4D6TH

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 65
sequence length 65
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4d6tH00
3BCCH 3H1IH 5KLVH 1SQQH 1KYOF 1NTMH 3L73H 1BE3H 3L74H 3H1LH 3H1KH 1NTKH 3CWBH 4U3FH 2A06H 1NU1H 3H1HH 2IBZH 1SQBH 1L0LH 2BCCH 4D6TH 1SQVH 3CX5F 4PD4F 1PPJH 3CXHF 2FYUH 1EZVH 3L70H 1PP9H 3L75H 1NTZH 1BCCH 3L71H 3H1JH 1SQPH 1SQXH 1P84F 3TGUH 1BGYH 3L72H 1L0NH 1KB9F
chains in the Genus database with same CATH superfamily
3OE7G 4NXNO 1AR5A 2E74B 3SYOA 1NU1H 1MOFA 4O2BB 4DR5B 1OCZB 1FXHA 2Q4PA 2PY5A 2ZR2A 3P32A 1BMFG 1KP2A 5EYPA 1K5QA 1AP6A 1MNGA 1A32A 1IBLB 2F43G 5CBGA 2A7WA 3VBBA 4X64B 4TUYB 4MTXA 1H2KA 1J5EB 2WWWA 2RJZA 4YJ2A 3FB8C 1XNRB 1FD9A 3ZHVA 3JAWA 2VWJA 3BABA 2HP8A 2Q0OC 4IIJA 2IM9A 1EBOA 3HKDA 1IVSA 5FPOA 1PNMA 2X6AA 2F4VB 2DE0X 4ABMA 1KKCA 1GO3F 1QR9A 2JEUA 2QM7A 4EFEA 1V55C 4X1IA 3CC7V 1YITV 2KKWA 3D3IA 3K5LA 4AQYB 1S3JA 3IC7A 1R1BA 2HKOA 2RCVA 4I0XA 1EM1A 3E8FA 1W0KG 1DK1A 1SQBH 4ZHQB 1L8DA 2PF4E 4R6ZA 4K35A 2GHYA 4PDLA 1RPOA 4B3TB 1AI4A 1OCOB 3N27A 4DR1B 1YSCA 4EB6B 2P22C 2OT5A 4NR1A 1IBKB 1S77D 3C3SA 2HHHO 4JYBA 4TQDA 1SA0B 2XAGA 3A0RA 3E35A 1YIJV 3CCLV 2YICA 1IURA 3AEIA 1OCCC 4UB8Z 3IJ4A 3JAMN 1PL0A 2RQ6A 4I5SA 2VS0A 1JJ2U 1KP3A 3ZJZA 4BR6A 3STZC 3MAQA 1D5AA 2KG7B 2X0LA 1KMIZ 1SQPH 1VQ4V 4HAMA 4L8JA 5J2UB 2OTJV 3WG7B 5KAIZ 1P7BA 4U7OA 1BZKA 2XNDG 1CEZA 3HKEA 5IYZA 2RN9A 4GLXA 3G80A 5L3GA 1H2GA 1XMQB 3SYQA 3AG2C 5IYCO 3GWOA 4TOIA 1Q86W 1MZEA 1GN4A 1VF7A 3W7XA 2Y0IA 1VIBA 3F5WC 2XASA 2PTMA 5CB4B 4AI8A 4GKJB 4LF8O 4HNAB 4K0KO 5EBMC 3T1CA 1VQ8V 3G6EV 4P30A 1BE3H 4GCZA 4LFAB 4FIPC 1QNMA 1FXKC 3CRQA 2ADQB 1GK9A 4D7SA 1R6NA 1K4DC 3BRCA 1U96A 3E22A 3EFFK 3NR7A 2E3CA 4DRXA 2NN4A 2BTQA 2AXTZ 3F7YC 1RP3B 3A8TA 3ABKC 4XDLA 3QNEA 1Q43A 1VQ6V 5JVDA 2R72A 3N2GA 1AI6A 2Q68A 2WLLA 3A0HZ 4W4LA 5LXTB 4I9QA 5JCOC 2GSMB 1K34A 2ZXWB 2F66C 2E75B 4QE7A 4IHJB 2YEVA 4MVQA 1NR7A 4UXNA 3ABMC 1Y6XA 2ZNJA 2A9HA 2P6JA 3B09A 1LR1A 4ZOLA 1FXKA 1GM8A 1M1KW 4NXMO 4OPAA 4FPPA 2JRIA 5L3EA 2HG5C 5IT9N 1Q82W 4B3RB 4IYHA 2XTAA 3FX7A 4WBNB 1P84F 2O57A 3BY6A 5JCOA 2YXYA 3CHXA 2B9ZA 4JASA 4RQEA 1GMGA 4P9PA 1AJNA 1H8HG 4R8CA 1IBMB 3FKSG 4TSFG 4YY3B 1Y74B 2EIJB 4DV3B 3MHHC 4O2AA 1Z5VA 2JJ1G 5LYJB 1OCRB 3OTOO 3T1HO 4H44B 3BAAA 1ZL8B 2IJIA 1I94B 2CE4A 3ZCCA 1MZFA 2QKAA 3AK3A 4LF6O 1SZXA 1N8RW 2GBOA 1B6QA 2EJRA 3E2EA 2DQ0A 3FD9A 3OMIB 1HR0O 1ORQC 2H3OA 2CTRA 1NKDA 5BMVB 4PI2A 1MG1A 3VQWA 4K3AA 1QLEB 2IU0A 2ZINA 2RMKB 4X62O 4AILC 4JTDB 5LOVA 4B3SB 3CCVV 5KHJA 2VQEB 4JTAB 5B66Z 5LGUA 3CSXA 2ZKOA 3TGUH 3CXCU 1H2LA 1FAFA 3T2MA 1YCIA 1XMOO 5EK0A 5B1BB 4PDMA 4UUJC 1I08A 3BVOA 4MVMA 3AG4C 2DWEC 4KXRA 4LR3A 3GB7C 4K0KB 3QTCA 3CCUV 1W0JG 2XT9A 4IGGA 4GKKB 2EIMB 1M56B 4X1YB 2E5LB 4LF9O 3OT7A 5IY5B 3GVMA 4DR6B 2Q67A 2JVDA 3ETGA 2AGAA 4LH7A 1BQ0A 5B1AB 4YHHO 2DWDC 3M99B 5D5QA 1KC8W 1TA8A 1N0JA 3FB6C 1OZ0A 3UM7A 5IE9A 3GWKC 3SYCA 3Q4HA 4U3JB 1WNSA 3OTFA 2HLDG 3OFNG 4NB5A 5F2VO 2P5OA 1HNWB 4KHPO 2GUZB 2JGDB 4GX0A 5H6QA 3HKCA 3IC9A 3K9AA 1WLEA 2CGNA 3F5TA 4LF7B 4DR2B 1RFYA 2MW2B 3LUTB 4WCEV 3D36C 4BAYA 4NTXA 1K9MW 1WB8A 4UVAA 3CCMV 4JZ2A 1JFFA 3QO7A 2PYJA 2EBOA 3TK1A 1DLBA 3RBZA 1KECA 1EN5A 2A06H 4UFZA 1K4CC 4DW1A 1KKDA 1GRJA 3X2QB 1FJGB 1JQ0A 4GT1A 1UJWB 3ABLC 2QKSA 1AR1B 2YI9A 5IJ0B 4DR7O 1COWG 3AG3C 4MS2A 4LF5O 4O4IB 1F51A 2Y69B 4ICGA 4JZGA 1TVKB 1WA8A 3JATB 3FAVA 1S76D 4J9ZB 5GONB 4G28B 5KAFZ 1GN6A 3UT5B 3W7TA 1ZX3A 1V54B 2K9PA 5B1NA 3T1HB 1N36B 5J2TA 3E8BA 4P2ZA 5LA6A 1I7FA 1XILA 3D36A 4X65O 2YIBA 4O4LB 4PV1B 1AI5A 3OGIB 1XBLA 4TV8A 3ZHTA 1VQNV 1Q6UA 4LH6A 2WLJA 1N32O 3RYHA 2DN9A 2Q9LA 5HFLA 3CWBH 2WLIB 4JI8O 4N21A 3M8AA 2UU9O 4Q6GA 2BE3A 2HEPA 2OCCB 1XEQA 3U10A 3W7UA 2AZ2A 5GW7A 1F4NA 4O4JB 1DTOA 4F6RA 4ASUG 2UUCB 4EEQA 4NKGB 3RWRD 1HNXB 3DC5A 1H38A 4FJCC 4QE9A 4J7ZA 2FL4A 2ZCEA 2UXDB 4DV0O 3JD4A 3CC4V 