4D6TJ

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
PTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 58
sequence length 58
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4d6tJ00
1BGYJ 3L70J 1PP9J 2BCCJ 2IBZI 1BCCJ 1EZVI 3TGUJ 3L73J 1NTZJ 4D6TJ 3CWBJ 1SQQJ 3H1LJ 1SQVJ 1BE3J 4U3FJ 1KB9I 1SQPJ 5KLVJ 4PD4I 1L0LJ 3L71J 2FYUJ 3H1KJ 1NTMJ 3H1IJ 1SQXJ 1NU1J 3L74J 3L72J 3BCCJ 3CX5I 3H1JJ 1NTKJ 1P84I 3L75J 3CXHI 3H1HJ 1L0NJ 1SQBJ 1KYOI
chains in the Genus database with same CATH superfamily
3HD7B 3TF5A 3HUSB 3GLMA 2ZVOB 1WRGA 2JKVA 3VMAA 2WZ7A 1HF9A 3RK3E 1NJIQ 3B4SA 2XKMA 1FOSE 1N7SB 5EFWB 2C0WA 3CCQP 2AXCA 3H1KG 2N9YB 1T3JA 4Y99C 3D71A 1GL2D 2YNYA 2Y0DA 3V2NA 1LT9C 1UIIA 2WSEH 4IFMA 3L72E 2R5BA 1SQBD 1GMJA 1JOCA 5AW8B 3L70J 4QMAA 2M3BA 3MIWA 3F89A 2YO3A 1RF1A 2OYHA 4I7ZC 4K35A 1N8RQ 3L36A 3V2QA 3TYYA 2PGDA 1KILA 1YI2P 1L0LG 1KYOI 3VMZA 5AW1B 2QEXP 2Z5HA 1AVYA 1SQPE 3LW5H 1QGKB 3WUUA 4H44B 1RQUA 3EWKA 2YKQA 5KJ7A 2ZXXA 2OTJP 4UB8E 2OYHB 1RF1B 3L75J 3USSA 4XFJA 4DCKA 5KAIH 3U1CA 2W90A 2N1TD 1S9KD 2OGUA 4R4LA 1PPJD 2NPSA 4H13B 1MV8A 3MHVA 3AE8C 1KTMA 1IC2A 3H1HD 1Q86Q 1FDMA 1M8OB 2IZ1A 3JCUH 2IZ0A 1LWUC 4M3LA 2W6BA 4HH2A 1BGYG 1VQLP 2AEJA 5DJUB 2KNCA 1NTME 1VL2A 2ZFCA 3BRTB 4JBZA 3PLNA 4ASWA 4Y28J 2NPSB 1URQC 1RE4A 1NTZE 2KZJA 1IO4A 3Q5SA 2J5UA 2SPZA 2OTKE 1P84D 2IPPA 1S72P 5KKZB 1SQPK 2KOGA 1MFZA 1NKNA 2GA1A 2IDBA 1FAVA 2HPCA 2E75C 2KNCB 3V4QA 2AXTH 4CPGA 1SQVJ 1LTBC 3H1JD 1YITP 3GHGC 3L74J 4GOFA 1Y9BA 1PP9E 1KB9D 4Z1MH 4AUWA 3LIDA 2IBZG 4PD4E 3CI9A 3HD7D 4YTPC 2HPCB 4IFFA 3BCCE 3Q3DA 1FDIA 5KLVG 2E76B 1NTMK 1N7SD 2JO1A 1EDIA 2HLOA 2H7HA 1OVUA 3E7KA 1LT9A 3RBZA 1WMKA 5GTIE 1NTZK 4D6TG 3HE4A 2K9JB 3H1IE 1M1KQ 2WPSA 1M57D 2M8RA 3P8CD 1SQBJ 2BCCD 1PZQA 1NU1G 3IN6A 3JC22 2OQQA 2FKWB 5B66H 3C1LA 3CCVP 2E74C 2KYVA 4Y99B 3RK2C 3CC4P 1QX8A 2I1JA 4XE5B 2IFNA 2P1JA 2E42A 3CCUP 1LT9B 3HE4B 2K1AA 1EXIA 1KZUB 3RL0g 1JM0A 3V5BA 3M06A 2QIWA 3CXHE 4H44D 4I7ZB 1DD4A 3VP8A 4TLFA 5APTA 1PGQA 3Q1MA 2VRSA 2FYNB 2JEEA 1H88A 2PFXA 4ASVA 1KILD 3ITKA 2WSSH 2RH0A 1H0TA 3V2PA 3C9IA 3PP5A 4H13D 2YIUC 3FWNA 3H1HJ 3B5NC 4YPCA 1JTHA 1ZP0C 1LWUA 3ABVC 4IFDK 1OX3A 5KJ7D 3CCMP 1DX7A 3MD0A 5AW7B 2O01N 2UWJE 1P84I 3BASA 5AVSB 1AQTA 4WWIA 1OIPA 1BDCA 3L70E 3CWBD 1URQA 3G71P 1GTWA 2KS1A 4A7PA 1H0TB 1SQQJ 3G6EP 2NPSD 3G3ZA 5KAFE 1JTHB 1NTKD 1LWUB 3MGNA 2NZ2A 4DT0A 2Q1KA 1K05A 1OMIA 3P7KA 1U7MA 1KC8Q 1L4AC 1XTCC 2KIKA 1QVFO 1SQXD 1URQB 2OTLP 3L35A 2KS1B 3GHGA 2E5YA 1ZRTD 1ZOYC 3H1JJ 1L0ND 2IYPA 1FZAA 1USDA 1AFOA 2A45G 3L72G 3NMDA 1BE3D 4KT0J 3GG2A 3WU2E 5BU8B 3CX5D 3A5TA 1OFCX 1SFCC 2J59M 1KYOD 2WTYA 2A45H 3GHGB 1IFMA 1FZCC 3KDPB 1KORA 2M0BA 3KZIH 1SQPG 2YKOA 2QA4P 2ZYAA 2KB7P 1HJ0A 2Y0EA 2YO2A 1PPJG 2ZAEB 3GW6A 4DJGA 1PFIA 2MKVA 1LTGC 4GIFA 2FYUJ 2C9NY 4C7NA 4UB8H 