4D6TJ

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
PTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
total genus 21
structure length 58
sequence length 58
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4d6tJ00
4D6TJ 3L72J 1SQPJ 3L75J 3H1IJ 3L74J 1L0NJ 1SQQJ 3L71J 1SQBJ 4U3FJ 1EZVI 1NTZJ 5KLVJ 1PP9J 1NTMJ 4PD4I 3H1KJ 1BE3J 1NU1J 3CWBJ 1KB9I 1P84I 3H1JJ 2FYUJ 1KYOI 1SQXJ 1BCCJ 3H1HJ 1SQVJ 3H1LJ 1NTKJ 2IBZI 1L0LJ 3TGUJ 3CX5I 3L73J 3BCCJ 3L70J 2BCCJ 3CXHI 1BGYJ
chains in the Genus database with same CATH superfamily
1X79B 3A0BH 1JEKA 1W5CE 3V2NA 1IK9A 1FJPA 1FZCA 2IYPA 4R4LA 2W83C 2ZT9D 3H1JE 4UB6E 3IR9A 4RO0A 2QJPC 4JQ0D 2G8YA 1SQBJ 1IFDA 3B71A 2P7JA 4OGQC 3SSUA 1L0ND 1SQXK 2W27A 1HBWA 3EQ2A 1S3JA 2CPSA 3AE1C 1PIXA 3MGNA 4H13D 2ZVOB 3ZDMA 1OMIA 1VF5C 2JO1A 3HE5B 2Z5IA 3H1KJ 4OWFA 5AW3B 5KJ7A 1YQ3C 1KB9E 1YYCA 1K05A 1UIXA 2ZYGA 2KK7A 1JY3P 2FYUJ 1QEXA 1FZBA 1GD2E 2Q6QA 1H0TB 3TDKA 4N3YB 1CW5A 2LKMA 3VOPA 1SFCD 1X22A 3M0AA 1N73C 2QJKB 4RESB 4TT3H 2GUSA 3BCCJ 3PLNA 4H0LD 1SQVD 2HPCB 4C7RA 1VQ9P 3CCLP 3CMEP 2BCCD 4JF7A 2E76B 1NTKD 2WPSA 1MFTA 1E5WA 2IZ1A 2KIKA 2BCCG 2WPRA 3HD7C 4H13C 1IFJA 4PV1B 1LJ2A 3RBZA 1WRGA 3O6QB 1NOHA 1SQPE 1ZRTD 1JY2N 2WSEH 2RN0A 2E5YA 2QJPB 1IFIA 1NTZJ 3M0DC 1SQQE 2BASA 2BCCE 1AFOA 1YITP 2I8DA 3D6YA 3AEFC 2BEZF 3RK3B 1LWUA 2E5TA 3E1RA 1EDKA 1PGPA 2OYOA 2P67A 3CXHD 3L70E 3L73D 2WT7B 1GDTA 2GUVA 1T6AA 3KXDA 1FS0E 3H1HJ 1NTKJ 3MTUE 1JNMA 5CCGD 2HODB 5CCHA 2MKVA 2LXCB 2O01J 4N78D 3H1KD 1BCCD 1S2EA 1N7LA 3G71P 1ZR4A 2O1JA 1NAFA 3HTKA 5AW8B 3UIAA 1YJ9P 3K5BA 1JUNA 3SFDC 1NTMK 2A45G 1NJIQ 2IFMA 2E75C 2O1KA 5KKZB 1KMIZ 3HE4B 3QH9A 3SWYA 1K73Q 1M1JB 4HKZH 3D71A 1BE3E 2M3BA 1OW8A 3L37A 2Z4EA 1OW6A 3RK3C 2AEMA 3H1LE 1PPJE 2HYNA 1YTZT 3BATA 3HUSB 3LW5H 1RE3A 3P8CD 5AW5B 2WSCJ 2J59M 2H7HA 1Y47A 3H25A 1FZCC 3BRTB 1W2BO 2ZXXA 1FBMA 1PPJG 2W90A 3GG2A 4GT1A 1S72P 1MZ9A 2QIWA 3IFMA 3B5NA 1BGYE 1NH4A 2J58A 4U7JA 1M7LA 2QRXA 1KYOI 5AW0B 1J2JB 2HR3A 1X9VA 1RF1C 1IO4A 3TGUJ 2AXTE 2WZ7A 3CX5I 3L71G 4OH8B 5TJHA 4A7PA 2QJKC 2H8PD 3GHGC 4M3LA 2XU6A 3L74J 1LTJB 4YPCA 2WSFH 1VL2A 1RQVA 2Y0CA 3KQGA 5AVZB 1JY3N 4ZKUA 1OVRA 2HG5D 3OJAB 2B87B 1L4AA 3BCCG 1PP9D 2P1JA 3P7KA 5EFWB 4D6TG 1EZVI 1JMMA 2C0WA 2K1AA 2Q3EA 5C39A 1EC5A 1Q81Q 1SQXG 2QVAA 3N4XA 1FZGA 3B5NC 3C9IA 1HVVA 3I56P 2W6BA 1KV4A 1JTHA 3WU2E 1NWQA 4WY4A 2O01H 4U3FD 3VP9A 2ZT9C 4AQRD 5KJ7C 2OYIC 4UB8H 1P84E 1BDDA 3MZWB 1ZW0A 3FWLA 1LT9B 2FYNB 2B9BA 1IC2A 3GLMA 4H44C 1VPCA 2A06D 3TNUA 2FYUD 3EWKA 4DZOA 3S9OA 1L0LK 1Y9BA 1EZVG 3H1JG 1LT1A 5BU5A 4ZMDA 3CCVP 1JY3O 1EZVD 1YJNP 1ZV8A 3CX5H 3A0BE 2YKOA 3D70A 1L0NJ 3GF3A 3LIDA 5KAFE 5KJ7D 2OYHA 2ZVNB 1KTMA 3HE4A 3VN0A 3G4SP 2E75B 3CD6P 1LTIC 3HD7A 1R8EA 5B66E 2KLUA 1ZP0C 4KHXA 1NU1D 2Y9YA 3H1ID 4GIFA 4IL6H 1GK6A 4Z1MH 1HGVA 1L0NK 