5CN0A 3CE2A 3EXAA 2ETNA 2AW9A 3TXSA 2LJ2A 2A0LA 5L3BA 4Z1VA 5ITZB 3I55V 5BR8B 4RQFA 5EZYB 2P4VA 4DV1O 1JOYA 2XHBA 3OEEG 3DXRA 5IDJA 4DV7O 1SS3A 5CA1B 2CDYA 3ASNB 3VQXA 2JIZG 4YJ3B 4LFCB 1NS1A 4LWSA 2DJVA 3JAKB 1RSOB 2JJ2G 4I50B 1HNZO 2D3OW 3JSLA 1K8AW 1VQMV 5LP6B 2QKCA 4X20A 3K9SA 4B3MO 1XNQO 5LHGA 4X66O 2Q73A 3CMAV 1Q8IA 1Y67A 2ZIOA 5A2QN 4J42A 1MMMA 4WFAV 5CA0B 1BSMA 5CBFA 1PNLA 1KD1W 4CS3A 1QCEA 1WB7A 3JARA 3SDLA 5L3FA 1O9HA 3H1KH 3S3XA 1VQ9V 4JAVA 2RNBA 4MVOA 2WSSG 4O4HA 5IYBO 3O9OA 3IFXA 4JI6B 2V7QG 4BIZA 3M7MX 3K57A 1K92A 1RPRA 3RW0A 5FNVA 4YJ2B 5K1XA 2EINC 3TJTA 4DR4O 4UCTA 4TWKA 5E1AC 2OWOA 5EC2C 1IDSA 5JQGA 4FK5C 4DW0A 4DV6B 3P30A 3CMEV 2N05A 1FXVA 3OR6C 3H1IH 1R3IC 4MTOA 3IAYA 1VQLV 4O2BA 3G67A 5B3SB 3P3NA 2YC0A 5IWAB 4H33A 2XAHA 3STLC 1DF5A 1N34O 4I0XB 3CB2A 1K97A 3QF7A 3N2KB 1N32B 1SQXH 1G4YB 4H0LB 5D5PA 1SRYA 4DV5B 4TUYA 2XUMA 1R3KC 1IX9A 1N0NA 1VF5B 4DYLA 3ZHUA 1GN2A 3JYCA 1SC5B 3E89A 1OCOC 4JI7O 4JI0B 3ZRSA 4D7TA 4UV8A 4OX9B 3ZMSA 4CH6A 2WLMA 3RYIB 1KUQA 3SPIA 3LNNA 3G71V 3WU2Z 1Y66A 4LF4O 4BW9A 3DC6A 4G27B 1WJZA 3E83A 4QPKA 2YIAA 3B8NA 5EBLC 2H94A 2ZDIC 2IJJA 1TUBB 1G1XB 4JI5B 4CH5A 2OCHA 1ENVA 1KU9A 1MABG 1HP8A 1TAEA 2QE7G 3HKEB 3K08A 3AK1A 4LFBB 1EZJA 1X4TA 4MTGA 3WG7C 4OXSA 3KZIZ 2XAJA 1N33B 3L70H 2UXCB 2BOBC 4ZHQA 2HJDA 2DQ3A 3K5OA 1W2BU 2R9IA 1QHTA 3ZBHA 4EB6A 1SESA 1SQGA 1GM9A 3H1JH 1JR9A 5JH7B 3E22B 3BA9A 4P9OA 4DRXB 3CEIA 1XOUA 1YVWA 2ZDIA 3OD4A 4FM1A 1WP8A 3H01A 2JEXA 2X7RB 2WLKA 2KG7A 1UFIA 2IH1C 1VQ7V 2UUBB 5J2UA 2WLLB 4DR3B 1PP9H 2RDCA 1NVPD 3CRCA 3ICXA 2L6LA 1K33A 5C93A 2QR4A 3KG2A 4NXNB 1VEWA 2KB1A 2EZOA 2YEVB 4DUZO 2EIKB 2EX3A 1E79G 3FB5C 2QGNA 3H1HH 3ZMVA 4I9WA 2ZR3A 2BCCH 3LNMB 1FXKB 3D8CA 4YIPA 5JWPA 3MHSC 5K1PA 3CRRA 4F4LA 1BT8A 5LHIA 2VQFO 2ZIMA 4YIOA 4FLZA 3ABKB 3ZHSA 4ZI7B 1US6A 4DUYO 1NZ6A 3VOUA 2FMLA 3F7VC 1SQVH 1CP9A 1K5SA 4QPJA 3K06A 5EC1C 4QGPA 2N04A 3P3PA 5LXTA 2ZM6O 1AJQA 1N4CA 2NLJC 2DYSB 2P90A 4JI4O 1VARA 2EIJC 4IHJA 4HZ3A 2VWKA 4UCOA 4MT8A 3JALB 1GM7A 1M9NA 4JAUA 3VQVA 3WB2A 3K03A 4JI1O 2Z5UA 1MSWD 2NNUA 4FLYA 3S3WA 2P67A 3K5NA 3L72H 2EILB 3KCYA 5EBWC 4JI2O 2QWOB 4I7ZB 4EFBA 1ZSPA 1VQPV 1L0LH 3CXHF 5DECA 4CH4A 2HHHB 2LGWA 4PA6A 3CPWU 5LOVB 1NBMG 1FFXB 5HFMA 1QLEC 1DGSA 3CCEV 5J9PC 1D2DA 5DEDA 5LYJA 2UXXA 1WN7A 3HR0A 2OYQA 1M93A 2PI4A 2LW1A 4UV9A 1ZL8A 2UXBO 1WAZA 1FS0G 3E86A 1TGOA 2ODMA 5B1BC 3U11A 3L73H 3UQ8A 3SGIA 1E1RG 3H1LH 3ABUA 2AZ0A 5LMUO 2KQXA 3ZX6A 3QVNA 2DYRC 3AG1C 4LF8B 5JJNB 1QQCA 4FM2A 1M56C 1Q5OA 4X1KB 1FPOA 3QG5A 4CS4A 1R73A 4JYAO 1QLNA 3HKBA 2G38A 3WB0A 1YDXA 2HR3A 1FFTB 1VP7A 2EZPA 2UUAO 5LGNA 3RFRA 1F7YA 2F93B 1J95A 2W6IG 4JV5O 3OW2U 4GX2A 4FFBB 1Z2GA 4I55B 3CCJV 1AI7A 1YHQV 2BOCC 1BHAA 3RVYA 4J41A 1Q7YW 3W7WA 2QTOA 4J9YB 2W0FC 1JX9A 3A2FA 1LUVA 3FYEB 5KHGA 2JDIG 3ASOB 4NVPA 1JFFB 2YIBD 4X1YA 3AK2A 4FVMA 1S72V 1L1FA 1NTZH 4PDRA 1YF2A 2JS3A 4BWAA 3RYFB 5DN6G 1FKAO 4NXMB 5BZBA 4UB6Z 2KSDA 5LGTA 2IW5A 2HFEC 1RM1C 3X2QC 1NQTA 1M4UA 3ZHRA 3RYCA 1M57B 1K7DA 2Q69A 4GUNA 4IYIA 3TXQA 5IJ9B 1MSDA 4U3JA 2Y69C 5LL6Y 4DR5O 1I5XA 2OIGA 2ZNIA 5J2TB 3ABTA 5B5EZ 2GUZA 5LA6B 2JGDA 3AG7A 3FYIB 1XI1A 1SZTA 4CC5A 4JTCB 3BPZA 4MW8A 4WFFA 3LSUA 3I5DA 1XHXA 3K3WA 3ZRWA 4DV4O 3OTOB 1JPXA 2YDEA 1IBLO 2ZE7A 5KUMA 3PJSK 4FZ0A 4X64O 2LP7A 4OPHA 3RVZA 2B1IA 3RT3C 3AG3B 1QVGU 1J5EO 4PJ0Z 2B5UA 1F23A 4LNUB 4LF6B 3MD0A 4KL1A 1XNRO 4L87A 1M90W 1G8MA 3ZRXA 3CYOA 4NTYA 4UVBA 2P06A 2IJKA 3CCQV 2N74A 1HR0B 5KX5B 2R9RB 4GYCB 4J7JA 4IT5A 2ZE8A 3UO3A 1B3QA 2F4VO 5GONA 4I4TB 4YXWG 1HDJA 3UT5A 3OEHG 2GTSA 1QBZA 4MTFA 4X62B 2WPDG 3OMAB 2YXLA 4NYKA 4AQYO 3T1YO 4K8ZA 1XREA 4MVZA 4XDJA 4TV9B 3SR2C 1YTFD 4CC6A 4FLXA 3ZS8C 3LDDA 3SJCC 4Z1MG 4FLTA 1XL4A 1NH2D 1XMOB 1R6KA 3SPCA 1GKFA 2CH7B 4B3TO 4DR1O 4J7KA 5KHKA 1NTMH 1B04A 3NXSA 1IBKO 5KA6A 4H13B 2ZQMA 3K0GA 2ZE5A 1Q3EA 3ASNC 1IXBA 5KMGB 