5KLVK 1HJBA 3PJSK 3TGUD 1J1EC 3G9RA 1EDJA 3KHUA 1EDKA 3VMYA 5BU5A 4PV1C 3AECC 4YXWH 2QM8A 1SQVE 1JO5A 3RBXA 3CPWO 2XDJA 1M1JC 3I5CA 3A0HH 3L74E 1KQFB 1OXZA 3HRNA 1DD3A 3IR9A 2QJKC 3L73D 2E74B 1NTMG 3RK2B 4U3FD 3R2PA 4GOEA 4C7NB 1YQ3C 4WY4C 1IFNA 1LGHB 3HE5A 2O01H 3CCJP 1QL2A 1NTZG 2LXCB 1G1IA 1ZN5A 1IFJA 3B5NA 1K73Q 3M91A 4ZKPA 1ZMEC 1N73C 1OWAA 2A06D 1T2KC 2V4HA 3AEAC 3TNUA 1SQBE 5AVUB 1VPCA 4KJMA 3CWBJ 3ZDMA 2YIUB 5APVA 1CI6B 1PP9G 4LLHA 1KQLA 1VQ6P 1NTKJ 5E79E 4GKGA 2WMMA 4JQ0D 2P7JA 1K9MQ 3CC2P 1AV1A 1L4AA 3BCCG 2H89C 2QSIA 2KSJA 3TNUB 4GODA 2BCCG 4L76A 3BATA 1FJPA 1SQXJ 3CX5I 2JDIH 1URQD 1NAFA 2B87A 3VP9A 1L0NJ 3OAKA 3H1IG 2K3RA 3S4RA 2O1JA 4EYYQ 1BE3J 1DH3A 1S9KE 1SFCA 5GTIH 1L4AB 1PPJE 3TDKA 2WVRA 4L75A 1R5SA 1CW5A 3H1HE 2E75D 2W27A 1BCCD 2AEMA 2LR2A 4OGQC 2G8YA 1X9VA 1KILB 2OYIA 1HTLC 1FZCA 2R3CA 1SS1A 2B87B 3L71D 3M9QA 2PRRA 3K5BA 1ZV8A 3AEDC 4W80A 2V7QJ 1EZVD 2BEQD 2XV5A 1EC5A 1M7LA 1JY2P 2QJYC 1SFCB 3M9HA 2Q3IA 3B71A 1PIXA 5APYA 2NRGA 3H1LJ 1ZR2A 1P84E 1YTZT 3RK3C 2OYIB 1FZCB 1OZHA 3PHLA 5CBOA 5M1BA 2E5TA 3TGUJ 1SQQD 1JY2N 2Z5IA 1XTGB 1Y8AA 1M1JA 4OH8B 1S2EA 1A02J 3AE2C 3H1JE 4I1LA 1EQ7A 1NWQA 1EXJA 3GF7A 1IZNB 3MP7B 3M0DC 3L73J 3V2RA 3H6PA 1KB9E 3S9OA 1LTIC 2E74D 4WY4A 4U3FJ 2WSCJ 3L70G 3RK2D 3CMEP 1J1EB 2D2CC 2HR3A 3FGAD 4PV1B 5APQA 3L37A 4N78D 4DZOA 2FXPA 2HYNA 1VQOP 1FZGA 1KMIZ 1KQSO 2QJKB 4BWNA 5AW0B 1N73A 2YMKA 4EIJA 1JY2O 3NFQA 2IFMA 5KAFH 4WY4B 5CJ0A 4WB4A 2ZT9C 2ZYGA 3P8CE 3N4XA 2BCCE 4GDOA 2I1KA 1Z56A 3L75G 5DJTB 3U59A 3E1IA 1AVOA 3H1KD 2XU6A 4AQRD 5B5EE 3B5ND 1L2PA 2O1KA 3AE6C 1N73B 2JP3A 3FWLA 3Q5PA 1S5LE 4HKZH 1FU1A 2ZYDA 1FDOA 1YYCA 2WPQA 5AVYB 2FYUD 2L91A 5H2FE 3W67A 1MKMA 3AEBC 1T6AA 3I55P 1HVVA 3O6QA 3S1KA 5KAIE 2FFDC 4EDFA 2KXPB 1L0LD 2WPVB 1LTSC 2XZRA 1KILE 1NH4A 1VQ4P 2W6JH 3F5HA 3AE5C 1ZLLA 3JCUE 3BRVB 1L4AD 2GM4A 3BVHA 4UB6E 1BCCJ 1EZVI 2YXQB 1FBMA 1FZEA 2L5GB 3O6QB 4WBAA 3L71J 1Q82Q 1DIPA 1SQVG 2M3EA 4AYCA 2WSFJ 2ZXEB 1IK7A 2AEFA 3WMM0 2PAJA 3L74G 3CWBE 4R4MA 4B86A 1JUNA 1JEKA 1SFCD 2KLUA 4OGQB 1NTKE 3A0BE 1BGYD 1YJWP 4RKUJ 3O8ZA 1X79B 1NOHA 1VF5D 2KSEA 2WT7A 1CSBA 3D6YA 3V4WA 2QJYB 4ZNCA 1HWTC 1W2EA 2POHA 2QE7H 1NVOA 1SQXE 2HODA 3SWKA 2QM7A 1ZRTE 1L0NE 2JWAA 4GT1A 3M0DA 1OVRA 1LJ2A 4L73A 4RJTA 1YQ4C 3RK3B 1BE3E 1VQ7P 1SQBG 4LGDE 4JF7A 3SFDC 2CK3H 5TISE 3CX5E 3SWFA 4MN4C 2JR8A 2JJLA 1Q90D 1H8AA 2B9BA 2WT7B 1KYOE 3L75E 2ZVNB 4PV1D 2R44A 1AQ5A 3VYIA 2HODB 1Q7YQ 2Q3EA 2GUSA 2E75B 1JCCA 1OW8A 1TU3F 2IBZD 2QG4A 3N7NA 1K04A 5E79H 3C8VA 4WY4D 5KLVD 4I2LC 1CZQA 5AW6B 2WSEJ 1VDFA 1VF5C 4OWFA 3H1KJ 2XNDH 2O3JA 1AJYA 2CPBA 1NHLA 4IOIH 4D6TD 3SFEC 1T8ZA 3TGUE 1FZBA 3H1LD 3H1HG 4EOTA 1LT1A 2ZT9B 1D7MA 1T2KD 2Z4EA 1NU1D 5CCGC 3A7OA 4DOJA 2KP8A 5CCHC 2GUVA 2P58A 2FFDA 2OARA 5KTBA 3L73E 3LW5J 4U3FE 1KQGB 2RKLA 3KQGA 