3L72E 3VYIA 1SQBD 4PD4H 2R32A 4MN4C 1KB9I 3AE5C 3JCUE 5E79E 1GTWA 4GOEA 3H1IE 4EIJA 2KZIA 3L72G 3P32A 1SQVJ 1T2KD 1G2CA 3CCUP 1VQLP 3L4FA 1U7JA 2K9YA 1LTBC 4YXWH 2WTYA 1X0TA 3Q1MA 1DEBA 3L74D 1N7SB 1K9MQ 1N2DC 3FGAD 1LT9C 2FYNC 5AVRB 3L35A 1OX3A 4JYBA 5APVA 1USEA 1VQ6P 3H1KG 2FYZA 3H1IJ 2Y0EA 3V6IA 4BWNA 1SQVK 3A2AA 3KYQA 3L74E 3TGUD 2JJLA 3KHUA 1VQKP 2NPSB 3PH0A 3H1KE 3I5CA 3B5NB 1L4AB 1SS1A 3KPEA 1MV8A 3JCUH 2A45H 1SQBG 2JWDA 1GW4A 2KZJA 4L73A 3SWKA 2D2CD 1HH0A 3TGUE 3RK3D 1KQFB 2M5AA 2D2CB 1EDIA 5KLVD 1NTME 5KAIH 3P8MC 2IFNA 1KILC 3CWBJ 1LTAC 4I7ZB 1P84I 3M9BA 3GHGB 4H0LB 1NTMG 3V2QA 2IBZI 5CJ0A 1M8OB 1NO4A 4XA4A 1SLQA 3CCQP 2E74D 3PHLA 1HGZA 4EOTA 3RL0C 1HTLC 2YKPA 5KAFH 2JEEA 1ZRTE 1GL2C 2AEJA 4RKUJ 5CCGC 2V4HA 4D6TJ 2YIUC 3CCRP 4ZKPA 1BE3G 1U57A 4DT0A 1D7MA 1AQ5A 1YQ4C 5AW1B 4DJGA 1VDFA 4Y99B 4BRYB 1PV3A 1LNQA 2R5BA 1BDCA 1OFCX 2R3SA 1UIIA 2YXQB 3A0HH 1VQ5P 2KUBA 1FJKA 1PGQA 1G1IA 4L75A 2POHA 1N86A 2QJYB 1AQTA 3L71E 1FZEA 4GOFA 1PP9J 1QL1A 2IDBA 3HUSC 2FXOA 4Y99C 2WMMA 4PV1C 4N78E 1BCCE 1CI6A 1IFMA 2IPPA 3CCJP 2HPCA 1PP9E 2WSCH 1GL2B 1LTGC 2B88A 1R5SA 4DOJA 1MFZA 5AW4B 4LC1A 1M90Q 4BXLA 2FFDB 2R44A 3FXEA 1OW7A 4H0LC 1NTKK 3CC2P 2HFED 2FFDC 3M06A 4LLHA 4WB4A 2HODA 1RQUA 3G3ZA 3GF7A 2N1TD 2GA1A 3N7NA 5AW2B 2OGUA 3G9RA 2M5AB 4YXDC 3HRNA 3FWNA 1BSHA 2FXPA 2L5GB 2B87A 2DW3A 1M57D 4Y28J 1VF5B 4D6TD 3TSIA 2Y9ZA 2XNDH 3L75D 1KILA 3BVHA 1VF5D 5AVXB 1OZHA 3LIEA 5AVYB 4KJMA 1Q86Q 3OA7A 2OYHC 2IYOA 1FOSF 2JWAA 4RJTA 1EZVE 1KZUB 5KLVJ 4EYYQ 1N8RQ 1JOCA 1MUUA 2FXMA 1RY3A 3H1HG 3CMAP 1VQ4P 1URQD 1OXZA 3TK1A 1NU1J 3Q5RA 1YTZI 2NRGA 2NZ2A 2YIUB 1S4XA 1NTZE 1Q2NA 4IFMA 4PD4D 2OTKE 1ZLLA 3KDPB 3L73J 4DCKA 1NTZG 2IBZG 3BASA 3Q3DA 3CC4P 4JYCA 1IZNB 1NTZD 3KZIH 3FX0A 2M0BA 3CC7P 4IFDK 1H0TA 3HE5A 3L75G 1Z56A 3RL0g 3LW5J 5AVVB 3VMXA 1DD4A 2SPZA 5KTBA 1YJWP 2PP6A 3M9QA 3CCEP 3TYYA 3E7KA 5CJ4A 1YIJP 1GU4A 3BRVB 4U3FE 5AVSB 4I6MC 3RK2C 1SQPK 2NPSC 4IOIH 1URQA 3CI9A 2AXTH 4U3FG 1GK4A 2V7QH 3AEGC 4OGQB 3H1IG 2KB7P 1VQ8P 1J1EB 1RE4C 1FDOA 3MUDA 3CX5D 1HUCA 2RKLA 1VQMP 3EFGA 1HWTC 3G6EP 3MD0A 1CI6B 1N7SC 1SQPG 1LGHB 1SQXJ 2PFXA 1HJ0A 5APYA 1USDA 4CPGA 4WVZA 4BRYA 1KB9D 1N7SD 1SQVG 2GM4A 1J1EC 3E1IA 1VQNP 5KLVE 2Q5UA 4NPFX 2ZT9B 3TNUB 1BGYJ 5K5GB 1KORA 1PZQA 3V2RA 2OYIB 3L74G 2WSEJ 1JCCA 2XDJA 3AE7C 3B4SA 4GODA 3RL0B 4AYCA 2I1JA 1H8AA 4K3AA 4N6JA 3RK2B 2ZAEB 2NPSD 2Q3IA 2W8ZA 3L71J 3D6ZA 1EQ7A 1FDIA 2JP3A 4WY4C 3RK2D 3WUTA 2K3RA 3TGUG 1KILB 3KZIE 1GU5A 5DJTB 1Q82Q 1J1DC 1CSBA 2KS1A 2WVRA 4ZNCA 2KP8A 3I55P 1K8AQ 1RF0C 3JSVC 1KB9H 1PGOA 3AEBC 5L8RJ 1EDLA 3AE9C 1KILE 1L0LE 4I2LC 4PD4I 4GKGA 1YBKA 1OVUA 4R4MA 3HUSA 3MP7B 5DJUB 1G2CB 1L4AC 2YMKA 1Q90D 1DD3A 4XFJA 3H1JJ 3GW6A 3Q5SA 1QVGO 1NAYA 3O6QA 3S1KA 1H89A 5AVUB 1SQQK 1BSNA 2E74B 2VRSA 2CPBA 2CK3H 2KYVA 3VTPC 4B86A 3HTKB 2KI7B 2C9LY 3USSA 4ASWA 5APSA 3L70J 1NYHA 1SQQG 1KFMA 2P10A 1BE3D 3L73E 1DEEG 3A7OA 4TLFA 4UB6H 1BCCG 1XTCC 5AVQB 4ASVA 5CMZA 1URQC 1K04A 3NTNA 3RK3E 2K9JB 1L4AD 1PGJA 3V2PA 1NU1K 1SQQJ 2H89C 1JM0A 2A45I 2PRRA 2QG4A 1JB0J 3L70G 1RHZB 3M0DA 1FU1A 2QM8A 3H32A 4IFFA 4IL6X 1T8ZA 4C7NA 1BGYD 1RF0A 1AA0A 5KLIB 1SP4A 1GZLA 3CCMP 1EXJA 3V4QA 4W7YA 2K9JA 2OARA 1KFNA 4GDOA 3U1CA 2ZXEB 4WY4D 4O9BA 2RH0A 1SQXD 1H88A 1PPJD 1ZMEC 1S5LE 1FDMA 1A02J 2YKQA 5APQA 1FAVA 1YI2P 1NVOA 4HB1A 3VP8A 3H1LJ 4WBAA 2XKMA 3JC22 2Z5HA 5AVTB 3A5TA 1SQXE 1AV1A 1JY2O 2LR2A 3AEAC 3H1LG 4LGDE 1L2PA 1KYOD 2WSFJ 3WUVA 2BCCJ 2N1TB 2FKWB 1LTJA 1IFPA 2WSSH 2YMYA 1RE4A 3AE2C 3L72J 3L71D 2H43A 2C0XA 2Y0DA 2W6AA 4QMAA 1OIPA 1BGYG 2QM7A 1JY2P 3H32B 3V5BA 1FZCB 2K88A 2B89A 1KQLA 3H1HE 1OWAA 3F5HA 1JTHB 1NHLA 1KQGB 3CWBE 1P84D 2E76C 1M1JC 1NTMJ 2ZJSE 3CLQA 3Q5PA 1HJBA 4XE5B 2KSJA 1LTSC 3H1HD 2P58A 2FYUE 2ZYAA 3CWBG 1EXIA 1WMKA 2I1KA 5KAIE 1NKZB 5APWA 2QEXP 2MJZA 1KYOH 3NXSA 3R2PA 3V4WA 4C46A 1LTJC 4D6TE 5BVZA 4I7ZC 2E43A 1SVFA 1DIPA 1FZFA 2K37A 5B5EH 1N73A 1SFCB 1LWUC 2H88C 5GTHE 3L75J 2XZRA 3BCCD 5KLIC 2JKVA 2KS1B 2QSIA 2A06E 1YHQP 1RF1B 2IZ0A 3IN6A 2YNYA 5H2FH 1NTZK 3F89A 2V7QJ 5CBNA 1SQVE 2E76D 1GMJA 1M56D 1ZOYC 5CHXA 4WWIA 1URQB 2FBWC 5CCGA 4L76A 5GTIE 3HD7D 1QLED 3L36A 2E42A 1RF1A 1FZAA 2HLOA 3HD7B 2UWJE 3A3YB 3ITKA 1NU1G 2M3EA 4H13B 3S4RA 4PJ0H 4JBZA 1TU3F 2N9YB 3VMAA 3AECC 1IK7A 5E79H 5AW7B 1SQPD 2Q9IA 1NGMB 1S9KE 1NU1E 2WPVB 1RH5B 5KLVG 2O01N 4W7ZA 1ZR2A 2N1TC 1LWUB 1SFCC 5KKZC 1QGKB 3GMAA 3L72D 1SQBE 1T2KC 5AVWB 3PJSK 1WT6A 1G1JA 3PTZA 1L0NE 1S9KD 2BEQD 3SWFA 4NPEA 3CXHE 3ABVC 1S1CX 1J1DB 3CXHH 3Q2YA 1M1JA 3WMM0 1L0NG 1EDJA 4HH2A 1KQSO 1IFNA 2OTLP 3C1LA 2KOGA 1AVYA 5APXA 1IJDB 2WWWA 4PV1D 1KN7A 3AEDC 3CX5E 3U1AA 3NMDA 1ZXGA 4AUWA 1L0LG 2M8RA 1AJYA 4OGQD 1QX8A 3W68A 1HF9A 1Y8AA 4L74A 2JDIH 3MUDC 2QJYC 3T97B 2R5DA 4I1LA 2Q7CA 1P84H 1AVOA 2Q1KA 4UB8E 4EDFA 1OVVA 3RGUA 5TISH 1CZQA 1U7MA 2N1TA 3II6A 4H44B 5KLVK 5TISE 3WUUA 3WU2H 1BCCJ 4H44D 3L73G 2ZYDA 1NTKE 3T97A 3OAKA 2XNXA 1GL2D 5H2FE 1NTMD 2YXRB 3A0HE 2P2UA 4NPDA 3RL0D 2OTJP 4YTPC 5APTA 2E74C 4JPZB 3CCSP 1A02F 1NTKG 1R5LA 2YO3A 1SQQD 1Q7YQ 2OYIA 2FFDA 3AE3C 1M1KQ 5APUA 5B5EE 1FC2C 3B5ND 1N73B 5CBOA 5BU8B 1KILD 1L0LD 3GHGA 5M1BA 1T3JA 2LXBA 2KNCB 1KYOE 1JO5A 3L70D 2YO2A 3SFEC 2D2CC 4K35A 2QA4P 4W80A 2AXCA 3B8EB 2OQQA 2J5UA 2FY8A 4WY4B 2N9BA 3IAOA 3CPWO 1W2EA 3H6PA 2C9NY 2WPQA 3CL3D 2KNCA 3PP5A 1LT9A 3AE4C 3AEEC 1DX7A 3O8ZA 5AW6B 4KT0J 4EI2A 2QE7H 3M91A 4HJGH 5CCHC 1X8YA 2W6JH 1JMBA 4PJ0E 5AW9B 1KD1Q 1L0LJ 2O3JA 3CWBD 1GL2A 1SQBK 1GW3A 1T3UA 3MHVA 5CCHD 1VQOP 5GTIH 3H1LD 3CXHI 3EFFK 3P8CE 1SQPJ 1LP1B 2FYUG 3QWOC 1ZN5A 2G3AA 2IBZD 2IX7C 3TF5A 2OYHB 3MIWA 3NFQA 4HYTB 4C7NB 2R3CA 1PP9G 1NKNA 1RE3C 2XV5A 1S5LX 2WQYC 4U3FJ 5GTHH 2KLVA 2IBZE 1VQ7P 1FE6A 2RMZA 2ZFCA 1QVFO 2PAJA 2AEFA 2KXPB 3BCCE 1XTGB 1KC8Q 2L91A 2E75D 3FXDA 2ITAA 4PD4E 1PL5A 3AE8C 3L75E 1S5LH 3U59A 3VMYA 2NPSA 2WITA 3OW2O 3IF4A 3RBXA 1BE3J 4IL6E 3VMZA 1DH3A 2FYUK 1QL2A 2WT7A 1VQPP 3PRJA 2PGDA 5B66H 1PFIA 4OVNF 3W67A 3C8VA 2JR8A 2KSEA 1LTTC 1JCDA 1E79H 1N7SA 3H1JD 1MKMA 1SFCA 1FOSE 2A06G 1LP1A 3M9HA 3R4YA 3AE6C
