4D6TJ

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
b'PTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 58
sequence length 58
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4d6tJ00
2FYUJ 5KLVJ 1SQQJ 3H1LJ 1L0NJ 1SQXJ 3L72J 1BGYJ 3H1HJ 3L74J 3H1KJ 1L0LJ 1P84I 3L75J 1KB9I 2BCCJ 4D6TJ 4PD4I 1NTKJ 1KYOI 1NU1J 3CXHI 3H1IJ 3BCCJ 2IBZI 3TGUJ 1BE3J 1NTZJ 3L71J 1SQPJ 4U3FJ 3CX5I 1PP9J 1BCCJ 3H1JJ 3L73J 1SQBJ 1EZVI 3CWBJ 1SQVJ 3L70J 1NTMJ
chains in the Genus database with same CATH superfamily
1NTZG 2K3RA 3CCRP 2KS1B 3RL0D 2ZXXA 4AQRD 2QJPC 3M06A 4U3FE 1ZN5A 1AQ5A 1G1IA 1SFCA 1UIIA 3CCMP 4N78E 3CLQA 1FC2C 3AEFC 1NTMK 2E74D 4C46A 5B66E 3CMAP 1BCCD 2HR3A 1K04A 5APSA 3H6PA 1KZUB 1NTZK 1VDFA 1KMIZ 1OVRA 1L2PA 1RE3A 3LIDA 1PV3A 2QIWA 3K5BA 1MKMA 1NTKD 4C7NB 3AE4C 1HTLC 2PP6A 3O6QA 3VOPA 3H1JJ 1RF1A 1N73B 3TSIA 2P10A 3L70E 1YYCA 2H89C 3IR9A 3MUDA 4IL6H 3C9IA 2W8ZA 3P32A 2P7JA 5AW0B 1JM0A 3HD7C 2WZ7A 3AE8C 1OWAA 3L71E 1X79B 4XFJA 2FFDB 2E42A 1NTMJ 2HODB 3A0HH 1Z56A 2FYUG 1NTZJ 2BCCD 4UB8H 1VQ5P 1NOHA 1NH4A 1JY2N 1SQBE 1FZAA 2Q6QA 3GW6A 2Q3IA 3AE6C 1OIPA 1QL1A 2L91A 1ZMEC 4EDFA 1P84I 3FXDA 3GF3A 4GOFA 5KJ7A 3CC4P 1K05A 1KQSO 1EZVE 3GHGA 3HTKA 4N6JA 2FYNC 1T2KC 3CWBD 2IX7C 1GL2C 1LT9A 1SS1A 1CI6B 1KILB 3MHVA 3A2AA 3S1KA 2K9YA 1LTJA 1ZV8A 1EDKA 1NU1E 3BCCJ 2ZXEB 1SQXG 3Q3DA 2V7QJ 2ITAA 2FYUK 1SQPD 5B66H 4ZNCA 3H25A 1DD3A 3PLNA 4ZKPA 4BRYB 3MZWB 2P1JA 3QWOC 3ABVC 2QEXP 2IZ0A 3G3ZA 2M5AA 2G3AA 1S9KD 1J2JB 3LW5J 1N7SC 3H1HG 3ITKA 2XU6A 3H1ID 1QL2A 1KQGB 5CCHA 4XA4A 1S5LX 4I7ZB 1FS0E 5KAFE 1JOCA 1IK7A 1EDJA 5BU8B 1NWQA 4O9BA 4D6TJ 2OYIA 1OX3A 3H1LG 2K1AA 1VF5B 2J59M 2OGUA 3KZIE 3V4WA 3OW2O 1VQ9P 4TLFA 2A45G 4OH8B 2RN0A 1T3UA 2B9BA 4ZKUA 4WWIA 1FZGA 1EDIA 3HUSC 4QMAA 2WSFH 3SWKA 1NAYA 3TYYA 3JSVC 2WPQA 5CCGA 3I56P 3CCLP 2KYVA 2MKVA 3T97A 2QJPB 3FGAD 2N1TC 5L8RJ 4Y99C 1HGZA 3E1RA 1BE3D 1K73Q 2B87B 2WPVB 1KILD 4OGQC 3AE5C 3HE4B 4YTPC 2WMMA 1PPJG 1KTMA 3NMDA 1BSHA 3NFQA 5M1BA 2OYHA 2FKWB 1BCCE 2PGDA 2XZRA 1USDA 1Q82Q 1PP9D 2IBZG 5APQA 1JMBA 5TISH 3H1HJ 2HPCA 1R5LA 4AUWA 3L36A 1NTKE 4NPDA 5AVTB 1SQQG 5AW9B 3IF4A 2OQQA 4K35A 3H1LJ 2JDIH 5KAFH 3TNUB 1L4AA 3HD7B 5AW4B 2R32A 2MJZA 1NTKJ 2KIKA 3CCEP 1VQOP 5KAIE 2Z4EA 1VQ8P 1VF5D 2Q9IA 2JWDA 2VRSA 4IFMA 3KZIH 1AFOA 1BGYJ 2BEQD 2R5BA 2Q7CA 1NO4A 1K8AQ 3VYIA 2BCCE 1AVYA 3D6ZA 1L0LD 1AQTA 1X9VA 2HG5D 2W83C 1SQQK 3CX5D 2NPSC 3RK3D 3CCUP 1Q81Q 1FAVA 3CCQP 2A06G 1KN7A 1CW5A 2C0XA 2BCCJ 3JCUE 1MZ9A 2HLOA 2KOGA 1OW8A 3TGUJ 1HJ0A 3PP5A 4EIJA 3CWBE 2POHA 2FYNB 1NKZB 2R3CA 2LXBA 1GL2B 1HH0A 1SQBD 2KP8A 2RMZA 4BXLA 1ZOYC 3A7OA 1TU3F 3L72J 1U57A 5CJ4A 3H1KJ 2E5TA 2XKMA 2OTJP 1SQPE 3A0BE 2C0WA 3D6YA 3B5NB 3KDPB 1SQQJ 1RF1C 1S9KE 3RK2B 3EFGA 3EQ2A 1N7SB 3H1IE 1QVGO 3P8CD 1RF0A 1EZVI 1VQMP 1RE4A 1M57D 3CPWO 2KSJA 