1BGAA 2NLYA 2CXGA 2E09A 4EXBA 1QDSA 2IKHA 3QZ6A 4MSSA 3ZVHB 2Y62A 1FHDA 1E6NA 4KFNA 4CU7A 3BE7A 2W92A 3KCJA 3GC4A 3TA6A 3RRAA 5EMJA 3RX2A 4HNVA 2CKSA 3WH7A 4E38A 1HW6A 3I68A 3HURA 2IXUA 3UQNA 2FHBA 3QMRA 3R94A 2Z1BA 5A95A 2J27A 2R91A 1K4HA 4KERA 1I8JA 5A6MA 1E9IA 2X1TA 3A9IA 2RUSA 2DT2A 4MYAA 1F3WA 3APYA 1DJIA 2QV5A 5D2YA 2X16A 1XGDA 1OD8A 3EOLA 1ELSA 2CBIA 3Q4DA 1CGYA 2BFGA 4TXEA 3QN3A 4DNHA 2OT0A 3GH5A 3J7HA 1LRQA 3GKAA 3VIPA 3IRDA 1Z69A 1EZWA 3GFZA 3BAXA 3TTYA 1DJNA 3TN3A 3LI0A 2VCBA 3W84A 1L6YA 1QHOA 1QK0A 1Q65A 2D20A 4KEZA 7ENLA 3B8SA 1K77A 3FXGA 1EA9C 3E96A 3PNUA 1ITQA 4UNIA 3NVDA 2ZUNA 3WY1A 3CUZA 3OVRA 3GKFA 1AK5A 3TP4A 1DIKA 1TMHA 2VI0A 1V5XA 2XSAA 1Q2RA 3LK6A 1IWBA 5DMLA 2ZUUA 4XD5A 2WDAA 1HN1A 2XVNA 2ZZ1A 2DPEA 4LALA 2H8XA 3OZMA 4PMYA 3G3DA 3AROA 1IXPA 1WPCA 1B0IA 2XH2A 3VNYA 4YNGA 3PUGA 2X7VA 3NQDA 3W1MA 1CB7B 1V6YA 4DBDA 2ZZ7A 4MJZA 2O0TA 1R30A 3H55A 2QGHA 3KBNA 3MDWA 3U57A 3W70A 1B3YA 3SURA 4CVUA 1CGXA 4CNPA 2YLLA 5F4XA 2E8YA 1E6XM 5FF2A 2OX4A 2AL2B 3GTIA 3MSGA 4IXHA 1ZJIA 2FJKA 4HHHA 4INFA 3KL3A 8XIMA 3BPWA 3W00A 4RJEA 1S1PA 2J7GA 5AY7A 3UWWA 5BRBA 4JTLA 3S0CA 2ZUWA 2H9AB 2PZ0A 3MBFA 3HZ3A 1ML1A 2Q8XA 3ITGA 4NAFB 3F1QA 3IGUA 3KBUC 3QZEA 4W7VA 3EBVA 4H2HA 1W37A 3FDKA 3QQWA 1R3SA 3W7JA 4K7YA 2HROA 3IGHX 3WK3A 2F9RA 4NP7A 1EP3A 3PWGA 4H9YA 5ECUA 2O92A 4C7GA 4KRUA 4LY8A 4IJBA 2D2OA 4GQGA 3W6YA 1IV8A 4DZAA 3PBVA 1AW2A 2QPXA 3H22A 3GTXA 1RWGA 1LQAA 4MJMA 4XG1A 1LL4A 2AGTA 2WHKA 2F8QA 4TOQA 1SSGA 1Q6DA 1ESWA 1IEQA 3SQMA 4XD3A 4QEHA 5JBFA 2QIIA 4GQRA 5GVJA 3OPSA 3E1F1 7A3HA 4H7VA 2JALA 1M7PA 5A1AA 2WM1A 3G1SA 5CPMA 3P60A 4LQ1A 4JAWA 1GORA 2WYSA 4ATDA 3WJWA 3E0LA 4D6EA 1LG1A 4P7OA 1TVPA 1TR1A 2E7FA 4WUIA 2Z1WA 3PBMA 1W1IE 1PIFA 2VYOA 3P74A 1R5YA 2A6LA 3SJNA 3W27A 4JFWA 3Q65A 3QLDA 3HPXA 3RX4A 2VXNA 4LB4A 3TZNA 2BVTA 4AF0B 4JYEA 1OGBA 1TJRA 5FL1A 3LPPA 1TIMA 4QS6A 4AB4A 2OZ0A 3LB0A 4XUYA 4O28A 4Y9MA 3GU1A 3I6RA 4JS3A 1QJWA 4NXSA 2PDJA 4WCJA 3WLNA 3QH2A 2XIIA 1P1XA 4N02A 4C6IA 3WF3A 3VIHA 