3MZWB 2B89A 1L0LJ 1SLQA 1SQQG 3IAOA 3OJAB 3MUDC 3Q2YA 3EQ2A 3VOPA 4U7JA 5C39A 2C0XA 2QJPC 1VQ8P 2KI7B 2WITA 1HGZA 5AVQB 3UIAA 4NPEA 5AVTB 2FFDB 1YIJP 1P84H 2A06E 1HUCA 1GD2E 1LTJC 4ZKUA 3W68A 4IL6X 2HFED 3H1JG 1Q81Q 3R4YA 4JYCA 3JSVC 1YTZI 2WWWA 1RE3C 1OW6A 1ZR4A 4W7YA 3B8EB 3VTPC 4OGQD 2IYOA 4O9BA 5GTHE 3HE5B 1BGYJ 2RN0A 3I56P 1VQNP 3AEFC 5APWA 2R5DA 2PP6A 1KB9H 1S4XA 5AVRB 3B5NB 3H32A 4H0LC 1SQVK 1GW3A 3FXEA 5L8RJ 1VQMP 4PJ0E 4JPZB 3KYQA 4PD4H 3RK3D 2HG5D 5TJHA 3D70A 1J1DC 1GDTA 1SVFA 3P32A 1OVVA 4ZMDA 2FYUG 1BCCE 2IBZI 4BRYA 1GW4A 3H32B 1IFPA 1VQ9P 5AW9B 2YXRB 1NO4A 3KZIE 3L71E 1LTTC 3L72D 3PTZA 2QRXA 2FYNC 1EDLA 5B5EH 2W8ZA 5APSA 1EZVE 1RH5B 1W2BO 1VQ5P 3RL0D 2K88A 3OW2O 1VQKP 3Q5RA 2D2CD 1S5LH 4OVNF 1SQBK 3VMXA 1RF0C 5KLVJ 3CL3D 3HTKA 1E79H 4XA4A 1KFMA 4BRYB 5H2FH 1BDDA 1UIXA 3D6ZA 4IL6E 2YMYA 4D6TJ 1SQPD 1JMBA 1IJDB 1SQQE 1S5LX 5AW5B 1KFNA 3AE1C 3A0HE 1GL2C 5CCGA 4KHXA 2FY8A 3AEEC 2ZT9D 1NU1J 5CCHA 3CXHH 3LIEA 1VF5B 3HTKB 2KUBA 4UB6H 5CMZA 2QVAA 2H43A 1JNMA 3CWBG 2WQYC 3MUDA 3CMAP 2M5AA 2J58A 3WUVA 5KLIC 4N78E 5AVXB 1NTKG 2LXBA 3MTUE 3CLQA 2N9BA 3RL0C 1H89A 3TSIA 2G3AA 1NTMD 2ITAA 2Q9IA 1NAYA 3CCLP 1BSHA 1JY3P 4L74A 1G2CA 1LTJA 4C46A 3A0BH 1FS0E 2Q5UA 1NTZD 3GMAA 2K9YA 2B88A 1M1JB 1SQXG 1YBKA 3GF3A 2P10A 2R3SA 1L0NG 2M5AB 1IFIA 3H25A 2QJPB 1PV3A 3CCSP 3H1KE 1RE3A 2R32A 1SQQK 2N1TC 5AW2B 1BE3G 4N6JA 3CC7P 1JY3N 2K9JA 3TK1A 1MZ9A 3T97A 4WVZA 1G2CB 1LTJB 1KV4A 1LP1A 1GU5A 1U57A 2Q6QA 5TISH 3CX5H 2FYUE 1N86A 5AVVB 1PP9D 5CJ4A 1KYOH 2W83C 1HBWA 3SSUA 3IF4A 2Y0CA 4PD4D 2CPSA 1FC2C 5APUA 1E5WA 1L0LE 4YXDC 3WU2H 3BCCD 2H8PD 1BSNA 3T97B 3H1LG 2BEZF 5BVZA 2A45I 2V7QH 1MFTA 1GU4A 1LP1B 4H0LB 1N2DC 1RHZB 1KN7A 1W5CE 1NGMB 1USEA 1JY3O 5AVZB 4BXLA 1NYHA 3H1ID 2ZJSE 3TGUG 3PRJA 5AW4B 3L72J 5AW3B 3QH9A 1M56D 1PGJA 2OYOA 1MUUA 1PGOA 3AE9C 1RF0A 1J1DB 3L73G 1OW7A 1QVGO 1DEBA 3HD7C 4I6MC 3HUSC 4U3FG 2P67A 5CBNA 2C9LY 4LC1A 1BGYE 1YJNP 3M0AA 2FYUK 1X22A 2I8DA 1J2JB 3U1AA 1N7SC 1IK9A 3QWOC 1SQPJ 2WSCH 1GL2A 3CXHD 3II6A 1QL1A 1FE6A 2BASA 2WPRA 1RQVA 1L0LK 1X0TA 3AE4C 1LNQA 1GZLA 2AXTE 4NPFX 1G1JA 2A06G 2RMZA 4HB1A 1FJKA 1HGVA 5K5GB 2KLVA 2Y9YA 2KK7A 1N7LA 1GL2B 1GK6A 2K37A 1ZW0A 4NPDA 3IFMA 5CCGD 2IX7C 2O01J 4N3YB 1IFDA 4EI2A 3PH0A 5CCHD 1Q2NA 1NTMJ 3NXSA 2JWDA 2IBZE 3L70D 2MJZA 4H44C 1R8EA 1Y47A 5GTHH 3FXDA 1NKZB 2LKMA 1NTZJ 3FX0A 2P2UA 2OYHC 1RF1C 1KB9I 5KLVE 5KLIB 1K8AQ 3AE3C 3E1RA 3AE7C 2N1TA 1SP4A 1KILC 4RESB 3RL0B 3P8MC 1YJ9P 1PL5A 2D2CB 1GK4A 4H13C 4D6TE 1NTKK 3NTNA 3EFGA 5B66E 2YKPA 4HJGH 3H1LE 4PJ0H 1A02F 2W6AA 1BCCG 4PD4I 1NU1E 5KJ7C 3L75D 2Y9ZA 1QLED 4RO0A 2KZIA 3CCEP 3L71G 1PP9J 2E76D 1SQXK 2N1TB 1QEXA 2OYIC 2E43A 1S3JA 1L0NK 3A2AA 1EZVG 3L4FA 2NPSC 1U7JA 4K3AA 3BCCJ 3KXDA 1KD1Q 1JMMA 2FYZA 2WSFH 2BCCJ 5KKZC 1YHQP 3V6IA 1PGPA 3G4SP 1WT6A 4TT3H 4H0LD 1LTAC 1AA0A 1JB0J 3H1IJ 2Q7CA 3M9BA 4W7ZA 1S1CX 4JYBA 4IL6H 1JCDA 1RE4C 1FZFA 3CCRP 5APXA 3WUTA 5AVWB 1T3UA 1R5LA 3VN0A 1ZXGA 3OA7A 3HD7A 3RGUA 3HUSA 2DW3A 3CXHI 1NU1K 4HYTB 1SQVD 1VQPP 2H88C 2FXMA 2FBWC 1RY3A 1N7SA 1HH0A 5CHXA 2XNXA 2E76C 3KPEA 1FOSF 4C7RA 1X8YA 3L74D 3A3YB 3AEGC 3EFFK 3SWYA 1CI6A 1M90Q 3CD6P 2FXOA 1DEEG
