4D6TJ

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
PTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
total genus 21
structure length 58
sequence length 58
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4d6tJ00
3TGUJ 2IBZI 1BGYJ 1P84I 1SQQJ 1NTZJ 1NU1J 3L74J 1SQVJ 3H1KJ 3H1JJ 3L71J 1PP9J 1SQBJ 3CX5I 1KB9I 3BCCJ 4D6TJ 2BCCJ 1EZVI 1BCCJ 3H1IJ 1NTKJ 1KYOI 1BE3J 3H1LJ 3L72J 5KLVJ 4PD4I 1SQPJ 3CXHI 4U3FJ 1SQXJ 1L0LJ 3H1HJ 3L70J 3L73J 2FYUJ 3L75J 1L0NJ 3CWBJ 1NTMJ
chains in the Genus database with same CATH superfamily
3L75G 1FZCC 2G8YA 4DOJA 2I8DA 2N1TA 2Z5IA 4C7RA 2MKVA 2GUVA 1NTZK 4Y99C 4WBAA 2KYVA 3H1HD 1SQVG 1USEA 3AE6C 3N7NA 3W68A 3LW5J 3G6EP 1R5LA 2KOGA 1N73C 1BSNA 3HRNA 1JTHA 1SLQA 1PGOA 1DH3A 3RK3E 4M3LA 1BCCJ 3E1RA 1KORA 1NTKD 1RE4A 2KNCA 4D6TE 2IZ0A 1PIXA 5APVA 1J2JB 3MTUE 1G2CA 1JY2O 3LW5H 1Q90D 4RO0A 2JWAA 4IFDK 3HE4A 5CCHD 4WB4A 2KB7P 3G9RA 4KT0J 3JCUE 2BEQD 3W67A 3RK2C 5CBOA 3AE9C 2ITAA 3GF7A 1T2KC 5CCHA 2QJKC 1SQQE 2WSFH 3AEEC 1SQPD 1YHQP 3EFFK 1VQ4P 4W80A 2WWWA 2XZRA 3VP8A 1IK9A 4WY4C 1NTZJ 2FXOA 3CMAP 1FDOA 1UIXA 1MUUA 2L91A 1M90Q 1IZNB 5CBNA 1KQSO 1YQ3C 2RH0A 2N1TD 3L74J 3TYYA 5KKZC 2WSEJ 1ZP0C 1ZXGA 1YTZI 2ZT9D 3B71A 2KSEA 3PTZA 1HJ0A 2QM7A 2WPSA 3B5NA 1G1JA 1SQBJ 1VQMP 1GL2C 1YJWP 3CXHH 3TSIA 2POHA 3V6IA 1SFCC 2PFXA 3H25A 2Y0CA 1G2CB 1YITP 1KD1Q 2O01N 3U1CA 3L72D 3AEAC 3HUSC 1VQKP 3C1LA 5AVZB 2FYUD 1NTKK 1KC8Q 2Q9IA 1URQA 2PP6A 1VQNP 2E5TA 1S3JA 1SS1A 1OVUA 2H88C 2WZ7A 4UB8H 3B5NC 1FBMA 4H0LD 1VQ8P 3L75J 3AE3C 2YMYA 3L73G 1SQQK 2YKQA 4JBZA 1LTJB 2Q7CA 3SWFA 3L74E 2HFED 2N1TC 2QRXA 1N86A 1QLED 1RF0C 4MN4C 5KLIB 1VQ6P 1FAVA 1FZEA 1MFZA 1OVVA 2J59M 2NPSD 2KI7B 1SQXG 2E75B 2OYOA 1KYOE 3A0BE 2A45H 3B5NB 4W7ZA 1VPCA 3AE1C 4OWFA 1ZLLA 3L71G 3D70A 4UB6E 1M1KQ 1RF0A 5H2FE 3P7KA 4I6MC 1L4AC 3H1IJ 1J1EC 5AVSB 5KLVK 1SFCB 1NTKG 2IYPA 4RKUJ 4C7NB 4EOTA 2FKWB 2WITA 1FE6A 1JY3O 1IFDA 3QH9A 4PV1D 5M1BA 1GL2B 1KFMA 1KB9E 1SQPJ 4H0LC 3O8ZA 3RK3D 2JJLA 1RE3C 3OA7A 1U7MA 3NFQA 4H44D 2HODA 1GK6A 2FFDB 1BGYE 5GTHE 1KMIZ 2KP8A 1OWAA 1ZW0A 1R5SA 2E76B 3L73E 4K3AA 4WY4B 3H1IG 1BGYJ 4Y28J 3CCLP 3EFGA 1FZAA 3H1KG 2KZJA 2WSEH 3FX0A 5B5EE 2PAJA 1FJKA 2W83C 3OJAB 4L76A 1YQ4C 5AVYB 3CCSP 3RK2B 2ZYDA 5APWA 2ZT9B 4I7ZB 1K9MQ 1N7SB 1FS0E 3TGUG 3VMXA 2WSFJ 1JY2P 3I56P 1M1JA 3D71A 3FGAD 5KJ7C 1HVVA 2I1KA 3V4WA 4C7NA 1NTZG 5APUA 3VMYA 1GMJA 2M8RA 2Q3EA 2WPVB 1L0LE 4QMAA 1PGPA 5KKZB 1IK7A 3CCJP 3L70E 4PD4I 3KYQA 1LP1B 1OZHA 2HLOA 2Y0DA 1JTHB 3GG2A 2YXQB 4TT3H 1S5LH 2KS1B 1JM0A 5AVWB 3BCCG 3D6YA 2GUSA 1NH4A 3H1LJ 1GDTA 1VQ7P 1RE4C 1RQVA 2WSCH 3S4RA 4KJMA 1JCCA 5KLVG 2NPSA 3IFMA 1M8OB 3MD0A 3L71J 1SQVK 3V2NA 2Z4EA 1M1JB 1PP9J 3P8CD 1EDKA 1LT9A 2KLVA 2FBWC 3M0AA 1MV8A 3BCCJ 1K8AQ 2V4HA 5K5GB 2IFNA 3II6A 2Q5UA 2IBZG 2QIWA 3H1LG 1DD3A 4H13D 1X22A 