4D6TH

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 65
sequence length 65
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4d6tH00
3H1IH 2BCCH 3L71H 1NTZH 4U3FH 1SQVH 1L0LH 3H1HH 1PP9H 1SQXH 1SQBH 1BCCH 2A06H 3H1JH 1PPJH 3L74H 3TGUH 3BCCH 3L75H 1EZVH 3CXHF 3L70H 1L0NH 3CWBH 1NU1H 1P84F 2IBZH 3L72H 3H1LH 1BGYH 4PD4F 4D6TH 1KB9F 1SQPH 1BE3H 2FYUH 1NTKH 1KYOF 3H1KH 3L73H 1NTMH 5KLVH 3CX5F 1SQQH
chains in the Genus database with same CATH superfamily
4K8ZA 1P4RA 5LHHA 4JI7B 4UCSA 3O9OA 4RAIA 3ABTA 1DF4A 4I55A 2ZNIA 1WAZA 3WG7C 4YY3B 3ZHSA 2BTQA 4BW5A 4DRXB 2N04A 1AR5A 5C8YA 2R72A 4AI8A 3DGEA 3TETA 4G27B 3ABLC 1KQSU 2UU9B 4PA9A 4O4IB 3JASB 4Q20A 2WPDG 1EZVH 1AVMA 1XMOO 1UJWB 2LW7A 3B77A 1Q6UA 2HKOA 4O2AB 4MVSA 3OTOB 1VQMV 2IJKA 1V9PA 2DN9A 1D5AA 1Q3EA 4I50B 2MK3A 4DV1O 1IBKO 3UQ8A 3I5DA 4PHZA 1JJOA 2LW1A 3T1HB 3OT7A 2ZNJA 2QKSA 4DR1O 1WP8A 4FLXA 3CC4V 3BA9A 4FK5C 4X62B 3RYIA 3JD2A 5KMGA 1H2NA 3FAVB 1KB9F 4ASUG 2YI8A 1R3LC 2YXYA 4I4TA 4P30A 3RVZA 5JH7B 2QR4A 1HWYA 3ZRSA 2XUMA 5KA5A 1HNZO 1L1FA 2Q0AA 2VQFB 2YSUB 3N2GB 2BOCC 1W0KG 1ZLZA 3E8FA 2P4VA 2YIBD 1TUBB 2VQEB 4BIZA 1F4NA 5IYZA 1XNQB 2UXCB 4LF5B 4I7ZB 4I9QA 2QWRB 4L87A 1NH2B 3K0GA 2ZE7A 3CCEV 4D7SA 5FPRA 1NTZH 4MVQA 1V54B 4J41A 1SQBH 2V1DA 3L74H 1K92A 3UM7A 5LP6A 3OUFA 4LFCO 3RVYA 2PYLA 3MDSA 4YIOA 3ZHQA 4JI8B 2CTQA 3BY6A 4UCTA 1BQ0A 4DV3B 4EFEA 2ILMA 1MOFA 2P4KA 1K5QA 1VQPV 4GX1A 4GKKB 3ZIAG 4NTXA 2EBOA 4WBNB 1E79G 2OCCB 5KX5B 5EZYA 1QR8A 5KUMA 4GX5A 5J2TB 4PDVA 1NTMH 4YJ2A 2X6CA 4JPRA 1OJHA 2EILB 2Q4PA 1URFA 4DV4B 3B8MA 2WAMA 3JARB 4TQDA 3TJTA 4PELA 2RMKB 5EBMC 2FKXA 3W7UA 2ZXWB 2AW9A 2RNBA 1VIBA 1JPXA 2OCCC 3OD4A 1V55B 1GN2A 1SZTA 1WPBA 1QLEB 1VF6C 3L75H 3C90A 4UCOA 1QHTA 2IBZH 4IIJA 3JCUZ 3EFFK 1Q6HA 1NVPB 1SA0A 4OPAA 1VQ7V 4ZIBA 5JJNB 3SPGA 4DK1A 5TISZ 3RWRD 2LO1A 1GRJA 3HKEB 1VQ5V 5LBQA 4JI3O 5D5QA 4JI2B 2ZKOA 2V4DA 3K9AA 2ZXWC 3ZHTA 4GZRB 2F43G 1R3IC 1V55C 3G80A 4CS4A 3K04A 2BSKA 3THOA 1BGYH 1ZL8B 1BE3H 3EVKA 4ZI7B 2CK3G 3SYCA 1XREA 2QJ1A 1W0JG 1B6QA 2NN4A 3T1HO 3M7MX 4TV8A 2ATKC 2ZQMA 1YTFB 3TK1A 1KMIZ 2Y69B 4C7UA 5IJ0B 1K97A 4LP8A 3RYFA 2KKWA 4JI1O 3WB2A 2FTKA 1P7GA 3BEHA 2GHYA 4DV6O 1RFYA 2DYSB 1PNLA 2VS0A 4O2BB 1BL8A 1KECA 1I7FA 1JX9A 2XAGA 4LNUA 5B1AC 3CRAA 3BFRA 5GW7A 2JS3A 4LCUC 2JGDA 1BHAA 4OPHA 1ORQC 2K9PA 3H1LH 2F95B 4DUZB 2IH1C 1R73A 1EN5A 1YJNV 5JCOC 3JATB 1N34O 4PI0A 1NH2D 2D3OW 3D36C 1AJPA 3QO5A 4IYIA 1FJGO 3C3SA 2JJ2G 4OXSA 1XILA 2UXBO 5F2VO 2EINC 4DR4O 1O9GA 1KP2A 1PV0A 2NLJC 3NR7A 1FXKB 2Y48A 1JQ0A 4MVOA 1THZA 2RJZA 1SQPH 2P90A 3HKCA 4NXMB 4U7NA 2Q9LA 2UUAB 5DN6G 2WLJA 1OCOB 3BA8A 3EHBB 4DXWA 1FFXA 1DGSA 4KL1A 4MW3A 2EIKB 3CRMA 2GTSA 2BE3A 3J81N 4TSFG 4XDLA 1Y74B 1BHBA 1GN6A 1NJIW 2YIDA 1DF5A 1AP6A 1IVSA 1M57B 3ZHRA 3VQWA 3IFXA 3ASOB 2HLDG 3JD4A 2ZDIC 2LQTA 4Z1MG 1N32B 2XOKG 3DSQA 4UB6Z 4XDKA 4AHCA 4W4LA 4WFGA 4TT3G 1Q5OA 4J42A 4X65B 4H37A 2V7QG 2YIBA 1NT2B 4E2LA 2EIKC 1TVKB 3OUSA 4E4EA 1IBLO 4EFBA 1NKDA 3DXRB 3F5TA 4DK0A 1RM1C 3GWOA 2UUBO 1AI7A 3FB7C 5IE9A 3CXCU 2E5LO 3D3QA 4X88A 5JWPA 1N33O 3AG4B 1JVMA 2XT9A 4LWSA 2A9HA 1KKDA 4FM1A 3FKSG 1YEWA 1NVPD 4B7EA 1VF7A 3SPCA 3CB2A 3E22B 1FD9A 4MVUA 3UT5A 2EX3A 1VQ9V 1COWG 5JQGA 1SKVA 4QPJA 1XMOB 5BMVA 2B1IA 4JYYA 3T1CA 2BOBC 3E86A 4UCUA 2VWJA 1BZKA 2QSAA 5C93A 1S0VA 1H2GA 4DR3O 4DV1B 4MTOA 5IYBO 1IBKB 3AG1C 5EC2C 3FB8C 3CEIA 2GSMB 1FYJA 2P6JA 4MT8A 1M4UA 4DR1B 5E1AC 4KFMA 4HZ3A 1D2DA 1R3JC 1I5YA 2HVKC 4AILC 2WSSG 2GBOA 3X2QC 2Z0AA 1KC8W 1YTFD 2F4VO 1S3JA 3OGIB 4P9PA 1I94O 3M8AA 4LC1A 1XL4A 4B3MO 2XASA 5IJ9B 4OGQB 4DR6O 1F7YA 1EN6A 2PTMA 1HNZB 5L3EA 3VBBA 1NS1A 1PM9A 3LDEA 1Y66A 3CRRA 1UFIA 2RQ6A 3K5MA 2PY5A 2EIMB 2GTAA 4JASA 3AG2B 5L3DA 4DUYO 2ZE6A 2Q8VA 5EK0A 3BVOA 5LYJB 1MG1A 2YIAA 1B06A 4DRXA 2LFRA 5LGNA 4NTWA 4HNAB 2WLMA 4WFAV 1VQ4V 1H8EG 5B3SB 1S72V 1X59A 2ITCC 2QE7G 