chains in the Genus database with same CATH topology
1BGYJ 3L70J 1PP9J 2BCCJ 2IBZI 1BCCJ 1EZVI 3TGUJ 3L73J 1NTZJ 4D6TJ 3CWBJ 1SQQJ 3H1LJ 1SQVJ 1BE3J 4U3FJ 1KB9I 1SQPJ 5KLVJ 4PD4I 1L0LJ 3L71J 2FYUJ 3H1KJ 1NTMJ 3H1IJ 1SQXJ 1NU1J 3L74J 3L72J 3BCCJ 3CX5I 3H1JJ 1NTKJ 1P84I 3L75J 3CXHI 3H1HJ 1L0NJ 1SQBJ 1KYOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY J;  3L70 J;  1PP9 J;  2BCC J;  2IBZ I;  1BCC J;  1EZV I;  3TGU J;  3L73 J;  1NTZ J;  4D6T J;  3CWB J;  1SQQ J;  3H1L J;  1SQV J;  1BE3 J;  4U3F J;  1KB9 I;  1SQP J;  5KLV J;  4PD4 I;  1L0L J;  3L71 J;  2FYU J;  3H1K J;  1NTM J;  3H1I J;  1SQX J;  1NU1 J;  3L74 J;  3L72 J;  3BCC J;  3CX5 I;  3H1J J;  1NTK J;  1P84 I;  3L75 J;  3CXH I;  3H1H J;  1L0N J;  1SQB J;  1KYO I; 
#chains in the Genus database with same CATH topology
 3HD7 B;  3TF5 A;  3HUS B;  3GLM A;  2ZVO B;  1WRG A;  2JKV A;  3VMA A;  2WZ7 A;  1HF9 A;  3RK3 E;  1NJI Q;  3B4S A;  2XKM A;  1FOS E;  1N7S B;  5EFW B;  2C0W A;  3CCQ P;  2AXC A;  3H1K G;  2N9Y B;  1T3J A;  4Y99 C;  3D71 A;  1GL2 D;  2YNY A;  2Y0D A;  3V2N A;  1LT9 C;  1UII A;  2WSE H;  4IFM A;  3L72 E;  2R5B A;  1SQB D;  1GMJ A;  1JOC A;  5AW8 B;  3L70 J;  4QMA A;  2M3B A;  3MIW A;  3F89 A;  2YO3 A;  1RF1 A;  2OYH A;  4I7Z C;  4K35 A;  1N8R Q;  3L36 A;  3V2Q A;  3TYY A;  2PGD A;  1KIL A;  1YI2 P;  1L0L G;  1KYO I;  3VMZ A;  5AW1 B;  2QEX P;  2Z5H A;  1AVY A;  1SQP E;  3LW5 H;  1QGK B;  3WUU A;  4H44 B;  1RQU A;  3EWK A;  2YKQ A;  5KJ7 A;  2ZXX A;  2OTJ P;  4UB8 E;  2OYH B;  1RF1 B;  3L75 J;  3USS A;  4XFJ A;  4DCK A;  5KAI H;  3U1C A;  2W90 A;  2N1T D;  1S9K D;  2OGU A;  4R4L A;  1PPJ D;  2NPS A;  4H13 B;  1MV8 A;  3MHV A;  3AE8 C;  1KTM A;  1IC2 A;  3H1H D;  1Q86 Q;  1FDM A;  1M8O B;  2IZ1 A;  3JCU H;  2IZ0 A;  1LWU C;  4M3L A;  2W6B A;  4HH2 A;  1BGY G;  1VQL P;  2AEJ A;  5DJU B;  2KNC A;  1NTM E;  1VL2 A;  2ZFC A;  3BRT B;  4JBZ A;  3PLN A;  4ASW A;  4Y28 J;  2NPS B;  1URQ C;  1RE4 A;  1NTZ E;  2KZJ A;  1IO4 A;  3Q5S A;  2J5U A;  2SPZ A;  2OTK E;  1P84 D;  2IPP A;  1S72 P;  5KKZ B;  1SQP K;  2KOG A;  1MFZ A;  1NKN A;  2GA1 A;  2IDB A;  1FAV A;  2HPC A;  2E75 C;  2KNC B;  3V4Q A;  2AXT H;  4CPG A;  1SQV J;  1LTB C;  3H1J D;  1YIT P;  3GHG C;  3L74 J;  4GOF A;  1Y9B A;  1PP9 E;  1KB9 D;  4Z1M H;  4AUW A;  3LID A;  2IBZ G;  4PD4 E;  3CI9 A;  3HD7 D;  4YTP C;  2HPC B;  4IFF A;  3BCC E;  3Q3D A;  1FDI A;  5KLV G;  2E76 B;  1NTM K;  1N7S D;  