1HBWA 5AW8B 3HD7C 5TISE 1RF1C 2E43A 5TISH 1PZQA 1LT1A 1MKMA 4BRYA 3H1JG 1U57A 3HD7D 3PRJA 3KQGA 1T2KD 3IF4A 2KS1A 1ZR2A 1AJYA 1NJIQ 2P7JA 4DZOA 1EDLA 5CCHC 2K1AA 4GDOA 1NAFA 3HTKA 1NAYA 3RK2D 5B66E 3FXEA 1JB0J 4AQRD 5B66H 1VQ5P 1EXJA 3GF3A 2R3SA 3E7KA 1S72P 1URQB 4N3YB 3S1KA 2E74C 2ZXEB 5GTIH 1KV4A 1SQPG 3L73D 2WT7A 2B88A 2IDBA 2YIUB 3F89A 2QA4P 3H1KE 2C9LY 4GODA 3SFDC 1YJNP 1BCCE 1NU1K 4GIFA 3BRVB 3RL0B 3VMAA 4D6TJ 4JPZB 1JMMA 2YXRB 4JF7A 2JR8A 1GL2D 2ZFCA 1BSHA 3R2PA 3O6QA 1BE3J 2N9BA 1IFPA 1LTGC 1JNMA 1LWUC 4R4MA 1KN7A 2YO2A 1VF5C 3Q5PA 2UWJE 4H0LB 2LKMA 3Q5RA 1ZRTE 5AW3B 1YI2P 1SQPK 3CX5D 1KYOH 3A0BH 1L0LD 1X9VA 4RESB 1SQVD 2W6JH 2QJYC 2JDIH 5E79H 3T97A 5KAFH 1EDJA 3IR9A 1SQQG 1FU1A 2KXPB 1SVFA 4H13B 5H2FH 4H13C 3KZIE 1QL2A 3WUUA 2M3EA 3MZWB 3KZIH 3CCQP 1XTCC 5CMZA 2E76C 2DW3A 2QSIA 3CI9A 3V2RA 2HPCB 2K3RA 3MGNA 5AVTB 4CPGA 4K35A 1KILC 2WPQA 4ZMDA 1K73Q 1SQBD 4NPDA 2E75D 1XTGB 2FYZA 2LXCB 2N1TB 3CWBG 3Q1MA 3Q2YA 2H43A 1FOSF 1Y8AA 1LTJC 3GW6A 3H1JD 2Z5HA 3BASA 1NGMB 2H7HA 2RN0A 1SQPE 3HD7A 1NTZD 1RF1A 1A02J 5AVQB 3GHGC 1HGZA 1HWTC 1J1EB 3H32A 4XE5B 1LGHB 3L74G 3BATA 1D7MA 5B5EH 2BASA 1S9KD 3L70J 3RK3C 1E5WA 1HGVA 1JCDA 3JCUH 4H44B 4WVZA 5KAIH 1W5CE 5KAIE 4DT0A 1ZMEC 4ASVA 1RHZB 4IL6H 2WMMA 4N6JA 1NTMJ 1T3UA 1URQC 1PL5A 1G1IA 2CK3H 5AVRB 1H0TB 3VTPC 1NHLA 2IBZI 2E76D 2WQYC 3LIDA 3M06A 3HUSA 1OMIA 1VL2A 3K5BA 1JOCA 1BCCD 2R44A 2FY8A 1FDIA 1JEKA 4PD4D 3TF5A 3H6PA 1L0ND 2R3CA 1CSBA 1ZRTD 1NWQA 3G71P 2L5GB 3L71E 1USDA 3CXHE 2BCCJ 1N8RQ 1P84D 3B5ND 3HD7B 4GT1A 1DEEG 1NTMG 2QJKB 3TK1A 5BU5A 1RF1B 3KXDA 3H32B 2IX7C 2HYNA 3O6QB 1RQUA 4NPFX 2OYHA 2E42A 2GM4A 1NTKE 1GK4A 2Q1KA 1KTMA 1SP4A 4LGDE 1BDDA 1KILE 1LTSC 2RKLA 2C0WA 1LT9B 2YKOA 1M1JC 3CXHI 4JYCA 4LC1A 4A7PA 1NVOA 2M0BA 1CZQA 1L0NG 3Q5SA 3PLNA 2D2CD 3PH0A 3CC2P 1BCCG 1S4XA 3CLQA 3CCRP 5AW2B 3TGUE 1BE3D 1EZVD 1GW4A 4N78D 1AA0A 1CI6B 5C39A 1L4AD 1PPJE 3CXHD 3PP5A 2OTJP 4LLHA 1AQ5A 4L73A 2Y9YA 2J58A 4D6TD 1FZCA 1NTZE 2JO1A 2Y9ZA 5KTBA 2W90A 1L0LK 2R5DA 2WPRA 4Y99B 3V2PA 3VYIA 3AE7C 1MZ9A 2P1JA 3OW2O 2P58A 3CMEP 1HF9A 3WUTA 3CX5I 1OFCX 1X79B 2CPSA 4UB6H 1EZVI 4GKGA 5AW9B 3L72E 1KYOI 2WT7B 4BRYB 2QM8A 1K05A 3AE8C 1URQD 2WVRA 3H1HE 1E79H 3CX5E 1N7SC 1LT9C 2OYIA 5GTIE 1LTIC 2AXCA 2B89A 1LTBC 2XNXA 4GOFA 1DX7A 5KLVE 1OIPA 1PPJD 3MHVA 3Q3DA 2XV5A 3L36A 4PD4E 3V2QA 3TGUJ 1TU3F 1KYOD 2E5YA 1NU1E 5GTHH 2BEZF 4U7JA 1VQPP 2Y0EA 1VQLP 1K04A 1NU1J 1OW8A 3HE5A 1IFJA 1KQLA 1SQQD 2A06D 1Q81Q 3H1KJ 1ZR4A 1SQBE 4YXDC 1P84E 1HJBA 1ZOYC 2LXBA 1P84H 1WT6A 1BDCA 1N7SD 4AUWA 2BCCG 2Q3IA 5CJ0A 2CPBA 4PJ0H 4PJ0E 2W6BA 3RGUA 2FYNB 1H89A 5AW0B 1IFNA 1QX8A 2NZ2A 3L72G 3OAKA 2HPCA 2NPSC 1NO4A 1GZLA 4U3FE 3M0DC 1LNQA 3CC7P 1FOSE 1M57D 3IAOA 4JYBA 4L74A 4U3FJ 3L75E 4I1LA 3UIAA 2XDJA 5AW6B 1HTLC 1KB9D 1FZFA 4R4LA 1S5LE 2AXTE 