4J11A 1WPXA 4MW8A 4LFCB 3JASA 4J7ZA 4PDLA 1M5IA 1RSOB 4DV0O 3FYIB 4CS3A 3RYCB 3LDCA 3QNEA 4L8JA 1SC5B 4O2AA 1DTOA 2EIMC 4X66O 3FD9A 4I50A 1VEWA 4JV5O 3ZHUA 4FJCC 2Y0IA 1N0JA 4FLWA 1JFFA 2A79B 1XQ8A 1X4TA 2WLLB 4WF9V 3KKYA 1Y67A 1N36O 2W0XA 3ZMZA 4W4KA 5BY1A 4UVCA 5EYPB 3A8TA 1QNMA 1I5XA 1Y4MA 2IH3C 2B9ZA 3FAVA 3SYQA 1GN4A 4PV1B 5LXTA 2QEXV 1YITV 4GKJO 1IDSA 5D5PA 3H1HH 5JH7A 3LNNA 3ML0A 1K33A 4B3RO 2EZOA 1QQCA 5KA6A 4FM2A 5H9CA 3N2GA 3JYCA 3OMIB 3ZN1A 4DW0A 1ROPA 3HPLC 1RPRA 3E8BA 2ZE8A 4RQEA 3IAYA 3ABMC 2JJ1G 1FFTB 3JD0A 4JTDB 2CTPA 2IU3A 1SQFA 2QTSA 4XDJA 1JMKC 2Q6AA 3BPZA 2JRIA 2WWWA 4X1KA 3K79A 3G6BA 2GUZB 4JI3B 1QLNA 2Y0PA 4MVRA 2HEPA 5KLVH 3CX5F 1VARA 2JIZG 3STZC 3G4SV 3ZRXA 2HJFC 3SDLA 4GX2A 3L72H 2YDEA 5GTHZ 4GX0A 4WBNA 4NB5A 5L3GA 2CH7B 5KX5A 2EULA 2YEVB 1M9NA 3B09A 5J2TA 2BCCH 2OCHA 3SJAC 2YS8A 3CMEV 2XAHA 1BCCH 2UXDO 4KHPO 2B5UA 4F6RB 4X20B 4JI1B 3UO2A 1WNSA 2Q73A 4MTXA 4DV6B 4UV9A 3JARA 3SR2C 1N8RW 3DC6A 4MTFA 3IC9A 1AP5A 2HP8A 4B3TO 2E75B 4JI5O 4UVBA 5LA6B 3CHXA 2OTJV 2DQ0A 3E8HA 2KQXA 4WFHA 5B5EZ 1HR0O 1B3QA 3VQXA 1N34B 2Y4UA 1K4DC 1OHHG 5LGUA 5H5NA 2DQ3A 4JF3A 3E8GA 1TGOA 4MVZA 1FJGB 3HKDB 4B7KA 4B3SO 4LF4O 1S77D 3TXSA 2P7TC 2UXBB 3HKEA 4DR4B 3T4ZA 3FX7A 1AI5A 5KHGA 1TA8A 2AHYA 1XOUA 1H2LA 2XAJA 2Y4TA 1XHXA 3N2KB 5BR8O 3OR7C 3UCSC 4MS2A 1ZL8A 4YJ3B 3CCMV 5IWAO 3E83A 3ASNB 4ZI7A 1SQQH 3I56V 2UXNA 3ETDA 4NTYA 2ZD9A 2P67A 1AR4A 2JS5A 2ZR3A 4LF9O 5LGTA 1YSCA 1H2MA 2PZSA 1XDCA 1H38A 2IU0A 3GWKC 4O4LA 4O4HB 4R8CA 5IJ0A 1NZ6A 4H13B 3EXAA 4ZBMA 2DMXA 5CN0A 3OM3B 3ABKC 2M6YA 5DM6V 2A06H 3MHHC 3ASNC 2QKAA 3JCZA 1ZX3A 1MNGA 2A0LA 1QVGU 1IBLB 3CS5A 1AI4A 3CCLV 1KBHA 2UUBB 4A5UB 5B1NA 2E5LB 5J2UB 2LJ2A 1S5JA 1N33B 2ETNA 4ZOLA 3BCCH 1Y6XA 3VQYA 3F7VC 3GB7C 1S5HC 4I0XB 3ZMVA 2ITDC 4I4TB 3K9SA 5KHKA 4JYBA 5LOVB 4DV7O 1FXKA 4ZKIA 2HVJC 1IXBA 1SZXA 1Q43A 1CPYA 1D5NA 1HNXO 3W7WA 2ZCEA 5LMUO 4U3FH 1H2SB 3OMNB 5IYZB 2C2AA 1VQLV 4UB8Z 1W2BU 2Q0OC 4PJ0Z 4EB6B 4DR7O 2ADQB 4DR3B 4IHJB 5JVDB 4CH3A 1Q81W 4K3AA 1FXVA 2HJDA 4PA6A 5K1XA 3SJCC 2CE4A 2LFSA 5B1AB 1XUQA 1OCRC 4Q6GA 5K1PA 1GAXA 3OEHG 5DECA 1WB7A 2F4VB 4JZ2A 1I94B 4FFBB 4HAMA 4B3MB 3JAWA 3PN1A 4DR6B 2IJJA 3CJHB 2Q7EA 2YXHA 2EINB 3QG5A 4LF6O 1ZSPA 3QTCA 3AEIA 3SJBC 3QF7A 4R50A 4G28B 3K06A 1JCHA 1IZ3A 1YI2V 1FAFA 4DUYB 2P5OA 3LNMB 2X0LA 5LP6C 3JSNA 3LUTB 2YXLA 3ZRVA 4FPPA 3FB5C 4DW1A 3F7YC 1XNRO 1MABG 4CS2A 3APOA 1XL6A 4WCEV 3G67A 4BAYA 4X1IA 1WP7A 3E22A 2ZIOA 2W0FC 1RP3B 3KG2A 2MW2B 3ETGA 5HFLA 2HG5C 2QWQB 1VP7A 4DV0B 4FFKA 5FNVB 5H2FZ 4CH4A 1M93A 3SYPA 4F4LA 2CDYA 1KU9A 4UXNA 4X66B 1FPOA 1A32A 1PNMA 4JV5B 4IGGA 1Q6IA 2YC0A 1AJQA 1PP9H 3WB1A 5HFMA 4MSWC 3LSQA 1PNKA 2JK5C 1N36B 1K9MW 3BAAA 2JEXA 1QR9A 1WN7A 2CGNA 1RM1B 4O4JB 3T4DA 3I55V 2WLIB 3DC5A 1JR9A 4BIUA 5L3CA 4IL6Z 1M56C 3CPWU 4GKJB 2JGUA 2AXTZ 1LUVA 3RT3C 3OFNG 1GKFA 4B3RB 2HFEC 3OR6C 1HNWO 2Z5UA 3CCSV 4ZHQB 4X1YB 1YXBA 1XBLA 3Q4HA 3G71V 2F1MA 2KG7A 2K1EA 3C3TA 3CCJV 3M99B 4DR2O 3R66A 1B04A 2OWOA 5LYJA 2HR3A 4K0KO 4JAAA 4CH6A 2EIJB 5BZBA 1SQXH 4HNAA 3ZMTA 4PA4A 4N21A 5ITZA 1ENVA 3AG1B 4UCRA 2L6LA 2IW5A 2Q7HA 1BT8A 1RPOA 2R9RB 2AHZA 2WA4A 1AI6A 3O65A 2QM7A 3WU2Z 1AJNA 5E79Z 3L73H 1Y76B 1CEZA 3X2QB 4JI4O 1NI8A 3K5OA 3H9VA 2ZM6O 2QDOA 1Q7YW 5CA0A 3CRQA 3CRCA 3T2MA 3P30A 5IT9N 2EIJC 1YCIA 1U97A 2RCVA 1XI1A 4RQFA 2P06A 3P3PA 5FL7G 5LMNO 2PI5A 4LH6A 1R6NA 4IYHA 3K5LA 3CC2V 1QVFU 3KZIZ 5KHIA 2NR5A 1K7DA 1G1XB 5CMUA 5EYPA 1R6TA 4K8XA 3E35A 2UXXA 2UXDB 3NXSA 4U3JA 4KHPB 1ZUQA 2QM8A 3CXHF 3STLC 3JALB 3K59A 3PJSK 1QCEA 4RUFA 4LF7O 4R7CA 5IYCO 3ETEA 1MSWD 4B3TB 1E1RG 4JYAO 2QA4V 4JI5B 2CTWA 4QGPA 4NXNO 1MZFA 1EZJA 1HR0B 1Q86W 5KHJA 1IX9A 2R9AA 3P3NA 2UUCO 1YJWV 4B3SB 4LF4B 1OV9A 5AG2A 1WA8B 5LL6Y 2GUZA 4BW9A 1KP3A 1K73W 1OCZC 1SQGA 4PA7A 1QBZA 2YUAA 3AK3A 1IURA 3CWBH 4GT1A 1VQKV 2E3CA 4O4IA 5BR8B 1OZ0A 1VQNV 5IWAB 