4X20B 4LF9B 4O4JA 1X59A 2B1GA 2ADPA 3U0ZA 2QM8A 3CJHA 5IYDO 3KKYA 4YHHB 5EIBC 5KA5A 2X6BA 5LMNO 4X88A 3B2EE 5C8YB 1YZBA 4Q20A 3J7AU 4GZRB 2QA4V 1NH2B 3JD0A 2ILMA 5ITZA 2K1EA 1VQKV 1SQFA 1SF9A 4O4HB 3DSQA 3RN4A 2LGQA 4KHPB 1D5NA 1ZAUA 1XUQA 1KYOF 4GKJO 1VMGA 1VQ5V 3BHPA 3JD2A 3ZHQA 2F95B 5EYPB 4MVRA 1OCZC 4YJ3A 1NR1A 2BSKA 4BIUA 4LFAO 3JAKA 3ZN0A 5JJJB 2HVKC 4I50A 1PL4A 2Q7EA 4ZIBA 3WB1A 5JQGB 1DF4A 2QEXV 1R3JC 3JASA 1JMKC 4QJFB 3JAWB 4FZ1A 1NI8A 4DR7B 1Y76A 4IIJB 5CA0A 1Q81W 4LF5B 1M5IA 1EZVH 3HKDB 3L75H 3ZEDA 4FFKA 2ZT9B 4N23A 2Y0PA 3B77A 1K73W 2YSUB 2DMXA 1PKXA 1H2NA 1ROPA 5B3SC 3B40A 4DV4B 1EN4A 5GTHZ 4X1IB 2EINB 3HPLC 4X65B 2FTKA 3K58A 4DXWA 1AB3A 1THZA 1WPXA 2HVJC 1BCCH 2CK3G 4R50A 1XHZA 3C3TA 2Y48A 2WLHA 4PHZA 2CTPA 4JI8B 4XBFA 3LDCA 1SQQH 2QJ1A 4B3RO 2UU9B 4HYOA 4X89A 3K59A 4TQFA 3FB7C 3CX5F 1XL6A 2LFRA 2LFSA 4CBCA 2H8PC 3JD3A 4X9QA 1QR8A 4C7UA 1IBMO 1EFRG 4YY3O 2LQTA 1YEWA 2P4KA 4DV3O 1S5HC 3B8MA 3ETQA 3T1YB 2DW4A 3A0BZ 1V55B 2L35A 4G2KA 1WP7A 3OMNB 4JI3O 1OHHG 4DV0B 5L3DA 4R7CA 4PELA 2AHYA 3L9DA 5H9CA 3N2KA 1O9GA 4UCUA 1I94O 2QWQB 2XAQA 5IYZB 4KUMA 5JJEB 2QTSA 1PM9A 1OV9A 1PNKA 4DV1B 1LUWA 2GTAA 2W6JG 4PA4A 3H9VA 2R70A 1L0NH 2WA4A 1KB9F 2YIDA 3BEHA 4DV7B 2CTQA 3OGCC 3UKMA 4CH3A 1AR4A 3JCZA 3EHBB 5DM6V 1AP5A 4F6EA 2Q7HA 4RUFA 4WFHA 3RYIA 2QSAA 4H37A 4NTWA 2HJFC 2R9AA 1ZLZA 1OCCB 4MVSA 3TETA 1SA0A 5LP6A 5LMNB 1HNZB 2ZE6A 1YJ9V 5LHHA 3SJAC 2ITCC 4B3SO 3CP1A 1TUBA 3B4SA 4LP8A 3ZMZA 5KLVH 2VQEO 1UPGA 4B3MB 1XNQB 4X66B 3APQA 2BTQB 5GTIZ 2XAFA 2LW7A 2WA3A 3ZRVA 4BIOA 1P49A 5JVDB 3N2GB 4U7NA 1EN6A 1B06A 3AG2B 3OUSA 4FMTA 3SPGA 2CAZC 4W4KA 4LBEC 2EIKC 1U97A 1S0VA 1V9PA 2W0XA 2C2AA 4GKKO 2DOSA 1TUEB 4FM0A 2PGGA 2E5LO 2ZXWC 4RAIA 2UXNA 4DR6O 5CB4A 4QIWF 4D6TH 4ZOLB 5JH7A 4J80A 3CC2V 4HNAA 2PYLA 4FLUA 2GV9A 4HBNA 1P7GA 1BHBA 1GTOA 4DR4B 4J11A 4WFBV 4IL6Z 5FL7G 3L74H 3C90A 1BQZA 4DO2A 2IU3A 4DK0A 3CS5A 1NVPB 4MSWC 4B08A 5CBHA 1HNWO 1LNQA 4PA3A 1SERA 2GDSA 4O2AB 1BGYH 4RO2A 4LF7O 3ABMB 5KHIA 2DYSC 4DR2O 1N34B 3W7SA 1AVMA 3K5MA 2OTLV 5H5NA 2QWPB 3SYAA 3SYPA 2Q7GA 2V4DA 1W59A 1Q6HA 1OCRC 3E8GA 5H2FZ 2Q8VA 3L71H 5BXZA 1FJGO 4ZI7A 4B7EA 2EILC 1G6UA 2NR5A 2YXHA 2IJHA 3APOA 3O65A 1CPYA 2ATKC 1SKVA 4JI7B 4CZZA 3OM3B 3ZMUA 3R65A 2EJ7A 2ITDC 2Y4TA 4WBNA 4LF4B 1NT2B 1ZTEA 2OIEA 4JI3B 3SPHA 4B7KA 1N36O 3BCCH 3J80N 3JALA 1URFA 5B1OA 1Y74A 2IH3C 3LSSA 2X6CA 4ZBMA 5A9GA 1QU7A 3ZIAG 4WF9V 1OJHA 3QO8A 3E8HA 4Z2WA 3UO2A 2Y4UA 1GAXA 3OR7C 4GX5A 1H8EG 1MA1A 2CUGA 1I5YA 4WFEA 4MW3A 5CA3A 4J10A 3HKBB 3UCSC 4UCVA 1F4MA 3BA8A 4E2LA 2UUCO 1E1QG 3CRMA 1HNXO 1FFXA 1S5JA 2EIMC 2UXDO 4FLWA 5IY5C 5L3CA 2Q5ZA 3K0DA 3D3QA 4E4EA 5BMVA 1ZWIC 2FB5A 3CRAA 4LC1A 3CCRV 5B1AC 3Q4HB 5BR8O 2P7TC 1Y4MA 3ML0A 4CS2A 2DYRB 3AG4B 1CXZB 3DTUB 3AG1B 2EULA 2Z3YA 3JD1A 4DUZB 1BS3A 3G6BA 3HKCB 4RUEA 1JJOA 3SJBC 3OUFA 4MVUA 1YJNV 1SETA 3ASOC 1JA8A 4LFCO 1Z5WA 4X1KA 4JYYA 1HWYA 1BL8A 1KBHA 3LDEA 1XDCA 2VQFB 3ETEA 4JAAA 3RYCB 3DGEA 2F1MA 2AHZA 4DUYB 5H6RA 2PZSA 4PDVA 4DV2O 1M57C 3HB3B 1ZUQA 1WA8B 4PA7A 4DK1A 4FFBA 1Q90D 1H2MA 3RGBA 4PD4F 2YI8A 4I55A 4TT3G 3FAVB 2FYUH 3G4SV 4WFGA 1S5LZ 2ZM6B 2V1DA 3ZRWB 4JI4B 4X8AA 4EKWA 4JI6O 5KUKA 4LCUC 2CTWA 3ETDA 1RM1B 4TV8B 3T4ZA 1V54C 4JI1B 1PPJH 2VRZA 1FYJA 2QM4A 3ZN1A 3RYHB 3JCUZ 3JSNA 4FLVA 3RYFA 1WPBA 2F23A 4JGSA 3ABLB 4JI2B 5LBQA 2MK3A 1I0HA 5CMUA 3EVKA 1YJWV 4UCSA 1AILA 1PD3A 4DV6O 5FLXN 2E76B 3K79A 5IJ9A 1IZ3A 2A3QA 4UCRA 3VQYA 2QWRB 1KQSU 5IJ0A 2D2CB 1R3LC 4F6RB 2QDOA 2M6YA 4O4IA 5IWAO 2OCCC 4PI0A 3QO5A 1T5EA 1TVKA 5TISZ 2PUSA 1R6TA 3JATA 2JS5A 4JF3A 1GH6A 4XDKA 3SJQC 5E79Z 3KCXA 5BY1A 3CD6V 4DV5O 2UXBB 1Q6IA 1VF6C 4JPRA 1YXBA 4O4LA 3DXRB 2CGOA 5AG2A 3J81N 4LNUA 2JK5C 3FFQA 3THOA 2A79B 3PN1A 2WAMA 1VQOV 2PI5A 4JI0O 5LMUB 4OX9O 2WLIA 2WLNA 1P4RA 3CJHB 4LWSB 3BFRA 4U3FH 5KX5A 1PV0A 4QNHB 2XOKG 3K04A 3SPJA 2YS8A 1GN3A 5EIBD 4JYAB 4I4TA 2ARHA 2QWNB 4JI5O 3IGAC 3TCUA 3T4DA 4JYCA 4LFBO 2BTOA 2UUAB 1AJPA 1H2SB 5LP6C 4TV9A 1YI2V 2M7WA 1N33O 2UXCO 4AHCA 1YTFB 1VF6A 4KFMA 2IBZH 1QVFU 4JV5B 3JARB 3OAAG 4GX1A 2CH7A 3MDSA 1AROP 1JCHA 5EZYA 1XMQO 3LSQA 1K3EA 2BSKB 4RWUA 4KP4A 3WFVA 1JVMA 5CA1A 1NTKH 5KMGA 4ZKIA 2Q0AA 2LO1A 5FNVB 4A5UB 2Z0AA 4K8XA 1HW7A 5KHHA 1IXMA 3JASB 2JGUA 4UVCA 3ZMTA 4OGQB 2FKXA 4BW5A 1RSOA 2YUAA 1Y76B 1XQ8A 3R66A 2Q6AA 3CCSV 1NJIW 3I56V 4DV2B 2UUBO 2ZD9A 5C8YA 4DR3O 5FPRA 4PA9A