2JO1 A;  1EDI A;  2HLO A;  2H7H A;  1OVU A;  3E7K A;  1LT9 A;  3RBZ A;  1WMK A;  5GTI E;  1NTZ K;  4D6T G;  3HE4 A;  2K9J B;  3H1I E;  1M1K Q;  2WPS A;  1M57 D;  2M8R A;  3P8C D;  1SQB J;  2BCC D;  1PZQ A;  1NU1 G;  3IN6 A;  3JC2 2;  2OQQ A;  2FKW B;  5B66 H;  3C1L A;  3CCV P;  2E74 C;  2KYV A;  4Y99 B;  3RK2 C;  3CC4 P;  1QX8 A;  2I1J A;  4XE5 B;  2IFN A;  2P1J A;  2E42 A;  3CCU P;  1LT9 B;  3HE4 B;  2K1A A;  1EXI A;  1KZU B;  3RL0 g;  1JM0 A;  3V5B A;  3M06 A;  2QIW A;  3CXH E;  4H44 D;  4I7Z B;  1DD4 A;  3VP8 A;  4TLF A;  5APT A;  1PGQ A;  3Q1M A;  2VRS A;  2FYN B;  2JEE A;  1H88 A;  2PFX A;  4ASV A;  1KIL D;  3ITK A;  2WSS H;  2RH0 A;  1H0T A;  3V2P A;  3C9I A;  3PP5 A;  4H13 D;  2YIU C;  3FWN A;  3H1H J;  3B5N C;  4YPC A;  1JTH A;  1ZP0 C;  1LWU A;  3ABV C;  4IFD K;  1OX3 A;  5KJ7 D;  3CCM P;  1DX7 A;  3MD0 A;  5AW7 B;  2O01 N;  2UWJ E;  1P84 I;  3BAS A;  5AVS B;  1AQT A;  4WWI A;  1OIP A;  1BDC A;  3L70 E;  3CWB D;  1URQ A;  3G71 P;  1GTW A;  2KS1 A;  4A7P A;  1H0T B;  1SQQ J;  3G6E P;  2NPS D;  3G3Z A;  5KAF E;  1JTH B;  1NTK D;  1LWU B;  3MGN A;  2NZ2 A;  4DT0 A;  2Q1K A;  1K05 A;  1OMI A;  3P7K A;  1U7M A;  1KC8 Q;  1L4A C;  1XTC C;  2KIK A;  1QVF O;  1SQX D;  1URQ B;  2OTL P;  3L35 A;  2KS1 B;  3GHG A;  2E5Y A;  1ZRT D;  1ZOY C;  3H1J J;  1L0N D;  2IYP A;  1FZA A;  1USD A;  1AFO A;  2A45 G;  3L72 G;  3NMD A;  1BE3 D;  4KT0 J;  3GG2 A;  3WU2 E;  5BU8 B;  3CX5 D;  3A5T A;  1OFC X;  1SFC C;  2J59 M;  1KYO D;  2WTY A;  2A45 H;  3GHG B;  1IFM A;  1FZC C;  3KDP B;  1KOR A;  2M0B A;  3KZI H;  1SQP G;  2YKO A;  2QA4 P;  2ZYA A;  2KB7 P;  1HJ0 A;  2Y0E A;  2YO2 A;  1PPJ G;  2ZAE B;  3GW6 A;  4DJG A;  1PFI A;  2MKV A;  1LTG C;  4GIF A;  2FYU J;  2C9N Y;  4C7N A;  4UB8 H;  5KLV K;  1HJB A;  3PJS K;  3TGU D;  1J1E C;  3G9R A;  1EDJ A;  3KHU A;  1EDK A;  3VMY A;  5BU5 A;  4PV1 C;  3AEC C;  4YXW H;  2QM8 A;  1SQV E;  1JO5 A;  3RBX A;  3CPW O;  2XDJ A;  1M1J C;  3I5C A;  3A0H H;  3L74 E;  1KQF B;  1OXZ A;  3HRN A;  1DD3 A;  3IR9 A;  2QJK C;  3L73 D;  2E74 B;  1NTM G;  3RK2 B;  4U3F D;  3R2P A;  4GOE A;  4C7N B;  1YQ3 C;  4WY4 C;  1IFN A;  1LGH B;  3HE5 A;  2O01 H;  3CCJ P;  1QL2 A;  1NTZ G;  2LXC B;  1G1I A;  1ZN5 A;  1IFJ A;  3B5N A;  1K73 Q;  3M91 A;  4ZKP A;  1ZME C;  1N73 C;  1OWA A;  2A06 D;  1T2K C;  2V4H A;  3AEA C;  3TNU A;  1SQB E;  5AVU B;  1VPC A;  4KJM A;  3CWB J;  3ZDM A;  2YIU B;  5APV A;  1CI6 B;  1PP9 G;  4LLH A;  1KQL A;  1VQ6 P;  1NTK J;  5E79 E;  4GKG A;  2WMM A;  4JQ0 D;  2P7J A;  1K9M Q;  3CC2 P;  1AV1 A;  1L4A A;  3BCC G;  2H89 C;  2QSI A;  2KSJ A;  3TNU B;  4GOD A;  2BCC G;  4L76 A;  3BAT A;  1FJP A;  1SQX J;  3CX5 I;  2JDI H;  1URQ D;  1NAF A;  2B87 A;  3VP9 A;  1L0N J;  3OAK A;  3H1I G;  2K3R A;  3S4R A;  2O1J A;  