4D6IA

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 1 blood group a-tetrasaccharide (e558a l19 mutant)
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
587
structure length
587
Chain Sequence
b'EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYHTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 218
structure length 587
sequence length 587
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d6iA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d6iA01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d6iA02
1OT2A 4JFWA 2PC8A 3AMGA 5A95A 3AICA 2EQDA 5CJ5A 5HPCA 3AZSA 3AFBA 3LPGA 1JDDA 4HU0A 5A1AA 4D1JA 1FOBA 1ITXA 1OJPA 4B15A 3WQ4A 2WHKA 1X1IA 2J8GA 1SMAA 4R27A 1CNVA 3G6MA 1V03A 2G4FA 3ZJ6A 3CHEA 3VGGA 5FCZA 3F4VA 4UNIA 1AVAA 1H0IA 3PN8A 1HMWA 1AQHA 1W3JA 2AAAA 1BHGA 2WHJA 1XH1A 3RM4A 3BSGA 4OKDA 2W67A 4ZE4A 3GZAA 5ABFB 2WDAA 1JDAA 5JUVA 1B2YA 1SYTA 1WZAA 1Z32X 3OBAA 4U5KA 5I23A 2J75A 1TCMA 4MB5A 4NRSA 3WQWA 3BCFA 2XGIA 1OIMA 2CITA 4U33A 4HA4A 2JIWA 3IJ7A 1C8XA 2VL4A 4MTVA 3IJ9A 3IAQA 4HPGA 4Y7EA 5CGMA 1W9BM 3L4YA 4U3AA 4CD7A 5A69A 1UD6A 1UWSA 4W88A 4AZIA 1US3A 3ARUA 2QMJA 1W9XA 1PX4A 1C7TA 1VEPA 3ARZA 4AXNA 2W62A 2IXVA 1W3LA 3WH6A 3WSUA 1JFHA 3CZKA 2CYGA 4ACZA 3UERA 3MUY1 1O7AA 2GFTA 2A3AA 2YIHA 2VO5A 1H0GA 2D0GA 4UQAA 3CTTA 2YJQA 1GVYA 1V0KA 1HKJA 1EQCA 2VNCA 5M3WA 1J9YA 3EDFA 3WMSA 1HVQA 2ZUMA 4MPKA 3UCQA 5GNZA 3VUPA 1M01A 3CGTA 4LPCA 1X6NA 1ECEA 2WHMA 4M82A 3AMKA 3AZTA 3M07A 4PEEA 3RILA 3AS2A 2WPGA 4AY1A 4CVUA 4J3UA 2WCOA 1Q6CA 2PWEA 3VD3A 2WC7A 5I79A 3VMPA 1JD7A 1LWJA 2VX4A 2PI6A 1EDTA 2WWDA 1JYWA 2RGMA 3W28A 3LMYA 3T09A 4W5UA 3TOPA 1HJVA 3AHTA 2ZX5A 1UZ1A 3SCNA 2J4GA 3NDZA 1P6WA 2C0HA 1XD1A 1VFMA 3L4XA 4UFMA 3WBEA 1BFNA 1DHKA 3N18A 3NDYA 1WDPA 3ARPA 5DEZA 1M53A 4RL3A 4PTVA 1VBRA 3WH5A 3FW6A 5BXRA 1CPUA 2BHZA 4U2ZA 2GK1B 3TP4A 4C7FA 4P7NA 3VU2A 4KGJA 2W5FA 2F2HA 3AIVA 3NSNA 1TFVA 4TTUA 3QGVA 4GXPA 3RIKA 2PB1A 3W53A 2EPMX 3OIHA 1MFUA 3VIPA 5IHRA 4JHOA 1W9PA 2XYLA 3LPFA 2WMGA 2ZICA 3HN3A 2WVVB 3GH4A 1J01A 1NOUA 4AD3A 2W92A 4D6JA 4LYPA 3U5YA 1JZ3A 3DHPA 2QMKA 2VRJA 4ACYA 1BYAA 1NWUA 4PUEA 5CG0A 3AXHA 3WFZA 2VZTA 1HVXA 4PTWA 1JDCA 3VGDA 1EO7A 4H41A 2D20A 3WDIA 1VAHA 3OZPA 1CGTA 1JI2A 1EHAA 4PTMA 1KWGA 2J7DA 2EPNA 2VR5A 1GORA 1WDQA 3GDBA 3AS1A 3GXDA 4HTYA 1OGSA 4MNMA 4W8LA 4PRWA 2GDUA 5BYWA 1XHGA 2AMGA 2XWEA 4C7GA 5M5DA 2DT3A 5BXTA 1H3GA 4F9JA 2ZUWA 1HJWA 3UR8A 5KEZA 1J0KA 4K68A 4YPJA 1MQQA 3SCRA 1W2PA 3GXMA 1CENA 2WYSA 3ZO9A 3VDCA 1ISWA 1R87A 1RWFA 2VI0A 4CCEA 3OLGA 1J0NA 5DMYA 3L4WA 4H8VA 4F66A 1OM0A 3AHYA 2DSVA 4BQ3A 4D6HA 1W9DM 2D0FA 3DYOA 4TVDA 3PZTA 3WNNA 4HA3A 1UR8A 3EDKA 3ARQA 3RM9A 3W82A 2YL8A 2JF7A 1E6SM 1W9VA 5A6JA 1V3JA 2NW0A 1RW9A 1VBUA 2XFRA 4HZ6A 2Y24A 2CKRA 1HN1A 1OJOA 1B3VA 1AQ0A 2DSKA 4DWSA 5A3HA 5FIPA 5AC4A 5F7UA 3OLDA 1NWRA 3MUIA 1IZJA 3VIJA 2J7BA 2WB5A 5FL0A 3MO4A 3AYRA 3ZJKA 1V3IA 4KRUA 4XX6A 1QI5A 3AS3A 1GCYA 1WZKA 4C7DA 3VOCA 1FHDA 3POCA 3MV01 3RPMA 4PMDA 3AHZA 5IFPA 4B3KA 4BS0A 1HJUA 2DT0A 4JKMA 2NT1A 2J79A 3SCWA 1LF1A 2WVUA 4D1IA 4QLLA 5E0CA 5AC5A 1J0JA 1C92A 1U30A 5EMYA 3GNPA 3AHXA 1U2YA 2J74A 1B31A 3ALFA 1H2JA 3WF0A 4AD4A 2QPUA 3SUVA 1JNEA 3CMJA 1ISYA 1CZ1A 1HJSA 5C70A 1I1WA 4PSPA 3O9NA 4XUYA 1ZJAA 1ZBCA 1SR0A 1HKIA 3WKZA 4JFSA 1OD8A 4FF5A 5CPSA 2E24A 3MMWA 2XVKA 3M46A 1E70M 2TAAA 4FLQA 4D6GA 2WAGA 2MANA 3T2PA 2UY5A 2XIBA 3BLPX 3SURA 2O92A 4BCEA 3U7VA 4PSRA 1J0IA 4QP0A 3QHOA 1RWAA 1F4AA 3UG3A 5GNYA 3EMQA 2XVPA 1OT1A 3T2OA 2V3GA 4J7RA 2UY3A 3LPOA 1V02A 3CO4A 3VMNA 3QOKA 1E4MM 5JBEA 5CSUA 1JAEA 3QOMA 3NJ3A 1ISVA 3PZMA 1KBBA 1LJYA 4FLOA 4PBGA 2BXYA 3WDQA 2CXGA 4B3LA 2VR4A 6CGTA 1UKQA 1CDGA 1V3LA 3W26A 1XD0A 2Z1SA 1N7PA 3ZOAA 4WLCA 2ZXDA 1MW0A 3LPPA 4JKLA 3OZOA 1GONA 3PZQA 4JAWA 4KRTA 1CECA 1JG9A 1N7RA 1KXVA 4CU7A 2GSJA 3DC0A 1Q4NX 1TUXA 1UWTA 4UFLA 2YLLA 2WMIB 4Z2KA 5I6SA 2VUYA 4UQ9A 5I5RA 2FGLA 1ISZA 2FH6A 2YL6A 1UYQA 1N7OA 3UETA 1GJUA 1UKSA 1WKYA 4H7VA 4OIFA 1OCQA 4Z2HA 4DM1A 1JI1A 4AZBA 1GHRA 1CGUA 1XYFA 1OINA 1E9LA 4UOZA 1JXKA 7A3HA 3OG2A 4OZOA 2Q8XA 2X1IA 4CUCA 1JAKA 4S3KA 3AYSA 3DYMA 1GUVA 1QW9A 2XUCA 5M03A 1DWAM 4ZFMA 1PJ9A 2VQTA 3DYPA 1W32A 3WMCA 4LXFA 2ZE0A 4H04A 3CZLA 3POHA 3VINA 1HL9A 2WLZA 4W8AA 1AQMA 3NSMA 1B3WA 2ESCA 5E6ZA 4AZ6A 4CD8A 4UQEA 2WSKA 3T0AA 1MXDA 1CXIA 1IT0A 3CH9A 3GTNA 4AD0A 2NSXA 3VDAA 1W3HA 3L2MA 3AIQA 3VDBA 1VFOA 4HP5A 1UD5A 4AC1X 2D22A 2GVYA 4GQQA 1R85A 3W25A 1UKPA 1W3KA 1RPKA 1EGUA 1LXMA 3QHMA 2OYLA 1EO5A 2CEQA 3AIEA 1UH3A 1U33A 2YL9A 3CPUA 3I3DA 4MNKA 4AEEA 3NSXA 1V0LA 4ML4A 4P8WA 3PTQA 4TXEA 4W7WA 4YN5A 3ZR5A 3AMDA 1BYCA 3AISA 1ZBVA 3GH7A 3MMUA 4ZENA 3UEQA 4QLJA 2VZUA 3GBDA 3ARVA 2BV9A 1NM9A 2XSBA 3N1AA 4DWSB 4MNLA 4WIWA 3VTRA 4D6EA 3WDPP 5TD4A 4WSJA 2F8QA 1V6YA 1V6UA 4CU6A 2V3DA 1B30A 1GZJA 3CZGA 5GNXA 2A3EA 2WKLA 3SCQA 4S3JA 1UWUA 2FH8A 2CCRA 5C71A 4D6CA 4M8UA 4AD5A 4U31A 3O6AA 1XGZA 4LQ1A 2ZUNA 4MADA 5CPQA 1XH2A 2YBUA 3WQVA 3VGEA 4Z2LA 4IISA 4ZEPA 1UQZA 3FHAA 5BRPA 2BS9A 1GQIA 1VRXA 4H8UA 1HM2A 4W5ZA 3TTSA 2D23A 1QBBA 3OGRA 3FAXA 4U2YA 1QW8A 