4WBAA 1IZNB 1IK9A 3HD7D 1D7MA 3B4SA 5AVZB 1FOSF 5AVWB 5KAIH 4WB4A 3FXEA 5APTA 4YXWH 2M8RA 5DJTB 2KS1A 2KLVA 3WU2E 4LC1A 3H1JG 3L75J 2GUSA 3KYQA 5CJ0A 5BU5A 3CI9A 3L37A 2WT7B 1PFIA 5AW2B 1SQVK 1Y8AA 1AA0A 1MFZA 3RL0g 4Z1MH 4JBZA 3HUSB 3BRVB 4R4MA 2KZJA 3LIEA 4EI2A 3L73D 3A0HE 3M9BA 1M90Q 3PH0A 3TK1A 4RKUJ 4DOJA 1NTMG 5AVYB 1LT9C 3JCUH 1RQUA 2N1TB 4A7PA 1BE3E 4Y99B 2K9JA 4UB8E 1LTJC 2XDJA 4I1LA 2YMKA 1KILE 1GL2D 3V2NA 4OGQB 3AE1C 3BRTB 1W2BO 2Q1KA 2BASA 2LR2A 3VTPC 2O01H 1N73A 1JY3O 2HFED 2IPPA 1YQ3C 1PP9E 3A0BH 3II6A 1M1JA 1SQVJ 2QM7A 3B5ND 1FZCA 4JYBA 1FDOA 1PGPA 5CCHC 2ZVOB 4HYTB 3RK2D 1SQXD 1U7MA 1S4XA 3L74D 1XTCC 2R5DA 2FFDA 4WY4B 4U3FJ 4ZMDA 3BCCG 1KV4A 1EZVG 1QLED 3IFMA 2KUBA 5KLVD 1KD1Q 1GDTA 1KFNA 3CC7P 3VMZA 4H0LB 1YQ4C 2E75D 4L75A 3WU2H 1G1JA 4H44C 1YITP 1L0LE 1VQ7P 5K5GB 2PRRA 5GTIH 1FBMA 3CX5E 1FJKA 3RK3E 2NPSB 1SP4A 2UWJE 3L70J 4D6TG 3BVHA 3Q5PA 1CI6A 1KILA 1R5SA 1Y9BA 1IFNA 2OARA 3AE3C 2G8YA 1JY3P 1N86A 3L71J 1H88A 2OYHC 4IFFA 2HYNA 2ZFCA 1AV1A 1GMJA 4OGQD 1CZQA 1NU1K 2WPRA 1LJ2A 2Y9YA 4OVNF 1HVVA 1VQ6P 1SQBJ 2WSFJ 3O6QB 1RF1B 1J1DC 2D2CC 2WQYC 3VMXA 3FWNA 2IYPA 1H8AA 1URQB 1YTZI 1M8OB 2YIUC 3GMAA 3P8CE 1YBKA 1Y47A 1L4AC 3M0DC 2IBZD 4WY4D 5APUA 1IC2A 1RHZB 3HRNA 3V2RA 5TISE 1X0TA 3TDKA 3F5HA 1HGVA 3VMAA 5KKZC 2DW3A 1NU1J 3AEAC 1X22A 1Q2NA 1KFMA 2N9BA 4H0LD 4DZOA 2ZT9C 3F89A 2WSCH 2WSEH 1YI2P 1GU4A 4K3AA 3CX5H 2N9YB 2NPSD 3L73E 3B8EB 1NTKG 1RQVA 3HE4A 3HTKB 2YMYA 1EDLA 1YJ9P 5APVA 1R8EA 3KHUA 2QE7H 1JUNA 2QG4A 1BGYG 5APWA 3PTZA 5APXA 3D70A 3D71A 1Q90D 1RY3A 1H0TB 1YJWP 4I2LC 1N7LA 1UIXA 1LWUA 2PAJA 3E7KA 4AYCA 3SFDC 3M9QA 2ZYAA 2ZJSE 2BCCG 4XE5B 3TNUA 3HD7A 3TGUG 5AVRB 1SQXE 1NTKK 1URQD 1RE4C 3L74E 1S5LH 5AVSB 5GTHE 1L0ND 1HWTC 2YO3A 5AW6B 2KNCB 3L72G 3H1KG 1H89A 4BWNA 5KLVE 1M7LA 4W80A 2YO2A 2QJKC 2CK3H 3I5CA 4PD4D 1QX8A 5AW5B 1W2EA 1LTIC 1BCCJ 1YTZT 3V6IA 3UIAA 4ASWA 5KLVJ 1SQPG 4H44B 1AVOA 1IFPA 3CXHE 2YNYA 3IAOA 1G2CA 1GU5A 3T97B 4W7YA 2O1JA 3P7KA 2XNXA 1GL2A 4UB6H 1GTWA 3H1JD 1OW6A 2RH0A 1GZLA 2WITA 1CSBA 2C9NY 3V5BA 3U1AA 3B5NA 2KXPB 3L75G 1JTHA 1OVUA 2E5YA 1KC8Q 3R2PA 2FYZA 1X8YA 1NTMD 1M1JC 4JF7A 2IYOA 5AVXB 1FZCC 1SFCC 1SQPK 3BASA 3W67A 5CHXA 2KZIA 3CX5I 3V2QA 2Y0DA 4NPEA 1NTZD 1YIJP 1J1DB 3G9RA 2D2CB 1NHLA 5CBNA 5CCHD 2NZ2A 1VQ4P 2QJYC 5AVUB 2YIUB 5C39A 2IBZE 5GTHH 3AECC 2H43A 2KB7P 2V4HA 4M3LA 2K37A 4DCKA 1W5CE 3CWBJ 1RE3C 2QM8A 3R4YA 1WMKA 1WRGA 3ZDMA 4N3YB 1DIPA 1VQNP 3H32B 2E43A 2WT7A 1GD2E 2YKPA 5AW3B 5KKZB 1DEEG 1SQVG 3MUDC 2O01J 1SVFA 1JO5A 1KYOD 1SQPJ 3TF5A 3BCCD 3Q2YA 1ZRTD 2ZT9B 3L35A 2P2UA 1DH3A 2JR8A 4EOTA 3V4QA 1JEKA 3NTNA 4H44D 4GIFA 3CC2P 4U3FG 1LP1A 1GW3A 1LTGC 1IJDB 1MFTA 3USSA 1PGJA 2QRXA 3CXHH 1K9MQ 3H1IJ 2Z5HA 1VQLP 4HJGH 4RJTA 1QVFO 2W90A 2A45H 2Q5UA 2RKLA 1ZR2A 3B71A 1ZR4A 3CD6P 1IFMA 1KB9H 4YXDC 