1W2EA 2IFMA 2A06G 2AXTH 3A3YB 1IFIA 3MUDC 1YJ9P 2KIKA 1L0NE 4L75A 3RL0g 3USSA 5AW5B 1OW6A 5EFWB 5AW7B 2V7QH 2JEEA 1SQVJ 3P32A 1X0TA 4IL6X 2ZXXA 5KJ7A 1S1CX 2D2CC 2YMKA 2K9YA 3PHLA 4U3FD 3BRTB 1H0TA 2H89C 3RK3B 1KILD 4OGQB 1X8YA 4OGQC 1KILA 3HUSB 1IFMA 3VP9A 3EQ2A 3U59A 3A0HE 2NPSB 2OYHC 3WUVA 2IYOA 4ZNCA 3GHGB 3MUDA 2JP3A 1LJ2A 3SWYA 5BVZA 1NTMD 3C8VA 3D6ZA 4TLFA 3MIWA 4WY4D 5CCGD 5AVXB 1SQXJ 2QG4A 3L70D 1J1DB 4NPEA 1JMBA 3H1HG 2FYUK 1OX3A 4C46A 1VQ9P 1FDMA 3JC22 2W27A 2ZAEB 2AEJA 3A7OA 3M9QA 5KLVD 3CWBE 1P84I 2M5AA 4ASWA 1BE3G 1EZVG 3H1ID 2OTKE 4YPCA 5APXA 3AEGC 5DJTB 2K9JA 2KZIA 3AE5C 2OGUA 2YNYA 1FJPA 4OVNF 3RL0D 2KK7A 2NRGA 2HR3A 5APQA 1AVOA 4EI2A 1Q86Q 2A06E 1IJDB 2Q6QA 2ZVOB 1PGJA 2PRRA 4IFMA 1CI6A 3ITKA 1PP9E 1T3JA 1WMKA 3AE2C 2IZ1A 3M0DA 1H88A 1VF5B 3NXSA 1NU1G 1VDFA 2BCCE 3M9BA 3VOPA 1U7JA 1BGYG 1IC2A 1L2PA 1LWUB 3AEFC 4W7YA 1JY2N 4XFJA 2XNDH 1T6AA 1SQXK 3B4SA 3CWBD 1L0LJ 3GMAA 4BWNA 3L71D 1YTZT 1YIJP 1SQBG 3CCEP 1YYCA 2IBZE 3H1LE 1RH5B 2AEFA 2B87B 2C0XA 1QEXA 2FYUJ 2A45I 2O3JA 2WSSH 2XU6A 2ZYGA 3CWBJ 2M5AB 3TNUA 1M7LA 3LIEA 1AQTA 5AW4B 3VN0A 2O01H 3H1KD 5DJUB 1SQQJ 1FZCB 5KJ7D 1LTAC 1NKZB 3RBZA 2YO3A 1FZBA 2RMZA 3T97B 3CD6P 1SFCA 3CL3D 1ZN5A 5L8RJ 1VQOP 1L0LG 2KLUA 3RBXA 2AEMA 2QJPB 3KHUA 3L70G 1N2DC 5E79E 2QEXP 4WWIA 1KQFB 1KB9I 2FYUG 3L74D 4HH2A 2H8PD 3AEDC 3I5CA 4PD4H 1N73B 1AFOA 1LWUA 3AE4C 1DEBA 4HYTB 3BCCE 3E1IA 3P8CE 4BXLA 4ZKPA 5CCGA 2IPPA 2OYIB 2KNCB 5KLVJ 1KB9H 1WRGA 3L35A 3CCUP 2B87A 3I55P 4DJGA 1QGKB 1JY3N 2LR2A 1KZUB 4B86A 1PP9G 1QL1A 2WSCJ 3R4YA 3A0HH 1FZGA 1SQXD 2I1JA 2R5BA 2XKMA 3C9IA 4IL6E 3HE5B 1L4AA 1NTMK 1JY3P 3ZDMA 1GU4A 4O9BA 2ZT9C 1KFNA 3ABVC 4I7ZC 3EWKA 3N4XA 3H1JJ 2PGDA 3U1AA 4IOIH 1PP9D 2J5UA 1PGQA 2N9YB 1S5LX 3H1JE 2HG5D 3HE4B 2ZJSE 3JSVC 1QVFO 1LP1A 4HJGH 1IO4A 3V4QA 1Y47A 3FWNA 1GU5A 4YTPC 3S9OA 1EC5A 1EQ7A 1VF5D 2ZYAA 2FFDC 2FXMA 3L4FA 1YBKA 1GTWA 2IBZD 2B9BA 3H1LD 1BE3E 1EZVE 3AECC 4N78E 3SWKA 3G4SP 1EDIA 5CHXA 1GD2E 1A02F 1PFIA 5AVUB 2BCCD 3TDKA 4AYCA 1KILB 2GA1A 4OGQD 4DCKA 4EYYQ 2ZVNB 3FXDA 1JUNA 3BVHA 2OARA 1L0NJ 5APYA 2OYHB 3FWLA 1L4AB 4D6TG 2O1JA 2E74D 3G3ZA 1Z56A 4H44C 4PV1C 1OW7A 4PV1B 5AVVB 1SQVE 2KUBA 3A2AA 3L37A 1SFCD 5APSA 2OTLP 3NMDA 2SPZA 1GW3A 1NKNA 2D2CB 4GOEA 3VMZA 3WMM0 3WU2H 2E75C 3CCVP 3WU2E 2JWDA 1Q82Q 2K88A 4KHXA 1PPJG 1N7LA 2P2UA 1NOHA 1J1DC 2OQQA 3H1IE 1CW5A 3GHGA 1S2EA 3F5HA 4Z1MH 3PJSK 1HUCA 2YKPA 1BGYD 3A5TA 1NU1D 1LTTC 3HTKB 5APTA 5CCGC 3QWOC 1LTJA 1NYHA 2FXPA 2K37A 3CPWO 3B8EB 3CX5H 2O01J 5AW1B 3SSUA 3TGUD 1EXIA 2KSJA 1W2BO 4RJTA 1NTME 1ZV8A 2YIUC 3L73J 5TJHA 3AEBC 1L0NK 1JO5A 3IN6A 3M91A 2QJYB 2FYNC 1HH0A 3L75D 4HB1A 2W6AA 2FYUE 3V5BA 3SFEC 2K9JB 2V7QJ 2P10A 5KLIC 1SQBK 1M56D 4JQ0D 2JKVA 3M9HA 2R32A 2WTYA 1FC2C 2W8ZA 1Q2NA 3BCCD 3CC4P 3MP7B 1R8EA 2P67A 2VRSA 1RE3A 4EIJA 4IFFA 1OVRA 1GL2A 2G3AA 1QVGO 1DD4A 4UB8E 3RL0C 3GLMA 1T8ZA 5BU8B 1H8AA 1Y9BA 2OYIC 1RY3A 1N7SA 3P8MC 4EDFA 4XA4A 1NTKJ 4HKZH 2HODB 2QVAA 2FFDA 1AVYA 1UIIA 2M3BA 5CJ4A 2C9NY 3L72J 1SQXE 2A45G 4ZKUA 4WY4A 3KDPB 4OH8B 2E74B 2QE7H 1S9KE 2QJPC 1MFTA 3NTNA 2MJZA 1OXZA 2O1KA 3H1HJ 1N73A 1DIPA 4U3FG 3TNUB 5KAFE 1AV1A 4I2LC 1Q7YQ 3CCMP 3KPEA 1KQGB 4YXWH 1PV3A