chains in the Genus database with same CATH topology
3BCCH 3H1IH 5KLVH 1SQQH 1KYOF 1NTMH 3L73H 1BE3H 3L74H 3H1LH 3H1KH 1NTKH 3CWBH 4U3FH 2A06H 1NU1H 3H1HH 2IBZH 1SQBH 1L0LH 2BCCH 4D6TH 1SQVH 3CX5F 4PD4F 1PPJH 3CXHF 2FYUH 1EZVH 3L70H 1PP9H 3L75H 1NTZH 1BCCH 3L71H 3H1JH 1SQPH 1SQXH 1P84F 3TGUH 1BGYH 3L72H 1L0NH 1KB9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC H;  3H1I H;  5KLV H;  1SQQ H;  1KYO F;  1NTM H;  3L73 H;  1BE3 H;  3L74 H;  3H1L H;  3H1K H;  1NTK H;  3CWB H;  4U3F H;  2A06 H;  1NU1 H;  3H1H H;  2IBZ H;  1SQB H;  1L0L H;  2BCC H;  4D6T H;  1SQV H;  3CX5 F;  4PD4 F;  1PPJ H;  3CXH F;  2FYU H;  1EZV H;  3L70 H;  1PP9 H;  3L75 H;  1NTZ H;  1BCC H;  3L71 H;  3H1J H;  1SQP H;  1SQX H;  1P84 F;  3TGU H;  1BGY H;  3L72 H;  1L0N H;  1KB9 F; 
#chains in the Genus database with same CATH topology
 3OE7 G;  4NXN O;  1AR5 A;  2E74 B;  3SYO A;  1NU1 H;  1MOF A;  4O2B B;  4DR5 B;  1OCZ B;  1FXH A;  2Q4P A;  2PY5 A;  2ZR2 A;  3P32 A;  1BMF G;  1KP2 A;  5EYP A;  1K5Q A;  1AP6 A;  1MNG A;  1A32 A;  1IBL B;  2F43 G;  5CBG A;  2A7W A;  3VBB A;  4X64 B;  4TUY B;  4MTX A;  1H2K A;  1J5E B;  2WWW A;  2RJZ A;  4YJ2 A;  3FB8 C;  1XNR B;  1FD9 A;  3ZHV A;  3JAW A;  2VWJ A;  3BAB A;  2HP8 A;  2Q0O C;  4IIJ A;  2IM9 A;  1EBO A;  3HKD A;  1IVS A;  5FPO A;  1PNM A;  2X6A A;  2F4V B;  2DE0 X;  4ABM A;  1KKC A;  1GO3 F;  1QR9 A;  2JEU A;  2QM7 A;  4EFE A;  1V55 C;  4X1I A;  3CC7 V;  1YIT V;  2KKW A;  3D3I A;  3K5L A;  4AQY B;  1S3J A;  3IC7 A;  1R1B A;  2HKO A;  2RCV A;  4I0X A;  1EM1 A;  3E8F A;  1W0K G;  1DK1 A;  1SQB H;  4ZHQ B;  1L8D A;  2PF4 E;  4R6Z A;  4K35 A;  2GHY A;  4PDL A;  1RPO A;  4B3T B;  1AI4 A;  1OCO B;  3N27 A;  4DR1 B;  1YSC A;  4EB6 B;  2P22 C;  2OT5 A;  4NR1 A;  1IBK B;  1S77 D;  3C3S A;  2HHH O;  4JYB A;  4TQD A;  1SA0 B;  2XAG A;  3A0R A;  3E35 A;  1YIJ V;  3CCL V;  2YIC A;  1IUR A;  3AEI A;  1OCC C;  4UB8 Z;  3IJ4 A;  3JAM N;  1PL0 A;  2RQ6 A;  4I5S A;  2VS0 A;  1JJ2 U;  1KP3 A;  3ZJZ A;  4BR6 A;  3STZ C;  3MAQ A;  1D5A A;  2KG7 B;  2X0L A;  1KMI Z;  1SQP H;  1VQ4 V;  4HAM A;  4L8J A;  5J2U B;  2OTJ V;  3WG7 B;  5KAI Z;  1P7B A;  4U7O A;  1BZK A;  2XND G;  1CEZ A;  3HKE A;  5IYZ A;  2RN9 A;  4GLX A;  3G80 A;  5L3G A;  1H2G A;  1XMQ B;  3SYQ A;  3AG2 C;  5IYC O;  3GWO A;  4TOI A;  1Q86 W;  1MZE A;  1GN4 A;  1VF7 A;  3W7X A;  2Y0I A;  1VIB A;  3F5W C;  2XAS A;  2PTM A;  5CB4 B;  4AI8 A;  4GKJ B;  4LF8 O;  4HNA B;  4K0K O;  5EBM C;  3T1C A;  1VQ8 V;  3G6E V;  4P30 A;  1BE3 H;  4GCZ A;  4LFA B;  4FIP C;  1QNM A;  1FXK C;  3CRQ A;  2ADQ B;  1GK9 A;  4D7S A;  1R6N A;  1K4D C;  3BRC A;  1U96 A;  3E22 A;  3EFF K;  3NR7 A;  2E3C A;  4DRX A;  2NN4 A;  2BTQ A;  2AXT Z;  3F7Y C;  1RP3 B;  3A8T A;  3ABK C;  4XDL A;  3QNE A;  1Q43 A;  1VQ6 V;  5JVD A;  2R72 A;  3N2G A;  1AI6 A;  2Q68 A;  2WLL A;  3A0H Z;  4W4L A;  5LXT B;  4I9Q A;  5JCO C;  2GSM B;  1K34 A;  2ZXW B;  2F66 C;  2E75 B;  4QE7 A;  4IHJ B;  2YEV A;  4MVQ A;  1NR7 A;  4UXN A;  3ABM C;  1Y6X A;  2ZNJ A;  2A9H A;  2P6J A;  3B09 A;  1LR1 A;  4ZOL A;  1FXK A;  1GM8 A;  1M1K W;  4NXM O;  4OPA A;  4FPP A;  2JRI A;  5L3E A;  2HG5 C;  5IT9 N;  1Q82 W;  4B3R B;  4IYH A;  2XTA A;  3FX7 A;  4WBN B;  1P84 F;  2O57 A;  3BY6 A;  5JCO A;  2YXY A;  3CHX A;  2B9Z A;  4JAS A;  4RQE A;  