3VN0A 3Q5SA 5GTIE 1NAFA 4MN4C 4D6TD 3AE2C 3FX0A 2AEMA 5KJ7C 2LKMA 1E5WA 5E79H 4KJMA 3GHGC 3CCJP 2FYUD 3KXDA 4WY4A 3L70G 5AVVB 1LGHB 3HE5B 3NXSA 3S9OA 2SPZA 4H13C 3P8MC 3CCSP 4IFDK 1IFJA 2D2CD 1T2KD 2AXTE 3KPEA 3L71G 1L0NE 1USEA 1FDMA 1OFCX 3MGNA 3G4SP 2LXCB 2FY8A 4C7NA 3OA7A 1BE3J 3G71P 1KQLA 4IL6X 2XV5A 2JEEA 3RK3C 1PZQA 2YXQB 2QJKB 3PJSK 1L0NJ 2GM4A 4OWFA 4PD4E 2ZYDA 1IFIA 3MTUE 1SQBG 1T3JA 2I1KA 2NPSA 1NKNA 1N7SD 1BDCA 3AEBC 2QVAA 2K88A 4DJGA 1PP9J 2HODA 2OYIC 3SWFA 1OXZA 2E76C 2ZT9D 3VP8A 1L0LK 2O3JA 1GW4A 2I1JA 3MP7B 1QEXA 4L76A 3H1HD 5KTBA 4RESB 4GKGA 4Y28J 2W6BA 2IFMA 3H1JE 2K9JB 2B89A 1NU1G 2WWWA 1FZFA 5BVZA 4PV1C 4RO0A 3H1LD 2H8PD 1SQBK 2H88C 1NYHA 1JCCA 1VQPP 3CXHD 1LWUC 2YKQA 1MUUA 1IO4A 5CCGC 1NTME 1URQA 1M1JB 3SSUA 2YKOA 4GOEA 2YXRB 1FZCB 1SFCB 1L0LJ 2WSCJ 2Y0CA 3U59A 2WSEJ 1BGYD 2W27A 1KB9D 3CXHI 1NTZE 2N1TD 5AW7B 2O1KA 3AEDC 1HUCA 3AE7C 2BEZF 2Y0EA 5B5EE 1OZHA 3PRJA 2A45I 4BRYA 2IDBA 2QJYB 4W7ZA 2AXTH 3L73G 1RH5B 1KB9I 1YJNP 1P84D 2O01N 4CPGA 4R4LA 3MIWA 3TGUD 1S72P 1SLQA 3A3YB 5AW1B 2ZYGA 1M56D 1PPJD 3AE9C 4LLHA 4L74A 1FZEA 1S5LE 4PD4H 1KYOE 2C9LY 3L72D 4NPFX 3VP9A 3H1KD 3BCCE 3MD0A 1ZRTE 3AEEC 2AEJA 2XNDH 2OTLP 1PGOA 1EXIA 2JKVA 5CBOA 1SQQD 4PJ0E 3RL0C 2IBZI 3JC22 3L74G 1EC5A 2J5UA 1FDIA 1N2DC 1HJBA 3AEGC 4KT0J 1H0TA 1KORA 4JPZB 3B5NC 2AEFA 2QSIA 1BCCG 3RK2C 4D6TE 1WT6A 3OJAB 3CCVP 2JP3A 3WUVA 1BDDA 2JJLA 3G6EP 3WUTA 5KLVG 2B87A 4UB6E 2E74C 1XTGB 2P58A 3GHGB 2NRGA 2FYUE 5EFWB 1SFCD 2KNCA 1JY2O 1LT9B 2CPSA 3PHLA 4H13B 3M91A 3N7NA 4TT3H 3L75D 2JO1A 3M0AA 1LTJB 1J1EC 5KLIC 3L73J 5B5EH 1SQXK 2A06D 2E75C 2FYUJ 5H2FE 1LTBC 5APYA 1FU1A 4GDOA 2FXMA 3GG2A 3E1IA 1BSNA 2M5AB 2FXOA 3RK3B 4L73A 5KLVK 1NJIQ 3WUUA 4U7JA 1VQKP 1RF0C 1GK6A 2FBWC 1KYOH 3VMYA 1NVOA 1T6AA 2OYIB 2E76B 4ASVA 2V7QH 5AW8B 1S2EA 1Q7YQ 2Q3EA 1FOSE 1SQVD 3C8VA 1SQXJ 1ZP0C 3L74J 3H1HE 1PL5A 3CWBG 1A02J 4GODA 4PJ0H 1Q86Q 1GK4A 3LW5H 2B88A 2CPBA 2WVRA 1KQFB 4U3FD 1JMMA 1MV8A 2JWAA 3H1LE 1JY2P 2M3EA 4PV1B 4PD4I 4N78D 4YPCA 3U1CA 1YHQP 1LWUB 3WMM0 1QGKB 4WY4C 5KJ7D 1S1CX 2L5GB 4IOIH 2WSSH 1S3JA 1DD4A 5TJHA 3H1IG 3RBXA 4I6MC 1DX7A 1LT1A 1BGYE 3M0DA 4WVZA 2Z5IA 1KB9E 4H13D 2M0BA 2OYHB 3I55P 3N4XA 1PIXA 3H32A 4H0LC 1N73C 3L4FA 1FJPA 1FE6A 5E79E 3L70D 5H2FH 1OVVA 1P84E 2OTKE 1N7SA 3RBZA 3GF7A 1T8ZA 2HPCB 2J58A 3TGUE 3A5TA 2P67A 1LTAC 3O8ZA 3C1LA 3L71D 3CL3D 4C7RA 3FWLA 1PPJE 2FFDC 2FXPA 4HB1A 2GUVA 1VL2A 3L72E 3H1KE 2QA4P 2GA1A 4DT0A 4JQ0D 1L4AB 1M1KQ 1G2CB 2E76D 1ZLLA 2KSEA 4GT1A 2ZAEB 3GLMA 1LNQA 1BE3G 1SQQE 2I8DA 4EYYQ 4HH2A 2R3SA 2KI7B 2ZVNB 3RL0B 3HUSA 5CMZA 3CMEP 1L0NG 1AJYA 3S4RA 1N8RQ 2IZ1A 3V2PA 1HF9A 1JB0J 4HKZH 1EZVD 1JY3N 1JTHB 2KLUA 4PV1D 1PP9G 1URQC 1DEBA 3HE5A 1KILC 3Q1MA 2N1TA 1KYOI 1PGQA 5CCGD 1NU1D 2E74B 1A02F 5AVQB 1EXJA 3M9HA 2H7HA 2OYOA 2IFNA 1OW7A 2R44A 3L75E 3SWYA 1ZW0A 4B86A 1J1EB 3W68A 5KLIB 2A06E 1U7JA 1JNMA 2E75B 1L0NK 4IL6E 2WPSA 3Q5RA 1OMIA 3OAKA 4I7ZC 4KHXA 1P84H 2M3BA 1FZBA 5DJUB 3EFFK 2W6AA 1VPCA 2W6JH 3QH9A 1L0LG 1VF5C 1E79H 1EQ7A 3KQGA 3RGUA 1IFDA 1NGMB 3BATA 2WTYA 2AXCA 2KK7A 1LP1B 1HBWA 2Y9ZA 1LTTC 1L4AD 2PFXA 1LTSC 3EWKA 1JCDA 3SFEC 1ZXGA 1SQVE 3IN6A 4JYCA 4LGDE