4EYY Q;  1BE3 J;  1DH3 A;  1S9K E;  1SFC A;  5GTI H;  1L4A B;  1PPJ E;  3TDK A;  2WVR A;  4L75 A;  1R5S A;  1CW5 A;  3H1H E;  2E75 D;  2W27 A;  1BCC D;  2AEM A;  2LR2 A;  4OGQ C;  2G8Y A;  1X9V A;  1KIL B;  2OYI A;  1HTL C;  1FZC A;  2R3C A;  1SS1 A;  2B87 B;  3L71 D;  3M9Q A;  2PRR A;  3K5B A;  1ZV8 A;  3AED C;  4W80 A;  2V7Q J;  1EZV D;  2BEQ D;  2XV5 A;  1EC5 A;  1M7L A;  1JY2 P;  2QJY C;  1SFC B;  3M9H A;  2Q3I A;  3B71 A;  1PIX A;  5APY A;  2NRG A;  3H1L J;  1ZR2 A;  1P84 E;  1YTZ T;  3RK3 C;  2OYI B;  1FZC B;  1OZH A;  3PHL A;  5CBO A;  5M1B A;  2E5T A;  3TGU J;  1SQQ D;  1JY2 N;  2Z5I A;  1XTG B;  1Y8A A;  1M1J A;  4OH8 B;  1S2E A;  1A02 J;  3AE2 C;  3H1J E;  4I1L A;  1EQ7 A;  1NWQ A;  1EXJ A;  3GF7 A;  1IZN B;  3MP7 B;  3M0D C;  3L73 J;  3V2R A;  3H6P A;  1KB9 E;  3S9O A;  1LTI C;  2E74 D;  4WY4 A;  4U3F J;  2WSC J;  3L70 G;  3RK2 D;  3CME P;  1J1E B;  2D2C C;  2HR3 A;  3FGA D;  4PV1 B;  5APQ A;  3L37 A;  4N78 D;  4DZO A;  2FXP A;  2HYN A;  1VQO P;  1FZG A;  1KMI Z;  1KQS O;  2QJK B;  4BWN A;  5AW0 B;  1N73 A;  2YMK A;  4EIJ A;  1JY2 O;  3NFQ A;  2IFM A;  5KAF H;  4WY4 B;  5CJ0 A;  4WB4 A;  2ZT9 C;  2ZYG A;  3P8C E;  3N4X A;  2BCC E;  4GDO A;  2I1K A;  1Z56 A;  3L75 G;  5DJT B;  3U59 A;  3E1I A;  1AVO A;  3H1K D;  2XU6 A;  4AQR D;  5B5E E;  3B5N D;  1L2P A;  2O1K A;  3AE6 C;  1N73 B;  2JP3 A;  3FWL A;  3Q5P A;  1S5L E;  4HKZ H;  1FU1 A;  2ZYD A;  1FDO A;  1YYC A;  2WPQ A;  5AVY B;  2FYU D;  2L91 A;  5H2F E;  3W67 A;  1MKM A;  3AEB C;  1T6A A;  3I55 P;  1HVV A;  3O6Q A;  3S1K A;  5KAI E;  2FFD C;  4EDF A;  2KXP B;  1L0L D;  2WPV B;  1LTS C;  2XZR A;  1KIL E;  1NH4 A;  1VQ4 P;  2W6J H;  3F5H A;  3AE5 C;  1ZLL A;  3JCU E;  3BRV B;  1L4A D;  2GM4 A;  3BVH A;  4UB6 E;  1BCC J;  1EZV I;  2YXQ B;  1FBM A;  1FZE A;  2L5G B;  3O6Q B;  4WBA A;  3L71 J;  1Q82 Q;  1DIP A;  1SQV G;  2M3E A;  4AYC A;  2WSF J;  2ZXE B;  1IK7 A;  2AEF A;  3WMM 0;  2PAJ A;  3L74 G;  3CWB E;  4R4M A;  4B86 A;  1JUN A;  1JEK A;  1SFC D;  2KLU A;  4OGQ B;  1NTK E;  3A0B E;  1BGY D;  1YJW P;  4RKU J;  3O8Z A;  1X79 B;  1NOH A;  1VF5 D;  2KSE A;  2WT7 A;  1CSB A;  3D6Y A;  3V4W A;  2QJY B;  4ZNC A;  1HWT C;  1W2E A;  2POH A;  2QE7 H;  1NVO A;  1SQX E;  2HOD A;  3SWK A;  2QM7 A;  1ZRT E;  1L0N E;  2JWA A;  4GT1 A;  3M0D A;  1OVR A;  1LJ2 A;  4L73 A;  4RJT A;  1YQ4 C;  3RK3 B;  1BE3 E;  1VQ7 P;  1SQB G;  4LGD E;  4JF7 A;  3SFD C;  2CK3 H;  5TIS E;  3CX5 E;  3SWF A;  4MN4 C;  2JR8 A;  2JJL A;  1Q90 D;  1H8A A;  2B9B A;  2WT7 B;  1KYO E;  3L75 E;  2ZVN B;  4PV1 D;  2R44 A;  1AQ5 A;  3VYI A;  2HOD B;  1Q7Y Q;  2Q3E A;  2GUS A;  2E75 B;  1JCC A;  1OW8 A;  1TU3 F;  2IBZ D;  2QG4 A;  3N7N A;  1K04 A;  5E79 H;  3C8V A;  4WY4 D;  5KLV D;  4I2L C;  1CZQ A;  5AW6 B;  2WSE J;  1VDF