4XZWA 1CLVA 1CXKA 2OSWA 3CUIA 2ZXQA 1V6XA 3PZOA 4CCCA 3WEZA 4HPHA 4B9ZA 2ZX6A 1E40A 4ZE5A 3VIMA 2QPSA 4J3XA 2DSZA 2DT1A 3WQ8A 2XPKA 1H49A 5HNNA 2DEPA 3MUAA 2PBOA 5E70A 1M03A 3I3BA 5EB8A 4JFVA 3CUJA 3WN6A 1KCKA 5A6KA 1X1HA 3MANA 2BRVX 2CHNA 2ZX7A 2E0PA 1IZKA 1E0VA 4BZYA 3AIUA 4Z2IA 1UWQA 3T0BA 3A47A 1LL6A 2QF8A 2J7EA 2V5CA 4QAWA 4CCDA 4PMUA 1TA3B 3WDRA 3VIFA 1BLIA 1E3XA 2EO7A 1C90A 1EGZA 1MW1A 1KCLA 3QHNA 1A3HA 2CERA 1Q6EA 1MQRA 4L4OA 4YHGA 4ZXOA 1EOMA 3W38A 1LOHA 3VIGA 1GQKA 3M7SA 1QNSA 2J62A 3AMCA 3GH5A 4KH2A 4MJ4A 2DQXA 1EHNA 2ZIDA 2B31A 3N9KA 3W24A 4W85A 1H5VA 2WMJA 1HNYA 1RWCA 3WF3A 1K9EA 3AOFA 3PTKA 1BVZA 3W81A 1WDRA 3VX0A 3AZRA 3APGA 1GHSA 2VMFA 1UD8A 1EDQA 4Q22A 4M80A 1EQPA 1E6QM 3ZT6A 1NP0A 4PYSA 8A3HA 3WD1A 2BVTA 2GUYA 4JFUA 4X9YA 3K8KA 3VIKA 1MWOA 4D71A 2X03A 3O2LA 1XYZA 5AY7A 5AYIA 5BRQA 3VD9A 2G3IA 1BG9A 5D9MA 4J3TA 4TX8A 3II1A 1GOOA 2CESA 2G8ZA 3PZNA 3BC9A 4PMRA 2BRPA 4Q7NA 2WM0A 4ATWA 4MB3A 4M81A 4AWEA 3VMOA 1Y7VA 2OWXA 4BQ4A 1R7OA 4JCMA 3MMDA 3HJEA 1W2VA 2O9RA 3VIIA 5A6AA 2VCCA 5CSYA 2G3NA 1Q6GA 4KGLA 3W6LA 3BMWA 4NF7A 4WF7A 1DWGM 3SCSA 3ZQ9A 5DO8A 1EA9C 3ZMRA 4Z2JA 2ZXBA 2X0YA 5E09A 2FHBA 1M04A 3D3AA 1JZ7A 3N12A 1PX8A 1NOWA 4AZHA 1E6ZA 1JFXA 1DEDA 2VRQA 1GOWA 3WEOA 5I3DA 4DUXA 3KL3A 1CGVA 1C7SA 5I0DA 4DWSD 1E6XM 5FL1A 1KGWA 2VX5A 3CHFA 4A4AA 2YL5A 2DIJA 5ABGA 3BGAA 4PMZA 5JIPA 1PAMA 3SUTA 1V08A 3W37A 3GYCA 5M17A 4IPLA 5E0FA 2OWCA 5JBFA 1QVBA 4M29A 1JZ4A 1OSEA 2WMIA 2EBNA 1QNPA 2CBUA 2EJ1A 1G1YA 1F4HA 5EFFA 2J7FA 1SMDA 2VC9A 3ARXA 4AIEA 1GQJA 4D72A 2YDRA 1XV8A 5C8BB 3ZJ7A 4IUGA 3WNKA 4W8BA 1J0YA 3WQ5A 1CWYA 1ZS2A 4J28A 1E56A 4URIA 3L4TA 2J7HA 1XRVA 4IPNB 3MS8A 2D2OA 3N15A 1W1PA 1V6WA 1VFFA 1HT6A 1YQ2A 6TAAA 1PEZA 5E6YA 5E9AA 4E4PA 4UFKA 3BAKA 4J3VA 3F5KA 3GNOA 3CBWA 1E6RA 4DUWA 4D6DA 4EANA 1BGGA 2JF6A 4UOQA 1GNXA 2O9PA 2J7CA 3M6DA 4UQBA 1FP9A 4KMQA 1WO2A 1RWGA 2Y5EA 3VIHA 3IJ8A 1GVIA 1K9TA 5ECUA 3F5JA 3W27A 3TTYA 4DM2A 1G94A 1NARA 1C8QA 2WW5A 3FN9A 1GOQA 3MKKA 5DT7A 3VM7A 1JNDA 3GXFA 4TX6A 1J12A 3K8MA 1MW3A 1B3YA 2D0HA 1CGWA 1E1FA 5BXSA 2E4TA 2OYMA 1R86A 2D3LA 4CN1A 3ARYA 4GO9A 1Q6DA 4CN4A 1N7NA 4L4PA 3U5UA 5DF0A 3AMLA 1ESWA 3SUUA 3AJ7A 3DECA 4CD5A 5A6SA 1E43A 2CBJA 2VOTA 1ZU8A 3VKKA 1OWQA 4W87A 2WCAA 3WD2A 1TE1A 1KFWA 3UESA 4HOWA 3N13A 2ZUVA 4EKJA 1C3FA 1F9GA 1LG2A 1I75A 4P7QA 2CBVA 2CPUA 2VT0A 1H11A 1QI4A 3CLWA 1HJXA 1HJQA 4NI3A 1JXJA 1W91A 1EH9A 1PZ3A 4QLKA 2GJRA 1BTCA 4WKHA 2XVGA 3AQUA 2EPKX 4GPNA 4PMNA 4P7LA 1US2A 4D6IA 3PHAA 3VD4A 2XSAA 3WY1A 5A8OA 3WNLA 4FLRA 5HBFA 3SEPA 1KQZA 3CZ8A 3OGSA 5A2BA 4ATDA 2V38A 1NOFA 3EMZA 4TOQA 2D1ZA 1UR4A 4JL1A 4W84A 4NRRA 5BROA 2UY4A 5D9PA 3A4XA 3HU7A 1B1YA 1ODZA 4LYRA 1S46A 5GQBA 2BFGA 4CVWA 3WF2A 4TUFA 2E9MA 2ZXAA 3W4RA 4M24A 5D8WA 5LA2A 1XCXA 3TTQA 1E4NA 1B3ZA 1LQ0A 1W1TA 1V0MA 3CZEA 5JBDA 4J3SA 3ARWA 1VF8A 3CMGA 2Q1FA 2ZX9A 1TA3A 2UY2A 4PN2A 3K4AA 2YA0A 1B3XA 3WNOA 3UG4A 4B9YA 2ZOXA 1FH8A 1VEOA 1XSJA 4GI6A 3T0DA 4MAZA 2EPOA 1JGIA 5CZKA 2Z1KA 4BF7A 1OJNA 4GIAA 2W66A 3BSHA 2XM1A 1QI3A 1PPIA 1QHZA 1E5JA 2YDQA 1QOXA 3WUGA 1JIBA 2HISA 2RGLA 1JF6A 5A8MA 1F1SA 3L4VA 2V3FA 4X0VA 2V3EA 3THDA 2F61A 4U3CA 2WMKA 3GM8A 1B9ZA 1HXJA 3ECQA 1J0ZA 1HIZA 2E8ZA 2Y8VA 2DPEA 2XM2A 4UOJA 2OLHA 4EE9A 1LWHA 3AIWA 1RP8A 2HVMA 2BHUA 4OJYA 2VTFA 1KR0A 4QCFA 1WDSA 1B90A 4P7OA 4CKQA 1EDGA 2CKSA 1UUQA 2Y2WA 3A6OA 2XG9A 3ARSA 3NUKA 4JL2A 5I77A 2WZEA 4OOUA 1D7FA 5CLWA 2WMFA 4V28A 1E4LA 2XWDA 1BPLB 1CLXA 1Q6FA 9CGTA 3THCA 4TVCA 3EYPA 1XSKA 8CGTA 3SUWA 3KL5A 1JZ5A 4E8CA 4CD6A 1BAGA 1ISXA 5EFDA 2NT0A 5I24A 2J7GA 2W63A 5HPOA 3TTOA 2X0HA 3GXIA 1X1JA 3VGHA 3B9DA 3SCTA 1H4PA 2A3CA 4FMVA 3K8LA 2W61A 5LA1A 3NIYA 1BVNP 1H41A 4HMCA 3VM5A 4ATLA 5A6LA 4V27A 4Z2GA 4MB4A 4W93A 4JFTA 2BHYA 1LL7A 1OIFA 1JYXA 1BYDA 5BXPA 2OSYA 2E9BA 5A6MA 2IUZA 3BCDA 1N82A 3SCOA 2ZWZA 4E2OA 1CXFA 3WF1A 5LA0A 1UKTA 1TVNA 4MNJA 3ZM8A 2DSUA 1HP4A 3S6TA 2VVSA 1DWHM 3E1F1 4P8XA 1O6IA 3WBAA 4D6FA 4P7RA 3EBVA 4W86A 4MDPA 2JALA 2G41A 3ALGA 5GPRA 3FNDA 4J3WA 4CGTA 2VX6A 1X1NA 1UWRA 4F79A 3SCUA 2J78A 1J10A 4UFHA 1CGYA 3OLIA 1E3ZA 2WLYA 1NWSA 1E5NA 1K6AA 4QFUA 3VVGA 3NCOA 4UTFA 3ZSSA 2X05A 5A8NA 1UH4A 1NP2A 3CZJA 3L4ZA 5DFAA 2Y8KA 2XTKA 2A3BA 2PWGA 2XVNA 1VFUA 2XVLA 2O9TA 1UH2A 1BGAA 1UKOA 1JYVA 4EAMA 1BSIA 1BYBA 5CQ1A 2CHOA 4HU8A 1DWIM 2YDSA 4MJ2A 3EDJA 2WWCA 1R7AA 4UFIA 2BY3A 1UD3A 2VZOA 3A4WA 5IXEA 5A2CA 1ODUA 1JF5A 3WD4A 1QI0A 2J47A 4FK9A 2OYKA 1UR0A 5ABHA 1QNQA 1FFRA 1ZB5A 3PZ9A 3WDJA 5A8PA 2WVSA 2BVDA 3RM8A 4HOXA 1C82A 1TG7A 2OWWA 1MXGA 4AZ7A 2JFEX 1UOKA 5JIWA 1HN0A 2ZUTA 1PBGA 5A2AA 4GI8A 1CB8A 5HXMA 2CNCA 1UZ4A 1DWJM 1CYGA 1XCWA 2VCBA 4YHEA 1GPFA 2BRWA 3SCVA 4CU8A 4HZ7A 4OBSA 2D24A 2WBKA 3U57A 1LXKA 2BNJA 2YKKA 3PZVA 2D3NA 4W89A 2Y4SA 1J0HA 2J8FA 4PMXA 5D9OA 2PWHA 1TMQA 4HOZA 4UZSA 1X6LA 3VILA 1XC6A 3VDHA 1KXQA 3WQ6A 4BA0A 3S2CA 1OD0A 1VIWA 3BAWA 3WH7A 2GJPA 2PF0A 3WL0A 4QDMA 1RH9A 2WANA 3UG5A 1G5AA 4P8UA 3SIMA 4AZ5A 1WNOA 1KGXA 4KWUA 3AI0A 2PWDA 1N7QA 3K4DA 1H09A 1W3YA 3D5HA 1BF2A 4UCFA 2WBGA 4R5EA 3SCPA 3BAIA 4AZCA 2BY0A 5IHSA 3FAWA 