chains in the Genus database with same CATH topology
3TGUJ 2IBZI 1BGYJ 1P84I 1SQQJ 1NTZJ 1NU1J 3L74J 1SQVJ 3H1KJ 3H1JJ 3L71J 1PP9J 1SQBJ 3CX5I 1KB9I 3BCCJ 4D6TJ 2BCCJ 1EZVI 1BCCJ 3H1IJ 1NTKJ 1KYOI 1BE3J 3H1LJ 3L72J 5KLVJ 4PD4I 1SQPJ 3CXHI 4U3FJ 1SQXJ 1L0LJ 3H1HJ 3L70J 3L73J 2FYUJ 3L75J 1L0NJ 3CWBJ 1NTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGU J;  2IBZ I;  1BGY J;  1P84 I;  1SQQ J;  1NTZ J;  1NU1 J;  3L74 J;  1SQV J;  3H1K J;  3H1J J;  3L71 J;  1PP9 J;  1SQB J;  3CX5 I;  1KB9 I;  3BCC J;  4D6T J;  2BCC J;  1EZV I;  1BCC J;  3H1I J;  1NTK J;  1KYO I;  1BE3 J;  3H1L J;  3L72 J;  5KLV J;  4PD4 I;  1SQP J;  3CXH I;  4U3F J;  1SQX J;  1L0L J;  3H1H J;  3L70 J;  3L73 J;  2FYU J;  3L75 J;  1L0N J;  3CWB J;  1NTM J; 
#chains in the Genus database with same CATH topology
 3L75 G;  1FZC C;  2G8Y A;  4DOJ A;  2I8D A;  2N1T A;  2Z5I A;  4C7R A;  2MKV A;  2GUV A;  1NTZ K;  4Y99 C;  4WBA A;  2KYV A;  3H1H D;  1SQV G;  1USE A;  3AE6 C;  3N7N A;  3W68 A;  3LW5 J;  3G6E P;  1R5L A;  2KOG A;  1N73 C;  1BSN A;  3HRN A;  1JTH A;  1SLQ A;  1PGO A;  1DH3 A;  3RK3 E;  4M3L A;  1BCC J;  3E1R A;  1KOR A;  1NTK D;  1RE4 A;  2KNC A;  4D6T E;  2IZ0 A;  1PIX A;  5APV A;  1J2J B;  3MTU E;  1G2C A;  1JY2 O;  3LW5 H;  1Q90 D;  4RO0 A;  2JWA A;  4IFD K;  3HE4 A;  5CCH D;  4WB4 A;  2KB7 P;  3G9R A;  4KT0 J;  3JCU E;  2BEQ D;  3W67 A;  3RK2 C;  5CBO A;  3AE9 C;  2ITA A;  3GF7 A;  1T2K C;  5CCH A;  2QJK C;  1SQQ E;  2WSF H;  3AEE C;  1SQP D;  1YHQ P;  3EFF K;  1VQ4 P;  4W80 A;  2WWW A;  2XZR A;  3VP8 A;  1IK9 A;  4WY4 C;  1NTZ J;  2FXO A;  3CMA P;  1FDO A;  1UIX A;  1MUU A;  2L91 A;  1M90 Q;  1IZN B;  5CBN A;  1KQS O;  1YQ3 C;  2RH0 A;  2N1T D;  3L74 J;  3TYY A;  5KKZ C;  2WSE J;  1ZP0 C;  1ZXG A;  1YTZ I;  2ZT9 D;  3B71 A;  2KSE A;  3PTZ A;  1HJ0 A;  2QM7 A;  2WPS A;  3B5N A;  1G1J A;  1SQB J;  1VQM P;  1GL2 C;  1YJW P;  3CXH H;  3TSI A;  2POH A;  3V6I A;  1SFC C;  2PFX A;  3H25 A;  2Y0C A;  1G2C B;  1YIT P;  1KD1 Q;  2O01 N;  3U1C A;  3L72 D;  3AEA C;  3HUS C;  1VQK P;  3C1L A;  5AVZ B;  2FYU D;  1NTK K;  1KC8 Q;  2Q9I A;  1URQ A;  2PP6 A;  1VQN P;  2E5T A;  1S3J A;  1SS1 A;  1OVU A;  2H88 C;  2WZ7 A;  4UB8 H;  3B5N C;  1FBM A;  4H0L D;  1VQ8 P;  3L75 J;  3AE3 C;  2YMY A;  3L73 G;  1SQQ K;  2YKQ A;  4JBZ A;  1LTJ B;  2Q7C A;  3SWF A;  3L74 E;  2HFE D;  2N1T C;  2QRX A;  1N86 A;  1QLE D;  1RF0 C;  4MN4 C;  5KLI B;  