chains in the Genus database with same CATH topology
4D6TJ 3L72J 1SQPJ 3L75J 3H1IJ 3L74J 1L0NJ 1SQQJ 3L71J 1SQBJ 4U3FJ 1EZVI 1NTZJ 5KLVJ 1PP9J 1NTMJ 4PD4I 3H1KJ 1BE3J 1NU1J 3CWBJ 1KB9I 1P84I 3H1JJ 2FYUJ 1KYOI 1SQXJ 1BCCJ 3H1HJ 1SQVJ 3H1LJ 1NTKJ 2IBZI 1L0LJ 3TGUJ 3CX5I 3L73J 3BCCJ 3L70J 2BCCJ 3CXHI 1BGYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T J;  3L72 J;  1SQP J;  3L75 J;  3H1I J;  3L74 J;  1L0N J;  1SQQ J;  3L71 J;  1SQB J;  4U3F J;  1EZV I;  1NTZ J;  5KLV J;  1PP9 J;  1NTM J;  4PD4 I;  3H1K J;  1BE3 J;  1NU1 J;  3CWB J;  1KB9 I;  1P84 I;  3H1J J;  2FYU J;  1KYO I;  1SQX J;  1BCC J;  3H1H J;  1SQV J;  3H1L J;  1NTK J;  2IBZ I;  1L0L J;  3TGU J;  3CX5 I;  3L73 J;  3BCC J;  3L70 J;  2BCC J;  3CXH I;  1BGY J; 
#chains in the Genus database with same CATH topology
 1X79 B;  3A0B H;  1JEK A;  1W5C E;  3V2N A;  1IK9 A;  1FJP A;  1FZC A;  2IYP A;  4R4L A;  2W83 C;  2ZT9 D;  3H1J E;  4UB6 E;  3IR9 A;  4RO0 A;  2QJP C;  4JQ0 D;  2G8Y A;  1SQB J;  1IFD A;  3B71 A;  2P7J A;  4OGQ C;  3SSU A;  1L0N D;  1SQX K;  2W27 A;  1HBW A;  3EQ2 A;  1S3J A;  2CPS A;  3AE1 C;  1PIX A;  3MGN A;  4H13 D;  2ZVO B;  3ZDM A;  1OMI A;  1VF5 C;  2JO1 A;  3HE5 B;  2Z5I A;  3H1K J;  4OWF A;  5AW3 B;  5KJ7 A;  1YQ3 C;  1KB9 E;  1YYC A;  1K05 A;  1UIX A;  2ZYG A;  2KK7 A;  1JY3 P;  2FYU J;  1QEX A;  1FZB A;  1GD2 E;  2Q6Q A;  1H0T B;  3TDK A;  4N3Y B;  1CW5 A;  2LKM A;  3VOP A;  1SFC D;  1X22 A;  3M0A A;  1N73 C;  2QJK B;  4RES B;  4TT3 H;  2GUS A;  3BCC J;  3PLN A;  4H0L D;  1SQV D;  2HPC B;  4C7R A;  1VQ9 P;  3CCL P;  3CME P;  2BCC D;  4JF7 A;  2E76 B;  1NTK D;  2WPS A;  1MFT A;  1E5W A;  2IZ1 A;  2KIK A;  2BCC G;  2WPR A;  3HD7 C;  4H13 C;  1IFJ A;  4PV1 B;  1LJ2 A;  3RBZ A;  1WRG A;  3O6Q B;  1NOH A;  1SQP E;  1ZRT D;  1JY2 N;  2WSE H;  2RN0 A;  2E5Y A;  2QJP B;  1IFI A;  1NTZ J;  3M0D C;  1SQQ E;  2BAS A;  2BCC E;  1AFO A;  1YIT P;  2I8D A;  3D6Y A;  3AEF C;  2BEZ F;  3RK3 B;  1LWU A;  2E5T A;  3E1R A;  1EDK A;  1PGP A;  2OYO A;  2P67 A;  3CXH D;  3L70 E;  3L73 D;  2WT7 B;  1GDT A;  2GUV A;  1T6A A;  3KXD A;  1FS0 E;  3H1H J;  1NTK J;  3MTU E;  1JNM A;  5CCG D;  2HOD B;  5CCH A;  2MKV A;  2LXC B;  2O01 J;  4N78 D;  3H1K D;  1BCC D;  1S2E A;  1N7L A;  3G71 P;  1ZR4 A;  2O1J A;  1NAF A;  3HTK A;  5AW8 B;  3UIA A;  1YJ9 P;  3K5B A;  1JUN A;  3SFD C;  1NTM K;  2A45 G;  1NJI Q;  2IFM A;  2E75 C;  2O1K A;  5KKZ B;  