1EXPA 3VGBA 1TR1A 2X2YA 3EDDA 1NH6A 4AMCA 5HDRA 3J7HA 4UFJA 4X0NA 5A8QA 3WF4A 1VJSA 4AISA 1GOMA 4XZBA 1JZ6A 1E6PA 3EMCA 3WNPA 3BAJA 3WDHA 4CD4A 1G0CA 1DWFM 1PZ2A 2EXOA 5CGTA 4OBRA 4ZXLA 2XFFA 3AIRA 5IDIA 1EOKA 2FHCA 1VEMA 4XV0A 5BWFA 2WVTA 1H1NA 1I1XA 2WC4A 2V5DA 3N04A 1QNOA 1WE5A 2WSPA 2DH2A 4P8VA 5A6BD 1K9DA 1A47A 4GO8A 1FHLA 4MAVA 2X09A 1HMUA 1NWTA 1OGBA 5A94A 1AMYA 1L8NA 3MU7A 3F5LA 4OOZA 1UG6A 1YHTA 3N11A 4AEFA 1GOKA 3U7BA 3KEHA 1WP6A 1B0IA 1BG4A 4LYQA 3CUFA 4CN6A 1V3KA 2FGZA 1C8YA 1ITCA 4IM4A 2YA2A 2WCGA 1WZLA 3FHQA 1KXTA 2A3HA 1HX0A 4UQCA 1UR9A 3WNMA 3W6MA 2VQUA 1OGGA 1LG1A 1E0WA 1TZ7A 4UR9A 1E4IA 1VB9A 3VGFA 1KBKA 3BH4A 1V3MA 2VZSA 4DUVA 1OJMA 4U5IA 1KXHA 3BMVA 4BQ2A 2E40A 3VNYA 4E8DA 1GOIA 4MDOA 2WNWA 2IXUA 5FKYA 3WH9A 1LL4A 1NQ6A 2ZUSA 1DP0A 5CPTA 3RMEA 1R8LA 4NSBA 1MW2A 3WIJA 4GI9A 1HM3A 2DSWA 3CHDA 3EDEA 3ZJ8A 2GDVA 3AHVA 1HL8A 3WFLA 2ZWYA 4W7VA 4GKLA 4BQ5A 1OBAA 1G9HA 4LX4A 3RDKA 2BVYA 4RE3A 1MQPA 4LGXA 3I3EA 1EIBA 1W1YA 1C93A 1KWKA 5A6BA 3AXIA 2BY1A 2YOCA 1J0MA 5BCAA 3L4UA 3B9AA 3PBGA 1MYRA 2WMHA 1FH7A 3IAPA 3IANA 1QNRA 1E0XA 3VD7A 1FH9A 1JL8A 2XGBA 3KL0A 1CIUA 4WJXA 4TVUA 3OGVA 3WD0A 4FLSA 1XH0A 2VRKA 2UWFA 1UA7A 4PCSA 3PTMA 2E8YA 1W9UA 1UD4A 2E3ZA 2WXDM 1QHPA 4M56A 4PMOA 1HP5A 3SUSA 1KGUA 2BY2A 1UQYA 1L0PA 2YA1A 1E55A 1V02E 3MUZ1 4B16A 2DIEA 2DGAA 1PIGA 5FD0A 4N42A 4AIOA 1FA2A 1HF6A 3VNZA 2GJXA 1V6VA 2O9OA 2ZX8A 3KWXA 4ACZB 2YBTA 3ZT5A 3FY1A 3VPLA 2XFYA 3ZIZA 1UA3A 4WSKA 3BXWA 4QCEA 2EPLX 2J25A 1CBGA 1ZBWA 2OSXA 2WC3A 4AZCB 5I78A 3CUHA 3CIVA 3RO8A 1ZL1A 4A3HA 1QBAA 5ABEA 4JIEA 3ARTA 4AYSA 2DT2A 2QV4A 1BQCA 1E15A 4W7UA 2C8NA 1D2KA 3T08A 3WENA 3K46A 1QPKA 4F8XA 4M1RA 4AD2A 2WCSA 3PZUA 1MFVA 4V2XA 3WUEA 3A4AA 3ARRA 2XJ7A 2QHAA 4H8HA 1E6NA 5IFTA 3IK2A 2FDMA 5FOOA 3DHUA 3HMCA 2FHFA 1E72M 1GJWA 1XSIA 3TONA 2VJXA 4UQDA 3NYDA 4DWSC 2AOSA 3PZIA 3GNRA 5ABFA 4JZ5A 3CUGA 5EBAA 1UWIA 3WH8A 5I2UA 1V3HA 2XHYA 2VX7A 4MB1A 4GQRA 1E73M 4JHZA 1UR2A 4PCTA 1J11A 1K9FA 1IV8A 4J27A 2E9LA 3WL1A 2WZHA 2PWFA 3BAYA 1WAWA 3AS0A 1HKKA 4PMVA 4F9DA 3VO0A 1C91A 3WMBA 1KQYA 2W4XA 3AXXA 2JEQA 3CHCA 4GZIA 4AW7A 3WD3A 2CIPA 3G6LA 3B9EA 2VURA 3GBEA 1VJZA 2J77A 1ZBKA 4WKAA 5LYRA 1TVPA 3UR7A 3RCNA 3VD5A 1WPCA 1OB0A 3WUFA 4AD1A 1HKMA 1KR1A 2W91A 4WK9A 3L2LA 1J18A 3WEMA 1D3CA 3FXYA 3B8SA 2VCAA 5AYBA 1I8QA 1GQLA 2EEXA 1MVYA 5D8ZA 2WKGA 3RJYA 3PZGA 4GINA 2VVNA 3MV11 4PMQA 2X8RA 4AZGA 1CTNA 3QR3A 1RWHA 5KZ6A 1GW1A 4HMEA 4A3YA 4HA1A 1UHVA 2VZVA 4PUDA 5CXPA 4PTXA 4HZ8A 3VIOA 3BAXA 1JZ2A 1CXHA 2QLYA 1LLOA 2BXZA 4N0RA 1UD2A 4TTGA 7CGTA 3T2QA 3OA5A 1V0NA 3ZR6A 3WUBA 3WELA 2E22A 1VENA 1CXEA 3OLEA 1RD6A 1DTUA 1QI2A 1W1VA 5D4YA 4H2CA 7TAAA 4GZEA 2WK2A 5HOSA 2G3MA 4JCLA 1M7XA 3W29A 3BLKA 5D9NA 1JD9A 5CLTA 1WB0A 4HMDA 4JKKA 3OB8A 3W0KA 2WZIA 2WHLA 3KZSA 2GK1A 3MSDA 2PBGA 3JUGA 4AIUA 1E71M 1CGXA 4WKFA 3ZSTA 3A3HA 1JYNA 2YLAA 3KE0A 3AROA 2C7FA 1CEOA 1SFSA 1PIFA 1QHOA 4OUEA 4UZUA 3ZT7A 2JEPA 4XB3A 2G3JA 3RJXA 1FP8A 1ZJBA 1KB3A 2JE8A 2XIIA 2DH3A 2DDXA 3N17A 1RP9A 1E1EA 3AIBA 2CBIA 1FFQA 3K1DA 1JZ8A 4EK7A 2WVVA 3MSGA 4RE2A 4RE4A 3TA9A 2GJXB 6A3HA 2ZUUA 3VX1A 1CXLA 1G01A 2CETA 1UR1A 2JIEA 1PX3A 1WCGA 4GZJA 4NZCA 5DT5A 4PMYA 1WZMA
chains in the Genus database with same CATH superfamily
3PUGA 1IR2A 4ERGA 1OT2A 3ANVA 3HG5A 3AMGA 1P4CA 2IKJA 1H1ZA 2FIQA 3IJQA 3LPGA 4D1JA 1FOBA 3QF0A 4TMBA 4B15A 3LCXA 3Q4DA 2WHKA 2OOGA 2OZ8A 4NG3A 2XH7A 2ISDA 3FA5A 2DW6A 1RBLA 3NAVA 5FCZA 1O5RA 4UNIA 3KBJA 3PN8A 1HMWA 1W3JA 3SQLA 3EB4A 1BHGA 1AW1A 4IJBA 3TOYA 3RM4A 4IPJA 2W67A 4DJFA 3L2IA 3STCA 4DO4A 1SSDA 1B2YA 3UJEA 1SYTA 1WZAA 1Z32X 1GGOA 4DZ5A 3S5SA 2J75A 3VE7A 5LNRA 3DKJA 2CITA 2JIWA 2RDWA 2VL4A 3IJ9A 2OX1A 2FZDA 3FYOA 3KBSA 4HPGA 4KT2A 1XRFA 3HFYA 3OOQA 3UW6A 3XISA 4WQ6A 1TJ2A 3UZXA 2YYTA 3LSCA 3S42A 4LNYA 4UTUA 3CYVA 3E2RA 4AXNA 1LOSA 2WOQA 5CC3A 4WJEA 4PFHA 1AL8A 3WH6A 4ACZA 4NX5A 3RN6A 4Z0SA 2GFTA 3RK8A 1H0GA 3M5VA 2EF9A 1L8PA 3OVRA 2EJAA 2GSEA 2VNCA 1DJIA 1J9YA 5CPMA 3O6CA 4ZOEA 1J4EA 5D33A 1TWSA 3ZWTA 4Q4MA 5TIMA 5E5CA 3GUWA 3GSMA 1ECEA 2WHMA 4TO8A 3A5FA 1O0SA 2YCLB 1G4TA 3CB8A 5BMWA 2PWEA 4DAIA 3VKAA 3CQJA 1QPNA 4S2BA 2WWDA 2FZNA 1JYWA 4I9TA 3RLHA 3TN6A 2E1WA 1HJVA 2ZX5A 2ZZ7A 3HO8A 2XFWA 3EWYA 2FZ8A 1P6WA 3WBEA 4Q4OA 5DEZA 1WDPA 3SRDA 3CHVA 4GUHA 1CPUA 2BHZA 3BW3A 3TP4A 3N2OA 2I9EA 2W5FA 3AIVA 3NSNA 4TTUA 3PAOA 4MUZA 4L9ZA 3NQMA 1OYCA 2CLFA 3OVGA 4WJ8A 2PB1A 3CLMA 4NAFB 2FZ9A 3PUEA 2C91A 3PAJA 3KTXA 2XYLA 2XU2A 2DVUA 3GXNA 2DZSA 4MHBA 1LCOA 1NOUA 3B03A 3U5YA 2QMKA 2VRJA 4ACYA 1EJTC 5I03A 4DB7A 1G7VA 2VZTA 4PTWA 1SZFA 4A8NA 4DN1A 1QJWA 1S38A 2D20A 1X7IA 5FI8A 1S2VA 3MUXA 1GORA 1NDZA 3SGGA 4J35A 3GDBA 3W72A 3GXDA 4W8LA 5BYWA 4PRWA 5DANA 4C7GA 5M5DA 2P53A 5BXTA 1H3GA 1W1IE 1B4EA 1UIOA 3KCJA 1HJWA 3MBFA 1J0KA 4YPJA 1DPMA 1YDOA 1VBJA 3RITA 1SJDA 3TU9A 3DFPA 3DFHA 2WYSA 3VDCA 3S3GA 2O0TA 3G1VA 5DBUA 2DP3A 1FBAA 4DLFA 1VC4A 4O0KA 1RWFA 4OECA 3OLGA 4H8VA 1QWKA 1OM0A 3OBKA 4GY7A 4BQ3A 1JCYA 2D0FA 3DYOA 4AQLA 1ELSA 3MP4A 1Z41A 3W82A 3RUBL 1E6SM 1W9VA 1V3JA 1VBUA 4QISA 1HN1A 4N6FA 3GQYA 