1GMG A;  4P9P A;  1AJN A;  1H8H G;  4R8C A;  1IBM B;  3FKS G;  4TSF G;  4YY3 B;  1Y74 B;  2EIJ B;  4DV3 B;  3MHH C;  4O2A A;  1Z5V A;  2JJ1 G;  5LYJ B;  1OCR B;  3OTO O;  3T1H O;  4H44 B;  3BAA A;  1ZL8 B;  2IJI A;  1I94 B;  2CE4 A;  3ZCC A;  1MZF A;  2QKA A;  3AK3 A;  4LF6 O;  1SZX A;  1N8R W;  2GBO A;  1B6Q A;  2EJR A;  3E2E A;  2DQ0 A;  3FD9 A;  3OMI B;  1HR0 O;  1ORQ C;  2H3O A;  2CTR A;  1NKD A;  5BMV B;  4PI2 A;  1MG1 A;  3VQW A;  4K3A A;  1QLE B;  2IU0 A;  2ZIN A;  2RMK B;  4X62 O;  4AIL C;  4JTD B;  5LOV A;  4B3S B;  3CCV V;  5KHJ A;  2VQE B;  4JTA B;  5B66 Z;  5LGU A;  3CSX A;  2ZKO A;  3TGU H;  3CXC U;  1H2L A;  1FAF A;  3T2M A;  1YCI A;  1XMO O;  5EK0 A;  5B1B B;  4PDM A;  4UUJ C;  1I08 A;  3BVO A;  4MVM A;  3AG4 C;  2DWE C;  4KXR A;  4LR3 A;  3GB7 C;  4K0K B;  3QTC A;  3CCU V;  1W0J G;  2XT9 A;  4IGG A;  4GKK B;  2EIM B;  1M56 B;  4X1Y B;  2E5L B;  4LF9 O;  3OT7 A;  5IY5 B;  3GVM A;  4DR6 B;  2Q67 A;  2JVD A;  3ETG A;  2AGA A;  4LH7 A;  1BQ0 A;  5B1A B;  4YHH O;  2DWD C;  3M99 B;  5D5Q A;  1KC8 W;  1TA8 A;  1N0J A;  3FB6 C;  1OZ0 A;  3UM7 A;  5IE9 A;  3GWK C;  3SYC A;  3Q4H A;  4U3J B;  1WNS A;  3OTF A;  2HLD G;  3OFN G;  4NB5 A;  5F2V O;  2P5O A;  1HNW B;  4KHP O;  2GUZ B;  2JGD B;  4GX0 A;  5H6Q A;  3HKC A;  3IC9 A;  3K9A A;  1WLE A;  2CGN A;  3F5T A;  4LF7 B;  4DR2 B;  1RFY A;  2MW2 B;  3LUT B;  4WCE V;  3D36 C;  4BAY A;  4NTX A;  1K9M W;  1WB8 A;  4UVA A;  3CCM V;  4JZ2 A;  1JFF A;  3QO7 A;  2PYJ A;  2EBO A;  3TK1 A;  1DLB A;  3RBZ A;  1KEC A;  1EN5 A;  2A06 H;  4UFZ A;  1K4C C;  4DW1 A;  1KKD A;  1GRJ A;  3X2Q B;  1FJG B;  1JQ0 A;  4GT1 A;  1UJW B;  3ABL C;  2QKS A;  1AR1 B;  2YI9 A;  5IJ0 B;  4DR7 O;  1COW G;  3AG3 C;  4MS2 A;  4LF5 O;  4O4I B;  1F51 A;  2Y69 B;  4ICG A;  4JZG A;  1TVK B;  1WA8 A;  3JAT B;  3FAV A;  1S76 D;  4J9Z B;  5GON B;  4G28 B;  5KAF Z;  1GN6 A;  3UT5 B;  3W7T A;  1ZX3 A;  1V54 B;  2K9P A;  5B1N A;  3T1H B;  1N36 B;  5J2T A;  3E8B A;  4P2Z A;  5LA6 A;  1I7F A;  1XIL A;  3D36 A;  4X65 O;  2YIB A;  4O4L B;  4PV1 B;  1AI5 A;  3OGI B;  1XBL A;  4TV8 A;  3ZHT A;  1VQN V;  1Q6U A;  4LH6 A;  2WLJ A;  1N32 O;  3RYH A;  2DN9 A;  2Q9L A;  5HFL A;  3CWB H;  2WLI B;  4JI8 O;  4N21 A;  3M8A A;  2UU9 O;  4Q6G A;  2BE3 A;  2HEP A;  2OCC B;  1XEQ A;  3U10 A;  3W7U A;  2AZ2 A;  5GW7 A;  1F4N A;  4O4J B;  1DTO A;  4F6R A;  4ASU G;  2UUC B;  4EEQ A;  4NKG B;  3RWR D;  1HNX B;  3DC5 A;  1H38 A;  4FJC C;  4QE9 A;  4J7Z A;  2FL4 A;  2ZCE A;  2UXD B;  4DV0 O;  3JD4 A;  3CC4 V;  5CN0 A;  3CE2 A;  3EXA A;  2ETN A;  2AW9 A;  3TXS A;  2LJ2 A;  2A0L A;  5L3B A;  4Z1V A;  5ITZ B;  3I55 V;  5BR8 B;  4RQF A;  5EZY B;  2P4V A;  4DV1 O;  1JOY A;  2XHB A;  3OEE G;  3DXR A;  5IDJ A;  4DV7 O;  1SS3 A;  5CA1 B;  2CDY A;  3ASN B;  3VQX A;  2JIZ G;  4YJ3 B;  4LFC B;  1NS1 A;  4LWS A;  2DJV A;  3JAK B;  1RSO B;  2JJ2 G;  4I50 B;  1HNZ O;  2D3O W;  3JSL A;  1K8A W;  1VQM V;  5LP6 B;  2QKC A;  4X20 A;  3K9S A;  4B3M O;  1XNQ O;  5LHG A;  4X66 O;  2Q73 A;  3CMA V;  1Q8I A;  1Y67 A;  2ZIO A;  5A2Q N;  4J42 A;  1MMM A;  4WFA V;  5CA0 B;  1BSM A;  5CBF A;  1PNL A;  1KD1 W;  4CS3 A;  1QCE A;  1WB7 A;  3JAR A;  3SDL A;  5L3F A;  1O9H A;  3H1K H;  3S3X A;  1VQ9 V;  4JAV A;  2RNB A;  4MVO A;  2WSS G;  4O4H A;  5IYB O;  3O9O A;  3IFX A;  4JI6 B;  2V7Q G;  4BIZ A;  3M7M X;  3K57 A;  1K92 A;  1RPR A;  3RW0 A;  5FNV A;  4YJ2 B;  5K1X A;  2EIN C;  3TJT A;  4DR4 O;  4UCT A;  4TWK A;  5E1A C;  2OWO A;  5EC2 C;  1IDS A;  5JQG A;  4FK5 C;  4DW0 A;  4DV6 B;  3P30 A;  3CME V;  2N05 A;  1FXV A;  3OR6 C;  3H1I H;  1R3I C;  4MTO A;  3IAY A;  1VQL V;  4O2B A;  3G67 A;  5B3S B;  3P3N A;  2YC0 A;  5IWA B;  4H33 A;  2XAH A;  3STL C;  1DF5 A;  1N34 O;  4I0X B;  3CB2 A;  1K97 A;  3QF7 A;  3N2K B;  1N32 B;  1SQX H;  1G4Y B;  4H0L