1KMI Z;  3HE4 B;  3QH9 A;  3SWY A;  1K73 Q;  1M1J B;  4HKZ H;  3D71 A;  1BE3 E;  2M3B A;  1OW8 A;  3L37 A;  2Z4E A;  1OW6 A;  3RK3 C;  2AEM A;  3H1L E;  1PPJ E;  2HYN A;  1YTZ T;  3BAT A;  3HUS B;  3LW5 H;  1RE3 A;  3P8C D;  5AW5 B;  2WSC J;  2J59 M;  2H7H A;  1Y47 A;  3H25 A;  1FZC C;  3BRT B;  1W2B O;  2ZXX A;  1FBM A;  1PPJ G;  2W90 A;  3GG2 A;  4GT1 A;  1S72 P;  1MZ9 A;  2QIW A;  3IFM A;  3B5N A;  1BGY E;  1NH4 A;  2J58 A;  4U7J A;  1M7L A;  2QRX A;  1KYO I;  5AW0 B;  1J2J B;  2HR3 A;  1X9V A;  1RF1 C;  1IO4 A;  3TGU J;  2AXT E;  2WZ7 A;  3CX5 I;  3L71 G;  4OH8 B;  5TJH A;  4A7P A;  2QJK C;  2H8P D;  3GHG C;  4M3L A;  2XU6 A;  3L74 J;  1LTJ B;  4YPC A;  2WSF H;  1VL2 A;  1RQV A;  2Y0C A;  3KQG A;  5AVZ B;  1JY3 N;  4ZKU A;  1OVR A;  2HG5 D;  3OJA B;  2B87 B;  1L4A A;  3BCC G;  1PP9 D;  2P1J A;  3P7K A;  5EFW B;  4D6T G;  1EZV I;  1JMM A;  2C0W A;  2K1A A;  2Q3E A;  5C39 A;  1EC5 A;  1Q81 Q;  1SQX G;  2QVA A;  3N4X A;  1FZG A;  3B5N C;  3C9I A;  1HVV A;  3I56 P;  2W6B A;  1KV4 A;  1JTH A;  3WU2 E;  1NWQ A;  4WY4 A;  2O01 H;  4U3F D;  3VP9 A;  2ZT9 C;  4AQR D;  5KJ7 C;  2OYI C;  4UB8 H;  1P84 E;  1BDD A;  3MZW B;  1ZW0 A;  3FWL A;  1LT9 B;  2FYN B;  2B9B A;  1IC2 A;  3GLM A;  4H44 C;  1VPC A;  2A06 D;  3TNU A;  2FYU D;  3EWK A;  4DZO A;  3S9O A;  1L0L K;  1Y9B A;  1EZV G;  3H1J G;  1LT1 A;  5BU5 A;  4ZMD A;  3CCV P;  1JY3 O;  1EZV D;  1YJN P;  1ZV8 A;  3CX5 H;  3A0B E;  2YKO A;  3D70 A;  1L0N J;  3GF3 A;  3LID A;  5KAF E;  5KJ7 D;  2OYH A;  2ZVN B;  1KTM A;  3HE4 A;  3VN0 A;  3G4S P;  2E75 B;  3CD6 P;  1LTI C;  3HD7 A;  1R8E A;  5B66 E;  2KLU A;  1ZP0 C;  4KHX A;  1NU1 D;  2Y9Y A;  3H1I D;  4GIF A;  4IL6 H;  1GK6 A;  4Z1M H;  1HGV A;  1L0N K;  3L72 E;  3VYI A;  1SQB D;  4PD4 H;  2R32 A;  4MN4 C;  1KB9 I;  3AE5 C;  3JCU E;  5E79 E;  1GTW A;  4GOE A;  3H1I E;  4EIJ A;  2KZI A;  3L72 G;  3P32 A;  1SQV J;  1T2K D;  1G2C A;  3CCU P;  1VQL P;  3L4F A;  1U7J A;  2K9Y A;  1LTB C;  4YXW H;  2WTY A;  1X0T A;  3Q1M A;  1DEB A;  3L74 D;  1N7S B;  1K9M Q;  1N2D C;  3FGA D;  1LT9 C;  2FYN C;  5AVR B;  3L35 A;  1OX3 A;  4JYB A;  5APV A;  1USE A;  1VQ6 P;  3H1K G;  2FYZ A;  3H1I J;  2Y0E A;  3V6I A;  4BWN A;  1SQV K;  3A2A A;  3KYQ A;  3L74 E;  3TGU D;  2JJL A;  3KHU A;  1VQK P;  2NPS B;  3PH0 A;  3H1K E;  3I5C A;  3B5N B;  1L4A B;  1SS1 A;  3KPE A;  1MV8 A;  3JCU H;  2A45 H;  1SQB G;  2JWD A;  1GW4 A;  2KZJ A;  4L73 A;  3SWK A;  2D2C D;  1HH0 A;  3TGU E;  3RK3 D;  1KQF B;  2M5A A;  2D2C B;  1EDI A;  5KLV D;  1NTM E;  5KAI H;  3P8M C;  2IFN A;  1KIL C;  3CWB J;  1LTA C;  4I7Z B;  1P84 I;  3M9B A;  3GHG B;  4H0L B;  1NTM G;  3V2Q A;  2IBZ I;  5CJ0 A;  1M8O B;  1NO4 A;  4XA4 A;  1SLQ A;  3CCQ P;  2E74 D;  3PHL A;  1HGZ A;  4EOT A;  3RL0 C;  1HTL C;  2YKP