A;  1VF5 C;  4OWF A;  3H1K J;  2XND H;  2O3J A;  1AJY A;  2CPB A;  1NHL A;  4IOI H;  4D6T D;  3SFE C;  1T8Z A;  3TGU E;  1FZB A;  3H1L D;  3H1H G;  4EOT A;  1LT1 A;  2ZT9 B;  1D7M A;  1T2K D;  2Z4E A;  1NU1 D;  5CCG C;  3A7O A;  4DOJ A;  2KP8 A;  5CCH C;  2GUV A;  2P58 A;  2FFD A;  2OAR A;  5KTB A;  3L73 E;  3LW5 J;  4U3F E;  1KQG B;  2RKL A;  3KQG A;  3MZW B;  2B89 A;  1L0L J;  1SLQ A;  1SQQ G;  3IAO A;  3OJA B;  3MUD C;  3Q2Y A;  3EQ2 A;  3VOP A;  4U7J A;  5C39 A;  2C0X A;  2QJP C;  1VQ8 P;  2KI7 B;  2WIT A;  1HGZ A;  5AVQ B;  3UIA A;  4NPE A;  5AVT B;  2FFD B;  1YIJ P;  1P84 H;  2A06 E;  1HUC A;  1GD2 E;  1LTJ C;  4ZKU A;  3W68 A;  4IL6 X;  2HFE D;  3H1J G;  1Q81 Q;  3R4Y A;  4JYC A;  3JSV C;  1YTZ I;  2WWW A;  1RE3 C;  1OW6 A;  1ZR4 A;  4W7Y A;  3B8E B;  3VTP C;  4OGQ D;  2IYO A;  4O9B A;  5GTH E;  3HE5 B;  1BGY J;  2RN0 A;  3I56 P;  1VQN P;  3AEF C;  5APW A;  2R5D A;  2PP6 A;  1KB9 H;  1S4X A;  5AVR B;  3B5N B;  3H32 A;  4H0L C;  1SQV K;  1GW3 A;  3FXE A;  5L8R J;  1VQM P;  4PJ0 E;  4JPZ B;  3KYQ A;  4PD4 H;  3RK3 D;  2HG5 D;  5TJH A;  3D70 A;  1J1D C;  1GDT A;  1SVF A;  3P32 A;  1OVV A;  4ZMD A;  2FYU G;  1BCC E;  2IBZ I;  4BRY A;  1GW4 A;  3H32 B;  1IFP A;  1VQ9 P;  5AW9 B;  2YXR B;  1NO4 A;  3KZI E;  3L71 E;  1LTT C;  3L72 D;  3PTZ A;  2QRX A;  2FYN C;  1EDL A;  5B5E H;  2W8Z A;  5APS A;  1EZV E;  1RH5 B;  1W2B O;  1VQ5 P;  3RL0 D;  2K88 A;  3OW2 O;  1VQK P;  3Q5R A;  2D2C D;  1S5L H;  4OVN F;  1SQB K;  3VMX A;  1RF0 C;  5KLV J;  3CL3 D;  3HTK A;  1E79 H;  4XA4 A;  1KFM A;  4BRY B;  5H2F H;  1BDD A;  1UIX A;  3D6Z A;  4IL6 E;  2YMY A;  4D6T J;  1SQP D;  1JMB A;  1IJD B;  1SQQ E;  1S5L X;  5AW5 B;  1KFN A;  3AE1 C;  3A0H E;  1GL2 C;  5CCG A;  4KHX A;  2FY8 A;  3AEE C;  2ZT9 D;  1NU1 J;  5CCH A;  3CXH H;  3LIE A;  1VF5 B;  3HTK B;  2KUB A;  4UB6 H;  5CMZ A;  2QVA A;  2H43 A;  1JNM A;  3CWB G;  2WQY C;  3MUD A;  3CMA P;  2M5A A;  2J58 A;  3WUV A;  5KLI C;  4N78 E;  5AVX B;  1NTK G;  2LXB A;  3MTU E;  3CLQ A;  2N9B A;  3RL0 C;  1H89 A;  3TSI A;  2G3A A;  1NTM D;  2ITA A;  2Q9I A;  1NAY A;  3CCL P;  1BSH A;  1JY3 P;  4L74 A;  1G2C A;  1LTJ A;  4C46 A;  3A0B H;  1FS0 E;  2Q5U A;  1NTZ D;  3GMA A;  2K9Y A;  2B88 A;  1M1J B;  1SQX G;  1YBK A;  3GF3 A;  2P10 A;  2R3S A;  1L0N G;  2M5A B;  1IFI A;  3H25 A;  2QJP B;  1PV3 A;  3CCS P;  3H1K E;  1RE3 A;  2R32 A;  1SQQ K;  2N1T C;  5AW2 B;  1BE3 G;  4N6J A;  3CC7 P;  1JY3 N;  2K9J A;  3TK1 A;  1MZ9 A;  3T97 A;  4WVZ A;  1G2C B;  1LTJ B;  1KV4 A;  1LP1 A;  1GU5 A;  1U57 A;  2Q6Q A;  5TIS H;  3CX5 H;  2FYU E;  1N86 A;  5AVV B;  1PP9 D;  5CJ4 A;  1KYO H;  2W83 C;  1HBW A;  3SSU A;  3IF4 A;  2Y0C A;  4PD4 D;  2CPS A;  1FC2 C;  5APU A;  1E5W A;  1L0L E;  4YXD C;  3WU2 H;  3BCC D;  2H8P D;  1BSN