chains in the Genus database with same CATH topology
2FYUJ 5KLVJ 1SQQJ 3H1LJ 1L0NJ 1SQXJ 3L72J 1BGYJ 3H1HJ 3L74J 3H1KJ 1L0LJ 1P84I 3L75J 1KB9I 2BCCJ 4D6TJ 4PD4I 1NTKJ 1KYOI 1NU1J 3CXHI 3H1IJ 3BCCJ 2IBZI 3TGUJ 1BE3J 1NTZJ 3L71J 1SQPJ 4U3FJ 3CX5I 1PP9J 1BCCJ 3H1JJ 3L73J 1SQBJ 1EZVI 3CWBJ 1SQVJ 3L70J 1NTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU J;  5KLV J;  1SQQ J;  3H1L J;  1L0N J;  1SQX J;  3L72 J;  1BGY J;  3H1H J;  3L74 J;  3H1K J;  1L0L J;  1P84 I;  3L75 J;  1KB9 I;  2BCC J;  4D6T J;  4PD4 I;  1NTK J;  1KYO I;  1NU1 J;  3CXH I;  3H1I J;  3BCC J;  2IBZ I;  3TGU J;  1BE3 J;  1NTZ J;  3L71 J;  1SQP J;  4U3F J;  3CX5 I;  1PP9 J;  1BCC J;  3H1J J;  3L73 J;  1SQB J;  1EZV I;  3CWB J;  1SQV J;  3L70 J;  1NTM J; 
#chains in the Genus database with same CATH topology
 1NTZ G;  2K3R A;  3CCR P;  2KS1 B;  3RL0 D;  2ZXX A;  4AQR D;  2QJP C;  3M06 A;  4U3F E;  1ZN5 A;  1AQ5 A;  1G1I A;  1SFC A;  1UII A;  3CCM P;  4N78 E;  3CLQ A;  1FC2 C;  3AEF C;  1NTM K;  2E74 D;  4C46 A;  5B66 E;  3CMA P;  1BCC D;  2HR3 A;  1K04 A;  5APS A;  3H6P A;  1KZU B;  1NTZ K;  1VDF A;  1KMI Z;  1OVR A;  1L2P A;  1RE3 A;  3LID A;  1PV3 A;  2QIW A;  3K5B A;  1MKM A;  1NTK D;  4C7N B;  3AE4 C;  1HTL C;  2PP6 A;  3O6Q A;  3VOP A;  3H1J J;  1RF1 A;  1N73 B;  3TSI A;  2P10 A;  3L70 E;  1YYC A;  2H89 C;  3IR9 A;  3MUD A;  4IL6 H;  3C9I A;  2W8Z A;  3P32 A;  2P7J A;  5AW0 B;  1JM0 A;  3HD7 C;  2WZ7 A;  3AE8 C;  1OWA A;  3L71 E;  1X79 B;  4XFJ A;  2FFD B;  2E42 A;  1NTM J;  2HOD B;  3A0H H;  1Z56 A;  2FYU G;  1NTZ J;  2BCC D;  4UB8 H;  1VQ5 P;  1NOH A;  1NH4 A;  1JY2 N;  1SQB E;  1FZA A;  2Q6Q A;  3GW6 A;  2Q3I A;  3AE6 C;  1OIP A;  1QL1 A;  2L91 A;  1ZME C;  4EDF A;  1P84 I;  3FXD A;  3GF3 A;  4GOF A;  5KJ7 A;  3CC4 P;  1K05 A;  1KQS O;  1EZV E;  3GHG A;  3HTK A;  4N6J A;  2FYN C;  1T2K C;  3CWB D;  2IX7 C;  1GL2 C;  1LT9 A;  1SS1 A;  1CI6 B;  1KIL B;  3MHV A;  3A2A A;  3S1K A;  2K9Y A;  1LTJ A;  1ZV8 A;  1EDK A;  1NU1 E;  3BCC J;  2ZXE B;  1SQX G;  3Q3D A;  2V7Q J;  2ITA A;  2FYU K;  1SQP D;  5B66 H;  4ZNC A;  3H25 A;  1DD3 A;  3PLN A;  4ZKP A;  4BRY B;  3MZW B;  2P1J A;  3QWO C;  3ABV C;  2QEX P;  2IZ0 A;  3G3Z A;  2M5A A;  2G3A A;  1S9K D;  1J2J B;  3LW5 J;  1N7S C;  3H1H G;  3ITK A;  2XU6 A;  3H1I D;  1QL2 A;  1KQG B;  5CCH A;  4XA4 A;  1S5L X;  4I7Z B;  1FS0 E;  5KAF E;  1JOC A;  1IK7 A;  1EDJ A;  5BU8 B;  1NWQ A;  4O9B A;  4D6T