2Q5ZA 2IJHA 2ADPA 1GTOA 4UV8A 5EBLC 4QNHB 2GDSA 2CH7A 1SQVH 2AZ0A 3CCRV 2YEVA 3VQVA 3R65A 1PPJH 5GONB 4LF9B 1L0NH 1NU1H 5A9GA 3ABMB 4JGSA 3LSSA 3ZJZA 2ZIMA 4P2ZA 4F6RA 3HKBB 1Q90D 3RYHB 3FFQA 1XEQA 2YICA 3MHSC 4U7OA 4TUYB 1BSMA 2AZ2A 2PF4E 1W59A 3KCXA 5LA6A 2QKCA 3K58A 1TUBA 5CBGA 3K08A 4HYOA 5IY5C 3OE7G 4OX9O 2A7WA 2R70A 1UPGA 4JAUA 2Q7GA 1L0LH 3HKDA 1Z2GA 1HW7A 4JI0O 4PDMA 5CB4B 4LF8O 2Q67A 1KUQA 3U10A 3AG3C 4DV7B 3ZRWB 4IT5A 2LP7A 2DOSA 3CP1A 2OIEA 3RN4A 1GM9A 4RUEA 4TWKA 3N2KA 1HNXB 3N27A 1VQ6V 5LMUB 4DV2O 3IJ4A 2F93B 2N05A 1YJ9V 4DV5O 2GV9A 4EKWA 4YJ3A 3JD1A 4JZGA 5B1BC 1OCCB 4JTAB 4FLTA 1MA1A 2WLKA 3UO3A 4G2KA 4DR7B 2H3OA 4X9QA 1PKXA 2O57A 1GN3A 1ZAUA 2EZPA 1NR7A 2JDIG 5CA1B 4O4HA 4X64O 2PUSA 2CAZC 3RBZA 1VMGA 1CP9A 1VF6A 4FM0A 1BS3A 4TV9B 3K03A 4NKGB 1K5SA 4JI6O 1OCCC 4D6TH 4F6EA 1FS0G 1R1BA 4KUMA 3K0DA 3CMAV 4LF6B 2CTRA 2WLNA 2ZINA 1BMFG 1DLBA 1JFFB 1JOYA 1IBMO 4LFAO 2XAQA 1J5EO 4J7KA 3K57A 3H1JH 1I0HA 5J2UA 5GTIZ 3GVMA 1VQOV 3W7SA 3SPHA 2WA3A 3CC7V 3JAKB 4YHHO 1NQTA 5LHIA 2QWPB 1M1KW 5LXTB 1F4MA 2BTOA 4UUJC 4YXWG 3U0ZA 2OT5A 4I0XA 5CBHA 1XNRB 5LOVA 1BQZA 4CBCA 1PD3A 1NBMG 3MAQA 2OIGA 2QM4A 3JSLA 5L3BA 3TXQA 1XHZA 2OYQA 4J7JA 4ICGA 1SF9A 3APQA 5KUKA 4EB6A 1P49A 3ABKB 4IHJA 5JVDA 2F23A 1J95A 1ZTEA 3E89A 2X6BA 4EEQA 4FLYA 4I55B 2ZR2A 4X1KB 3TGUH 2BTQB 3H01A 5LHGA 1XMQO 3A0HZ 4GCZA 4DYLA 5FPOA 5JJEB 5EIBC 2IJIA 5C8YB 4NR1A 5JCOA 4CZZA 3ZBHA 4DR5O 4FFBA 3RW0A 3T1YO 3D36A 3CE2A 1G6UA 3OEEG 4LBEC 4GYCB 3B4SA 3CJHA 2QGNA 1HNWB 1P7BA 3A2FA 3L9DA 3FB6C 2A3QA 4O2BA 3B8NA 1E1QG 5IYDO 1V54C 4NVPA 1EM1A 4LFBB 4FLUA 1YHQV 1S5LZ 1NR1A 4PDRA 4DR2B 3K3WA 1IXMA 3OAAG 5B1OA 2HHHO 4K0KB 2PGGA 4BWAA 1EBOA 3JATA 1LR1A 4UFZA 3RYIB 3HR0A 2XNDG 1Z5VA 5KMGB 4H44B 1GH6A 5J9PC 3CSXA 1KD1W 2E76B 4PD4F 4LR3A 1OCRB 1K3EA 3B2EE 5FNVA 4AQYO 4QJFB 4JI4B 2ZDIA 2E74B 2ZM6B 2XHBA 2N74A 2L35A 3A0RA 1AILA 4QE7A 4UVAA 4JI7O 3G6EV 2ZT9B 5KAIZ 1SS3A 2EILC 3ICXA 4I9WA 5LMNB 4YY3O 1N4CA 3ZS8C 3P32A 1HDJA 1Y74A 2H8PC 4LH7A 1WLEA 4O4JA 2WLIA 4XBFA 2RN9A 1PL0A 3AG7A 5LP6B 2UU9O 4KXRA 1QLEC 2DYRB 2F66C 3SYAA 4ZHQA 4LF7B 4X1YA 3ZMUA 3LSUA 3OTOO 3CCVV 1YDXA 1K8AW 4JYAB 4J9ZB 3ZN0A 2FB5A 5BXZA 1TVKA 3CCQV 4NXNB 3DXRA 1AR1B 4O4LB 3D8CA 5EZYB 1U96A 3UKMA 3IGAC 3E2EA 5KHHA 5B66Z 4X62O 2UUCB 3A0BZ 4YJ2B 1NTKH 2DYRC 4MVMA 3OW2U 2DWEC 2XTAA 1N0NA 4J80A 5KAFZ 1Y76A 3QVNA 2VQFO 1US6A 5EIBD 2M7WA 3BHPA 1R6KA 2VQEO 1M56B 4UCVA 1XNQO 3S3XA 2UXCO 3SJQC 4LF5O 3AK2A 2FYUH 3IC7A 3B40A 2YI9A 4MTGA 2Y69C 4PA3A 1WJZA 2CUGA 2QWNB 1H2KA 3RGBA 4ZOLB 2X6AA 1EN4A 4WFFA 1FKAO 4RO2A 4TQFA 2DYSC 2RDCA 4IIJB 1VQ8V 1QU7A 4Z2WA 1SRYA 1SA0B 4Z1VA 2KSDA 1GO3F 3JALA 3FYEB 1H8HG 5IDJA 5EBWC 4QIWF 3WB0A 5IJ9A 4JI8O 4N23A 2CGOA 2WLHA 1SETA 3TCUA 4DV3O 2BSKB 3ZEDA 1Q82W 4GKKO 1CXZB 2QTOA 2D2CB 4QE9A 4FVMA 4TOIA 4FZ0A 1PL4A 2FMLA 3QO7A 4OX9B 1FXKC 2DE0X 4LFBO 4HBNA 5H6RA 1O9HA 1YIJV 4TV8B 4J9YB 1R3KC 5EC1C 3H1IH 5A2QN 1WA8A 5FLXN 4J10A 4JI0B 4QPKA 1AB3A 3JAWB 1F23A 1OCOC 3RYFB 4LF8B 2PI4A 4DV4O 1P84F 2DW4A 1TAEA 4FLVA 4BIOA 3CYOA 2X7RB 4DV2B 1RSOA 3WFVA 4LNUB 4DV5B 1YVWA 3RYCA 4GUNA 1DK1A 1M57C 2JGDB 4BR6A 3ASOC 2ODMA 4YIPA 5JJJB 3AK1A 3SPJA 2G38A 3ZMSA 5H6QA 2PYJA 5GONA 2EJ7A 4ABMA 1ZWIC 3DTUB 4RWUA 1KYOF 2WLLA 1S76D 4X1IB 4X64B 3H1KH 2JEUA 3ABUA 3LDDA 2JVDA 4JYCA 4PI2A 3HKBA 1LNQA 4JI2O 3F5WC 4WFEA 3BABA 3RYHA 3W7TA 4FZ1A 3HKCB 2Q68A 4KP4A 4JI6B 4TUYA 3U11A 3W7XA 4FIPC 3AG4C 4I5SA 2LGWA 1L8DA 4WFBV 1OCZB 2IM9A 3SPIA 1FFXB 1VF5B 1IBMB 1WB8A 4LFAB 2ARHA 3L71H 1J5EB 3OTFA 5CBFA 2FL4A 1TUEB 4D7TA 1HP8A 4YHHB 3D3IA 4CC6A 2P22C 3JAMN 1F51A 4R6ZA 2Z3YA 4DO2A 5CB4A 1G4YB 1LUWA 4FLZA 3ZRWA 1GM7A 1GK9A 4B08A 4CH5A 1Q8IA 3ZHVA 1MSDA 1MZEA 3S3WA 4K35A 3Q4HB 3ETQA 2KG7B 2DJVA 2R9IA 5DEDA 3OMAB 5L3FA 2KB1A 3OGCC 4X89A 2Q69A 4CC5A 4DUZO 2OTLV 3CCUV 4FMTA 1GM8A 3VOUA 3JD3A 1SERA 1K34A 5ITZB 2VRZA 2DWDC 3RFRA 5CA1A 3K5NA 4LWSB 4NYKA 3BRCA 1SESA 1MMMA 1XMQB 4H0LB 2XAFA 1T5EA 5IY5B 1G8MA 4DR5B 2W6JG 3T1YB 3ZX6A 4X8AA 4P9OA 4TV9A 3UT5B 4JTCB 4X20A 4NXMO 2VWKA 3AG2C 2UUAO 5JQGB 5CA0B 4GLXA 2W6IG 5BMVB 5CA3A 2B1GA 1I08A 2ZE5A 3AG3B 2EJRA 4JAVA 3KCYA 1K4CC 4H33A 5B3SC 3J80N 3SGIA 2QWOB 1GMGA 3J7AU 1JJ2U 2NNUA 3JAKA 2HHHB 5B1BB 3SYOA 4U3JB 3ZCCA 3QO8A 1YZBA 1YF2A 3HB3B 1AROP 1Z5WA 3WG7B 1N32O 1M90W 3MD0A 1FXHA 3L70H 2H94A 3CD6V 4X65O 1EFRG 4AQYB 2AGAA 3ABLB 1JA8A 2LGQA 1KKCA