3OBEA 2A1YA 3MZ2A 1OJOA 3UVIA 1AQ0A 1X8CA 3OVQA 3SSZA 5FIPA 1TTQA 3MUIA 2IS7A 1TV8A 3C6CA 3TMQA 5K3VA 2WB5A 2X1TA 3MO4A 3ZJKA 3L5LA 2B7NA 4LEFA 1GCYA 4LU0A 1WZKA 4C7DA 4YVVA 1JPKA 3MYOA 1FHDA 3RPMA 1M3UA 3TSBA 3AHZA 4B3KA 2VEIA 4BS0A 2J6XA 2DT0A 4RDZA 2VC5A 4GYKA 4IG2B 3FYYA 1LF1A 4QLLA 5PTDA 1J0JA 5H8MA 4FX6M 5EMYA 3APTA 4JEJA 3GNPA 4WOQA 4JYEA 1IF2A 1KNWA 4OUIA 4A2SA 3ABOA 4AD4A 2QPUA 1ISYA 1HJSA 4QNEA 4NUWA 1F7BA 2R94A 1OD8A 1J93A 3NQDA 2Z6JA 4ZSUA 1P7TB 3LI1A 4D6GA 3CAVA 3T2PA 4AUBA 5TQLA 3GFXA 4BCEA 3U7VA 3M6YA 2ABAA 3CQIA 1W56A 5BNKA 2XGZA 4US6A 2V3GA 4J7RA 3LPOA 1XM3A 1E4MM 1X1ZA 1KBBA 1LJYA 4FALA 3B0VC 1R6WA 2VR4A 6CGTA 2QGHA 3W26A 1JRCA 3FDKA 3A9BA 4PUJA 4GUJA 5EA9A 1KFLA 4MFEA 2YBVA 4JKLA 5M1TA 3CS2A 1ZP4A 1GONA 2YCEA 3MPGA 2VGIA 2F6UA 1JG9A 1HZYA 2XIJA 1US0A 3IJLA 1KXVA 2ISFA 1AD4A 4CU7A 1Q5MA 3M0MA 3ITOA 1TPC1 3K5XA 2WQDA 2FB2A 3H54A 4C5ZA 3LCIA 3EGJA 2PD9A 1UKSA 4H7VA 4OIFA 4DNMA 2PWVA 1CGUA 2PLKA 1OINA 4UOZA 4UTHA 1DXFA 4YTTA 1JAKA 3P0WA 4JQAA 3AYSA 2FTYA 4HK6A 1XPYA 3H22A 5M03A 4JNZA 3A64A 1DWAM 4KWOA 2VQTA 3DYPA 1W32A 2JQXA 3WMCA 4UTIA 1LDCA 3POHA 3VINA 2WLZA 2WZMA 3NSMA 4ZQCA 2RDUA 4LW7A 1RCOB 4FEZA 2VEMA 2WSKA 1MXDA 3CH9A 2NSXA 4AMAA 1QOPA 4U4MA 4GQQA 4LALA 3SRHA 3KRBA 5I3HA 2NV1A 1JULA 2CEQA 1EEXA 1UH3A 3I3DA 1SJAA 3VDGA 3ZR5A 1EFZA 1UBSA 3UEQA 1FWGC 3ARVA 2BV9A 4NAFA 1NM9A 1RQEA 1Z42A 2INFA 4JIIX 3VTRA 3MB9A 2VUNA 3M47A 4JQ3A 1P0KA 5EU9A 2F8QA 1WYIA 4QG6A 1V6UA 3TC3A 1FWJC 3CZGA 3GVRA 4FS9A 5GNXA 1L2UA 4OV4A 2ZQ0A 3DFYA 2HS6A 4XZIA 3S2JA 3URAA 1W0MA 4ZQRA 3U2OA 3LTYA 4DI9A 1DJHA 4Q8VA 3T44A 4H01A 4U10A 3SFWA 1QFEA 4Q33A 2PZNA 4UBPC 3ITCA 3EOSA 4RDYA 1VP5A 2B0MA 1XW8A 5BRPA 2BS9A 1GQIA 4W5ZA 1HM2A 3TTSA 2D23A 2R6OA 3F2DA 3TR2A 1VCFA 1JPMA 4O8AA 1U5JA 1CLVA 1YE4A 4MWAE 3CJPA 1JCLA 1GZGA 3KWSA 2ZX6A 3IT4B 2VFDA 1EYWA 2HDJA 1J6OA 3OW1A 3WQ8A 3TK7A 2C14A 3G3DA 3MUAA 4YCOA 5EY5A 3EOLA 4UTLA 3QM3A 1XUZA 4JFVA 5G4EA 3WN6A 3IUIA 5A6KA 5FJRA 5DN1A 1X1HA 4A22A 1E0VA 4O18A 1OFDA 4BZYA 4QS5A 4AWSA 3AIUA 6TIMA 2PDCA 1UWQA 3T0BA 3W7DA 4HT3A 1KC7A 2V5CA 4G1KA 2HJPA 2HPIA 4EF9A 1QNVA 1E3XA 4O1BA 4XZHA 1RK5A 4O0QA 2ATMA 6XIAA 1I4NA 1Q63A 1YNYA 2CERA 1S3TC 3PULA 1MQRA 1CT5A 2ISWA 3GTFA 1WXJA 3TYUA 4UXDA 4P61A 1EOMA 4KWWA 1EC9A 3IPWA 1GQKA 3PWIA 1TELA 4C6OA 2R14A 3GH5A 4KH2A 4WX2A 2AL1A 4C65A 3ATYA 3GDMA 3TQVA 2P5NA 3RLUA 2QUTA 1K9EA 3AOFA 4RV8A 1L6YA 2ON3A 2VHLA 2YEPF 4JN8A 2XH0A 1EGMA 2OGJA 3W1TA 4MFDA 1Z8AA 1EQPA 3JZEA 3LXCA 1Y5VA 3CEPA 3WD1A 2BVTA 3WQGA 2YW3A 4HA0A 3VIKA 1MWOA 2X03A 2Z25A 5BRQA 1FDJA 1A5MC 4TX8A 3CM4A 2FYMA 4C90A 1GOOA 3M41A 4R7WA 1A53A 3BC9A 2F7FA 3PZNA 3MDWA 4PMRA 1VCVA 3W74A 3QSRA 1Y7VA 3OPSA 2I16A 4WXYA 4MMWA 4GC3A 3OEXA 1VRDA 3MMDA 1QRQA 4QX4A 4RW3A 2A7RA 3QFWA 1AG1O 4M19A 1Q6GA 1IWAA 3BMWA 4NF7A 1B57A 5KZMA 3MKVA 3DX5A 3N73A 3FX4A 2H8ZA 2ZXBA 3W7EA 2BG5A 1O1HA 4LVBA 5E09A 4LAMA 3GC4A 2FHBA 1M04A 3D3AA 1JZ7A 1PX8A 4LB4A 4JXCA 4AAJA 4G7EB 3WEOA 3CK5A 2JGQA 1J8VA 5I0DA 4IMEA 4DWSD 1KGWA 3CHFA 3VFLA 2GOKA 4IIDA 5ABGA 1XIIA 2B4GA 4H6RA 4HYWA 4PMZA 2WJZA 3UXKA 5JIPA 1EBHA 1PAMA 3HQOA 1P48A 1V08A 1QUMA 4XIAA 3SQSA 5K7JA 3R2GA 1GVFA 1OADA 1TQXA 1UUOA 2EBNA 5HATA 1KKOA 2EJ1A 2J7FA 1SMDA 1QO5A 1OX6A 4RZ4A 3U6WA 1O5XA 1YDYA 1JQVA 4NJIA 3Q37A 2PDPA 3MT1A 3OU8A 4D72A 3QXBA 4JQ4A 4H1ZA 4NZ3A 5F1VA 4DUOA 5XINA 2MUCA 2CU0A 4D8ZA 4IPNB 2R9RA 3N15A 2EAWA 3WLSA 3DI0A 4HHMA 1V6WA 1PEZA 4UFKA 4JTCA 5IM51 4J3VA 3M16A 1F07A 2EG7A 3NZ1A 3LHUA 4INFA 1I9CB 4KESA 5DX7A 2O9PA 4EF8A 4O16A 4S39A 1PZ0A 1FP9A 4GUIA 4KPLA 4Q4KA 2Y8UA 2Y89A 3LV5A 2P0IA 3QC3A 4DM2A 3TTYA 1BWLA 5AVHA 3O16A 1FQ0A 1C8QA 1TWDA 4RCXA 4IL2A 5F2LA 2OGYA 2Q8ZA 3BJFA 1GVQA 2ZZ1A 3MKKA 7ODCA 3QQ0A 3LENA 4EP8C 3K8MA 1K70A 2WKJA 1E1FA 5BXSA 2E4TA 2OYMA 4UTKA 5CAHA 4JTKA 5HWNA 1IEXA 1K8YA 1BXNA 2PA6A 3U5UA 3G0XA 1VH7A 4GLEA 4QG8A 4PUNA 2QNEA 5HJYA 4L65A 3VKKA 3C56A 2A0NA 4GQGA 1GG1A 4HOWA 2XH2A 1RQHA 1C3FA 1UJQA 3PBWA 1LG2A 4JTDA 4P7QA 3PG9A 3S5YA 5U7SA 3BOXA 3KBNA 1W91A 2OQLA 3S46A 1BTCA 3CV6A 5G2IA 1RUSA 1JDEA 4EPBC 2XVGA 2EPKX 4EPDC 4IOTA 4P7LA 1CI1A 1SM9A 1DL3A 3WY1A 4D8OA 3GKAA 2R1LA 5CKSA 2XZ7A 1KQZA 3CZ8A 1TIWA 4ATDA 2VYOA 1NOFA 3DBNA 3GNDA 5LZLA 3DXIA 3LLFA 2V6AA 1G67A 3A4XA 2FPYA 1S46A 1F76A 2BFGA 4HYRA 5EMJA 3TUUA 5A8GA 4TUFA 2IPJA 1W3NA 4PCPA 4QJ5B 4QS6A 4M24A 1OK6A 1E4NA 4POCA 4Y2WA 3HG3A 3W88A 3O3RA 1V0MA 2HXTA 4FXJA 3T8LA 4GVGA 2G0WA 2NUYA 3EA3A 4HZMA 3E3HA 3OQEA 1EX5A 4BWLA 1XDMA 1A5NC 4ZBCA 1KKRA 4PUWA 4C6CA 2UY2A 1B3XA 1UUMA 3WNOA 5CSRA 3NM3A 1POJA 2NUWA 1D8CA 4L5ZA 3TCSA 4GIAA 3BSHA 3GVGA 4UR7A 2X7WA 4JTQA 5AC7A 1PXGA 1RSCA 2HISA 8XIMA 1JF6A 4L6OA 2YYUA 4JBRA 4B5NA 3TN3A 4X0VA 2V3EA 3THDA 2PDBA 2F61A 5F4WA 3W1RA 3GRIA 4XAGA 1HXJA 3ECQA 1ZCOA 2E8ZA 1PE1A 4UOJA 3FGCB 1VYSX 2HVMA 1KR0A 2ZZ3A 4P7OA 1EDGA 3R11A 5D2VA 2WJDA 2XG9A 3ARSA 4JL2A 2WMFA 1E4LA 2XWDA 5FF7A 2VELA 2G95A 4TVCA 2ZZ6A 4R53A 8XIAA 4F40A 4LY4A 3UXIA 4HTBA 8CGTA 2W6RA 3KL5A 4E8CA 1BAGA 1QK0A 5HPOA 1E9IA 5CG7A 3SCTA 1H4PA 1Q65A 4PE8A 4O4WA 5LA1A 1H41A 4RDVA 4HMCA 1ME9A 4YS1A 4ADUA 3VM5A 