J;  2OYI A;  1OX3 A;  3H1L G;  2K1A A;  1VF5 B;  2J59 M;  2OGU A;  3KZI E;  3V4W A;  3OW2 O;  1VQ9 P;  4TLF A;  2A45 G;  4OH8 B;  2RN0 A;  1T3U A;  2B9B A;  4ZKU A;  4WWI A;  1FZG A;  1EDI A;  3HUS C;  4QMA A;  2WSF H;  3SWK A;  1NAY A;  3TYY A;  3JSV C;  2WPQ A;  5CCG A;  3I56 P;  3CCL P;  2KYV A;  2MKV A;  3T97 A;  2QJP B;  3FGA D;  2N1T C;  5L8R J;  4Y99 C;  1HGZ A;  3E1R A;  1BE3 D;  1K73 Q;  2B87 B;  2WPV B;  1KIL D;  4OGQ C;  3AE5 C;  3HE4 B;  4YTP C;  2WMM A;  1PPJ G;  1KTM A;  3NMD A;  1BSH A;  3NFQ A;  5M1B A;  2OYH A;  2FKW B;  1BCC E;  2PGD A;  2XZR A;  1USD A;  1Q82 Q;  1PP9 D;  2IBZ G;  5APQ A;  1JMB A;  5TIS H;  3H1H J;  2HPC A;  1R5L A;  4AUW A;  3L36 A;  1NTK E;  4NPD A;  5AVT B;  1SQQ G;  5AW9 B;  3IF4 A;  2OQQ A;  4K35 A;  3H1L J;  2JDI H;  5KAF H;  3TNU B;  1L4A A;  3HD7 B;  5AW4 B;  2R32 A;  2MJZ A;  1NTK J;  2KIK A;  3CCE P;  1VQO P;  5KAI E;  2Z4E A;  1VQ8 P;  1VF5 D;  2Q9I A;  2JWD A;  2VRS A;  4IFM A;  3KZI H;  1AFO A;  1BGY J;  2BEQ D;  2R5B A;  2Q7C A;  1NO4 A;  1K8A Q;  3VYI A;  2BCC E;  1AVY A;  3D6Z A;  1L0L D;  1AQT A;  1X9V A;  2HG5 D;  2W83 C;  1SQQ K;  3CX5 D;  2NPS C;  3RK3 D;  3CCU P;  1Q81 Q;  1FAV A;  3CCQ P;  2A06 G;  1KN7 A;  1CW5 A;  2C0X A;  2BCC J;  3JCU E;  1MZ9 A;  2HLO A;  2KOG A;  1OW8 A;  3TGU J;  1HJ0 A;  3PP5 A;  4EIJ A;  3CWB E;  2POH A;  2FYN B;  1NKZ B;  2R3C A;  2LXB A;  1GL2 B;  1HH0 A;  1SQB D;  2KP8 A;  2RMZ A;  4BXL A;  1ZOY C;  3A7O A;  1TU3 F;  3L72 J;  1U57 A;  5CJ4 A;  3H1K J;  2E5T A;  2XKM A;  2OTJ P;  1SQP E;  3A0B E;  2C0W A;  3D6Y A;  3B5N B;  3KDP B;  1SQQ J;  1RF1 C;  1S9K E;  3RK2 B;  3EFG A;  3EQ2 A;  1N7S B;  3H1I E;  1QVG O;  3P8C D;  1RF0 A;  1EZV I;  1VQM P;  1RE4 A;  1M57 D;  3CPW O;  2KSJ A;  4WBA A;  1IZN B;  1IK9 A;  3HD7 D;  1D7M A;  3B4S A;  5AVZ B;  1FOS F;  5AVW B;  5KAI H;  4WB4 A;  3FXE A;  5APT A;  4YXW H;  2M8R A;  5DJT B;  2KS1 A;  2KLV A;  3WU2 E;  4LC1 A;  3H1J G;  3L75 J;  2GUS A;  3KYQ A;  5CJ0 A;  5BU5 A;  3CI9 A;  3L37 A;  2WT7 B;  1PFI A;  5AW2 B;  1SQV K;  1Y8A A;  1AA0 A;  1MFZ A;  3RL0 g;  4Z1M H;  4JBZ A;  3HUS B;  3BRV B;  4R4M A;  2KZJ A;  3LIE A;  4EI2 A;  3L73 D;  3A0H E;  3M9B A;  1M90 Q;  3PH0 A;  3TK1 A;  4RKU J;  4DOJ A;  1NTM G;  5AVY B;  1LT9 C;  3JCU H;  1RQU A;  2N1T B;  4A7P A;  1BE3 E;  4Y99 B;  2K9J A;  4UB8 E;  1LTJ C;  2XDJ A;  4I1L A;  2YMK A;  1KIL E;  1GL2 D;  3V2N A;  4OGQ B;  3AE1 C;  3BRT B;  1W2B O;  2Q1K A;  2BAS A;  2LR2 A;  3VTP C;  2O01 H;  1N73 A;  1JY3 O;  2HFE D;  2IPP A;  1YQ3 C;  1PP9 E;  3A0B H;  3II6 A;  1M1J A;  1SQV J;  2QM7 A;  3B5N D;  1FZC A;  4JYB A;  1FDO A;  1PGP A;  5CCH C;  2ZVO B;  4HYT B;  3RK2 D;  1SQX D;  1U7M A;  1S4X A;  3L74 D;  1XTC C;  2R5D A;  2FFD A;  4WY4 B;  4U3F J;  4ZMD A;  3BCC G;  