A;  5KAF H;  2JEE A;  1ZRT E;  1GL2 C;  2AEJ A;  4RKU J;  5CCG C;  2V4H A;  4D6T J;  2YIU C;  3CCR P;  4ZKP A;  1BE3 G;  1U57 A;  4DT0 A;  1D7M A;  1AQ5 A;  1YQ4 C;  5AW1 B;  4DJG A;  1VDF A;  4Y99 B;  4BRY B;  1PV3 A;  1LNQ A;  2R5B A;  1BDC A;  1OFC X;  2R3S A;  1UII A;  2YXQ B;  3A0H H;  1VQ5 P;  2KUB A;  1FJK A;  1PGQ A;  1G1I A;  4L75 A;  2POH A;  1N86 A;  2QJY B;  1AQT A;  3L71 E;  1FZE A;  4GOF A;  1PP9 J;  1QL1 A;  2IDB A;  3HUS C;  2FXO A;  4Y99 C;  2WMM A;  4PV1 C;  4N78 E;  1BCC E;  1CI6 A;  1IFM A;  2IPP A;  3CCJ P;  2HPC A;  1PP9 E;  2WSC H;  1GL2 B;  1LTG C;  2B88 A;  1R5S A;  4DOJ A;  1MFZ A;  5AW4 B;  4LC1 A;  1M90 Q;  4BXL A;  2FFD B;  2R44 A;  3FXE A;  1OW7 A;  4H0L C;  1NTK K;  3CC2 P;  2HFE D;  2FFD C;  3M06 A;  4LLH A;  4WB4 A;  2HOD A;  1RQU A;  3G3Z A;  3GF7 A;  2N1T D;  2GA1 A;  3N7N A;  5AW2 B;  2OGU A;  3G9R A;  2M5A B;  4YXD C;  3HRN A;  3FWN A;  1BSH A;  2FXP A;  2L5G B;  2B87 A;  2DW3 A;  1M57 D;  4Y28 J;  1VF5 B;  4D6T D;  3TSI A;  2Y9Z A;  2XND H;  3L75 D;  1KIL A;  3BVH A;  1VF5 D;  5AVX B;  1OZH A;  3LIE A;  5AVY B;  4KJM A;  1Q86 Q;  3OA7 A;  2OYH C;  2IYO A;  1FOS F;  2JWA A;  4RJT A;  1EZV E;  1KZU B;  5KLV J;  4EYY Q;  1N8R Q;  1JOC A;  1MUU A;  2FXM A;  1RY3 A;  3H1H G;  3CMA P;  1VQ4 P;  1URQ D;  1OXZ A;  3TK1 A;  1NU1 J;  3Q5R A;  1YTZ I;  2NRG A;  2NZ2 A;  2YIU B;  1S4X A;  1NTZ E;  1Q2N A;  4IFM A;  4PD4 D;  2OTK E;  1ZLL A;  3KDP B;  3L73 J;  4DCK A;  1NTZ G;  2IBZ G;  3BAS A;  3Q3D A;  3CC4 P;  4JYC A;  1IZN B;  1NTZ D;  3KZI H;  3FX0 A;  2M0B A;  3CC7 P;  4IFD K;  1H0T A;  3HE5 A;  3L75 G;  1Z56 A;  3RL0 g;  3LW5 J;  5AVV B;  3VMX A;  1DD4 A;  2SPZ A;  5KTB A;  1YJW P;  2PP6 A;  3M9Q A;  3CCE P;  3TYY A;  3E7K A;  5CJ4 A;  1YIJ P;  1GU4 A;  3BRV B;  4U3F E;  5AVS B;  4I6M C;  3RK2 C;  1SQP K;  2NPS C;  4IOI H;  1URQ A;  3CI9 A;  2AXT H;  4U3F G;  1GK4 A;  2V7Q H;  3AEG C;  4OGQ B;  3H1I G;  2KB7 P;  1VQ8 P;  1J1E B;  1RE4 C;  1FDO A;  3MUD A;  3CX5 D;  1HUC A;  2RKL A;  1VQM P;  3EFG A;  1HWT C;  3G6E P;  3MD0 A;  1CI6 B;  1N7S C;  1SQP G;  1LGH B;  1SQX J;  2PFX A;  1HJ0 A;  5APY A;  1USD A;  4CPG A;  4WVZ A;  4BRY A;  1KB9 D;  1N7S D;  1SQV G;  2GM4 A;  1J1E C;  3E1I A;  1VQN P;  5KLV E;  2Q5U A;  4NPF X;  2ZT9 B;  3TNU B;  1BGY J;  5K5G B;  1KOR A;  1PZQ A;  3V2R A;  2OYI B;  3L74 G;  2WSE J;  1JCC A;  2XDJ A;  3AE7 C;  3B4S A;  4GOD A;  3RL0 B;  4AYC A;  2I1J A;  1H8A A;  4K3A A;  4N6J A;  3RK2 B;  2ZAE B;  2NPS D;  2Q3I A;  2W8Z A;  3L71 J;  3D6Z A;  1EQ7 A;  1FDI A;  2JP3 A;  4WY4 C;  3RK2 D;  3WUT A;  2K3R A;  3TGU G;  1KIL B;  3KZI E;  1GU5 A;  5DJT B;  1Q82 Q;  1J1D C;  1CSB A;  2KS1 A;  2WVR A;  4ZNC A;  2KP8 A;  3I55 P;  1K8A Q;  1RF0 C;  3JSV C;  1KB9 H;  1PGO A;  3AEB C;  5L8R J;  1EDL