chains in the Genus database with same CATH topology
3H1IH 2BCCH 3L71H 1NTZH 4U3FH 1SQVH 1L0LH 3H1HH 1PP9H 1SQXH 1SQBH 1BCCH 2A06H 3H1JH 1PPJH 3L74H 3TGUH 3BCCH 3L75H 1EZVH 3CXHF 3L70H 1L0NH 3CWBH 1NU1H 1P84F 2IBZH 3L72H 3H1LH 1BGYH 4PD4F 4D6TH 1KB9F 1SQPH 1BE3H 2FYUH 1NTKH 1KYOF 3H1KH 3L73H 1NTMH 5KLVH 3CX5F 1SQQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I H;  2BCC H;  3L71 H;  1NTZ H;  4U3F H;  1SQV H;  1L0L H;  3H1H H;  1PP9 H;  1SQX H;  1SQB H;  1BCC H;  2A06 H;  3H1J H;  1PPJ H;  3L74 H;  3TGU H;  3BCC H;  3L75 H;  1EZV H;  3CXH F;  3L70 H;  1L0N H;  3CWB H;  1NU1 H;  1P84 F;  2IBZ H;  3L72 H;  3H1L H;  1BGY H;  4PD4 F;  4D6T H;  1KB9 F;  1SQP H;  1BE3 H;  2FYU H;  1NTK H;  1KYO F;  3H1K H;  3L73 H;  1NTM H;  5KLV H;  3CX5 F;  1SQQ H; 
#chains in the Genus database with same CATH topology
 4K8Z A;  1P4R A;  5LHH A;  4JI7 B;  4UCS A;  3O9O A;  4RAI A;  3ABT A;  1DF4 A;  4I55 A;  2ZNI A;  1WAZ A;  3WG7 C;  4YY3 B;  3ZHS A;  2BTQ A;  4BW5 A;  4DRX B;  2N04 A;  1AR5 A;  5C8Y A;  2R72 A;  4AI8 A;  3DGE A;  3TET A;  4G27 B;  3ABL C;  1KQS U;  2UU9 B;  4PA9 A;  4O4I B;  3JAS B;  4Q20 A;  2WPD G;  1EZV H;  1AVM A;  1XMO O;  1UJW B;  2LW7 A;  3B77 A;  1Q6U A;  2HKO A;  4O2A B;  4MVS A;  3OTO B;  1VQM V;  2IJK A;  1V9P A;  2DN9 A;  1D5A A;  1Q3E A;  4I50 B;  2MK3 A;  4DV1 O;  1IBK O;  3UQ8 A;  3I5D A;  4PHZ A;  1JJO A;  2LW1 A;  3T1H B;  3OT7 A;  2ZNJ A;  2QKS A;  4DR1 O;  1WP8 A;  4FLX A;  3CC4 V;  3BA9 A;  4FK5 C;  4X62 B;  3RYI A;  3JD2 A;  5KMG A;  1H2N A;  3FAV B;  1KB9 F;  4ASU G;  2YI8 A;  1R3L C;  2YXY A;  4I4T A;  4P30 A;  3RVZ A;  5JH7 B;  2QR4 A;  1HWY A;  3ZRS A;  2XUM A;  5KA5 A;  1HNZ O;  1L1F A;  2Q0A A;  2VQF B;  2YSU B;  3N2G B;  2BOC C;  1W0K G;  1ZLZ A;  3E8F A;  2P4V A;  2YIB D;  1TUB B;  2VQE B;  4BIZ A;  1F4N A;  5IYZ A;  1XNQ B;  2UXC B;  4LF5 B;  4I7Z B;  4I9Q A;  2QWR B;  4L87 A;  1NH2 B;  3K0G A;  2ZE7 A;  3CCE V;  4D7S A;  5FPR A;  1NTZ H;  4MVQ A;  1V54 B;  4J41 A;  1SQB H;  2V1D A;  3L74 H;  1K92 A;  3UM7 A;  5LP6 A;  3OUF A;  4LFC O;  3RVY A;  2PYL A;  3MDS A;  4YIO A;  3ZHQ A;  4JI8 B;  2CTQ A;  3BY6 A;  4UCT A;  1BQ0 A;  4DV3 B;  4EFE A;  2ILM A;  1MOF A;  2P4K A;  1K5Q A;  1VQP V;  4GX1 A;  4GKK B;  3ZIA G;  4NTX A;  2EBO A;  4WBN B;  1E79 G;  2OCC B;  5KX5 B;  5EZY A;  1QR8 A;  5KUM A;  4GX5 A;  5J2T B;  4PDV A;  1NTM H;  4YJ2 A;  2X6C A;  4JPR A;  1OJH A;  2EIL B;  2Q4P A;  1URF A;  4DV4 B;  3B8M A;  2WAM A;  3JAR B;  4TQD A;  3TJT A;  4PEL A;  2RMK B;  5EBM C;  2FKX A;  3W7U A;  2ZXW B;  2AW9 A;  2RNB A;  1VIB A;  1JPX A;  2OCC C;  3OD4 A;  1V55 B;  1GN2 A;  1SZT A;  1WPB A;  1QLE B;  1VF6 C;  3L75 H;  3C90 A;  4UCO A;  1QHT A;  2IBZ H;  4IIJ A;  3JCU Z;  3EFF K;  1Q6H A;  1NVP B;  1SA0 A;  4OPA A;  1VQ7 V;  4ZIB A;  5JJN B;  3SPG A;  4DK1 A;  5TIS Z;  3RWR D;  2LO1 A;  1GRJ A;  3HKE B;  1VQ5 V;  5LBQ A;  4JI3 O;  5D5Q A;  4JI2 B;  2ZKO A;  2V4D A;  3K9A A;  2ZXW C;  3ZHT A;  4GZR B;  2F43 G;  1R3I C;  1V55 C;  3G80 A;  4CS4 A;  3K04 A;  2BSK A;  3THO A;  1BGY H;  1ZL8 B;  1BE3 H;  3EVK A;  4ZI7 B;  2CK3 G;  3SYC A;  1XRE A;  2QJ1 A;  1W0J G;  1B6Q A;  2NN4 A;  3T1H O;  3M7M X;  4TV8 A;  2ATK C;  2ZQM A;  1YTF B;  3TK1 A;  1KMI Z;  2Y69 B;  4C7U A;  5IJ0 B;  1K97 A;  4LP8 A;  3RYF A;  