1KV4 A;  1EZV G;  1QLE D;  3IFM A;  2KUB A;  5KLV D;  1KD1 Q;  1GDT A;  1KFN A;  3CC7 P;  3VMZ A;  4H0L B;  1YQ4 C;  2E75 D;  4L75 A;  3WU2 H;  1G1J A;  4H44 C;  1YIT P;  1L0L E;  1VQ7 P;  5K5G B;  2PRR A;  5GTI H;  1FBM A;  3CX5 E;  1FJK A;  3RK3 E;  2NPS B;  1SP4 A;  2UWJ E;  3L70 J;  4D6T G;  3BVH A;  3Q5P A;  1CI6 A;  1KIL A;  1R5S A;  1Y9B A;  1IFN A;  2OAR A;  3AE3 C;  2G8Y A;  1JY3 P;  1N86 A;  3L71 J;  1H88 A;  2OYH C;  4IFF A;  2HYN A;  2ZFC A;  1AV1 A;  1GMJ A;  4OGQ D;  1CZQ A;  1NU1 K;  2WPR A;  1LJ2 A;  2Y9Y A;  4OVN F;  1HVV A;  1VQ6 P;  1SQB J;  2WSF J;  3O6Q B;  1RF1 B;  1J1D C;  2D2C C;  2WQY C;  3VMX A;  3FWN A;  2IYP A;  1H8A A;  1URQ B;  1YTZ I;  1M8O B;  2YIU C;  3GMA A;  3P8C E;  1YBK A;  1Y47 A;  1L4A C;  3M0D C;  2IBZ D;  4WY4 D;  5APU A;  1IC2 A;  1RHZ B;  3HRN A;  3V2R A;  5TIS E;  1X0T A;  3TDK A;  3F5H A;  1HGV A;  3VMA A;  5KKZ C;  2DW3 A;  1NU1 J;  3AEA C;  1X22 A;  1Q2N A;  1KFM A;  2N9B A;  4H0L D;  4DZO A;  2ZT9 C;  3F89 A;  2WSC H;  2WSE H;  1YI2 P;  1GU4 A;  4K3A A;  3CX5 H;  2N9Y B;  2NPS D;  3L73 E;  3B8E B;  1NTK G;  1RQV A;  3HE4 A;  3HTK B;  2YMY A;  1EDL A;  1YJ9 P;  5APV A;  1R8E A;  3KHU A;  2QE7 H;  1JUN A;  2QG4 A;  1BGY G;  5APW A;  3PTZ A;  5APX A;  3D70 A;  3D71 A;  1Q90 D;  1RY3 A;  1H0T B;  1YJW P;  4I2L C;  1N7L A;  1UIX A;  1LWU A;  2PAJ A;  3E7K A;  4AYC A;  3SFD C;  3M9Q A;  2ZYA A;  2ZJS E;  2BCC G;  4XE5 B;  3TNU A;  3HD7 A;  3TGU G;  5AVR B;  1SQX E;  1NTK K;  1URQ D;  1RE4 C;  3L74 E;  1S5L H;  5AVS B;  5GTH E;  1L0N D;  1HWT C;  2YO3 A;  5AW6 B;  2KNC B;  3L72 G;  3H1K G;  1H89 A;  4BWN A;  5KLV E;  1M7L A;  4W80 A;  2YO2 A;  2QJK C;  2CK3 H;  3I5C A;  4PD4 D;  1QX8 A;  5AW5 B;  1W2E A;  1LTI C;  1BCC J;  1YTZ T;  3V6I A;  3UIA A;  4ASW A;  5KLV J;  1SQP G;  4H44 B;  1AVO A;  1IFP A;  3CXH E;  2YNY A;  3IAO A;  1G2C A;  1GU5 A;  3T97 B;  4W7Y A;  2O1J A;  3P7K A;  2XNX A;  1GL2 A;  4UB6 H;  1GTW A;  3H1J D;  1OW6 A;  2RH0 A;  1GZL A;  2WIT A;  1CSB A;  2C9N Y;  3V5B A;  3U1A A;  3B5N A;  2KXP B;  3L75 G;  1JTH A;  1OVU A;  2E5Y A;  1KC8 Q;  3R2P A;  2FYZ A;  1X8Y A;  1NTM D;  1M1J C;  4JF7 A;  2IYO A;  5AVX B;  1FZC C;  1SFC C;  1SQP K;  3BAS A;  3W67 A;  5CHX A;  2KZI A;  3CX5 I;  3V2Q A;  2Y0D A;  4NPE A;  1NTZ D;  1YIJ P;  1J1D B;  3G9R A;  2D2C B;  1NHL A;  5CBN A;  5CCH D;  2NZ2 A;  1VQ4 P;  2QJY C;  5AVU B;  2YIU B;  5C39 A;  2IBZ E;  5GTH H;  3AEC C;  2H43 A;  2KB7 P;  2V4H A;  4M3L A;  2K37 A;  4DCK A;  1W5C E;  3CWB J;  1RE3 C;  2QM8 A;  3R4Y A;  1WMK A;  1WRG A;  3ZDM A;  4N3Y B;  1DIP A;  1VQN P;  3H32 B;  2E43 A;  2WT7 A;  1GD2 E;  2YKP A;  5AW3 B;  5KKZ B;  1DEE G;  1SQV G;  3MUD C;  2O01 J;  1SVF A;  1JO5 A;  1KYO D;  1SQP J;  3TF5 A;  3BCC D;  3Q2Y A;  1ZRT D;  