1VQ6 P;  1FAV A;  1FZE A;  1MFZ A;  1OVV A;  2J59 M;  2NPS D;  2KI7 B;  1SQX G;  2E75 B;  2OYO A;  1KYO E;  3A0B E;  2A45 H;  3B5N B;  4W7Z A;  1VPC A;  3AE1 C;  4OWF A;  1ZLL A;  3L71 G;  3D70 A;  4UB6 E;  1M1K Q;  1RF0 A;  5H2F E;  3P7K A;  4I6M C;  1L4A C;  3H1I J;  1J1E C;  5AVS B;  5KLV K;  1SFC B;  1NTK G;  2IYP A;  4RKU J;  4C7N B;  4EOT A;  2FKW B;  2WIT A;  1FE6 A;  1JY3 O;  1IFD A;  3QH9 A;  4PV1 D;  5M1B A;  1GL2 B;  1KFM A;  1KB9 E;  1SQP J;  4H0L C;  3O8Z A;  3RK3 D;  2JJL A;  1RE3 C;  3OA7 A;  1U7M A;  3NFQ A;  4H44 D;  2HOD A;  1GK6 A;  2FFD B;  1BGY E;  5GTH E;  1KMI Z;  2KP8 A;  1OWA A;  1ZW0 A;  1R5S A;  2E76 B;  3L73 E;  4K3A A;  4WY4 B;  3H1I G;  1BGY J;  4Y28 J;  3CCL P;  3EFG A;  1FZA A;  3H1K G;  2KZJ A;  2WSE H;  3FX0 A;  5B5E E;  2PAJ A;  1FJK A;  2W83 C;  3OJA B;  4L76 A;  1YQ4 C;  5AVY B;  3CCS P;  3RK2 B;  2ZYD A;  5APW A;  2ZT9 B;  4I7Z B;  1K9M Q;  1N7S B;  1FS0 E;  3TGU G;  3VMX A;  2WSF J;  1JY2 P;  3I56 P;  1M1J A;  3D71 A;  3FGA D;  5KJ7 C;  1HVV A;  2I1K A;  3V4W A;  4C7N A;  1NTZ G;  5APU A;  3VMY A;  1GMJ A;  2M8R A;  2Q3E A;  2WPV B;  1L0L E;  4QMA A;  1PGP A;  5KKZ B;  1IK7 A;  3CCJ P;  3L70 E;  4PD4 I;  3KYQ A;  1LP1 B;  1OZH A;  2HLO A;  2Y0D A;  1JTH B;  3GG2 A;  2YXQ B;  4TT3 H;  1S5L H;  2KS1 B;  1JM0 A;  5AVW B;  3BCC G;  3D6Y A;  2GUS A;  1NH4 A;  3H1L J;  1GDT A;  1VQ7 P;  1RE4 C;  1RQV A;  2WSC H;  3S4R A;  4KJM A;  1JCC A;  5KLV G;  2NPS A;  3IFM A;  1M8O B;  3MD0 A;  3L71 J;  1SQV K;  3V2N A;  2Z4E A;  1M1J B;  1PP9 J;  3P8C D;  1EDK A;  1LT9 A;  2KLV A;  2FBW C;  3M0A A;  1MV8 A;  3BCC J;  1K8A Q;  2V4H A;  5K5G B;  2IFN A;  3II6 A;  2Q5U A;  2IBZ G;  2QIW A;  3H1L G;  1DD3 A;  4H13 D;  1X22 A;  1HBW A;  5AW8 B;  3HD7 C;  5TIS E;  1RF1 C;  2E43 A;  5TIS H;  1PZQ A;  1LT1 A;  1MKM A;  4BRY A;  3H1J G;  1U57 A;  3HD7 D;  3PRJ A;  3KQG A;  1T2K D;  3IF4 A;  2KS1 A;  1ZR2 A;  1AJY A;  1NJI Q;  2P7J A;  4DZO A;  1EDL A;  5CCH C;  2K1A A;  4GDO A;  1NAF A;  3HTK A;  1NAY A;  3RK2 D;  5B66 E;  3FXE A;  1JB0 J;  4AQR D;  5B66 H;  1VQ5 P;  1EXJ A;  3GF3 A;  2R3S A;  3E7K A;  1S72 P;  1URQ B;  4N3Y B;  3S1K A;  2E74 C;  2ZXE B;  5GTI H;  1KV4 A;  1SQP G;  3L73 D;  2WT7 A;  2B88 A;  2IDB A;  2YIU B;  3F89 A;  2QA4 P;  3H1K E;  2C9L Y;  4GOD A;  3SFD C;  1YJN P;  1BCC E;  1NU1 K;  4GIF A;  3BRV B;  3RL0 B;  3VMA A;  4D6T J;  4JPZ B;  1JMM A;  2YXR B;  4JF7 A;  2JR8 A;  1GL2 D;  2ZFC A;  1BSH A;  3R2P A;  3O6Q A;  1BE3 J;  2N9B A;  1IFP A;  1LTG C;  1JNM A;  1LWU C;  4R4M A;  1KN7 A;  2YO2 A;  1VF5 C;  3Q5P A;  2UWJ E;  4H0L B;  2LKM A;  3Q5R A;  1ZRT E;  5AW3 B;  1YI2 P;  1SQP K;  3CX5 D;  1KYO H;  3A0B H;  1L0L D;  1X9V A;  4RES B;  1SQV D;  2W6J H;  2QJY C;  2JDI H;  5E79 H;  3T97 A;  5KAF H;  1EDJ A;  3IR9 A;  1SQQ G;  1FU1 A;  2KXP B;  1SVF A;  4H13 B;  5H2F H;  4H13 C;  3KZI E;  1QL2 A;  3WUU A;  2M3E A;  3MZW B;  3KZI H;  3CCQ P;  1XTC C;  5CMZ A;  2E76 C;  2DW3 A;  2QSI A;  3CI9 A;  3V2R A;  2HPC B;  2K3R A;  3MGN A;  5AVT B;  4CPG A;  4K35 A;  1KIL C;  2WPQ A;  4ZMD A;  1K73 Q;  1SQB D;  4NPD A;  2E75 D;  1XTG B;  2FYZ A;  2LXC B;  2N1T B;  3CWB G;  3Q1M A;  3Q2Y A;  2H43 A;  1FOS F;  1Y8A A;  1LTJ C;  3GW6 A;  3H1J D;  2Z5H A;  3BAS A;  1NGM B;  2H7H A;  2RN0 A;  1SQP E;  3HD7 A;  1NTZ D;  1RF1 A;  1A02 J;  5AVQ B;  3GHG C;  1HGZ A;  1HWT C;  1J1E B;  3H32 A;  4XE5 B;  1LGH B;  3L74 G;  3BAT A;  1D7M A;  5B5E H;  2BAS A;  1S9K D;  3L70 J;  3RK3 C;  1E5W A;  1HGV A;  1JCD A;  3JCU H;  4H44 B;  4WVZ A;  5KAI H;  1W5C E;  5KAI E;  4DT0 A;  1ZME C;  4ASV A;  1RHZ B;  4IL6 H;  2WMM A;  4N6J A;  1NTM J;  1T3U A;  1URQ C;  1PL5 A;  1G1I A;  2CK3 H;  5AVR B;  1H0T B;  3VTP C;  1NHL A;  2IBZ I;  2E76 D;  2WQY C;  3LID A;  3M06 A;  3HUS A;  1OMI A;  1VL2 A;  3K5B A;  1JOC A;  1BCC D;  2R44 A;  2FY8 A;  1FDI A;  1JEK A;  4PD4 D;  3TF5 A;  3H6P A;  1L0N D;  2R3C A;  1CSB A;  1ZRT D;  1NWQ A;  3G71 P;  2L5G B;  3L71 E;  1USD A;  3CXH E;  2BCC J;  1N8R Q;  1P84 D;  3B5N D;  3HD7 B;  4GT1 A;  1DEE G;  1NTM G;  2QJK B;  3TK1 A;  5BU5 A;  1RF1 B;  3KXD A;  3H32 B;  2IX7 C;  2HYN A;  3O6Q B;  1RQU A;  4NPF X;  2OYH A;  2E42 A;  2GM4 A;  1NTK E;  1GK4 A;  2Q1K A;  1KTM A;  1SP4 A;  4LGD E;  1BDD A;  1KIL E;  1LTS C;  2RKL A;  2C0W A;  1LT9 B;  2YKO A;  1M1J C;  3CXH I;  4JYC A;  4LC1 A;  4A7P A;  1NVO A;  2M0B A;  1CZQ A;  1L0N G;  3Q5S A;  3PLN A;  2D2C D;  3PH0 A;  3CC2 P;  1BCC G;  1S4X A;  3CLQ A;  3CCR P;  5AW2 B;  3TGU E;  1BE3 D;  1EZV D;  1GW4 A;  4N78 D;  1AA0 A;  1CI6 B;  5C39 A;  1L4A D;  1PPJ E;  3CXH D;  3PP5 A;  2OTJ P;  4LLH A;  1AQ5 A;  4L73 A;  2Y9Y A;  2J58 A;  4D6T D;  1FZC A;  1NTZ E;  2JO1 A;  2Y9Z A;  5KTB A;  2W90 A;  1L0L K;  2R5D A;  2WPR A;  4Y99 B;  3V2P A;  3VYI A;  3AE7 C;  1MZ9 A;  2P1J A;  3OW2 O;  2P58 A;  3CME P;  1HF9 A;  3WUT A;  3CX5 I;  1OFC X;  1X79 B;  2CPS A;  4UB6 H;  1EZV I;  4GKG A;  5AW9 B;  3L72 E;  1KYO I;  2WT7 B;  4BRY B;  2QM8 A;  1K05 A;  3AE8 C;  1URQ D;  2WVR A;  3H1H E;  1E79 H;  3CX5 E;  1N7S C;  1LT9 C;  2OYI A;  5GTI E;  1LTI C;  2AXC A;  2B89 A;  1LTB C;  2XNX A;  4GOF A;  1DX7 A;  5KLV E;  1OIP A;  1PPJ D;  3MHV A;  3Q3D A;  2XV5 A;  3L36 A;  4PD4 E;  3V2Q A;  3TGU J;  1TU3 F;  1KYO D;  2E5Y A;  1NU1 E;  5GTH H;  2BEZ F;  4U7J A;  1VQP P;  2Y0E A;  1VQL P;  1K04 A;  1NU1 J;  1OW8 A;  3HE5 A;  1IFJ A;  1KQL A;  1SQQ D;  2A06 D;  1Q81 Q;  3H1K J;  1ZR4 A;  1SQB E;  4YXD C;  1P84 E;  1HJB A;  1ZOY C;  2LXB A;  1P84 H;  1WT6 A;  1BDC A;  1N7S D;  4AUW A;  2BCC G;  2Q3I A;  5CJ0 A;  2CPB A;  4PJ0 