A;  3T97 B;  3H1L G;  2BEZ F;  5BVZ A;  2A45 I;  2V7Q H;  1MFT A;  1GU4 A;  1LP1 B;  4H0L B;  1N2D C;  1RHZ B;  1KN7 A;  1W5C E;  1NGM B;  1USE A;  1JY3 O;  5AVZ B;  4BXL A;  1NYH A;  3H1I D;  2ZJS E;  3TGU G;  3PRJ A;  5AW4 B;  3L72 J;  5AW3 B;  3QH9 A;  1M56 D;  1PGJ A;  2OYO A;  1MUU A;  1PGO A;  3AE9 C;  1RF0 A;  1J1D B;  3L73 G;  1OW7 A;  1QVG O;  1DEB A;  3HD7 C;  4I6M C;  3HUS C;  4U3F G;  2P67 A;  5CBN A;  2C9L Y;  4LC1 A;  1BGY E;  1YJN P;  3M0A A;  2FYU K;  1X22 A;  2I8D A;  1J2J B;  3U1A A;  1N7S C;  1IK9 A;  3QWO C;  1SQP J;  2WSC H;  1GL2 A;  3CXH D;  3II6 A;  1QL1 A;  1FE6 A;  2BAS A;  2WPR A;  1RQV A;  1L0L K;  1X0T A;  3AE4 C;  1LNQ A;  1GZL A;  2AXT E;  4NPF X;  1G1J A;  2A06 G;  2RMZ A;  4HB1 A;  1FJK A;  1HGV A;  5K5G B;  2KLV A;  2Y9Y A;  2KK7 A;  1N7L A;  1GL2 B;  1GK6 A;  2K37 A;  1ZW0 A;  4NPD A;  3IFM A;  5CCG D;  2IX7 C;  2O01 J;  4N3Y B;  1IFD A;  4EI2 A;  3PH0 A;  5CCH D;  1Q2N A;  1NTM J;  3NXS A;  2JWD A;  2IBZ E;  3L70 D;  2MJZ A;  4H44 C;  1R8E A;  1Y47 A;  5GTH H;  3FXD A;  1NKZ B;  2LKM A;  1NTZ J;  3FX0 A;  2P2U A;  2OYH C;  1RF1 C;  1KB9 I;  5KLV E;  5KLI B;  1K8A Q;  3AE3 C;  3E1R A;  3AE7 C;  2N1T A;  1SP4 A;  1KIL C;  4RES B;  3RL0 B;  3P8M C;  1YJ9 P;  1PL5 A;  2D2C B;  1GK4 A;  4H13 C;  4D6T E;  1NTK K;  3NTN A;  3EFG A;  5B66 E;  2YKP A;  4HJG H;  3H1L E;  4PJ0 H;  1A02 F;  2W6A A;  1BCC G;  4PD4 I;  1NU1 E;  5KJ7 C;  3L75 D;  2Y9Z A;  1QLE D;  4RO0 A;  2KZI A;  3CCE P;  3L71 G;  1PP9 J;  2E76 D;  1SQX K;  2N1T B;  1QEX A;  2OYI C;  2E43 A;  1S3J A;  1L0N K;  3A2A A;  1EZV G;  3L4F A;  2NPS C;  1U7J A;  4K3A A;  3BCC J;  3KXD A;  1KD1 Q;  1JMM A;  2FYZ A;  2WSF H;  2BCC J;  5KKZ C;  1YHQ P;  3V6I A;  1PGP A;  3G4S P;  1WT6 A;  4TT3 H;  4H0L D;  1LTA C;  1AA0 A;  1JB0 J;  3H1I J;  2Q7C A;  3M9B A;  4W7Z A;  1S1C X;  4JYB A;  4IL6 H;  1JCD A;  1RE4 C;  1FZF A;  3CCR P;  5APX A;  3WUT A;  5AVW B;  1T3U A;  1R5L A;  3VN0 A;  1ZXG A;  3OA7 A;  3HD7 A;  3RGU A;  3HUS A;  2DW3 A;  3CXH I;  1NU1 K;  4HYT B;  1SQV D;  1VQP P;  2H88 C;  2FXM A;  2FBW C;  1RY3 A;  1N7S A;  1HH0 A;  5CHX A;  2XNX A;  2E76 C;  3KPE A;  1FOS F;  4C7R A;  1X8Y A;  3L74 D;  3A3Y B;  3AEG C;  3EFF K;  3SWY A;  1CI6 A;  1M90 Q;  3CD6 P;  2FXO A;  1DEE G; 
#chains in the Genus database with same CATH homology
 1BGY J;  3L70 J;  1PP9 J;  2BCC J;  2IBZ I;  1BCC J;  1EZV I;  3TGU J;  3L73 J;  1NTZ J;  4D6T J;  3CWB J;  1SQQ J;  3H1L J;  1SQV J;  1BE3 J;  4U3F J;  1KB9 I;  1SQP J;  5KLV J;  4PD4 I;  1L0L J;  3L71 J;  2FYU J;  3H1K J;  1NTM J;  3H1I J;  1SQX J;  1NU1 J;  3L74 J;  3L72 J;  3BCC J;  3CX5 I;  3H1J J;  1NTK J;  1P84 I;  3L75 J;  3CXH I;  3H1H J;  1L0N J;  1SQB J;  1KYO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...