4ATLA 2HCVA 1AFSA 5A6LA 4V27A 1EWDA 3HV9A 4DPQA 1XBVA 4MB4A 2BHYA 4L7ZA 1BYDA 4G7EA 3UCCA 3HPAA 3SCOA 1X7FA 3R89A 1G4SA 1REQA 2AQWA 5LA0A 3ZLFA 1TVNA 4MNJA 1BSLA 4BHYA 4B3ZA 1DQWA 1K7FA 1O6IA 3QMRA 5TAOA 3EBVA 3KTCA 2DV0A 2Z29A 2R82A 5DELA 4CGTA 4K37A 3PFMA 4H7CA 1UWRA 4F79A 3SCUA 3UYCA 3VNJA 1D9EA 1EPXA 3EPOA 3W85A 3MSRA 3M5YA 1EZ2A 1E5NA 1WBHA 1YNQA 3GU9A 4QFUA 4UTFA 5C54A 2X05A 1NP2A 3C8NA 2XTKA 4XD4A 3PVFA 4E38A 1BGAA 4D8AA 1IXNA 1DJNA 4LF1A 5LIUX 2CHOA 4XTIA 1TTJA 1DWIM 2YDSA 2J9ZA 2INEA 4Q7BA 5C9WA 4KW2A 4MGGA 3TWAA 4HPJA 3A4WA 5IXEA 1ODUA 3VA8A 1LRTA 1PKLA 3WD4A 2HBXA 4J2MA 2QT3A 1ZB5A 3QGAC 3BURA 3NXFA 1C82A 1KFKA 3EWCA 2ALRA 2VOMA 1Z69A 3PPGA 1UOKA 3FFSA 1HN0A 4ZSTA 4IX2A 5A2AA 4GI8A 3P6LA 3W2NA 2BX7A 1VS1A 5HXMA 4DZAA 5KZEA 3GS6A 4IQDA 4L6DA 3TMLA 3B8IA 5D2WA 4HNOA 1DBTA 2VCBA 4YHEA 4S3GA 5JU6A 3K1GA 2YKKA 3L0GA 4JY8A 3IIPA 4NNAA 2Y4SA 2I56A 5D9OA 2W3ZA 2Z0IA 3L65A 1X6LA 1LT7A 4XAZA 1XC6A 3OIXA 2NQ5A 1YXCA 1KXQA 3WQ6A 2GOUA 1OD0A 1EJXC 2GJPA 2YB4A 3PY2A 3BOLA 3PPHA 2WANA 3UG5A 4MWAA 1G5AA 1SFTA 5F2MA 1TO3A 4MG4A 2ONEA 3KBWA 4KWUA 3AI0A 4BKNA 4ZB2A 3ZR4A 1DVJA 3H2MA 5FJUA 2WBGA 2BY0A 1FCQA 4QJ3B 2X2YA 4AMCA 3L12A 4K7VA 4UTJA 4RNFA 2DZBA 4X0NA 3F7JA 2C3ZA 4O1EA 3L0NA 4CD4A 1A0DA 4LCQA 2OMAA 4OBRA 4QDPA 4ZQOA 3T8QA 5HQMA 3LYEA 1I1XA 2WC4A 2YCKX 5CZ0A 2PTYA 3N04A 4P8VA 3S47A 3ZVHA 4PBEA 2X09A 1HMUA 2BBFA 2GPTA 1L6WA 4GIYA 3F5LA 4OOZA 3N11A 1BG4A 4NKCA 4C6EA 3MHUA 1ITCA 2QIIA 2YA2A 4Z1YA 4QE1A 3SGUA 2INZA 4RZ5A 2OO0A 3JU2A 3SN4A 2W0UA 3ZVIA 2QYGA 2Z27A 2HE5A 2PDQA 1UP2A 2A3LA 1E4IA 3VGFA 1SSGA 1AJZA 3TIMA 3UWEA 4DUVA 1TIMA 4UTTA 2CZEA 1XCFA 4E8DA 1IEWA 4HB7A 2WSRA 3NGFA 4IQLA 2IXUA 4JS3A 1LL4A 2ZUSA 3UWUA 1GJPA 3QZEA 1R8LA 1MW2A 5G5IA 2DUXA 2P8BA 5D2XA 3EX2A 3QTPA 1D3GA 2PPGA 1P0BA 3WFLA 4GK8A 4GKLA 1OBAA 3TFXA 3EOUA 3M0LA 2AL2A 3WFAA 1M7OA 4J4KA 1MZHA 3MVIA 4DLOA 4K1WA 3QW4B 4PGLA 4RE3A 4NZ1A 5BWAA 4H7ZA 4LGXA 2PLCA 3AUJA 3GR7A 1C93A 2RDTA 5U4NA 3L5AA 3LRKA 2H3BA 2TSYA 3UGVA 1Q66A 2BOEX 3CMFA 2YOCA 4LB3A 4XD5A 4ZQNA 3BW4A 3XINA 2WMHA 1FH7A 5I3JA 3VD7A 1FH9A 3TE9A 4WJXA 3OGVA 3WD0A 1XH0A 5LNVA 2YEPB 1LROA 3UP8A 1PDYA 1UD4A 2WXDM 2OO6A 2NX3A 3H2AA 3SUSA 4ES4A 2Y7EA 1KGUA 1E9ZB 4S3BA 3VK5A 2IKIA 2YA1A 1XISA 4B16A 2IMRA 1Q6OA 5EMKA 3VNZA 2GJXA 4P2VA 2ZX8A 3HPSA 1O68A 5BRBA 2PGRA 3FY1A 1FHUA 4DJDD 2GQAA 3B40A 1UA3A 1BVWA 3R0DA 1QDSA 2OZ3A 1TUFA 4S3FA 1SQ7A 4MKSA 4Y8EA 3CUHA 5DRCA 3LI0A 1QBAA 2YSWA 3HTWA 2P3EA 3ARTA 3HPZA 4HVXA 3MQTA 2QV4A 3N25A 4PRRA 1E15A 1DJYA 2YXGA 1KW1A 3C0SA 3U0HA 1KCXA 3RR1A 3P62A 1UR3M 5D02A 4WHBA 2WCSA 2A85A 2OTDA 3PZUA 1AQFA 4C1NB 3KX6A 4S23A 3IVSA 3W7QA 3A4AA 4PODA 2REQA 1H7RA 3FLUA 3IK2A 5FOOA 3DHUA 2FHFA 1E72M 1GJWA 3TONA 4IJCA 4FIRA 5F1UA 3NYDA 2PCQA 2AOSA 3PZIA 4UTWA 5ABFA 4I9MA 5B7YA 2ZE3A 3FOKA 3GU2A 1QPRA 5FF3A 3B4UA 3AXKA 4B2DD 2OKOA 1EJRC 1NSJA 4KERA 1R30A 5F2GA 2WZHA 1WAWA 1Q4WA 4BI6A 1C91A 2ATSA 2ODOA 5LIKX 2B7OA 2JEQA 3P74A 5DBTA 2CIPA 3G6LA 3LHYA 2X30A 2VURA 4Q4QA 3GBEA 2J77A 3S6OA 1OB0A 4GNVA 2CLIA 1HKMA 2GL5A 4W4QA 3MZNA 1HQTA 2ACSA 2VCAA 2E09A 2EEXA 1MVYA 6ALDA 3ZS4A 1AH0A 1NY1A 8TIMA 4L1GA 2H9AB 3PZGA 4GINA 5KSWA 4PMQA 4AZGA 1CTNA 4A8IA 3QR3A 5KZ6A 5I07A 4HMEA 4HA1A 3B04A 4QSHA 2FFCA 3HFTA 4DO5A 2VZVA 4KCUA 4Y9OA 1NFGA 5CXPA 4PTXA 4HZ8A 1BF6A 2QLYA 1FXQA 1XG3A 1GEHA 1UD2A 4NX0A 1V0NA 3C2EA 4ASTA 5IOBA 4IGNA 1SPQA 1OFBA 4GXWA 3QQWA 2GVJA 3WELA 3W83A 2E22A 1LRQA 3O15A 1WUFA 3CL6A 4US5D 1NF7A 5D4YA 4H2CA 4GZEA 4ZOAA 2G3MA 4L1XA 3VNMA 4JCLA 4Z1CA 5KTLA 4S3CA 1FWNA 4YVXA 4ICMA 2OX4A 4JKKA 3OB8A 4AIUA 3JUGA 1ZGDA 2CZDA 3A3HA 2G96A 3URQA 3R5EA 3KE0A 4DI8A 1PIFA 3AUOA 3B8WA 3GVWA 1NFPA 1ONXA 1T41A 1ZJBA 4LV4A 2JE8A 2XIIA 2DDXA 4DIAA 1E1EA 1XKYA 3TV8A 1FFQA 3K1DA 4NZ5A 1Y5WA 4HSNA 4C91A 5DMNA 4Y9AA 2QVNA 3S4TA 3FV9A 4BK9A 1WQ5A 2JIEA 4UUIA 4BR1A 1YMYA 3TSMA 3N6QA 3DAQA 5I06A 3F4CA 3T07A 3CASA 4NZCA 1AD1A 2V0TA 4PMYA 3GG8A 4JFWA 3AICA 2EGZA 2EQDA 5CJ5A 5HPCA 3L66A 4HU0A 4HU3A 4CNUA 1OJPA 2Z2BA 3SI9A 4ALDA 4KCWA 3TWBA 3URNA 2J8GA 5HJXA 3V35A 3RR4A 3WK1A 1CNVA 4LBSA 1V03A 4PFMA 1RV8A 3R6IA 1J6PA 1KBIA 2GGGA 3ZJ6A 2OG9A 2PS2A 1H0IA 1AQHA 3A21A 1B4KA 3LQLA 3NNTA 3VABA 3PF3A 5C7HA 2RFGA 3BSGA 1P0EA 2PP3A 3VFCA 4H9YA 4ZE4A 3WLTA 4EXQA 1WA3A 3F59A 3FJ4A 1JDAA 4QR6A 5CEWA 4U5KA 1TCMA 4NRSA 3KXQA 4HN8A 4E3VA 4U33A 1RK6A 2X1RA 4HU4A 3S1WA 4MTVA 1VYRA 3IAQA 1W8SA 4GRSA 3IRSA 1W9BM 3L4YA 3ZYZA 5HR6A 2C15A 1L2QA 2QKFA 1K7EA 4K39A 1H50A 3V0UA 1PX4A 3RLVA 4DXKA 2CWXA 3EOEA 3YPIA 3N4AA 5HWMA 2IXVA 3CZKA 5CCZA 1TWZA 4Y96A 4FP1A 3UERA 3ZWSA 4DX3A 1KFEA 2VM8A 2A3AA 4G7FA 2YIHA 3E02A 4YXGA 4IXHA 4UQAA 1HKVA 1VHNA 1GVYA 5DCBA 3NG3A 5M3WA 3RX3A 3WMSA 3EDFA 2ZUMA 1I2PA 3W7MA 4C1KA 3CGTA 1X6NA 3ICJA 4M82A 3AMKA 4FX7A 3VKJA 5FF4A 4AY1A 1PVNA 2BTMA 3WLPA 1TTPA 4L9XA 1XKJA 5A5WA 1W1A1 4NXSA 3P5ZA 5I79A 4A3QA 1W3TA 3VMPA 1LWJA 2A79A 1RY8A 1R3WA 2FPVA 4R7OA 2NQLA 1XBXA 3W28A 2HTMA 3AO0A 4NXKA 4GYPC 4LVFA 2J4GA 4RPQA 3NDZA 2C0HA 1RJQA 1XD1A 3RF9A 2DZXA 3BARA 4UFMA 4GUFA 1DHKA 3NDYA 2CZ5A 4RL3A 3IUDA 3H8AA 3VOFA 3FW6A 