H;  4PJ0 E;  2W6B A;  3RGU A;  2FYN B;  1H89 A;  5AW0 B;  1IFN A;  1QX8 A;  2NZ2 A;  3L72 G;  3OAK A;  2HPC A;  2NPS C;  1NO4 A;  1GZL A;  4U3F E;  3M0D C;  1LNQ A;  3CC7 P;  1FOS E;  1M57 D;  3IAO A;  4JYB A;  4L74 A;  4U3F J;  3L75 E;  4I1L A;  3UIA A;  2XDJ A;  5AW6 B;  1HTL C;  1KB9 D;  1FZF A;  4R4L A;  1S5L E;  2AXT E;  1W2E A;  2IFM A;  2A06 G;  2AXT H;  3A3Y B;  1IFI A;  3MUD C;  1YJ9 P;  2KIK A;  1L0N E;  4L75 A;  3RL0 g;  3USS A;  5AW5 B;  1OW6 A;  5EFW B;  5AW7 B;  2V7Q H;  2JEE A;  1SQV J;  3P32 A;  1X0T A;  4IL6 X;  2ZXX A;  5KJ7 A;  1S1C X;  2D2C C;  2YMK A;  2K9Y A;  3PHL A;  4U3F D;  3BRT B;  1H0T A;  2H89 C;  3RK3 B;  1KIL D;  4OGQ B;  1X8Y A;  4OGQ C;  1KIL A;  3HUS B;  1IFM A;  3VP9 A;  3EQ2 A;  3U59 A;  3A0H E;  2NPS B;  2OYH C;  3WUV A;  2IYO A;  4ZNC A;  3GHG B;  3MUD A;  2JP3 A;  1LJ2 A;  3SWY A;  5BVZ A;  1NTM D;  3C8V A;  3D6Z A;  4TLF A;  3MIW A;  4WY4 D;  5CCG D;  5AVX B;  1SQX J;  2QG4 A;  3L70 D;  1J1D B;  4NPE A;  1JMB A;  3H1H G;  2FYU K;  1OX3 A;  4C46 A;  1VQ9 P;  1FDM A;  3JC2 2;  2W27 A;  2ZAE B;  2AEJ A;  3A7O A;  3M9Q A;  5KLV D;  3CWB E;  1P84 I;  2M5A A;  4ASW A;  1BE3 G;  1EZV G;  3H1I D;  2OTK E;  4YPC A;  5APX A;  3AEG C;  5DJT B;  2K9J A;  2KZI A;  3AE5 C;  2OGU A;  2YNY A;  1FJP A;  4OVN F;  3RL0 D;  2KK7 A;  2NRG A;  2HR3 A;  5APQ A;  1AVO A;  4EI2 A;  1Q86 Q;  2A06 E;  1IJD B;  2Q6Q A;  2ZVO B;  1PGJ A;  2PRR A;  4IFM A;  1CI6 A;  3ITK A;  1PP9 E;  1T3J A;  1WMK A;  3AE2 C;  2IZ1 A;  3M0D A;  1H88 A;  1VF5 B;  3NXS A;  1NU1 G;  1VDF A;  2BCC E;  3M9B A;  3VOP A;  1U7J A;  1BGY G;  1IC2 A;  1L2P A;  1LWU B;  3AEF C;  4W7Y A;  1JY2 N;  4XFJ A;  2XND H;  1T6A A;  1SQX K;  3B4S A;  3CWB D;  1L0L J;  3GMA A;  4BWN A;  3L71 D;  1YTZ T;  1YIJ P;  1SQB G;  3CCE P;  1YYC A;  2IBZ E;  3H1L E;  1RH5 B;  2AEF A;  2B87 B;  2C0X A;  1QEX A;  2FYU J;  2A45 I;  2O3J A;  2WSS H;  2XU6 A;  2ZYG A;  3CWB J;  2M5A B;  3TNU A;  1M7L A;  3LIE A;  1AQT A;  5AW4 B;  3VN0 A;  2O01 H;  3H1K D;  5DJU B;  1SQQ J;  1FZC B;  5KJ7 D;  1LTA C;  1NKZ B;  3RBZ A;  2YO3 A;  1FZB A;  2RMZ A;  3T97 B;  3CD6 P;  1SFC A;  3CL3 D;  1ZN5 A;  5L8R J;  1VQO P;  1L0L G;  2KLU A;  3RBX A;  2AEM A;  2QJP B;  3KHU A;  3L70 G;  1N2D C;  5E79 E;  2QEX P;  4WWI A;  1KQF B;  1KB9 I;  2FYU G;  3L74 D;  4HH2 A;  2H8P D;  3AED C;  3I5C A;  4PD4 H;  1N73 B;  1AFO A;  1LWU A;  3AE4 C;  1DEB A;  4HYT B;  3BCC E;  3E1I A;  3P8C E;  4BXL A;  4ZKP A;  5CCG A;  2IPP A;  2OYI B;  2KNC B;  5KLV J;  1KB9 H;  1WRG A;  3L35 A;  3CCU P;  2B87 A;  3I55 P;  4DJG A;  1QGK B;  1JY3 N;  2LR2 A;  1KZU B;  4B86 A;  1PP9 G;  1QL1 A;  2WSC J;  3R4Y A;  3A0H H;  1FZG A;  1SQX D;  2I1J A;  2R5B A;  2XKM A;  3C9I A;  4IL6 E;  3HE5 B;  1L4A A;  1NTM K;  1JY3 P;  3ZDM A;  