B;  5D5P A;  1SRY A;  4DV5 B;  4TUY A;  2XUM A;  1R3K C;  1IX9 A;  1N0N A;  1VF5 B;  4DYL A;  3ZHU A;  1GN2 A;  3JYC A;  1SC5 B;  3E89 A;  1OCO C;  4JI7 O;  4JI0 B;  3ZRS A;  4D7T A;  4UV8 A;  4OX9 B;  3ZMS A;  4CH6 A;  2WLM A;  3RYI B;  1KUQ A;  3SPI A;  3LNN A;  3G71 V;  3WU2 Z;  1Y66 A;  4LF4 O;  4BW9 A;  3DC6 A;  4G27 B;  1WJZ A;  3E83 A;  4QPK A;  2YIA A;  3B8N A;  5EBL C;  2H94 A;  2ZDI C;  2IJJ A;  1TUB B;  1G1X B;  4JI5 B;  4CH5 A;  2OCH A;  1ENV A;  1KU9 A;  1MAB G;  1HP8 A;  1TAE A;  2QE7 G;  3HKE B;  3K08 A;  3AK1 A;  4LFB B;  1EZJ A;  1X4T A;  4MTG A;  3WG7 C;  4OXS A;  3KZI Z;  2XAJ A;  1N33 B;  3L70 H;  2UXC B;  2BOB C;  4ZHQ A;  2HJD A;  2DQ3 A;  3K5O A;  1W2B U;  2R9I A;  1QHT A;  3ZBH A;  4EB6 A;  1SES A;  1SQG A;  1GM9 A;  3H1J H;  1JR9 A;  5JH7 B;  3E22 B;  3BA9 A;  4P9O A;  4DRX B;  3CEI A;  1XOU A;  1YVW A;  2ZDI A;  3OD4 A;  4FM1 A;  1WP8 A;  3H01 A;  2JEX A;  2X7R B;  2WLK A;  2KG7 A;  1UFI A;  2IH1 C;  1VQ7 V;  2UUB B;  5J2U A;  2WLL B;  4DR3 B;  1PP9 H;  2RDC A;  1NVP D;  3CRC A;  3ICX A;  2L6L A;  1K33 A;  5C93 A;  2QR4 A;  3KG2 A;  4NXN B;  1VEW A;  2KB1 A;  2EZO A;  2YEV B;  4DUZ O;  2EIK B;  2EX3 A;  1E79 G;  3FB5 C;  2QGN A;  3H1H H;  3ZMV A;  4I9W A;  2ZR3 A;  2BCC H;  3LNM B;  1FXK B;  3D8C A;  4YIP A;  5JWP A;  3MHS C;  5K1P A;  3CRR A;  4F4L A;  1BT8 A;  5LHI A;  2VQF O;  2ZIM A;  4YIO A;  4FLZ A;  3ABK B;  3ZHS A;  4ZI7 B;  1US6 A;  4DUY O;  1NZ6 A;  3VOU A;  2FML A;  3F7V C;  1SQV H;  1CP9 A;  1K5S A;  4QPJ A;  3K06 A;  5EC1 C;  4QGP A;  2N04 A;  3P3P A;  5LXT A;  2ZM6 O;  1AJQ A;  1N4C A;  2NLJ C;  2DYS B;  2P90 A;  4JI4 O;  1VAR A;  2EIJ C;  4IHJ A;  4HZ3 A;  2VWK A;  4UCO A;  4MT8 A;  3JAL B;  1GM7 A;  1M9N A;  4JAU A;  3VQV A;  3WB2 A;  3K03 A;  4JI1 O;  2Z5U A;  1MSW D;  2NNU A;  4FLY A;  3S3W A;  2P67 A;  3K5N A;  3L72 H;  2EIL B;  3KCY A;  5EBW C;  4JI2 O;  2QWO B;  4I7Z B;  4EFB A;  1ZSP A;  1VQP V;  1L0L H;  3CXH F;  5DEC A;  4CH4 A;  2HHH B;  2LGW A;  4PA6 A;  3CPW U;  5LOV B;  1NBM G;  1FFX B;  5HFM A;  1QLE C;  1DGS A;  3CCE V;  5J9P C;  1D2D A;  5DED A;  5LYJ A;  2UXX A;  1WN7 A;  3HR0 A;  2OYQ A;  1M93 A;  2PI4 A;  2LW1 A;  4UV9 A;  1ZL8 A;  2UXB O;  1WAZ A;  1FS0 G;  3E86 A;  1TGO A;  2ODM A;  5B1B C;  3U11 A;  3L73 H;  3UQ8 A;  3SGI A;  1E1R G;  3H1L H;  3ABU A;  2AZ0 A;  5LMU O;  2KQX A;  3ZX6 A;  3QVN A;  2DYR C;  3AG1 C;  4LF8 B;  5JJN B;  1QQC A;  4FM2 A;  1M56 C;  1Q5O A;  4X1K B;  1FPO A;  3QG5 A;  4CS4 A;  1R73 A;  4JYA O;  1QLN A;  3HKB A;  2G38 A;  3WB0 A;  1YDX A;  2HR3 A;  1FFT B;  1VP7 A;  2EZP A;  2UUA O;  5LGN A;  3RFR A;  1F7Y A;  2F93 B;  1J95 A;  2W6I G;  4JV5 O;  3OW2 U;  4GX2 A;  4FFB B;  1Z2G A;  4I55 B;  3CCJ V;  1AI7 A;  1YHQ V;  2BOC C;  1BHA A;  3RVY A;  4J41 A;  1Q7Y W;  3W7W A;  2QTO A;  4J9Y B;  2W0F C;  1JX9 A;  3A2F A;  1LUV A;  3FYE B;  5KHG A;  2JDI G;  3ASO B;  4NVP A;  1JFF B;  2YIB D;  4X1Y A;  3AK2 A;  4FVM A;  1S72 V;  1L1F A;  1NTZ H;  4PDR A;  1YF2 A;  2JS3 A;  4BWA A;  3RYF B;  5DN6 G;  1FKA O;  4NXM B;  5BZB A;  4UB6 Z;  2KSD A;  5LGT A;  2IW5 A;  2HFE C;  1RM1 C;  3X2Q C;  1NQT A;  1M4U A;  3ZHR A;  3RYC A;  1M57 B;  1K7D A;  2Q69 A;  4GUN A;  4IYI A;  3TXQ A;  5IJ9 B;  1MSD A;  4U3J A;  2Y69 C;  5LL6 Y;  4DR5 O;  1I5X A;  2OIG A;  2ZNI A;  5J2T B;  3ABT A;  5B5E Z;  2GUZ A;  5LA6 B;  2JGD A;  3AG7 A;  3FYI B;  1XI1 A;  1SZT A;  4CC5 A;  4JTC B;  3BPZ A;  4MW8 A;  4WFF A;  3LSU A;  3I5D A;  1XHX A;  3K3W A;  3ZRW A;  4DV4 O;  3OTO B;  1JPX A;  2YDE A;  1IBL O;  2ZE7 A;  5KUM A;  3PJS K;  4FZ0 A;  4X64 O;  2LP7 A;  4OPH A;  3RVZ A;  2B1I A;  3RT3 C;  3AG3 B;  1QVG U;  1J5E O;  4PJ0 Z;  2B5U A;  1F23 A;  4LNU B;  4LF6 B;  3MD0 A;  4KL1 A;  1XNR O;  4L87 A;  1M90 W;  1G8M A;  3ZRX A;  3CYO A;  4NTY A;  4UVB A;  2P06 