3U9IA 5BXRA 3STPA 3ABXA 1KV5A 2NV2A 3HURA 1POKA 4FNPA 4NYYA 1TFVA 3QGVA 4EAYA 4WSHA 2BODX 2EPMX 3OIHA 3BVJA 4RNJA 3VIPA 3FCPA 5IHRA 4JHOA 2PDLA 3IIVA 1W9PA 3LPFA 4GFIA 4MVAA 1UC5A 2GYIA 3GH4A 3DHPA 4MPQA 4LAZA 1HVXA 1JDCA 1EO7A 4H41A 1XLDA 3WDIA 4GX9A 4PTMA 1Z7AA 1YPFA 3OTRA 3PNUA 2WNNA 1XLCA 2PD5A 3AS1A 3PANA 4HTYA 5BU6A 3E5PA 2XWEA 3HV8A 2DZPA 2DT3A 1EP1A 4F9JA 3H6OA 4Z08A 3EA1A 3UR8A 5KEZA 4K68A 4F3HA 1R3YA 3GFZA 3DG3A 4ILSA 1BWVA 2HV5A 3QEZA 4CCEA 3L4WA 2BWGA 3AHYA 1HTIA 4D6HA 1W9DM 4OU1A 1KFCA 1VHCA 2B7QA 2BB0A 2YL8A 5A6JA 3FIGA 4H6EA 1XR2A 4ORIA 3TNBA 2XFRA 2JK2A 3S1XA 4CQ9A 1A0CA 2Y24A 2XDFA 1VQTA 1V93A 4C1LA 4G1NA 2DSKA 2NUXA 5F7UA 3OLDA 1NWRA 3VKDA 4CQDA 2J7BA 1GVSA 2Z1XA 1B9BA 1GT8A 5CPNA 1IEQA 3AYRA 1V3IA 3I6TA 1S1RA 1U22A 2RUSA 3POCA 4PMDA 4HN4A 3UXLA 5IFPA 1S2AA 3B9NA 2F38A 4OT7A 5J5RA 3W3OA 4AYGA 2V2CA 2PDMA 3IGUA 5AC5A 1C92A 1DIOA 1ZUAX 1U30A 4MOZA 1U2YA 1B54A 2J74A 3B3DA 3GD6A 3WF0A 2WNQA 4E5TA 4QEEA 3A3XA 3N2CA 3G77A 2WM1A 5C70A 1S5WA 2RAGA 3WQDA 3TAKA 3WLNA 3QR0A 3LHVA 1HKIA 2YX0A 3HBLA 3VC5A 3WKZA 2E24A 1BKSA 1S3HA 4WVXA 2XVKA 3M46A 4FXFA 4IP5A 2MANA 5LIXX 2V8ZA 1FCVA 4J40A 3M0IA 3P0XA 1F4AA 3UG3A 5GNYA 4LT9A 1CCWB 1EUNA 2NX1A 2PURA 2PDWA 3RX2A 3MJMA 1OC6A 3TJLA 1Y8BA 3NZRA 5JBEA 4NHVA 4MLRA 4WY0B 1JRBA 3I6EA 3P67A 1PL9A 1UASA 3PZMA 3IWPA 3OZYA 4PBGA 3WDQA 2CXGA 3OYZA 1OJXA 4C6LA 4O8RA 4JNYA 2Z1SA 4ZA0A 2KXRA 1DQXA 1IXOA 4RE0A 3S9IA 4JAWA 3W2LA 3QPYA 2IQ0A 3S2NA 1Q7ZA 2GSJA 4EXBA 1UWTA 3MY9A 3NEVA 4LYKA 2VUYA 5I5RA 1S2CA 3I6RA 3IIOA 3P7YA 2PGFA 4GJIA 3LRMA 3JW7A 3O63A 4Q8MA 2X41A 1JI1A 4AZBA 1XYFA 4KBXA 3M44A 5C9RA 5CBIA 4DF1A 2Q8XA 4JEQA 3DYMA 1QW9A 2XUCA 5L6UA 4ZCWA 5LNUA 3MHGA 1PJ9A 1JUEA 3NM1A 3QYQA 4LH8A 4LXFA 1Q7MA 3KBVA 5HJLA 3GE7A 2X1SA 1IEVA 4J1OA 4DY1A 1HL9A 4W8AA 4JIRA 2WV8A 1TRDA 3UD6A 5E6ZA 5LXEA 3B0YA 4AZ6A 2IKGA 1CXIA 1W3HA 3L2MA 3AIQA 3VDBA 4IUOA 3LHWA 1AMKA 1VFOA 5CSSA 4AC1X 3V1HA 1R85A 1RPKA 3SQMA 2OYLA 3U4AA 3EX1A 1RJRA 1OEPA 4MNKA 3CPUA 2OQHA 3WBXA 4AEEA 2VDHA 4P8WA 1YIXA 4W7WA 4JYDA 4MYXA 3AISA 1VFHA 3SECA 3FKRA 1ZBVA 3PQIA 4AVFA 2CZFA 2XSBA 2CLMA 2EKCA 2Z7GA 3DFOA 4MNLA 4DWSB 4D6EA 5TD4A 4DJEC 1SVDA 4QE5A 1UZHA 5HMDA 4PZVA 1B30A 1GZJA 1XIJA 1RBAA 1ZCCA 3C3UA 2A3EA 3FVDA 4A3UA 1AA1B 1SFJA 2FH8A 3KOWA 4AD5A 4ICNA 3O6AA 4O1FA 3N19B 4M6QA 4MADA 5CPQA 3EX4A 4QEHA 2QGYA 4C6NA 4UMBA 4AB4A 1XLAA 4LUSB 2VXNA 3PBVA 4IQJA 1RR2A 3N4EA 1T96A 3W2JA 3EA2A 1DE5A 1ITUA 1PV8A 3OGRA 3FAXA 3R58A 1D3HA 1CXKA 2OSWA 3TQKA 3E74A 3PZOA 4LUJA 1H62A 2QULA 4HPHA 3VIMA 4PL1A 4OWGA 4CNSA 1NAL1 3PR2A 2DT1A 4LWWA 2XPKA 4YCPA 5TBOA 5HNNA 3WJZA 2BP1A 4C6JA 2TODA 3DIPA 2P10A 3F4NA 1C8VA 4I8DA 3TYZA 1Q6LA 5EB8A 1KCKA 4K3ZA 2BRVX 1JGMA 2ZX7A 3ZZ1A 3UR5A 1IZKA 1ZP3A 5TF0A 1X38A 1VJIA 2J6VA 3TR9A 4GNJA 3QFEA 1TQJA 1ADOA 3A47A 3NO3A 5K4ZA 3A4JA 1W5OA 3A22A 3BZJA 1T7LA 1VPQA 1OFAA 3DESA 2OCZA 4QAWA 4PMUA 1JVNA 3WDRA 3VIFA 1BLIA 2EO7A 3QRHA 1MW1A 1KCLA 2HNHA 4OBTA 4F2UA 1A3HA 1C9DA 1Q6EA 3UWQA 4O50A 1ZPTA 4YHGA 3T78A 1MI3A 3W73A 3Q45A 1YBQA 2VEFA 2YW4A 1FWFC 4MY9A 3CWNA 2J62A 3AMCA 2DQXA 3N9KA 1H5VA 5I02A 1FVPA 2QV5A 4ROQA 3S8HA 1BVZA 3LZ5A 1WDRA 2VMFA 4PL2A 1RXOB 1TZZA 4Q22A 1SU5A 5T9BG 1NP0A 2GUYA 2Y1HA 3O2LA 4AXKA 3NA8A 3VD9A 3IS4A 2PDNA 4C60A 4GQBA 4FPSA 3NEHA 4QITA 3OZMA 4TQTA 5LSMA 4Q7NA 3GXPA 5FEXA 3H2FA 4MB3A 1FWWA 4M81A 3S2MA 4IPIA 2OWXA 2V81A 1R7OA 4R9OA 1KRAC 2OPJA 2O4QA 1W2VA 3NPWA 3VNLA 4O17A 3T9PA 4R88A 1DWGM 1YEYA 3R13A 3W7PA 1EA9C 4Z2JA 1Z9AA 1VYPX 5MF5A 4E2BA 2Q09A 3QR8A 3GHTA 4AZHA 1DEDA 5JVLA 2VRQA 4O0ZA 4YVPA 1C7SA 3NZGA 2A7NA 4Q4PA 1EBGA 5AYXA 2DFAA 2ZDRA 5HQEA 5MKGB 4RLIA 3VKCA 3UNDA 3BV4A 2Y7GA 3SUTA 3W37A 3GYCA 4AY8A 2EG8A 5E0FA 4R3UA 5JBFA 1QVBA 2QCFA 3QLLA 1OSEA 4O1AA 1XDJA 1QNPA 2CBUA 1IT8A 5EFFA 1MXSA 4MLJA 1R46A 3UU0A 3E0FA 5EKYA 1GQJA 4QXIA 4FF7A 1XV8A 5C8BB 1SZGA 3TZNA 5KMYA 4IUGA 3ZLGA 3WNKA 3WK0A 4W8BA 1J0YA 2VWSA 1G4EA 1IGWA 1ZS2A 1GWJA 1XIHA 1E56A 3PNZA 1W5NA 4URIA 3L4TA 2J7HA 3Q58A 3DFSA 1TV7A 3P2VA 4DF2A 4O1DA 1E9YB 3ES7A 1Q6RA 4CQ8A 1VFFA 6TAAA 4UNKA 1M68A 4GI4A 2A5HA 4E4PA 3F5KA 3GNOA 1TJ0A 2VZKD 3KCOA 3HGOA 1VFSA 1BGGA 4NJJA 2QVHA 3LCLA 4I9JA 5ABTA 1V6TA 1GNXA 1W5PA 3BOFA 3S9YA 4AX6A 3UZZA 4Q4SA 2X42A 3IJ8A 5ECUA 3F5JA 2HSAA 3I7RA 3NPXA 4ZQMA 5H2ZA 1H1YA 5K9CA 1XC4A 4YTUA 1NARA 3MI6A 4N9DA 1BKHA 1U1HA 1RLCL 2OR2A 2VD9A 3FN9A 3TJIA 1KV8A 1GOQA 5HULA 2YXXA 2NLYA 1J12A 1T40A 2ZC1A 3S83A 2D3LA 1ENUA 4PCFA 9RUBA 3PJUA 3N6JA 1FDYA 1ESWA 3SUUA 4ZGYA 3DECA 1XPGA 5C5YA 4X2PA 3WJWA 3FKKA 4IH3A 2NWSA 2VOTA 3N2XA 1OWQA 2BGQA 2QDDA 4W87A 4EWND 4CCZA 3KS6A 2NQZA 1F9GA 4AY7A 3LG3A 2CBVA 4LUSA 4IF2A 4DJED 4B5VA 1H11A 5C6MA 4I9AA 1HJXA 2OZ0A 4DBWA 3GR8A 1ONRA 4NI3A 1JXJA 2VGFA 3LY0A 4QLKA 2GJRA 3K30A 4JTSA 4GPNA 2E5CA 3MSYA 4PMNA 4IT1A 3DOPA 4KQNA 4D6IA 3ANYA 4E2DA 3EKZA 3Q67A 5A8OA 2F84A 5HBFA 5K2ZA 5EMMA 5A2BA 4LRTA 1EGVA 4W84A 3UYIA 4GH1A 4MKVA 1GOXA 5D9PA 3MI2A 4FNSA 4NT0A 1V8EA 3OG3A 5GVJA 3NGJA 4MIMA 1XIEA 2E9MA 3C52A 1FWCC 2ZXAA 3QR1A 4A21A 1M1BA 3W4RA 5LA2A 3GW0A 1B3ZA 2NZLA 1LQ0A 3PM6A 5HQLA 3CZEA 