2ZT9 B;  3L35 A;  2P2U A;  1DH3 A;  2JR8 A;  4EOT A;  3V4Q A;  1JEK A;  3NTN A;  4H44 D;  4GIF A;  3CC2 P;  4U3F G;  1LP1 A;  1GW3 A;  1LTG C;  1IJD B;  1MFT A;  3USS A;  1PGJ A;  2QRX A;  3CXH H;  1K9M Q;  3H1I J;  2Z5H A;  1VQL P;  4HJG H;  4RJT A;  1QVF O;  2W90 A;  2A45 H;  2Q5U A;  2RKL A;  1ZR2 A;  3B71 A;  1ZR4 A;  3CD6 P;  1IFM A;  1KB9 H;  4YXD C;  3VN0 A;  3Q5S A;  5GTI E;  1NAF A;  4MN4 C;  4D6T D;  3AE2 C;  3FX0 A;  2AEM A;  5KJ7 C;  2LKM A;  1E5W A;  5E79 H;  4KJM A;  3GHG C;  3CCJ P;  2FYU D;  3KXD A;  4WY4 A;  3L70 G;  5AVV B;  1LGH B;  3HE5 B;  3NXS A;  3S9O A;  2SPZ A;  4H13 C;  3P8M C;  3CCS P;  4IFD K;  1IFJ A;  2D2C D;  1T2K D;  2AXT E;  3KPE A;  3L71 G;  1L0N E;  1USE A;  1FDM A;  1OFC X;  3MGN A;  3G4S P;  2LXC B;  2FY8 A;  4C7N A;  3OA7 A;  1BE3 J;  3G71 P;  1KQL A;  4IL6 X;  2XV5 A;  2JEE A;  3RK3 C;  1PZQ A;  2YXQ B;  2QJK B;  3PJS K;  1L0N J;  2GM4 A;  4OWF A;  4PD4 E;  2ZYD A;  1IFI A;  3MTU E;  1SQB G;  1T3J A;  2I1K A;  2NPS A;  1NKN A;  1N7S D;  1BDC A;  3AEB C;  2QVA A;  2K88 A;  4DJG A;  1PP9 J;  2HOD A;  2OYI C;  3SWF A;  1OXZ A;  2E76 C;  2ZT9 D;  3VP8 A;  1L0L K;  2O3J A;  1GW4 A;  2I1J A;  3MP7 B;  1QEX A;  4L76 A;  3H1H D;  5KTB A;  4RES B;  4GKG A;  4Y28 J;  2W6B A;  2IFM A;  3H1J E;  2K9J B;  2B89 A;  1NU1 G;  2WWW A;  1FZF A;  5BVZ A;  4PV1 C;  4RO0 A;  3H1L D;  2H8P D;  1SQB K;  2H88 C;  1NYH A;  1JCC A;  1VQP P;  3CXH D;  1LWU C;  2YKQ A;  1MUU A;  1IO4 A;  5CCG C;  1NTM E;  1URQ A;  1M1J B;  3SSU A;  2YKO A;  4GOE A;  2YXR B;  1FZC B;  1SFC B;  1L0L J;  2WSC J;  2Y0C A;  3U59 A;  2WSE J;  1BGY D;  2W27 A;  1KB9 D;  3CXH I;  1NTZ E;  2N1T D;  5AW7 B;  2O1K A;  3AED C;  1HUC A;  3AE7 C;  2BEZ F;  2Y0E A;  5B5E E;  1OZH A;  3PRJ A;  2A45 I;  4BRY A;  2IDB A;  2QJY B;  4W7Z A;  2AXT H;  3L73 G;  1RH5 B;  1KB9 I;  1YJN P;  1P84 D;  2O01 N;  4CPG A;  4R4L A;  3MIW A;  3TGU D;  1S72 P;  1SLQ A;  3A3Y B;  5AW1 B;  2ZYG A;  1M56 D;  1PPJ D;  3AE9 C;  4LLH A;  4L74 A;  1FZE A;  1S5L E;  4PD4 H;  1KYO E;  2C9L Y;  3L72 D;  4NPF X;  3VP9 A;  3H1K D;  3BCC E;  3MD0 A;  1ZRT E;  3AEE C;  2AEJ A;  2XND H;  2OTL P;  1PGO A;  1EXI A;  2JKV A;  5CBO A;  1SQQ D;  4PJ0 E;  3RL0 C;  2IBZ I;  3JC2 2;  3L74 G;  1EC5 A;  2J5U A;  1FDI A;  1N2D C;  1HJB A;  3AEG C;  4KT0 J;  1H0T A;  1KOR A;  4JPZ B;  3B5N C;  2AEF A;  2QSI A;  1BCC G;  3RK2 C;  4D6T E;  1WT6 A;  3OJA B;  3CCV P;  2JP3 A;  3WUV A;  1BDD A;  2JJL A;  3G6E P;  3WUT A;  5KLV G;  2B87 A;  4UB6 E;  2E74 C;  1XTG B;  2P58 A;  3GHG B;  2NRG A;  2FYU E;  5EFW B;  1SFC D;  2KNC A;  1JY2 O;  1LT9 B;  2CPS A;  3PHL A;  4H13 B;  3M91 A;  3N7N A;  4TT3 H;  3L75 D;  2JO1 A;  3M0A A;  1LTJ B;  1J1E C;  5KLI C;  3L73 J;  5B5E H;  1SQX K;  2A06 D;  2E75 C;  2FYU J;  5H2F