A;  3AE9 C;  1KIL E;  1L0L E;  4I2L C;  4PD4 I;  4GKG A;  1YBK A;  1OVU A;  4R4M A;  3HUS A;  3MP7 B;  5DJU B;  1G2C B;  1L4A C;  2YMK A;  1Q90 D;  1DD3 A;  4XFJ A;  3H1J J;  3GW6 A;  3Q5S A;  1QVG O;  1NAY A;  3O6Q A;  3S1K A;  1H89 A;  5AVU B;  1SQQ K;  1BSN A;  2E74 B;  2VRS A;  2CPB A;  2CK3 H;  2KYV A;  3VTP C;  4B86 A;  3HTK B;  2KI7 B;  2C9L Y;  3USS A;  4ASW A;  5APS A;  3L70 J;  1NYH A;  1SQQ G;  1KFM A;  2P10 A;  1BE3 D;  3L73 E;  1DEE G;  3A7O A;  4TLF A;  4UB6 H;  1BCC G;  1XTC C;  5AVQ B;  4ASV A;  5CMZ A;  1URQ C;  1K04 A;  3NTN A;  3RK3 E;  2K9J B;  1L4A D;  1PGJ A;  3V2P A;  1NU1 K;  1SQQ J;  2H89 C;  1JM0 A;  2A45 I;  2PRR A;  2QG4 A;  1JB0 J;  3L70 G;  1RHZ B;  3M0D A;  1FU1 A;  2QM8 A;  3H32 A;  4IFF A;  4IL6 X;  1T8Z A;  4C7N A;  1BGY D;  1RF0 A;  1AA0 A;  5KLI B;  1SP4 A;  1GZL A;  3CCM P;  1EXJ A;  3V4Q A;  4W7Y A;  2K9J A;  2OAR A;  1KFN A;  4GDO A;  3U1C A;  2ZXE B;  4WY4 D;  4O9B A;  2RH0 A;  1SQX D;  1H88 A;  1PPJ D;  1ZME C;  1S5L E;  1FDM A;  1A02 J;  2YKQ A;  5APQ A;  1FAV A;  1YI2 P;  1NVO A;  4HB1 A;  3VP8 A;  3H1L J;  4WBA A;  2XKM A;  3JC2 2;  2Z5H A;  5AVT B;  3A5T A;  1SQX E;  1AV1 A;  1JY2 O;  2LR2 A;  3AEA C;  3H1L G;  4LGD E;  1L2P A;  1KYO D;  2WSF J;  3WUV A;  2BCC J;  2N1T B;  2FKW B;  1LTJ A;  1IFP A;  2WSS H;  2YMY A;  1RE4 A;  3AE2 C;  3L72 J;  3L71 D;  2H43 A;  2C0X A;  2Y0D A;  2W6A A;  4QMA A;  1OIP A;  1BGY G;  2QM7 A;  1JY2 P;  3H32 B;  3V5B A;  1FZC B;  2K88 A;  2B89 A;  1KQL A;  3H1H E;  1OWA A;  3F5H A;  1JTH B;  1NHL A;  1KQG B;  3CWB E;  1P84 D;  2E76 C;  1M1J C;  1NTM J;  2ZJS E;  3CLQ A;  3Q5P A;  1HJB A;  4XE5 B;  2KSJ A;  1LTS C;  3H1H D;  2P58 A;  2FYU E;  2ZYA A;  3CWB G;  1EXI A;  1WMK A;  2I1K A;  5KAI E;  1NKZ B;  5APW A;  2QEX P;  2MJZ A;  1KYO H;  3NXS A;  3R2P A;  3V4W A;  4C46 A;  1LTJ C;  4D6T E;  5BVZ A;  4I7Z C;  2E43 A;  1SVF A;  1DIP A;  1FZF A;  2K37 A;  5B5E H;  1N73 A;  1SFC B;  1LWU C;  2H88 C;  5GTH E;  3L75 J;  2XZR A;  3BCC D;  5KLI C;  2JKV A;  2KS1 B;  2QSI A;  2A06 E;  1YHQ P;  1RF1 B;  2IZ0 A;  3IN6 A;  2YNY A;  5H2F H;  1NTZ K;  3F89 A;  2V7Q J;  5CBN A;  1SQV E;  2E76 D;  1GMJ A;  1M56 D;  1ZOY C;  5CHX A;  4WWI A;  1URQ B;  2FBW C;  5CCG A;  4L76 A;  5GTI E;  3HD7 D;  1QLE D;  3L36 A;  2E42 A;  1RF1 A;  1FZA A;  2HLO A;  3HD7 B;  2UWJ E;  3A3Y B;  3ITK A;  1NU1 G;  2M3E A;  4H13 B;  3S4R A;  4PJ0 H;  4JBZ A;  1TU3 F;  2N9Y B;  3VMA A;  3AEC C;  1IK7 A;  5E79 H;  5AW7 B;  1SQP D;  2Q9I A;  1NGM B;  1S9K E;  1NU1 E;  2WPV B;  1RH5 B;  5KLV G;  2O01 N;  4W7Z A;  1ZR2 A;  2N1T C;  1LWU B;  1SFC C;  5KKZ C;  1QGK B;  3GMA A;  3L72 D;  1SQB E;  1T2K C;  5AVW B;  3PJS K;  1WT6 A;  1G1J A;  3PTZ A;  1L0N E;  1S9K D;  2BEQ D;  3SWF A;  4NPE A;  3CXH E;  3ABV C;  