2KKW A;  4JI1 O;  3WB2 A;  2FTK A;  1P7G A;  3BEH A;  2GHY A;  4DV6 O;  1RFY A;  2DYS B;  1PNL A;  2VS0 A;  4O2B B;  1BL8 A;  1KEC A;  1I7F A;  1JX9 A;  2XAG A;  4LNU A;  5B1A C;  3CRA A;  3BFR A;  5GW7 A;  2JS3 A;  4LCU C;  2JGD A;  1BHA A;  4OPH A;  1ORQ C;  2K9P A;  3H1L H;  2F95 B;  4DUZ B;  2IH1 C;  1R73 A;  1EN5 A;  1YJN V;  5JCO C;  3JAT B;  1N34 O;  4PI0 A;  1NH2 D;  2D3O W;  3D36 C;  1AJP A;  3QO5 A;  4IYI A;  1FJG O;  3C3S A;  2JJ2 G;  4OXS A;  1XIL A;  2UXB O;  5F2V O;  2EIN C;  4DR4 O;  1O9G A;  1KP2 A;  1PV0 A;  2NLJ C;  3NR7 A;  1FXK B;  2Y48 A;  1JQ0 A;  4MVO A;  1THZ A;  2RJZ A;  1SQP H;  2P90 A;  3HKC A;  4NXM B;  4U7N A;  2Q9L A;  2UUA B;  5DN6 G;  2WLJ A;  1OCO B;  3BA8 A;  3EHB B;  4DXW A;  1FFX A;  1DGS A;  4KL1 A;  4MW3 A;  2EIK B;  3CRM A;  2GTS A;  2BE3 A;  3J81 N;  4TSF G;  4XDL A;  1Y74 B;  1BHB A;  1GN6 A;  1NJI W;  2YID A;  1DF5 A;  1AP6 A;  1IVS A;  1M57 B;  3ZHR A;  3VQW A;  3IFX A;  3ASO B;  2HLD G;  3JD4 A;  2ZDI C;  2LQT A;  4Z1M G;  1N32 B;  2XOK G;  3DSQ A;  4UB6 Z;  4XDK A;  4AHC A;  4W4L A;  4WFG A;  4TT3 G;  1Q5O A;  4J42 A;  4X65 B;  4H37 A;  2V7Q G;  2YIB A;  1NT2 B;  4E2L A;  2EIK C;  1TVK B;  3OUS A;  4E4E A;  1IBL O;  4EFB A;  1NKD A;  3DXR B;  3F5T A;  4DK0 A;  1RM1 C;  3GWO A;  2UUB O;  1AI7 A;  3FB7 C;  5IE9 A;  3CXC U;  2E5L O;  3D3Q A;  4X88 A;  5JWP A;  1N33 O;  3AG4 B;  1JVM A;  2XT9 A;  4LWS A;  2A9H A;  1KKD A;  4FM1 A;  3FKS G;  1YEW A;  1NVP D;  4B7E A;  1VF7 A;  3SPC A;  3CB2 A;  3E22 B;  1FD9 A;  4MVU A;  3UT5 A;  2EX3 A;  1VQ9 V;  1COW G;  5JQG A;  1SKV A;  4QPJ A;  1XMO B;  5BMV A;  2B1I A;  4JYY A;  3T1C A;  2BOB C;  3E86 A;  4UCU A;  2VWJ A;  1BZK A;  2QSA A;  5C93 A;  1S0V A;  1H2G A;  4DR3 O;  4DV1 B;  4MTO A;  5IYB O;  1IBK B;  3AG1 C;  5EC2 C;  3FB8 C;  3CEI A;  2GSM B;  1FYJ A;  2P6J A;  4MT8 A;  1M4U A;  4DR1 B;  5E1A C;  4KFM A;  4HZ3 A;  1D2D A;  1R3J C;  1I5Y A;  2HVK C;  4AIL C;  2WSS G;  2GBO A;  3X2Q C;  2Z0A A;  1KC8 W;  1YTF D;  2F4V O;  1S3J A;  3OGI B;  4P9P A;  1I94 O;  3M8A A;  4LC1 A;  1XL4 A;  4B3M O;  2XAS A;  5IJ9 B;  4OGQ B;  4DR6 O;  1F7Y A;  1EN6 A;  2PTM A;  1HNZ B;  5L3E A;  3VBB A;  1NS1 A;  1PM9 A;  3LDE A;  1Y66 A;  3CRR A;  1UFI A;  2RQ6 A;  3K5M A;  2PY5 A;  2EIM B;  2GTA A;  4JAS A;  3AG2 B;  5L3D A;  4DUY O;  2ZE6 A;  2Q8V A;  5EK0 A;  3BVO A;  5LYJ B;  1MG1 A;  2YIA A;  1B06 A;  4DRX A;  2LFR A;  5LGN A;  4NTW A;  4HNA B;  2WLM A;  4WFA V;  1VQ4 V;  1H8E G;  5B3S B;  1S72 V;  1X59 A;  2ITC C;  2QE7 G;  4J11 A;  1WPX A;  4MW8 A;  4LFC B;  3JAS A;  4J7Z A;  4PDL A;  1M5I A;  1RSO B;  4DV0 O;  3FYI B;  4CS3 A;  3RYC B;  3LDC A;  3QNE A;  4L8J A;  1SC5 B;  4O2A A;  1DTO A;  2EIM C;  4X66 O;  3FD9 A;  4I50 A;  1VEW A;  4JV5 O;  3ZHU A;  4FJC C;  2Y0I A;  1N0J A;  4FLW A;  1JFF A;  2A79 B;  1XQ8 A;  1X4T A;  2WLL B;  4WF9 V;  3KKY A;  1Y67 A;  1N36 O;  2W0X A;  3ZMZ A;  4W4K A;  5BY1 A;  4UVC A;  5EYP B;  3A8T A;  1QNM A;  1I5X A;  1Y4M A;  2IH3 C;  2B9Z A;  3FAV A;  3SYQ A;  1GN4 A;  4PV1 B;  5LXT A;  2QEX V;  1YIT V;  4GKJ O;  1IDS A;  5D5P A;  3H1H H;  5JH7 A;  3LNN A;  3ML0 A;  1K33 A;  4B3R O;  2EZO A;  1QQC A;  5KA6 A;  4FM2 A;  5H9C A;  3N2G A;  3JYC A;  3OMI B;  3ZN1 A;  4DW0 A;  1ROP A;  3HPL C;  1RPR A;  3E8B A;  2ZE8 A;  4RQE A;  3IAY A;  3ABM C;  2JJ1 G;  1FFT B;  3JD0 A;  4JTD B;  2CTP A;  2IU3 A;  1SQF A;  2QTS A;  4XDJ A;  1JMK C;  2Q6A A;  3BPZ A;  2JRI A;  2WWW A;  4X1K A;  3K79 A;  3G6B A;  2GUZ B;  4JI3 B;  1QLN A;  2Y0P A;  4MVR A;  2HEP A;  5KLV H;  3CX5 F;  1VAR A;  2JIZ G;  3STZ C;  3G4S V;  3ZRX A;  2HJF C;  3SDL A;  4GX2 A;  3L72 H;  2YDE A;  5GTH Z;  4GX0 A;  4WBN A;  4NB5 A;  5L3G A;  2CH7 B;  5KX5 A;  2EUL A;  2YEV B;  1M9N A;  3B09 A;  5J2T A;  2BCC H;  2OCH A;  3SJA C;  2YS8 A;  3CME