A;  2IJK A;  3CCQ V;  2N74 A;  1HR0 B;  5KX5 B;  2R9R B;  4GYC B;  4J7J A;  4IT5 A;  2ZE8 A;  3UO3 A;  1B3Q A;  2F4V O;  5GON A;  4I4T B;  4YXW G;  1HDJ A;  3UT5 A;  3OEH G;  2GTS A;  1QBZ A;  4MTF A;  4X62 B;  2WPD G;  3OMA B;  2YXL A;  4NYK A;  4AQY O;  3T1Y O;  4K8Z A;  1XRE A;  4MVZ A;  4XDJ A;  4TV9 B;  3SR2 C;  1YTF D;  4CC6 A;  4FLX A;  3ZS8 C;  3LDD A;  3SJC C;  4Z1M G;  4FLT A;  1XL4 A;  1NH2 D;  1XMO B;  1R6K A;  3SPC A;  1GKF A;  2CH7 B;  4B3T O;  4DR1 O;  4J7K A;  5KHK A;  1NTM H;  1B04 A;  3NXS A;  1IBK O;  5KA6 A;  4H13 B;  2ZQM A;  3K0G A;  2ZE5 A;  1Q3E A;  3ASN C;  1IXB A;  5KMG B;  4X20 B;  4LF9 B;  4O4J A;  1X59 A;  2B1G A;  2ADP A;  3U0Z A;  2QM8 A;  3CJH A;  5IYD O;  3KKY A;  4YHH B;  5EIB C;  5KA5 A;  2X6B A;  5LMN O;  4X88 A;  3B2E E;  5C8Y B;  1YZB A;  4Q20 A;  3J7A U;  4GZR B;  2QA4 V;  1NH2 B;  3JD0 A;  2ILM A;  5ITZ A;  2K1E A;  1VQK V;  1SQF A;  1SF9 A;  4O4H B;  3DSQ A;  3RN4 A;  2LGQ A;  4KHP B;  1D5N A;  1ZAU A;  1XUQ A;  1KYO F;  4GKJ O;  1VMG A;  1VQ5 V;  3BHP A;  3JD2 A;  3ZHQ A;  2F95 B;  5EYP B;  4MVR A;  1OCZ C;  4YJ3 A;  1NR1 A;  2BSK A;  4BIU A;  4LFA O;  3JAK A;  3ZN0 A;  5JJJ B;  2HVK C;  4I50 A;  1PL4 A;  2Q7E A;  4ZIB A;  3WB1 A;  5JQG B;  1DF4 A;  2QEX V;  1R3J C;  3JAS A;  1JMK C;  4QJF B;  3JAW B;  4FZ1 A;  1NI8 A;  4DR7 B;  1Y76 A;  4IIJ B;  5CA0 A;  1Q81 W;  4LF5 B;  1M5I A;  1EZV H;  3HKD B;  3L75 H;  3ZED A;  4FFK A;  2ZT9 B;  4N23 A;  2Y0P A;  3B77 A;  1K73 W;  2YSU B;  2DMX A;  1PKX A;  1H2N A;  1ROP A;  5B3S C;  3B40 A;  4DV4 B;  1EN4 A;  5GTH Z;  4X1I B;  2EIN B;  3HPL C;  4X65 B;  2FTK A;  3K58 A;  4DXW A;  1AB3 A;  1THZ A;  1WPX A;  2HVJ C;  1BCC H;  2CK3 G;  4R50 A;  1XHZ A;  3C3T A;  2Y48 A;  2WLH A;  4PHZ A;  2CTP A;  4JI8 B;  4XBF A;  3LDC A;  1SQQ H;  2QJ1 A;  4B3R O;  2UU9 B;  4HYO A;  4X89 A;  3K59 A;  4TQF A;  3FB7 C;  3CX5 F;  1XL6 A;  2LFR A;  2LFS A;  4CBC A;  2H8P C;  3JD3 A;  4X9Q A;  1QR8 A;  4C7U A;  1IBM O;  1EFR G;  4YY3 O;  2LQT A;  1YEW A;  2P4K A;  4DV3 O;  1S5H C;  3B8M A;  3ETQ A;  3T1Y B;  2DW4 A;  3A0B Z;  1V55 B;  2L35 A;  4G2K A;  1WP7 A;  3OMN B;  4JI3 O;  1OHH G;  4DV0 B;  5L3D A;  4R7C A;  4PEL A;  2AHY A;  3L9D A;  5H9C A;  3N2K A;  1O9G A;  4UCU A;  1I94 O;  2QWQ B;  2XAQ A;  5IYZ B;  4KUM A;  5JJE B;  2QTS A;  1PM9 A;  1OV9 A;  1PNK A;  4DV1 B;  1LUW A;  2GTA A;  2W6J G;  4PA4 A;  3H9V A;  2R70 A;  1L0N H;  2WA4 A;  1KB9 F;  2YID A;  3BEH A;  4DV7 B;  2CTQ A;  3OGC C;  3UKM A;  4CH3 A;  1AR4 A;  3JCZ A;  3EHB B;  5DM6 V;  1AP5 A;  4F6E A;  2Q7H A;  4RUF A;  4WFH A;  3RYI A;  2QSA A;  4H37 A;  4NTW A;  2HJF C;  2R9A A;  1ZLZ A;  1OCC B;  4MVS A;  3TET A;  1SA0 A;  5LP6 A;  5LMN B;  1HNZ B;  2ZE6 A;  1YJ9 V;  5LHH A;  3SJA C;  2ITC C;  4B3S O;  3CP1 A;  1TUB A;  3B4S A;  4LP8 A;  3ZMZ A;  5KLV H;  2VQE O;  1UPG A;  4B3M B;  1XNQ B;  4X66 B;  3APQ A;  2BTQ B;  5GTI Z;  2XAF A;  2LW7 A;  2WA3 A;  3ZRV A;  4BIO A;  1P49 A;  5JVD B;  3N2G B;  4U7N A;  1EN6 A;  1B06 A;  3AG2 B;  3OUS A;  4FMT A;  3SPG A;  2CAZ C;  4W4K A;  4LBE C;  2EIK C;  1U97 A;  1S0V A;  1V9P A;  2W0X A;  2C2A A;  4GKK O;  2DOS A;  1TUE B;  4FM0 A;  2PGG A;  2E5L O;  2ZXW C;  4RAI A;  2UXN A;  4DR6 O;  5CB4 A;  4QIW F;  4D6T H;  4ZOL B;  5JH7 A;  4J80 A;  3CC2 V;  4HNA A;  2PYL A;  4FLU A;  2GV9 A;  4HBN A;  1P7G A;  1BHB A;  1GTO A;  4DR4 B;  4J11 A;  4WFB V;  4IL6 Z;  5FL7 G;  3L74 H;  3C90 A;  1BQZ A;  4DO2 A;  2IU3 A;  4DK0 A;  3CS5 A;  1NVP B;  4MSW C;  4B08 A;  5CBH A;  1HNW O;  1LNQ A;  4PA3 A;  1SER A;  2GDS A;  4O2A B;  1BGY H;  4RO2 A;  4LF7 O;  3ABM B;  5KHI A;  2DYS C;  4DR2 O;  1N34 B;  3W7S A;  1AVM A;  3K5M A;  2OTL V;  5H5N A;  2QWP B;  3SYA A;  3SYP A;  2Q7G A;  2V4D A;  1W59 A;  1Q6H A;  1OCR C;  3E8G A;  5H2F Z;  2Q8V A;  3L71 H;  