1S1C X;  1J1D B;  3CXH H;  3Q2Y A;  1M1J A;  3WMM 0;  1L0N G;  1EDJ A;  4HH2 A;  1KQS O;  1IFN A;  2OTL P;  3C1L A;  2KOG A;  1AVY A;  5APX A;  1IJD B;  2WWW A;  4PV1 D;  1KN7 A;  3AED C;  3CX5 E;  3U1A A;  3NMD A;  1ZXG A;  4AUW A;  1L0L G;  2M8R A;  1AJY A;  4OGQ D;  1QX8 A;  3W68 A;  1HF9 A;  1Y8A A;  4L74 A;  2JDI H;  3MUD C;  2QJY C;  3T97 B;  2R5D A;  4I1L A;  2Q7C A;  1P84 H;  1AVO A;  2Q1K A;  4UB8 E;  4EDF A;  1OVV A;  3RGU A;  5TIS H;  1CZQ A;  1U7M A;  2N1T A;  3II6 A;  4H44 B;  5KLV K;  5TIS E;  3WUU A;  3WU2 H;  1BCC J;  4H44 D;  3L73 G;  2ZYD A;  1NTK E;  3T97 A;  3OAK A;  2XNX A;  1GL2 D;  5H2F E;  1NTM D;  2YXR B;  3A0H E;  2P2U A;  4NPD A;  3RL0 D;  2OTJ P;  4YTP C;  5APT A;  2E74 C;  4JPZ B;  3CCS P;  1A02 F;  1NTK G;  1R5L A;  2YO3 A;  1SQQ D;  1Q7Y Q;  2OYI A;  2FFD A;  3AE3 C;  1M1K Q;  5APU A;  5B5E E;  1FC2 C;  3B5N D;  1N73 B;  5CBO A;  5BU8 B;  1KIL D;  1L0L D;  3GHG A;  5M1B A;  1T3J A;  2LXB A;  2KNC B;  1KYO E;  1JO5 A;  3L70 D;  2YO2 A;  3SFE C;  2D2C C;  4K35 A;  2QA4 P;  4W80 A;  2AXC A;  3B8E B;  2OQQ A;  2J5U A;  2FY8 A;  4WY4 B;  2N9B A;  3IAO A;  3CPW O;  1W2E A;  3H6P A;  2C9N Y;  2WPQ A;  3CL3 D;  2KNC A;  3PP5 A;  1LT9 A;  3AE4 C;  3AEE C;  1DX7 A;  3O8Z A;  5AW6 B;  4KT0 J;  4EI2 A;  2QE7 H;  3M91 A;  4HJG H;  5CCH C;  1X8Y A;  2W6J H;  1JMB A;  4PJ0 E;  5AW9 B;  1KD1 Q;  1L0L J;  2O3J A;  3CWB D;  1GL2 A;  1SQB K;  1GW3 A;  1T3U A;  3MHV A;  5CCH D;  1VQO P;  5GTI H;  3H1L D;  3CXH I;  3EFF K;  3P8C E;  1SQP J;  1LP1 B;  2FYU G;  3QWO C;  1ZN5 A;  2G3A A;  2IBZ D;  2IX7 C;  3TF5 A;  2OYH B;  3MIW A;  3NFQ A;  4HYT B;  4C7N B;  2R3C A;  1PP9 G;  1NKN A;  1RE3 C;  2XV5 A;  1S5L X;  2WQY C;  4U3F J;  5GTH H;  2KLV A;  2IBZ E;  1VQ7 P;  1FE6 A;  2RMZ A;  2ZFC A;  1QVF O;  2PAJ A;  2AEF A;  2KXP B;  3BCC E;  1XTG B;  1KC8 Q;  2L91 A;  2E75 D;  3FXD A;  2ITA A;  4PD4 E;  1PL5 A;  3AE8 C;  3L75 E;  1S5L H;  3U59 A;  3VMY A;  2NPS A;  2WIT A;  3OW2 O;  3IF4 A;  3RBX A;  1BE3 J;  4IL6 E;  3VMZ A;  1DH3 A;  2FYU K;  1QL2 A;  2WT7 A;  1VQP P;  3PRJ A;  2PGD A;  5B66 H;  1PFI A;  4OVN F;  3W67 A;  3C8V A;  2JR8 A;  2KSE A;  1LTT C;  1JCD A;  1E79 H;  1N7S A;  3H1J D;  1MKM A;  1SFC A;  1FOS E;  2A06 G;  1LP1 A;  3M9H A;  3R4Y A;  3AE6 C; 
#chains in the Genus database with same CATH homology
 4D6T J;  3L72 J;  1SQP J;  3L75 J;  3H1I J;  3L74 J;  1L0N J;  1SQQ J;  3L71 J;  1SQB J;  4U3F J;  1EZV I;  1NTZ J;  5KLV J;  1PP9 J;  1NTM J;  4PD4 I;  3H1K J;  1BE3 J;  1NU1 J;  3CWB J;  1KB9 I;  1P84 I;  3H1J J;  2FYU J;  1KYO I;  1SQX J;  1BCC J;  3H1H J;  1SQV J;  3H1L J;  1NTK J;  2IBZ I;  1L0L J;  3TGU J;  3CX5 I;  3L73 J;  3BCC J;  3L70 J;  2BCC J;  3CXH I;  1BGY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...