V;  2XAH A;  1BCC H;  2UXD O;  4KHP O;  2B5U A;  4F6R B;  4X20 B;  4JI1 B;  3UO2 A;  1WNS A;  2Q73 A;  4MTX A;  4DV6 B;  4UV9 A;  3JAR A;  3SR2 C;  1N8R W;  3DC6 A;  4MTF A;  3IC9 A;  1AP5 A;  2HP8 A;  4B3T O;  2E75 B;  4JI5 O;  4UVB A;  5LA6 B;  3CHX A;  2OTJ V;  2DQ0 A;  3E8H A;  2KQX A;  4WFH A;  5B5E Z;  1HR0 O;  1B3Q A;  3VQX A;  1N34 B;  2Y4U A;  1K4D C;  1OHH G;  5LGU A;  5H5N A;  2DQ3 A;  4JF3 A;  3E8G A;  1TGO A;  4MVZ A;  1FJG B;  3HKD B;  4B7K A;  4B3S O;  4LF4 O;  1S77 D;  3TXS A;  2P7T C;  2UXB B;  3HKE A;  4DR4 B;  3T4Z A;  3FX7 A;  1AI5 A;  5KHG A;  1TA8 A;  2AHY A;  1XOU A;  1H2L A;  2XAJ A;  2Y4T A;  1XHX A;  3N2K B;  5BR8 O;  3OR7 C;  3UCS C;  4MS2 A;  1ZL8 A;  4YJ3 B;  3CCM V;  5IWA O;  3E83 A;  3ASN B;  4ZI7 A;  1SQQ H;  3I56 V;  2UXN A;  3ETD A;  4NTY A;  2ZD9 A;  2P67 A;  1AR4 A;  2JS5 A;  2ZR3 A;  4LF9 O;  5LGT A;  1YSC A;  1H2M A;  2PZS A;  1XDC A;  1H38 A;  2IU0 A;  3GWK C;  4O4L A;  4O4H B;  4R8C A;  5IJ0 A;  1NZ6 A;  4H13 B;  3EXA A;  4ZBM A;  2DMX A;  5CN0 A;  3OM3 B;  3ABK C;  2M6Y A;  5DM6 V;  2A06 H;  3MHH C;  3ASN C;  2QKA A;  3JCZ A;  1ZX3 A;  1MNG A;  2A0L A;  1QVG U;  1IBL B;  3CS5 A;  1AI4 A;  3CCL V;  1KBH A;  2UUB B;  4A5U B;  5B1N A;  2E5L B;  5J2U B;  2LJ2 A;  1S5J A;  1N33 B;  2ETN A;  4ZOL A;  3BCC H;  1Y6X A;  3VQY A;  3F7V C;  3GB7 C;  1S5H C;  4I0X B;  3ZMV A;  2ITD C;  4I4T B;  3K9S A;  5KHK A;  4JYB A;  5LOV B;  4DV7 O;  1FXK A;  4ZKI A;  2HVJ C;  1IXB A;  1SZX A;  1Q43 A;  1CPY A;  1D5N A;  1HNX O;  3W7W A;  2ZCE A;  5LMU O;  4U3F H;  1H2S B;  3OMN B;  5IYZ B;  2C2A A;  1VQL V;  4UB8 Z;  1W2B U;  2Q0O C;  4PJ0 Z;  4EB6 B;  4DR7 O;  2ADQ B;  4DR3 B;  4IHJ B;  5JVD B;  4CH3 A;  1Q81 W;  4K3A A;  1FXV A;  2HJD A;  4PA6 A;  5K1X A;  3SJC C;  2CE4 A;  2LFS A;  5B1A B;  1XUQ A;  1OCR C;  4Q6G A;  5K1P A;  1GAX A;  3OEH G;  5DEC A;  1WB7 A;  2F4V B;  4JZ2 A;  1I94 B;  4FFB B;  4HAM A;  4B3M B;  3JAW A;  3PN1 A;  4DR6 B;  2IJJ A;  3CJH B;  2Q7E A;  2YXH A;  2EIN B;  3QG5 A;  4LF6 O;  1ZSP A;  3QTC A;  3AEI A;  3SJB C;  3QF7 A;  4R50 A;  4G28 B;  3K06 A;  1JCH A;  1IZ3 A;  1YI2 V;  1FAF A;  4DUY B;  2P5O A;  3LNM B;  2X0L A;  5LP6 C;  3JSN A;  3LUT B;  2YXL A;  3ZRV A;  4FPP A;  3FB5 C;  4DW1 A;  3F7Y C;  1XNR O;  1MAB G;  4CS2 A;  3APO A;  1XL6 A;  4WCE V;  3G67 A;  4BAY A;  4X1I A;  1WP7 A;  3E22 A;  2ZIO A;  2W0F C;  1RP3 B;  3KG2 A;  2MW2 B;  3ETG A;  5HFL A;  2HG5 C;  2QWQ B;  1VP7 A;  4DV0 B;  4FFK A;  5FNV B;  5H2F Z;  4CH4 A;  1M93 A;  3SYP A;  4F4L A;  2CDY A;  1KU9 A;  4UXN A;  4X66 B;  1FPO A;  1A32 A;  1PNM A;  4JV5 B;  4IGG A;  1Q6I A;  2YC0 A;  1AJQ A;  1PP9 H;  3WB1 A;  5HFM A;  4MSW C;  3LSQ A;  1PNK A;  2JK5 C;  1N36 B;  1K9M W;  3BAA A;  2JEX A;  1QR9 A;  1WN7 A;  2CGN A;  1RM1 B;  4O4J B;  3T4D A;  3I55 V;  2WLI B;  3DC5 A;  1JR9 A;  4BIU A;  5L3C A;  4IL6 Z;  1M56 C;  3CPW U;  4GKJ B;  2JGU A;  2AXT Z;  1LUV A;  3RT3 C;  3OFN G;  1GKF A;  4B3R B;  2HFE C;  3OR6 C;  1HNW O;  2Z5U A;  3CCS V;  4ZHQ B;  4X1Y B;  1YXB A;  1XBL A;  3Q4H A;  3G71 V;  2F1M A;  2KG7 A;  2K1E A;  3C3T A;  3CCJ V;  3M99 B;  4DR2 O;  3R66 A;  1B04 A;  2OWO A;  5LYJ A;  2HR3 A;  4K0K O;  4JAA A;  4CH6 A;  2EIJ B;  5BZB A;  1SQX H;  4HNA A;  3ZMT A;  4PA4 A;  4N21 A;  5ITZ A;  1ENV A;  3AG1 B;  4UCR A;  2L6L A;  2IW5 A;  2Q7H A;  1BT8 A;  1RPO A;  2R9R B;  2AHZ A;  2WA4 A;  1AI6 A;  3O65 A;  2QM7 A;  3WU2 Z;  1AJN A;  5E79 Z;  3L73 H;  1Y76 B;  1CEZ A;  3X2Q B;  4JI4 O;  1NI8 A;  3K5O A;  3H9V A;  2ZM6 O;  2QDO A;  1Q7Y W;  5CA0 A;  3CRQ A;  3CRC A;  3T2M A;  3P30 A;  5IT9 N;  2EIJ C;  1YCI A;  1U97 A;  2RCV A;  1XI1 A;  4RQF A;  2P06 A;  3P3P A;  5FL7 G;  5LMN O;  2PI5 A;  4LH6 A;  1R6N A;  4IYH A;  3K5L A;  3CC2 V;  1QVF U;  3KZI Z;  5KHI A;  2NR5 A;  1K7D A;  1G1X B;  5CMU