2BGSA 4GE8A 2D73A 4J3SA 4HNVA 2V82A 1S5NA 2Q1FA 4JYFA 3ABZA 4EIVA 3K4AA 3QZAA 1VEOA 1XSJA 4JTIA 4IIFA 3I68A 2NXIA 4IMAA 1VFLA 1A80A 1KM3A 5F4SA 1EP2A 4KEUA 2W66A 2XM1A 1PPIA 1DYSA 4WXZA 1GQNA 3IGHX 2FVLA 5D2YA 3WUGA 4A35A 5A8MA 1F1SA 2V3FA 4YU1A 2X40A 4HHPA 4U3CA 2WMKA 3GM8A 3LM3A 1XGEA 3TZFA 3KAOA 3W1QA 1DKWA 2PP1A 2Y8VA 1S5VA 4EE9A 3SO7A 3IV3A 1LWHA 3HPFA 1RP8A 3TAOA 4D2JA 2BHUA 4OJYA 4E3TA 1WDSA 4OVXA 1B90A 4CKQA 1TMHA 4U28A 3C4UA 4ZFCA 1TTIA 3GTHA 2Y2WA 3A6OA 3NUKA 4RKAA 4OOUA 3HA1A 4PRTA 4V28A 4ZL1A 3SY8A 4YIWA 3EYPA 3KLKA 1DJXA 2GUBA 3RPDA 1K8ZA 2F6XA 1S39A 3HM7A 3V5FA 1ISXA 1OFRA 2GDQA 5EFDA 1ICQA 3CT7A 3T6CA 4FIQA 3B9DA 4DBEA 3FXGA 4LCSA 3K8LA 3C3NA 3NIYA 4NY2A 2ZRXA 3V16A 1T8XA 1XIMA 1UP3A 3K13A 2NX9A 3F2BA 1ICPA 1RPXA 1MEWA 1TJPA 3F1QA 3DHDA 5BXPA 2OSYA 2E9BA 3O6YX 3BCDA 1VRAB 1N82A 4ZZ9A 2ZRWA 3E12A 2FJKA 4XAFA 1QWGA 4NIRA 2VFEA 1TPDA 3C8FA 4LVDA 1OQFA 2VVSA 2A6LA 5D32A 1DJWA 4X3ZA 3MHFA 4P8XA 3WBAA 4D6FA 1P43A 3GNXA 2JALA 2P1FA 1R2RA 3E2QA 3BQ5A 5GPRA 4PB3A 5I3IA 4JHMA 1A5OC 2I17A 1MEHA 2J78A 3TLLA 1CGYA 1XLKA 3TNOA 1E3ZA 1NWSA 1K6AA 3ZSSA 5A8NA 3SRKA 1UH4A 2DY3A 4A3RA 4XBJA 3UJRA 1F73A 2A3BA 2HMCA 2XVNA 2XVLA 3HGSA 2X1UA 3T0CA 1JYVA 1BYBA 5CQ1A 2PTXA 4ZQPA 2CW6A 3N6HA 1R7AA 1ITQA 4UFIA 1R9YA 3TKFA 5A2CA 4WOZA 1XQLA 2WZTA 3OQ8A 1QI0A 4DF0A 4LUIA 1FFRA 3LNPA 3PZ9A 5HMFA 4LV9A 4JNMA 3L0KA 4DYJA 5A8PA 1AODA 2WVSA 4MY1A 1A4LA 3NQVA 4BI5A 4WGHA 2OWWA 4GCAA 1K8XA 1WKDA 1N2VA 3ENLA 2ZUTA 3T05A 3DZ1A 3W6YA 3WLJA 1TMLA 1UZ4A 5G1YA 1XLBA 4NZ4A 1R3RA 1CYGA 1IYXA 1XCWA 2ICSA 4HZ7A 2D24A 4H3DA 3FSUA 3FA3A 1W5MA 4AHOA 2P50A 1J0HA 2J8FA 2BDQA 3T81A 3EEZA 2TPSA 5I3KA 2DVXA 4FOJA 3VDHA 4N2YA 1X98A 1VIWA 1LP6A 3KBUC 3SN1A 3WL0A 2QCDB 4N7QA 4HD5A 3PUDA 1RH9A 4AZ5A 1KGXA 3MJYA 3R8GA 1H7PA 3CQKA 2QDEA 3K4DA 1SO4A 4LS1A 3D5HA 1LORA 1XJBA 3DN5A 4Q8TA 3U8GA 3SCPA 3BAIA 5C7VA 1YRRA 4AZCA 5IHSA 3JR2A 5BOFA 2OJPA 1EXPA 5FJTA 2E68A 4GABA 2E6AA 1GYLA 4UFJA 5CGQA 1VJSA 3CO8A 3WF4A 1GOMA 3GWQA 2P8CA 3WNPA 3WDHA 3NWRA 1PZ2A 5E0KA 1S5TA 1XDLA 2G97A 1FY6A 2WVTA 1H1NA 1F3XA 4L4LA 3KP0A 2V5DA 3QMTA 1DOSA 1QNOA 1WE5A 3WQCA 1K9DA 1VPYA 1TZ9A 2GWGA 4FX8A 1NWTA 5C9ZA 4OFCA 2QCHA 1AMYA 5D30A 1YHTA 3W7HA 3U7BA 1WP6A 1TPWA 4LYQA 4JGDA 5AN7A 3T4WA 4CN6A 2FGZA 4ZO8A 3THUA 3NO1A 2WCGA 3FHQA 2A3HA 3TYDA 2PTWA 4UQCA 3SN0A 4S2CA 4PA8A 2QDGA 1HGWA 4HNTA 1E0WA 1S2UA 1VB9A 2I14A 4HNCA 5F4XA 2R1MA 3BH4A 4XISA 1W37A 1ECQA 3W86A 3BMVA 3CQ0A 5AYZA 4MDOA 2WNWA 2FGBA 3WH9A 1NQ6A 5CC7A 1XLJA 3RGTA 2FTWA 4NSBA 3REQB 3W7LA 4DXVA 3DDMA 1HM3A 2DSWA 2ZA3A 3W2MA 3S5ZA 3EDEA 1HL8A 4W7VA 1M41A 1LBFA 3BLEA 1A5CA 3RDKA 2O4MA 4HJFA 3H7VA 4FXSA 3G1XA 2YR1A 4JIHA 3GAYA 3LCFA 5I3FA 1V77A 2VGGA 3DGRA 4V1XA 1EIBA 4Z0JA 3ATZA 5AVNA 4LJ3A 3VNIA 4KCVA 1A4MA 1BRLA 5DRIA 1Q8AA 4KS0A 1NEYA 1YE6A 3AXIA 3EAUA 2ZZ5A 3C2OA 4HPXA 4PUMA 3IAPA 4XVEA 4BFAA 1KTNA 1E0XA 2NWRA 3EWXA 4HJWA 4F0HA 3VOHA 3KL0A 4TVUA 1EPVA 3G1SA 4FLSA 1FHVA 4K6AA 1UA7A 5EL1A 3N34A 5EPDA 2G50A 3IJDA 2E8YA 4HCDA 1QHPA 3QZ6A 1HP5A 3UZYA 3KRZA 1XIBA 4B5TA 2BY2A 4A29A 5FD0A 1OF8A 1IHIA 1OY0A 4FO4A 1WX0A 1V6VA 3DG7A 1I60A 3KWXA 5HWJA 3TJ4A 4IMCA 4DWDA 3ZIZA 3R8RA 4WSKA 2AGKA 4QCEA 2J25A 2OSXA 2ABBA 3DHFA 1A5KC 5ABEA 2Y70A 3RAOA 3NQEA 3BWWA 3ABSA 1DTNA 4W7UA 1D2KA 1GKPA 4M7TA 3SAZA 2ACUA 1EL3A 3MKCA 3USBA 1BXCA 3W07A 4F8XA 3WJSA 4KFOA 1XLFA 3TN4A 4IL0A 1MFVA 4GOAA 4ZODA 3JRKA 2PDXA 3AWNA 5IDZA 3ARRA 3PJTA 1SZEA 2QHAA 4PH6A 3M0VA 4KEZA 5C9XA 4H8HA 2CLLA 5IFTA 2FDMA 1WXYA 2Z1BA 4H00A 4M3PA 2VJXA 2E25A 4C5YA 3G1AA 4DWSC 2ZRYA 1GK8A 1OCJA 5CH9A 4JZ5A 5EBAA 1OYAA 3NFUA 1ZAIA 1OC5A 1MNZA 5I2UA 2XHYA 3ABRA 2O56A 4XD3A 4GQRA 1PWLA 3O1NA 4QQ3A 4GCXA 1UR2A 1FWHC 2PMQA 4Q8UA 4PCTA 1J11A 1K9FA 1IV8A 3T40A 2E9LA 1X8FA 1GKRA 3LGEA 3WL1A 1HKKA 4F9DA 5FEWA 3VO0A 3WMBA 3CHCA 4GZIA 3B9EA 1A5LC 1FWEC 4JTGA 5LYRA 1TVPA 3RCNA 3QPZA 3VD5A 2QUMA 4K7YA 4AD1A 2OLSA 4HNLA 3L2LA 1J18A 3MCOA 5BOOA 5AYBA 4E4FA 3KBMA 3N14A 3GVQA 5FAGA 1F3EA 3RJYA 5K4XA 2YZ5A 3MV11 1HUVA 2X8RA 5DQPA 4LUTB 2YCLA 3I4EA 1UHVA 4MM1A 4KRZA 1JZ2A 1KBJA 1OF6A 1LLOA 2I5IA 2BXZA 4TTGA 3T2QA 3OA5A 4F2TA 3VCNA 4IGHA 4DYEA 4JX6A 3BG3A 3ONBA 4GXMA 3NPVA 5HNRA 3W7IA 2GVEA 5C9UA 4HYVA 3QTGA 3BLFA 1W1VA 2UZ9A 4YWIA 1LBMA 1LLZA 4AC7C 1P6BA 1SO5A 1M7XA 3W29A 1KRMA 1JD9A 2VFGA 4B2DA 1SZNA 3B9OA 4DELA 3W0KA 4TV5A 3LCGA 2E5DA 4WKFA 3ZSTA 4ERAA 2ZA2A 3AROA 3KOFA 3SM0A 3H2EA 1THFD 4LEQA 1QHOA 3XIMA 4OUEA 1U5HA 4UZUA 3ZT7A 3U2ZA 3V36A 4XB3A 3RJXA 4B92A 3G0UA 1WBJA 5GJNA 1UPMB 4ZVJA 1VFTA 4QDWA 3BLOA 3TLQA 1C9WA 1Z89A 3UJ2A 4EK7A 4RE2A 2Y0FA 6A3HA 4O52A 3T1GA 1V79A 4LNCA 2ZUUA 1G01A 4KIRA 4PBFA 1TE6A 1PX3A 1WCGA 4S3EA 1TPEA 4GZJA 3KOXA 1BEUA 2ZFAA 1WZMA 6ENLA 1OX4B 1MUCA 2PC8A 1RQBA 2OU4A 4IWWA 3P84A 3AFBA 4TIMA 1JDDA 3GW3A 4CQBA 4C6BA 3WQ4A 5JMUA 4GKTA 1TKKA 3LB0A 1SFLA 1SMAA 2IQDA 4R27A 4LUYA 3P80A 3G6MA 2G4FA 3VGGA 1S5MA 3LEPA 3F4VA 1AVAA 4NZFA 4JICA 2A7PA 2Z24A 1B3OA 3ABQA 4US5A 4BF9A 1RA0A 2WHJA 3QPEA 1Q8JA 5FA5A 2WDAA 5JUVA 3KUMA 3TX9A 3GDLA 3P93A 1ZAJA 3OBAA 1EB3A 4MB5A 3UT0A 4IQEA 3WQWA 3BCFA 