E;  1LTB C;  5APY A;  1FU1 A;  4GDO A;  2FXM A;  3GG2 A;  3E1I A;  1BSN A;  2M5A B;  2FXO A;  3RK3 B;  4L73 A;  5KLV K;  1NJI Q;  3WUU A;  4U7J A;  1VQK P;  1RF0 C;  1GK6 A;  2FBW C;  1KYO H;  3VMY A;  1NVO A;  1T6A A;  2OYI B;  2E76 B;  4ASV A;  2V7Q H;  5AW8 B;  1S2E A;  1Q7Y Q;  2Q3E A;  1FOS E;  1SQV D;  3C8V A;  1SQX J;  1ZP0 C;  3L74 J;  3H1H E;  1PL5 A;  3CWB G;  1A02 J;  4GOD A;  4PJ0 H;  1Q86 Q;  1GK4 A;  3LW5 H;  2B88 A;  2CPB A;  2WVR A;  1KQF B;  4U3F D;  1JMM A;  1MV8 A;  2JWA A;  3H1L E;  1JY2 P;  2M3E A;  4PV1 B;  4PD4 I;  4N78 D;  4YPC A;  3U1C A;  1YHQ P;  1LWU B;  3WMM 0;  1QGK B;  4WY4 C;  5KJ7 D;  1S1C X;  2L5G B;  4IOI H;  2WSS H;  1S3J A;  1DD4 A;  5TJH A;  3H1I G;  3RBX A;  4I6M C;  1DX7 A;  1LT1 A;  1BGY E;  3M0D A;  4WVZ A;  2Z5I A;  1KB9 E;  4H13 D;  2M0B A;  2OYH B;  3I55 P;  3N4X A;  1PIX A;  3H32 A;  4H0L C;  1N73 C;  3L4F A;  1FJP A;  1FE6 A;  5E79 E;  3L70 D;  5H2F H;  1OVV A;  1P84 E;  2OTK E;  1N7S A;  3RBZ A;  3GF7 A;  1T8Z A;  2HPC B;  2J58 A;  3TGU E;  3A5T A;  2P67 A;  1LTA C;  3O8Z A;  3C1L A;  3L71 D;  3CL3 D;  4C7R A;  3FWL A;  1PPJ E;  2FFD C;  2FXP A;  4HB1 A;  2GUV A;  1VL2 A;  3L72 E;  3H1K E;  2QA4 P;  2GA1 A;  4DT0 A;  4JQ0 D;  1L4A B;  1M1K Q;  1G2C B;  2E76 D;  1ZLL A;  2KSE A;  4GT1 A;  2ZAE B;  3GLM A;  1LNQ A;  1BE3 G;  1SQQ E;  2I8D A;  4EYY Q;  4HH2 A;  2R3S A;  2KI7 B;  2ZVN B;  3RL0 B;  3HUS A;  5CMZ A;  3CME P;  1L0N G;  1AJY A;  3S4R A;  1N8R Q;  2IZ1 A;  3V2P A;  1HF9 A;  1JB0 J;  4HKZ H;  1EZV D;  1JY3 N;  1JTH B;  2KLU A;  4PV1 D;  1PP9 G;  1URQ C;  1DEB A;  3HE5 A;  1KIL C;  3Q1M A;  2N1T A;  1KYO I;  1PGQ A;  5CCG D;  1NU1 D;  2E74 B;  1A02 F;  5AVQ B;  1EXJ A;  3M9H A;  2H7H A;  2OYO A;  2IFN A;  1OW7 A;  2R44 A;  3L75 E;  3SWY A;  1ZW0 A;  4B86 A;  1J1E B;  3W68 A;  5KLI B;  2A06 E;  1U7J A;  1JNM A;  2E75 B;  1L0N K;  4IL6 E;  2WPS A;  3Q5R A;  1OMI A;  3OAK A;  4I7Z C;  4KHX A;  1P84 H;  2M3B A;  1FZB A;  5DJU B;  3EFF K;  2W6A A;  1VPC A;  2W6J H;  3QH9 A;  1L0L G;  1VF5 C;  1E79 H;  1EQ7 A;  3KQG A;  3RGU A;  1IFD A;  1NGM B;  3BAT A;  2WTY A;  2AXC A;  2KK7 A;  1LP1 B;  1HBW A;  2Y9Z A;  1LTT C;  1L4A D;  2PFX A;  1LTS C;  3EWK A;  1JCD A;  3SFE C;  1ZXG A;  1SQV E;  3IN6 A;  4JYC A;  4LGD E; 
#chains in the Genus database with same CATH homology
 2FYU J;  5KLV J;  1SQQ J;  3H1L J;  1L0N J;  1SQX J;  3L72 J;  1BGY J;  3H1H J;  3L74 J;  3H1K J;  1L0L J;  1P84 I;  3L75 J;  1KB9 I;  2BCC J;  4D6T J;  4PD4 I;  1NTK J;  1KYO I;  1NU1 J;  3CXH I;  3H1I J;  3BCC J;  2IBZ I;  3TGU J;  1BE3 J;  1NTZ J;  3L71 J;  1SQP J;  4U3F J;  3CX5 I;  1PP9 J;  1BCC J;  3H1J J;  3L73 J;  1SQB J;  1EZV I;  3CWB J;  1SQV J;  3L70 J;  1NTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...