A;  5EYP A;  1R6T A;  4K8X A;  3E35 A;  2UXX A;  2UXD B;  3NXS A;  4U3J A;  4KHP B;  1ZUQ A;  2QM8 A;  3CXH F;  3STL C;  3JAL B;  3K59 A;  3PJS K;  1QCE A;  4RUF A;  4LF7 O;  4R7C A;  5IYC O;  3ETE A;  1MSW D;  4B3T B;  1E1R G;  4JYA O;  2QA4 V;  4JI5 B;  2CTW A;  4QGP A;  4NXN O;  1MZF A;  1EZJ A;  1HR0 B;  1Q86 W;  5KHJ A;  1IX9 A;  2R9A A;  3P3N A;  2UUC O;  1YJW V;  4B3S B;  4LF4 B;  1OV9 A;  5AG2 A;  1WA8 B;  5LL6 Y;  2GUZ A;  4BW9 A;  1KP3 A;  1K73 W;  1OCZ C;  1SQG A;  4PA7 A;  1QBZ A;  2YUA A;  3AK3 A;  1IUR A;  3CWB H;  4GT1 A;  1VQK V;  2E3C A;  4O4I A;  5BR8 B;  1OZ0 A;  1VQN V;  5IWA B;  2Q5Z A;  2IJH A;  2ADP A;  1GTO A;  4UV8 A;  5EBL C;  4QNH B;  2GDS A;  2CH7 A;  1SQV H;  2AZ0 A;  3CCR V;  2YEV A;  3VQV A;  3R65 A;  1PPJ H;  5GON B;  4LF9 B;  1L0N H;  1NU1 H;  5A9G A;  3ABM B;  4JGS A;  3LSS A;  3ZJZ A;  2ZIM A;  4P2Z A;  4F6R A;  3HKB B;  1Q90 D;  3RYH B;  3FFQ A;  1XEQ A;  2YIC A;  3MHS C;  4U7O A;  4TUY B;  1BSM A;  2AZ2 A;  2PF4 E;  1W59 A;  3KCX A;  5LA6 A;  2QKC A;  3K58 A;  1TUB A;  5CBG A;  3K08 A;  4HYO A;  5IY5 C;  3OE7 G;  4OX9 O;  2A7W A;  2R70 A;  1UPG A;  4JAU A;  2Q7G A;  1L0L H;  3HKD A;  1Z2G A;  1HW7 A;  4JI0 O;  4PDM A;  5CB4 B;  4LF8 O;  2Q67 A;  1KUQ A;  3U10 A;  3AG3 C;  4DV7 B;  3ZRW B;  4IT5 A;  2LP7 A;  2DOS A;  3CP1 A;  2OIE A;  3RN4 A;  1GM9 A;  4RUE A;  4TWK A;  3N2K A;  1HNX B;  3N27 A;  1VQ6 V;  5LMU B;  4DV2 O;  3IJ4 A;  2F93 B;  2N05 A;  1YJ9 V;  4DV5 O;  2GV9 A;  4EKW A;  4YJ3 A;  3JD1 A;  4JZG A;  5B1B C;  1OCC B;  4JTA B;  4FLT A;  1MA1 A;  2WLK A;  3UO3 A;  4G2K A;  4DR7 B;  2H3O A;  4X9Q A;  1PKX A;  2O57 A;  1GN3 A;  1ZAU A;  2EZP A;  1NR7 A;  2JDI G;  5CA1 B;  4O4H A;  4X64 O;  2PUS A;  2CAZ C;  3RBZ A;  1VMG A;  1CP9 A;  1VF6 A;  4FM0 A;  1BS3 A;  4TV9 B;  3K03 A;  4NKG B;  1K5S A;  4JI6 O;  1OCC C;  4D6T H;  4F6E A;  1FS0 G;  1R1B A;  4KUM A;  3K0D A;  3CMA V;  4LF6 B;  2CTR A;  2WLN A;  2ZIN A;  1BMF G;  1DLB A;  1JFF B;  1JOY A;  1IBM O;  4LFA O;  2XAQ A;  1J5E O;  4J7K A;  3K57 A;  3H1J H;  1I0H A;  5J2U A;  5GTI Z;  3GVM A;  1VQO V;  3W7S A;  3SPH A;  2WA3 A;  3CC7 V;  3JAK B;  4YHH O;  1NQT A;  5LHI A;  2QWP B;  1M1K W;  5LXT B;  1F4M A;  2BTO A;  4UUJ C;  4YXW G;  3U0Z A;  2OT5 A;  4I0X A;  5CBH A;  1XNR B;  5LOV A;  1BQZ A;  4CBC A;  1PD3 A;  1NBM G;  3MAQ A;  2OIG A;  2QM4 A;  3JSL A;  5L3B A;  3TXQ A;  1XHZ A;  2OYQ A;  4J7J A;  4ICG A;  1SF9 A;  3APQ A;  5KUK A;  4EB6 A;  1P49 A;  3ABK B;  4IHJ A;  5JVD A;  2F23 A;  1J95 A;  1ZTE A;  3E89 A;  2X6B A;  4EEQ A;  4FLY A;  4I55 B;  2ZR2 A;  4X1K B;  3TGU H;  2BTQ B;  3H01 A;  5LHG A;  1XMQ O;  3A0H Z;  4GCZ A;  4DYL A;  5FPO A;  5JJE B;  5EIB C;  2IJI A;  5C8Y B;  4NR1 A;  5JCO A;  4CZZ A;  3ZBH A;  4DR5 O;  4FFB A;  3RW0 A;  3T1Y O;  3D36 A;  3CE2 A;  1G6U A;  3OEE G;  4LBE C;  4GYC B;  3B4S A;  3CJH A;  2QGN A;  1HNW B;  1P7B A;  3A2F A;  3L9D A;  3FB6 C;  2A3Q A;  4O2B A;  3B8N A;  1E1Q G;  5IYD O;  1V54 C;  4NVP A;  1EM1 A;  4LFB B;  4FLU A;  1YHQ V;  1S5L Z;  1NR1 A;  4PDR A;  4DR2 B;  3K3W A;  1IXM A;  3OAA G;  5B1O A;  2HHH O;  4K0K B;  2PGG A;  4BWA A;  1EBO A;  3JAT A;  1LR1 A;  4UFZ A;  3RYI B;  3HR0 A;  2XND G;  1Z5V A;  5KMG B;  4H44 B;  1GH6 A;  5J9P C;  3CSX A;  1KD1 W;  2E76 B;  4PD4 F;  4LR3 A;  1OCR B;  1K3E A;  3B2E E;  5FNV A;  4AQY O;  4QJF B;  4JI4 B;  2ZDI A;  2E74 B;  2ZM6 B;  2XHB A;  2N74 A;  2L35 A;  3A0R A;  1AIL A;  4QE7 A;  4UVA A;  4JI7 O;  3G6E V;  2ZT9 B;  5KAI Z;  1SS3 A;  2EIL C;  3ICX A;  4I9W A;  5LMN B;  4YY3 O;  1N4C A;  3ZS8 C;  3P32 A;  1HDJ A;  1Y74 A;  2H8P C;  4LH7 A;  1WLE A;  4O4J A;  2WLI A;  4XBF A;  2RN9 A;  1PL0 A;  3AG7 A;  5LP6 B;  2UU9 O;  4KXR A;  1QLE C;  2DYR B;  2F66 C;  3SYA A;  4ZHQ A;  4LF7 B;  4X1Y A;  3ZMU A;  3LSU A;  3OTO O;  