3BCJA 4B91A 1C8XA 3W2KA 4Y7EA 3IT6B 4KETA 4U3AA 2BOGX 4CD7A 5A69A 1EX1A 3WJYA 1US3A 4GUGA 3ARUA 1K4GA 4RNHA 3LLXA 2QMJA 3V7PA 3NO5A 1VEPA 1MEIA 3RX4A 1GYNA 2W62A 4KKXA 3WSUA 3ITGA 1JFHA 3KW3A 4GX8A 1O7AA 3LD5A 4WCJA 2VO5A 3C2RA 4IG2A 4FNRA 3UXDA 3CTTA 1V0KA 1HKJA 5CJMA 3P82A 3W1MA 2QPXA 1AH4A 1M01A 1ZJIA 3AZTA 3M07A 4PEEA 4O54A 3AS2A 4CVUA 1LOQA 2DUAA 4BJHA 3RO6A 4J3UA 2WCOA 1GVEA 3VD3A 2WC7A 1JD7A 1QAPA 5LNSA 3PSVA 2VX4A 2PI6A 4MKNA 3T09A 3TOPA 1P7TA 3AHTA 3BV7A 1IGSA 2E6DA 4XKYB 2HNEA 3SCNA 2XH4A 3O0KA 1VFMA 3L4XA 3L68A 1BFNA 2VDGA 1TX0A 1PIIA 1M53A 4PTVA 4L4MA 1VBRA 1TRIA 1RCQA 4U2ZA 1FCBA 2GK1B 4P7NA 2PU0A 3VU2A 1ZALA 3H70A 1KM4A 4XZMX 4K8EA 4GXPA 1TWWA 4X2RA 3RIKA 4ENLA 3W53A 3IGSA 4OHQA 3AC0A 3A24A 4WDXA 3I7QA 4YTRA 3HN3A 3TYEA 4NL1A 4F2BA 2HVOA 3PPFA 3CL8A 2BLEA 2WVVB 3W87A 2W92A 4D6JA 3CIXA 4LYPA 1BYAA 1XYCA 1PWMA 1YTKA 4PUEA 5FEZA 1FUYA 3AXHA 4X22A 1A50A 3MCMA 4Q8PA 1VAHA 3IJ6A 1CGTA 3OZPA 2HPMA 1JI2A 1KWGA 4LTSA 4YL2A 2VR5A 4LUTA 3CPRA 4M5PA 1WDQA 7REQB 1OGSA 3DU0A 4MNMA 2OVLA 1EWEA 3OVPA 3B0XA 2NSOA 1IIHA 4KFPA 1SUXA 2ISVA 3TYAA 3SCRA 2I1OA 3WLKX 1W2PA 3CU2A 1H51A 2VC6A 3MI3A 3ZO9A 1M7JA 2YZRA 1J0NA 5DMMA 3TXVA 3W00A 3U3HA 2DSVA 3SDOA 4G6CA 3WNNA 4HA3A 1UR8A 4HSHA 1Z44A 2UBPC 1RW9A 2DZUA 3LNMA 2CKRA 1U1UA 1VCGA 2ZTJA 4RW5A 5AC4A 4RZ6A 3M43A 4GVIA 2Y85A 4I7VA 4KRUA 3FDGA 1QI5A 3DI1A 4FI4A 4F4RA 1YLVA 1NIUA 4G9PA 3SBFA 3VOCA 1SW3A 5JXQA 3V1PA 4NNCA 2V5LA 3VOJA 3L7RA 3EOOA 4JKMA 3R4IA 3UZJA 1A5UA 2NT1A 1OX4A 1MMFA 4LAUA 2DZVA 2V2HA 1WKFA 4D1IA 3MUCA 1V5XA 2G3FA 4HMNA 2Y6ZA 3DC8A 3CAWA 1UMYA 1DJQA 2JKEA 3SUVA 1JNEA 1ZTVA 3CMJA 4MUPA 3AU6A 2QCNA 1I1WA 3O9NA 4YLWA 4WR3A 3GIQA 4XUYA 1ZBCA 1SR0A 1XFBA 5LKYA 1PCWA 5CPSA 5G1MA 1I2OA 3H2NA 3HOJA 2TAAA 4FLQA 1XLIA 2UY5A 2XIBA 2O92A 2R8WA 3Q2DA 2VFHA 1J0IA 4QP0A 3GTXA 3QHOA 2RJHA 1G4PA 1AUSL 5ENLA 3VE9A 1KFBA 1OT1A 2ZC8A 1OCBA 1TPFA 3QC0A 3QOKA 5CSUA 1JAEA 3QOMA 3NJ3A 1ISVA 3TQPA 3LU2A 1EYEA 3TROA 3FS2A 4TR9A 2J27A 2FFIA 4JY9A 2DU2A 4B5SA 1N7PA 3NDOA 3P60A 2GGIA 3KDOA 3ZOAA 1JQXA 4WLCA 2VP8A 1K02A 4Q32A 1JUBA 3H23A 3OZOA 2KAUC 3PZQA 1CLKA 4FNUA 4C6KA 3DFNA 5D05A 2GSHA 1DQUA 2CFFA 4Z1BA 1N7RA 4IGMA 3DC0A 4Z2KA 1GG0A 2WMIB 1IWBA 3LZ3A 5I6SA 5HUPA 4UQ9A 2FGLA 3NQCA 2FH6A 3H21A 2V2DA 1UYQA 1N7OA 2ZADA 5ECVA 1GJUA 1WKYA 2FMOA 4GNKB 1LTDA 4DM1A 1GHRA 1DJGA 4PCNA 5AZ1A 1JXKA 1A3XA 3OG2A 4HKPA 4CUCA 1W5QA 1EEPA 4S3KA 1GUVA 1XLEA 4ZFMA 1XYAA 1BWKA 1UZDA 5DY3A 3CZLA 3M64A 4MJMA 4PC8A 3R1ZA 1AQMA 3OA3A 2ESCA 5LIYX 3HQNA 1OFPA 2DZAA 4UQEA 3T0AA 4HBKA 4AD0A 3VDAA 4LANA 3EWDA 4S38A 1MNSA 1JCNA 2D22A 2GVYA 1W3KA 3FEQA 1LXMA 3QHMA 1D8WA 1EO5A 2YL9A 2JKPA 3USZA 3NSXA 4H9VA 4ML4A 1ZRQA 1BYCA 2L5HA 3GH7A 1W17A 4QLJA 3GBDA 4HCHA 3R12A 4JTLA 3LBCA 3WDPP 1H61A 4WSJA 3R94A 1UWAA 1FX6A 1V6YA 4CU6A 2IPGA 4DJDC 4I5XA 3OYXA 3LOTA 2B81A 3E38A 2C1IA 4S3JA 1UWUA 1EKOA 3IVTA 4J2PA 4M8UA 5CAKA 1XGZA 2FDSA 3R25A 4GH3A 2ZUNA 2QXWA 4S1FA 3NQAA 2YBUA 3KZPA 3VGEA 4IISA 3H2OA 2XISA 4ZEPA 2Q3RA 4Y9MA 4ZB0A 3UA4A 3UR2A 1X6UA 3DENA 4UR8A 1VRXA 3PB2A 7REQA 1QBBA 2OKTA 4U2YA 4XZWA 1PTDA 2E77A 3V5OA 3CUIA 2QJIA 1V6XA 3WQPA 4CCCA 2R24A 1E40A 5FJPA 3S1UA 4F0LA 3S6DA 2DSZA 4H9XA 5T8GA 3G1DA 4QSFA 1H49A 3CXOA 2PDJA 5E70A 2VZKB 3I3BA 4F0MA 1QO2A 1VD6A 3W02A 3KOYA 3MDUA 3MANA 4CQAA 3CPGA 4Y6GA 2E0PA 3BUVA 1BQGA 7ENLA 4IZGA 3UZWA 1HW6A 4AVOA 1SO6A 2AQOA 1H63A 4JN7A 3MC5A 4GYPA 2Y61A 3W7NA 2J7EA 3TYBA 3MWCA 4ICCX 1L6SA 1C90A 1PYMA 4TX9A 5JH1A 1X1OA 1VZWA 4O53A 3QHNA 4YWSA 4LBUA 4H9UA 3NQ2A 3W38A 3BPWA 4GFSA 3VIGA 3M7SA 1QNSA 3NL5A 1F6YA 4MJ4A 4AEOA 3QY8A 2ZIDA 1LUCB 1LQ2A 1TSIA 2QCCA 1RWCA 4Y8FA 2PGEA 1SW0A 1WKEA 3PTKA 3W81A 3VX0A 3AZRA 3G1HA 4LY8A 2AGTA 1NF0A 1UD8A 1OFEA 4M80A 2PDHA 1E6QM 3HQPA 4LFYA 3ZT6A 4PYSA 2Z6IA 4E6MA 4JFUA 1UIPA 4IICA 4NAEB 1UCWA 4ORMA 5AYIA 4J3TA 2QDHA 2BOFX 4HHHA 4I8YA 2DJXA 1OABA 2G8ZA 2Y5JA 3R7MA 2BRPA 4IXXA 3UWZA 4ATWA 1QXLA 3QBUA 1IIGA 3SJNA 3TXZA 3VMOA 3MO7A 4LBRA 1F61A 1O5KA 4JCMA 3HJEA 2O9RA 1XRTA 3QV8A 3OODA 5CSYA 2G3NA 1Y65A 3LTSA 4KGLA 1Q7QA 4GYFA 4WF7A 3MBDA 5DCDA 3SCSA 3A5VA 3ZQ9A 5DO8A 3UWVA 3RG6A 3ZMRA 4PULA 1VLWA 2FB3A 2P0OA 3LQGA 1E51A 1E6ZA 1F3WA 1GOWA 5I3DA 3TN5A 3DGBA 3RU8X 5FL1A 3EZ4A 3S2LA 4DZIA 4LCRA 1ZAHA 3AYVA 1EJSC 4XSMA 1FKWA 2QUNA 3BGAA 4QAIA 5FAJA 4H8NA 5M17A 5IBXC 2OWCA 4RXGA 4M29A 5T26A 2WMIA 4OQVA 1XINA 3WG6A 1AW5A 2QW5A 4FR6A 3WQFA 2BZNA 2CLOA 3FGCA 2GQ8A 1V51A 2F9RA 4JDBA 3I7SA 5M2FX 1FDZA 1XICA 4WY0F 4R7JA 1HO1A 4M6VA 3PB0A 4ZMGA 1XRVA 3M5XA 1I0BA 3IIZA 3CWHA 1W1PA 3PS7A 5E6YA 1U5VA 5D04C 3KCLA 5CC5A 2E67A 1YYAA 2D69A 1E6RA 4DUWA 5CBJA 5K9XA 4EANA 3QV9A 1A3WA 2EHHA 3P8JA 4UOQA 3S1GA 2PGWA 3W2UA 4UMAA 4AF0B 1H7XA 3PG8A 3NQ7A 4HGXA 2J7CA 2PDKA 3LXBA 4UQBA 1F5ZA 5AYYA 2GGEA 4RX0A 1O66A 4KMQA 3LX9A 4QM1A 3AJXA 2Y5EA 1GVIA 1K9TA 2FQIA 1BXBA 1PZ1A 2FJUB 4BY3A 2MNRA 1G94A 2CLEA 3QV7A 3F4DA 2WW5A 4D9PA 2IW0A 1B5TA 5D37A 5LGXA 5DT7A 3VM7A 1JNDA 5SWUA 3MWAA 3GAKA 1KD0A 1MW3A 5HNTA 4Z42C 3UJFA 1R86A 1Q6DA 4CN4A 2HE8A 1N7NA 2QCGA 3AMLA 5DF0A 4C6PA 4CD5A 1E43A 4ZOBA 3W9ZA 2CBJA 1ZU8A