1M3UA 3W07A 1F6PA 1GJPA 1IGSA 2WMHA 1O68A 5REQB 3PQIA 3U2OA 2ISSA 4RW5A 1UKPA 4AZHA 1RUSA 1UQYA 4U2ZA 4CEUC 1V6VA 3FDGA 4F0RA 3WJZA 1LTDA 4Q4RA 1J2BA 2FZ8A 5EB8A 1PS9A 3B97A 2A3AA 3QQ1A 3L4VA 3LEPA 2QMKA 4S23A 3MSYA 3T05A 4CEXC 2NX3A 3ZT6A 1UB3A 3VD4A 2J7HA 3EXRA 1UHVA 2PRLA 1OHLA 3NQ8A 4K2SA 3W24A 3NGJA 4LVFA 3M7SA 2OEJA 3O6AA 1UZ1A 2BLEA 3F7JA 3N2BA 4TX9A 3HMJG 4QFUA 1M7XA 3T7VA 1KFJA 2EKCA 4LV9A 4HOXA 4KT2A 3S5NA 3PTKA 1DJHA 1PZ0A 2AOSA 1UD4A 2BXZA 2QCGA 1ZU8A 1BYAA 5CJNA 3DUGA 1YDYA 1GG0A 1GVRA 1F73A 2GDQA 3UZWA 3NIYA 4K68A 2E22A 1KFBA 5HQMA 1GW1A 3GDBA 4L4MA 3GYCA 3M6YA 4N6FA 3UPWA 1B4KA 4MGGA 1GYLA 3LTSA 5A6LA 3PJUA 1UD5A 4GY7A 1TIWA 3OVQA 2YR1A 2PC4A 3CH0A 1SFJA 2PDHA 1DWJM 1ZZMA 1MVYA 5D9MA 1F8MA 4PEKA 2XG9A 1VH7A 3SCPA 4FS9A 1MDRA 3PPGA 3SBFA 4BWLC 1ODZA 1UD3A 4KCUA 3R58A 4E3TA 1H7NA 4AWTA 1V0MA 1OJMA 1LL6A 3DG3A 5CH9A 4AEOA 5F7UA 2YGYA 3CUHA 3A47A 3AYSA 2VDHA 1RPXA 2VZUA 1JI1A 5JU6A 3CZEA 2ZA1A 4EXQA 1S5MA 1F76A 4PFHA 2A0NA 3RF9A 3DFTA 3DCPA 1J0JA 4Z0JA 5EFDA 1A5OC 3R8GA 1XIBA 3ARPA 4JHMA 1BFNA 1J10A 3OBKA 4UMAA 3R89A 5H2ZA 2D0HA 3PJTA 4NILA 2NT1A 3A3WA 1ZBKA 4M56A 4PEEA 4XIAA 2Y1HA 4RDWA 2CNCA 3R2GA 1JZ2A 4JX4A 4MKNA 1GOOA 4BEQA 3ZLFA 4Q22A 3WDHA 2D22A 1OX6A 4UTTC 4QQ3A 1N2VA 1MUWA 1E4NA 5U7SA 3IJ7A 4DBSA 5A94A 4MWAE 5DY2A 4PMNA 1UKQA 3AMCA 4I6VA 1F6KA 1Q6CA 2I5QA 3L4WA 2Y6ZA 1L6FA 4JTHA 4NIRA 5GJMA 2QF8A 3WG6A 5IBXC 4YLWA 5CCZA 1BWVA 1D8CA 2IKGA 4DI9A 1DHPA 5I23A 1JGMA 3N6JA 1IIGA 2INFA 1NTHA 3LMYA 3R8RA 4GVIA 4UTJA 1TPUA 4GQ0A 3WLIA 1SMDA 4BY3A 3TW6A 3CH9A 2W62A 5A69A 4AD0A 4LUJA 3CAVA 1QBBA 5HNNA 4E3VA 3H70A 1NFPA 5FAJA 1E6ZA 1I2RA 4TTGA 3UGRA 3OLEA 3PSWA 3TMLA 4QS5A 1VEPA 1W5QA 3K5XA 5I06A 5IXEA 4IMFA 1DVJA 3C2YA 2B7QA 1ODUA 2O9OA 3UCDA 5A6SA 3XINA 3ZLGA 4H9TA 1BSLA 4JY9A 1JFXA 3ARXA 3BURA 3HG4A 4QXIA 4YTQA 4Q7BA 3RDKA 4XZHA 2XIJA 3NWRA 1ZAJA 4NVTA 1CWYA 4JL2A 4EPBC 2ZXAA 4AIBA 1OSEA 1FWSA 1KKOA 3SCRA 4R88A 4E0CA 2EO7A 3SAZA 1JCMP 4CD8A 4A35A 3PPFA 2PDMA 1BYCA 2VGFA 3MPGA 5LGXA 1QNVA