3CCV V;  1YDX A;  1K8A W;  4JYA B;  4J9Z B;  3ZN0 A;  2FB5 A;  5BXZ A;  1TVK A;  3CCQ V;  4NXN B;  3DXR A;  1AR1 B;  4O4L B;  3D8C A;  5EZY B;  1U96 A;  3UKM A;  3IGA C;  3E2E A;  5KHH A;  5B66 Z;  4X62 O;  2UUC B;  3A0B Z;  4YJ2 B;  1NTK H;  2DYR C;  4MVM A;  3OW2 U;  2DWE C;  2XTA A;  1N0N A;  4J80 A;  5KAF Z;  1Y76 A;  3QVN A;  2VQF O;  1US6 A;  5EIB D;  2M7W A;  3BHP A;  1R6K A;  2VQE O;  1M56 B;  4UCV A;  1XNQ O;  3S3X A;  2UXC O;  3SJQ C;  4LF5 O;  3AK2 A;  2FYU H;  3IC7 A;  3B40 A;  2YI9 A;  4MTG A;  2Y69 C;  4PA3 A;  1WJZ A;  2CUG A;  2QWN B;  1H2K A;  3RGB A;  4ZOL B;  2X6A A;  1EN4 A;  4WFF A;  1FKA O;  4RO2 A;  4TQF A;  2DYS C;  2RDC A;  4IIJ B;  1VQ8 V;  1QU7 A;  4Z2W A;  1SRY A;  1SA0 B;  4Z1V A;  2KSD A;  1GO3 F;  3JAL A;  3FYE B;  1H8H G;  5IDJ A;  5EBW C;  4QIW F;  3WB0 A;  5IJ9 A;  4JI8 O;  4N23 A;  2CGO A;  2WLH A;  1SET A;  3TCU A;  4DV3 O;  2BSK B;  3ZED A;  1Q82 W;  4GKK O;  1CXZ B;  2QTO A;  2D2C B;  4QE9 A;  4FVM A;  4TOI A;  4FZ0 A;  1PL4 A;  2FML A;  3QO7 A;  4OX9 B;  1FXK C;  2DE0 X;  4LFB O;  4HBN A;  5H6R A;  1O9H A;  1YIJ V;  4TV8 B;  4J9Y B;  1R3K C;  5EC1 C;  3H1I H;  5A2Q N;  1WA8 A;  5FLX N;  4J10 A;  4JI0 B;  4QPK A;  1AB3 A;  3JAW B;  1F23 A;  1OCO C;  3RYF B;  4LF8 B;  2PI4 A;  4DV4 O;  1P84 F;  2DW4 A;  1TAE A;  4FLV A;  4BIO A;  3CYO A;  2X7R B;  4DV2 B;  1RSO A;  3WFV A;  4LNU B;  4DV5 B;  1YVW A;  3RYC A;  4GUN A;  1DK1 A;  1M57 C;  2JGD B;  4BR6 A;  3ASO C;  2ODM A;  4YIP A;  5JJJ B;  3AK1 A;  3SPJ A;  2G38 A;  3ZMS A;  5H6Q A;  2PYJ A;  5GON A;  2EJ7 A;  4ABM A;  1ZWI C;  3DTU B;  4RWU A;  1KYO F;  2WLL A;  1S76 D;  4X1I B;  4X64 B;  3H1K H;  2JEU A;  3ABU A;  3LDD A;  2JVD A;  4JYC A;  4PI2 A;  3HKB A;  1LNQ A;  4JI2 O;  3F5W C;  4WFE A;  3BAB A;  3RYH A;  3W7T A;  4FZ1 A;  3HKC B;  2Q68 A;  4KP4 A;  4JI6 B;  4TUY A;  3U11 A;  3W7X A;  4FIP C;  3AG4 C;  4I5S A;  2LGW A;  1L8D A;  4WFB V;  1OCZ B;  2IM9 A;  3SPI A;  1FFX B;  1VF5 B;  1IBM B;  1WB8 A;  4LFA B;  2ARH A;  3L71 H;  1J5E B;  3OTF A;  5CBF A;  2FL4 A;  1TUE B;  4D7T A;  1HP8 A;  4YHH B;  3D3I A;  4CC6 A;  2P22 C;  3JAM N;  1F51 A;  4R6Z A;  2Z3Y A;  4DO2 A;  5CB4 A;  1G4Y B;  1LUW A;  4FLZ A;  3ZRW A;  1GM7 A;  1GK9 A;  4B08 A;  4CH5 A;  1Q8I A;  3ZHV A;  1MSD A;  1MZE A;  3S3W A;  4K35 A;  3Q4H B;  3ETQ A;  2KG7 B;  2DJV A;  2R9I A;  5DED A;  3OMA B;  5L3F A;  2KB1 A;  3OGC C;  4X89 A;  2Q69 A;  4CC5 A;  4DUZ O;  2OTL V;  3CCU V;  4FMT A;  1GM8 A;  3VOU A;  3JD3 A;  1SER A;  1K34 A;  5ITZ B;  2VRZ A;  2DWD C;  3RFR A;  5CA1 A;  3K5N A;  4LWS B;  4NYK A;  3BRC A;  1SES A;  1MMM A;  1XMQ B;  4H0L B;  2XAF A;  1T5E A;  5IY5 B;  1G8M A;  4DR5 B;  2W6J G;  3T1Y B;  3ZX6 A;  4X8A A;  4P9O A;  4TV9 A;  3UT5 B;  4JTC B;  4X20 A;  4NXM O;  2VWK A;  3AG2 C;  2UUA O;  5JQG B;  5CA0 B;  4GLX A;  2W6I G;  5BMV B;  5CA3 A;  2B1G A;  1I08 A;  2ZE5 A;  3AG3 B;  2EJR A;  4JAV A;  3KCY A;  1K4C C;  4H33 A;  5B3S C;  3J80 N;  3SGI A;  2QWO B;  1GMG A;  3J7A U;  1JJ2 U;  2NNU A;  3JAK A;  2HHH B;  5B1B B;  3SYO A;  4U3J B;  3ZCC A;  3QO8 A;  1YZB A;  1YF2 A;  3HB3 B;  1ARO P;  1Z5W A;  3WG7 B;  1N32 O;  1M90 W;  3MD0 A;  1FXH A;  3L70 H;  2H94 A;  3CD6 V;  4X65 O;  1EFR G;  4AQY B;  2AGA A;  3ABL B;  1JA8 A;  2LGQ A;  1KKC A; 
#chains in the Genus database with same CATH homology
 3H1I H;  2BCC H;  3L71 H;  1NTZ H;  4U3F H;  1SQV H;  1L0L H;  3H1H H;  1PP9 H;  1SQX H;  1SQB H;  1BCC H;  2A06 H;  3H1J H;  1PPJ H;  3L74 H;  3TGU H;  3BCC H;  3L75 H;  1EZV H;  3CXH F;  3L70 H;  1L0N H;  3CWB H;  1NU1 H;  1P84 F;  2IBZ H;  3L72 H;  3H1L H;  1BGY H;  4PD4 F;  4D6T H;  1KB9 F;  1SQP H;  1BE3 H;  2FYU H;  1NTK H;  1KYO F;  3H1K H;  3L73 H;  1NTM H;  5KLV H;  3CX5 F;  1SQQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...