1GU4 A;  4O9B A;  2ZT9 C;  1KFN A;  3ABV C;  4I7Z C;  3EWK A;  3N4X A;  3H1J J;  2PGD A;  3U1A A;  4IOI H;  1PP9 D;  2J5U A;  1PGQ A;  2N9Y B;  1S5L X;  3H1J E;  2HG5 D;  3HE4 B;  2ZJS E;  3JSV C;  1QVF O;  1LP1 A;  4HJG H;  1IO4 A;  3V4Q A;  1Y47 A;  3FWN A;  1GU5 A;  4YTP C;  3S9O A;  1EC5 A;  1EQ7 A;  1VF5 D;  2ZYA A;  2FFD C;  2FXM A;  3L4F A;  1YBK A;  1GTW A;  2IBZ D;  2B9B A;  3H1L D;  1BE3 E;  1EZV E;  3AEC C;  4N78 E;  3SWK A;  3G4S P;  1EDI A;  5CHX A;  1GD2 E;  1A02 F;  1PFI A;  5AVU B;  2BCC D;  3TDK A;  4AYC A;  1KIL B;  2GA1 A;  4OGQ D;  4DCK A;  4EYY Q;  2ZVN B;  3FXD A;  1JUN A;  3BVH A;  2OAR A;  1L0N J;  5APY A;  2OYH B;  3FWL A;  1L4A B;  4D6T G;  2O1J A;  2E74 D;  3G3Z A;  1Z56 A;  4H44 C;  4PV1 C;  1OW7 A;  4PV1 B;  5AVV B;  1SQV E;  2KUB A;  3A2A A;  3L37 A;  1SFC D;  5APS A;  2OTL P;  3NMD A;  2SPZ A;  1GW3 A;  1NKN A;  2D2C B;  4GOE A;  3VMZ A;  3WMM 0;  3WU2 H;  2E75 C;  3CCV P;  3WU2 E;  2JWD A;  1Q82 Q;  2K88 A;  4KHX A;  1PPJ G;  1N7L A;  2P2U A;  1NOH A;  1J1D C;  2OQQ A;  3H1I E;  1CW5 A;  3GHG A;  1S2E A;  3F5H A;  4Z1M H;  3PJS K;  1HUC A;  2YKP A;  1BGY D;  3A5T A;  1NU1 D;  1LTT C;  3HTK B;  5APT A;  5CCG C;  3QWO C;  1LTJ A;  1NYH A;  2FXP A;  2K37 A;  3CPW O;  3B8E B;  3CX5 H;  2O01 J;  5AW1 B;  3SSU A;  3TGU D;  1EXI A;  2KSJ A;  1W2B O;  4RJT A;  1NTM E;  1ZV8 A;  2YIU C;  3L73 J;  5TJH A;  3AEB C;  1L0N K;  1JO5 A;  3IN6 A;  3M91 A;  2QJY B;  2FYN C;  1HH0 A;  3L75 D;  4HB1 A;  2W6A A;  2FYU E;  3V5B A;  3SFE C;  2K9J B;  2V7Q J;  2P10 A;  5KLI C;  1SQB K;  1M56 D;  4JQ0 D;  2JKV A;  3M9H A;  2R32 A;  2WTY A;  1FC2 C;  2W8Z A;  1Q2N A;  3BCC D;  3CC4 P;  3MP7 B;  1R8E A;  2P67 A;  2VRS A;  1RE3 A;  4EIJ A;  4IFF A;  1OVR A;  1GL2 A;  2G3A A;  1QVG O;  1DD4 A;  4UB8 E;  3RL0 C;  3GLM A;  1T8Z A;  5BU8 B;  1H8A A;  1Y9B A;  2OYI C;  1RY3 A;  1N7S A;  3P8M C;  4EDF A;  4XA4 A;  1NTK J;  4HKZ H;  2HOD B;  2QVA A;  2FFD A;  1AVY A;  1UII A;  2M3B A;  5CJ4 A;  2C9N Y;  3L72 J;  1SQX E;  2A45 G;  4ZKU A;  4WY4 A;  3KDP B;  4OH8 B;  2E74 B;  2QE7 H;  1S9K E;  2QJP C;  1MFT A;  3NTN A;  2MJZ A;  1OXZ A;  2O1K A;  3H1H J;  1N73 A;  1DIP A;  4U3F G;  3TNU B;  5KAF E;  1AV1 A;  4I2L C;  1Q7Y Q;  3CCM P;  3KPE A;  1KQG B;  4YXW H;  1PV3 A; 
#chains in the Genus database with same CATH homology
 3TGU J;  2IBZ I;  1BGY J;  1P84 I;  1SQQ J;  1NTZ J;  1NU1 J;  3L74 J;  1SQV J;  3H1K J;  3H1J J;  3L71 J;  1PP9 J;  1SQB J;  3CX5 I;  1KB9 I;  3BCC J;  4D6T J;  2BCC J;  1EZV I;  1BCC J;  3H1I J;  1NTK J;  1KYO I;  1BE3 J;  3H1L J;  3L72 J;  5KLV J;  4PD4 I;  1SQP J;  3CXH I;  4U3F J;  1SQX J;  1L0L J;  3H1H J;  3L70 J;  3L73 J;  2FYU J;  3L75 J;  1L0N J;  3CWB J;  1NTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...