5BXZ A;  1FJG O;  4ZI7 A;  4B7E A;  2EIL C;  1G6U A;  2NR5 A;  2YXH A;  2IJH A;  3APO A;  3O65 A;  1CPY A;  2ATK C;  1SKV A;  4JI7 B;  4CZZ A;  3OM3 B;  3ZMU A;  3R65 A;  2EJ7 A;  2ITD C;  2Y4T A;  4WBN A;  4LF4 B;  1NT2 B;  1ZTE A;  2OIE A;  4JI3 B;  3SPH A;  4B7K A;  1N36 O;  3BCC H;  3J80 N;  3JAL A;  1URF A;  5B1O A;  1Y74 A;  2IH3 C;  3LSS A;  2X6C A;  4ZBM A;  5A9G A;  1QU7 A;  3ZIA G;  4WF9 V;  1OJH A;  3QO8 A;  3E8H A;  4Z2W A;  3UO2 A;  2Y4U A;  1GAX A;  3OR7 C;  4GX5 A;  1H8E G;  1MA1 A;  2CUG A;  1I5Y A;  4WFE A;  4MW3 A;  5CA3 A;  4J10 A;  3HKB B;  3UCS C;  4UCV A;  1F4M A;  3BA8 A;  4E2L A;  2UUC O;  1E1Q G;  3CRM A;  1HNX O;  1FFX A;  1S5J A;  2EIM C;  2UXD O;  4FLW A;  5IY5 C;  5L3C A;  2Q5Z A;  3K0D A;  3D3Q A;  4E4E A;  5BMV A;  1ZWI C;  2FB5 A;  3CRA A;  4LC1 A;  3CCR V;  5B1A C;  3Q4H B;  5BR8 O;  2P7T C;  1Y4M A;  3ML0 A;  4CS2 A;  2DYR B;  3AG4 B;  1CXZ B;  3DTU B;  3AG1 B;  2EUL A;  2Z3Y A;  3JD1 A;  4DUZ B;  1BS3 A;  3G6B A;  3HKC B;  4RUE A;  1JJO A;  3SJB C;  3OUF A;  4MVU A;  1YJN V;  1SET A;  3ASO C;  1JA8 A;  4LFC O;  1Z5W A;  4X1K A;  4JYY A;  1HWY A;  1BL8 A;  1KBH A;  3LDE A;  1XDC A;  2VQF B;  3ETE A;  4JAA A;  3RYC B;  3DGE A;  2F1M A;  2AHZ A;  4DUY B;  5H6R A;  2PZS A;  4PDV A;  4DV2 O;  1M57 C;  3HB3 B;  1ZUQ A;  1WA8 B;  4PA7 A;  4DK1 A;  4FFB A;  1Q90 D;  1H2M A;  3RGB A;  4PD4 F;  2YI8 A;  4I55 A;  4TT3 G;  3FAV B;  2FYU H;  3G4S V;  4WFG A;  1S5L Z;  2ZM6 B;  2V1D A;  3ZRW B;  4JI4 B;  4X8A A;  4EKW A;  4JI6 O;  5KUK A;  4LCU C;  2CTW A;  3ETD A;  1RM1 B;  4TV8 B;  3T4Z A;  1V54 C;  4JI1 B;  1PPJ H;  2VRZ A;  1FYJ A;  2QM4 A;  3ZN1 A;  3RYH B;  3JCU Z;  3JSN A;  4FLV A;  3RYF A;  1WPB A;  2F23 A;  4JGS A;  3ABL B;  4JI2 B;  5LBQ A;  2MK3 A;  1I0H A;  5CMU A;  3EVK A;  1YJW V;  4UCS A;  1AIL A;  1PD3 A;  4DV6 O;  5FLX N;  2E76 B;  3K79 A;  5IJ9 A;  1IZ3 A;  2A3Q A;  4UCR A;  3VQY A;  2QWR B;  1KQS U;  5IJ0 A;  2D2C B;  1R3L C;  4F6R B;  2QDO A;  2M6Y A;  4O4I A;  5IWA O;  2OCC C;  4PI0 A;  3QO5 A;  1T5E A;  1TVK A;  5TIS Z;  2PUS A;  1R6T A;  3JAT A;  2JS5 A;  4JF3 A;  1GH6 A;  4XDK A;  3SJQ C;  5E79 Z;  3KCX A;  5BY1 A;  3CD6 V;  4DV5 O;  2UXB B;  1Q6I A;  1VF6 C;  4JPR A;  1YXB A;  4O4L A;  3DXR B;  2CGO A;  5AG2 A;  3J81 N;  4LNU A;  2JK5 C;  3FFQ A;  3THO A;  2A79 B;  3PN1 A;  2WAM A;  1VQO V;  2PI5 A;  4JI0 O;  5LMU B;  4OX9 O;  2WLI A;  2WLN A;  1P4R A;  3CJH B;  4LWS B;  3BFR A;  4U3F H;  5KX5 A;  1PV0 A;  4QNH B;  2XOK G;  3K04 A;  3SPJ A;  2YS8 A;  1GN3 A;  5EIB D;  4JYA B;  4I4T A;  2ARH A;  2QWN B;  4JI5 O;  3IGA C;  3TCU A;  3T4D A;  4JYC A;  4LFB O;  2BTO A;  2UUA B;  1AJP A;  1H2S B;  5LP6 C;  4TV9 A;  1YI2 V;  2M7W A;  1N33 O;  2UXC O;  4AHC A;  1YTF B;  1VF6 A;  4KFM A;  2IBZ H;  1QVF U;  4JV5 B;  3JAR B;  3OAA G;  4GX1 A;  2CH7 A;  3MDS A;  1ARO P;  1JCH A;  5EZY A;  1XMQ O;  3LSQ A;  1K3E A;  2BSK B;  4RWU A;  4KP4 A;  3WFV A;  1JVM A;  5CA1 A;  1NTK H;  5KMG A;  4ZKI A;  2Q0A A;  2LO1 A;  5FNV B;  4A5U B;  2Z0A A;  4K8X A;  1HW7 A;  5KHH A;  1IXM A;  3JAS B;  2JGU A;  4UVC A;  3ZMT A;  4OGQ B;  2FKX A;  4BW5 A;  1RSO A;  2YUA A;  1Y76 B;  1XQ8 A;  3R66 A;  2Q6A A;  3CCS V;  1NJI W;  3I56 V;  4DV2 B;  2UUB O;  2ZD9 A;  5C8Y A;  4DR3 O;  5FPR A;  4PA9 A; 
#chains in the Genus database with same CATH homology
 3BCC H;  3H1I H;  5KLV H;  1SQQ H;  1KYO F;  1NTM H;  3L73 H;  1BE3 H;  3L74 H;  3H1L H;  3H1K H;  1NTK H;  3CWB H;  4U3F H;  2A06 H;  1NU1 H;  3H1H H;  2IBZ H;  1SQB H;  1L0L H;  2BCC H;  4D6T H;  1SQV H;  3CX5 F;  4PD4 F;  1PPJ H;  3CXH F;  2FYU H;  1EZV H;  3L70 H;  1PP9 H;  3L75 H;  1NTZ H;  1BCC H;  3L71 H;  3H1J H;  1SQP H;  1SQX H;  1P84 F;  3TGU H;  1BGY H;  3L72 H;  1L0N H;  1KB9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...